Networking DEC and IBM computers
Mish, W. H.
1983-01-01
Local Area Networking of DEC and IBM computers within the structure of the ISO-OSI Seven Layer Reference Model at a raw signaling speed of 1 Mops or greater are discussed. After an introduction to the ISO-OSI Reference Model nd the IEEE-802 Draft Standard for Local Area Networks (LANs), there follows a detailed discussion and comparison of the products available from a variety of manufactures to perform this networking task. A summary of these products is presented in a table.
Macro-IML manual for DEC PDP 11 computer with controller DEC CA 11-A/BORER type 1,533 A
International Nuclear Information System (INIS)
Kubitz, M.; Kind, R.
1975-03-01
The IML-implementations follow the Macro-Syntax as given in Appendix A of the document 'CAMAC. The Definitior of IML (A Language For Use in CAMAC Systems)'. This document has been adopted as a description by ESONE and AEC NIM in August/September 74 and has been published in October 74. They have been designed for the DEC PDP 11 computer with the branch controller DEC CA 11-A and the Single Crate Controller BORER Type 1,533 A. For both DEC operating systems, DOS V08/09 and RSX-11D/M a full set of macros has been implemented except the block transfer on special LAM, X-error control statements and the subscript mode. Transfer modes not implemented by the hardware of the CA 11-A are simulated by software. (orig.) [de
Evaluation of DEC`s GIGAswitch for distributed parallel computing
Energy Technology Data Exchange (ETDEWEB)
Chen, H.; Hutchins, J.; Brandt, J.
1993-10-01
One of Sandia`s research efforts is to reduce the end-to-end communication delay in a parallel-distributed computing environment. GIGAswitch is DEC`s implementation of a gigabit local area network based on switched FDDI technology. Using the GIGAswitch, the authors intend to minimize the medium access latency suffered by shared-medium FDDI technology. Experimental results show that the GIGAswitch adds 16.5 microseconds of switching and bridging delay to an end-to-end communication. Although the added latency causes a 1.8% throughput degradation and a 5% line efficiency degradation, the availability of dedicated bandwidth is much more than what is available to a workstation on a shared medium. For example, ten directly connected workstations each would have a dedicated bandwidth of 95 Mbps, but if they were sharing the FDDI bandwidth, each would have 10% of the total bandwidth, i.e., less than 10 Mbps. In addition, they have found that when there is no output port contention, the switch`s aggregate bandwidth will scale up to multiples of its port bandwidth. However, with output port contention, the throughput and latency performance suffered significantly. Their mathematical and simulation models indicate that the GIGAswitch line efficiency could be as low as 63% when there are nine input ports contending for the same output port. The data indicate that the delay introduced by contention at the server workstation is 50 times that introduced by the GIGAswitch. The authors conclude that the GIGAswitch meets the performance requirements of today`s high-end workstations and that the switched FDDI technology provides an alternative that utilizes existing workstation interfaces while increasing the aggregate bandwidth. However, because the speed of workstations is increasing by a factor of 2 every 1.5 years, the switched FDDI technology is only good as an interim solution.
Digital Equipment Corporation (DEC): A case study of indecision, innovation and company failure
Goodwin, D.T.
2016-01-01
The minicomputer began a revolution in the computer industry and was influential in the industry for over twenty years until superseded by client server computing and the personal computer. The subject of the thesis is a case study of how DEC, which was number two in the world in 1988, became a
, improving, and protecting Alaska's natural resources and environment to enhance the health, safety, economic , Assessment and Restoration Environmental Health Drinking Water Food Safety & Sanitation Laboratory Environmental Conservation Alaska Department of Environmental Conservation Search DEC State of Alaska Conserving
Dec-POMDPs as Non-Observable MDPs
Oliehoek, F.A.; Amato, C.
2014-01-01
A recent insight in the field of decentralized partially observable Markov decision processes (Dec-POMDPs) is that it is possible to convert a Dec-POMDP to a non-observable MDP, which is a special case of POMDP. This technical report provides an overview of this reduction and pointers to related
1983-01-01
The DEC (Digital Equipment Corporation) VT220 is a text terminal which uses an redesigned keyboard(LK201). The VT220 improved on the earlier VT100 series of terminals with much smaller physical packaging and and a much faster microprocessor.
TRASYS - THERMAL RADIATION ANALYZER SYSTEM (DEC VAX VERSION WITH NASADIG)
Anderson, G. E.
1994-01-01
. The flexible structure of TRASYS allows considerable freedom in the definition and choice of solution method for a thermal radiation problem. The program's flexible structure has also allowed TRASYS to retain the same basic input structure as the authors update it in order to keep up with changing requirements. Among its other important features are the following: 1) up to 3200 node problem size capability with shadowing by intervening opaque or semi-transparent surfaces; 2) choice of diffuse, specular, or diffuse/specular radiant interchange solutions; 3) a restart capability that minimizes recomputing; 4) macroinstructions that automatically provide the executive logic for orbit generation that optimizes the use of previously completed computations; 5) a time variable geometry package that provides automatic pointing of the various parts of an articulated spacecraft and an automatic look-back feature that eliminates redundant form factor calculations; 6) capability to specify submodel names to identify sets of surfaces or components as an entity; and 7) subroutines to perform functions which save and recall the internodal and/or space form factors in subsequent steps for nodes with fixed geometry during a variable geometry run. There are two machine versions of TRASYS v27: a DEC VAX version and a Cray UNICOS version. Both versions require installation of the NASADIG library (MSC-21801 for DEC VAX or COS-10049 for CRAY), which is available from COSMIC either separately or bundled with TRASYS. The NASADIG (NASA Device Independent Graphics Library) plot package provides a pictorial representation of input geometry, orbital/orientation parameters, and heating rate output as a function of time. NASADIG supports Tektronix terminals. The CRAY version of TRASYS v27 is written in FORTRAN 77 for batch or interactive execution and has been implemented on CRAY X-MP and CRAY Y-MP series computers running UNICOS. The standard distribution medium for MSC-21959 (CRAY version
TRASYS - THERMAL RADIATION ANALYZER SYSTEM (DEC VAX VERSION WITHOUT NASADIG)
Vogt, R. A.
1994-01-01
. The flexible structure of TRASYS allows considerable freedom in the definition and choice of solution method for a thermal radiation problem. The program's flexible structure has also allowed TRASYS to retain the same basic input structure as the authors update it in order to keep up with changing requirements. Among its other important features are the following: 1) up to 3200 node problem size capability with shadowing by intervening opaque or semi-transparent surfaces; 2) choice of diffuse, specular, or diffuse/specular radiant interchange solutions; 3) a restart capability that minimizes recomputing; 4) macroinstructions that automatically provide the executive logic for orbit generation that optimizes the use of previously completed computations; 5) a time variable geometry package that provides automatic pointing of the various parts of an articulated spacecraft and an automatic look-back feature that eliminates redundant form factor calculations; 6) capability to specify submodel names to identify sets of surfaces or components as an entity; and 7) subroutines to perform functions which save and recall the internodal and/or space form factors in subsequent steps for nodes with fixed geometry during a variable geometry run. There are two machine versions of TRASYS v27: a DEC VAX version and a Cray UNICOS version. Both versions require installation of the NASADIG library (MSC-21801 for DEC VAX or COS-10049 for CRAY), which is available from COSMIC either separately or bundled with TRASYS. The NASADIG (NASA Device Independent Graphics Library) plot package provides a pictorial representation of input geometry, orbital/orientation parameters, and heating rate output as a function of time. NASADIG supports Tektronix terminals. The CRAY version of TRASYS v27 is written in FORTRAN 77 for batch or interactive execution and has been implemented on CRAY X-MP and CRAY Y-MP series computers running UNICOS. The standard distribution medium for MSC-21959 (CRAY version
Rhythmic expression of DEC2 protein in vitro and in vivo.
Sato, Fuyuki; Muragaki, Yasuteru; Kawamoto, Takeshi; Fujimoto, Katsumi; Kato, Yukio; Zhang, Yanping
2016-06-01
Basic helix-loop-helix (bHLH) transcription factor DEC2 (bHLHE41/Sharp1) is one of the clock genes that show a circadian rhythm in various tissues. DEC2 regulates differentiation, sleep length, tumor cell invasion and apoptosis. Although studies have been conducted on the rhythmic expression of DEC2 mRNA in various tissues, the precise molecular mechanism of DEC2 expression is poorly understood. In the present study, we examined whether DEC2 protein had a rhythmic expression. Western blot analysis for DEC2 protein revealed a rhythmic expression in mouse liver, lung and muscle and in MCF-7 and U2OS cells. In addition, AMP-activated protein kinase (AMPK) activity (phosphorylation of AMPK) in mouse embryonic fibroblasts (MEFs) exhibited a rhythmic expression under the condition of medium change or glucose-depleted medium. However, the rhythmic expression of DEC2 in MEF gradually decreased in time under these conditions. The medium change affected the levels of DEC2 protein and phosphorylation of AMPK. In addition, the levels of DEC2 protein showed a rhythmic expression in vivo and in MCF-7 and U2OS cells. The results showed that the phosphorylation of AMPK immunoreactivity was strongly detected in the liver and lung of DEC2 knockout mice compared with that of wild-type mice. These results may provide new insights into rhythmic expression and the regulation between DEC2 protein and AMPK activity.
Kshirsagar, Nilima A; Gogtay, N J; Garg, B S; Deshmukh, P R; Rajgor, D D; Kadam, V S; Thakur, P A; Gupta, A; Ingole, N S; Lazdins-Helds, J K
2017-10-01
Lymphatic filariasis (LF) affects 73 countries, causes morbidity and impedes socioeconomic development. We had found no difference in safety and micro (Mf) and macro filarial action of single-dose diethylcarbamazine (DEC) and DEC + albendazole (ABZ) in an F01 study done in India (year 2000). There was a programmatic need to evaluate safety and efficacy of multiple annual treatments (F02). Subjects (155) from the F01 study, meeting inclusion-exclusion criteria, were enrolled in F02 and treated with further two annual doses of DEC or DEC + ABZ. Efficacy was evaluated for Mf positivity by peripheral smear (PS) and nucleopore (NP) filter, circulating filarial antigen (CFA) and filarial dance sign (FDS) positivity and Mf count at yearly follow-up. Safety was assessed for 5 days after drug administration. Total of 139 subjects evaluated for efficacy (69 DEC and 70 DEC + ABZ group). Mf positivity prevalence declined progressively by 95% (PS), 66% (NP), and 95% (PS) and 86% (NP); CFA positivity prevalence declined by 15% and 9%; FDS by 100% each; Mf count declined by 75.5 and 76.9% with three annual treatment of DEC and DEC + ABZ, respectively. Addition of ABZ did not show any advantage over DEC given as three annual rounds for LF. DEC and DEC + ABZ were well tolerated. There was no correlation between result of CFA and FDS, (both claimed to be indicative of adult worm). Analysis of published studies and our data indicate that macrofilaricidal effect of DEC/DEC + ABZ may be seen in children and not adults, with three or more annual dosing.
African Journals Online (AJOL)
2008-12-12
Dec 12, 2008 ... wheeze in the past year, and 174 who did not. Interventions:Administered .... best of three spirometer readings was taken, and any individual with ... all those wheezers with reported ever having asthma, and the 'negatives' to ...
African Journals Online (AJOL)
2008-12-12
Dec 12, 2008 ... cardiac-arrhythmias cardio-myopathy, HIV/AIDS, Left Ventricular ... (LVH), infective endocarditis, atrial septal aneurysm, carotid plaques with or ... patients who died had anterior circulation ischaemic stroke as per ... disturbance of cerebral function of sudden onset ..... of strict blood pressure control (15, 32).
International Nuclear Information System (INIS)
Bauer, H.; Black, I.; Heusler, A.; Hoeptner, G.; Krafft, F.; Lang, R.; Moellenkamp, R.; Mueller, W.; Mueller, W.F.; Schati, C.; Schmidt, A.; Schwind, D.; Weber, G.
1983-01-01
The computer groups has been reorganized to take charge for the general purpose computers DEC10 and VAX and the computer network (Dataswitch, DECnet, IBM - connections to GSI and IPP, preparation for Datex-P). (orig.)
Stream traffic data archival, querying, and analysis with TransDec.
2011-01-01
The goal of research was to extend the traffic data analysis of the TransDec (short for : Transportation Decision-Making) system, which was developed under METRANS 09-26 : research grant. The TransDec system is a real-data driven system to support de...
OL-DEC-MDP Model for Multiagent Online Scheduling with a Time-Dependent Probability of Success
Directory of Open Access Journals (Sweden)
Cheng Zhu
2014-01-01
Full Text Available Focusing on the on-line multiagent scheduling problem, this paper considers the time-dependent probability of success and processing duration and proposes an OL-DEC-MDP (opportunity loss-decentralized Markov Decision Processes model to include opportunity loss into scheduling decision to improve overall performance. The success probability of job processing as well as the process duration is dependent on the time at which the processing is started. The probability of completing the assigned job by an agent would be higher when the process is started earlier, but the opportunity loss could also be high due to the longer engaging duration. As a result, OL-DEC-MDP model introduces a reward function considering the opportunity loss, which is estimated based on the prediction of the upcoming jobs by a sampling method on the job arrival. Heuristic strategies are introduced in computing the best starting time for an incoming job by each agent, and an incoming job will always be scheduled to the agent with the highest reward among all agents with their best starting policies. The simulation experiments show that the OL-DEC-MDP model will improve the overall scheduling performance compared with models not considering opportunity loss in heavy-loading environment.
Annals of Medical and Health Sciences Research – Jul. - Dec., 2011 ...
African Journals Online (AJOL)
EGOLUM
2011-12-22
Dec 22, 2011 ... Annals of Medical and Health Sciences Research – Jul. – Dec., 2011 – Vol. ... Method: The study was a cross-sectional survey of pregnant women in Enugu; South-East Nigeria. The ..... Medical Encyclopedia. {Assessed on ...
EAMJ Dec Presure Ulcer 09.indd
African Journals Online (AJOL)
2009-12-01
Dec 1, 2009 ... Geriatric surgery, comprehensive care of the elderly ... Galdin, J.E. Sepsis associated with decubitus ulcer. Amer. J. Med. 1976 ... Ann. Platy. ... A multisite study of the predictive validity of the. Braden scale. Nurs. Res. 1998; 47: ...
MetaUniDec: High-Throughput Deconvolution of Native Mass Spectra
Reid, Deseree J.; Diesing, Jessica M.; Miller, Matthew A.; Perry, Scott M.; Wales, Jessica A.; Montfort, William R.; Marty, Michael T.
2018-04-01
The expansion of native mass spectrometry (MS) methods for both academic and industrial applications has created a substantial need for analysis of large native MS datasets. Existing software tools are poorly suited for high-throughput deconvolution of native electrospray mass spectra from intact proteins and protein complexes. The UniDec Bayesian deconvolution algorithm is uniquely well suited for high-throughput analysis due to its speed and robustness but was previously tailored towards individual spectra. Here, we optimized UniDec for deconvolution, analysis, and visualization of large data sets. This new module, MetaUniDec, centers around a hierarchical data format 5 (HDF5) format for storing datasets that significantly improves speed, portability, and file size. It also includes code optimizations to improve speed and a new graphical user interface for visualization, interaction, and analysis of data. To demonstrate the utility of MetaUniDec, we applied the software to analyze automated collision voltage ramps with a small bacterial heme protein and large lipoprotein nanodiscs. Upon increasing collisional activation, bacterial heme-nitric oxide/oxygen binding (H-NOX) protein shows a discrete loss of bound heme, and nanodiscs show a continuous loss of lipids and charge. By using MetaUniDec to track changes in peak area or mass as a function of collision voltage, we explore the energetic profile of collisional activation in an ultra-high mass range Orbitrap mass spectrometer. [Figure not available: see fulltext.
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... a case study of University of Lagos, 3 faculties within the university constituted the study population ... career advancement, women, academics, information communication ... provides a great development opportunity and.
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... was small. ... organizational effectiveness and one of such .... Instead, contingency-situation theories were developed to indicate that ... development, a company will experience ..... Journal of Applied Psychology 53,. 87-92.
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... 2Justice Development and Peace Commission, Onitsha, Nigeria ... Community information comprises of services offered by libraries and information ... poor and marginalized groups to improve their standard of living and ...
EAMJ The Prevalence Dec 09.indd
African Journals Online (AJOL)
2009-12-12
Dec 12, 2009 ... Case definitions: The primary outcome was having a documented ADR after exposure to HAART. The cases were defined according to the guidelines contained in the Kenya National Clinical Manual for. ART providers (8), which mainly follows the criteria used by the AIDSClinical Trials Group (ACTG) (9).
289-- 14 Dec 2009 [Final Version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... tragedy in a sea of simplifications. The complex .... Different levels of communication often sharpen the discussion. ... resistance, mounting costs and rising discontent on the home front' in ... of Evangelicals in Orlando, Florida).
African Journals Online (AJOL)
Missing intrauterine contraceptive device (IUCD) is a known complication of ... complaints of missing IUCD over an 11 year period, from 1 January 1990 to 31 ... removal were extracted and analysed using tabulations and simple ... Nigerian Journal of Surgery • Dec. ... abdominal pain 5(25%) and string not felt 4(20%).
195--10 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-10
Dec 10, 2009 ... Accepted: 25 June 2009. Published: ... This paper will focus on the Leuenberg Agreement as a possible ... to confuse the true meaning of the Confession. ... Differences were minimalised as a matter of terminology and words.
ARC2D - EFFICIENT SOLUTION METHODS FOR THE NAVIER-STOKES EQUATIONS (DEC RISC ULTRIX VERSION)
Biyabani, S. R.
1994-01-01
computers to emulate Cray system time calls, which should be easy to modify for other machines as well. The standard distribution media for this version is a 9-track 1600 BPI ASCII Card Image format magnetic tape. The Cray version was developed in 1987. The IBM ES/3090 version is an IBM port of the Cray version. It is written in IBM VS FORTRAN and has the capability of executing in both vector and parallel modes on the MVS/XA operating system and in vector mode on the VM/XA operating system. Various options of the IBM VS FORTRAN compiler provide new features for the ES/3090 version, including 64-bit arithmetic and up to 2 GB of virtual addressability. The IBM ES/3090 version is available only as a 9-track, 1600 BPI IBM IEBCOPY format magnetic tape. The IBM ES/3090 version was developed in 1989. The DEC RISC ULTRIX version is a DEC port of the Cray version. It is written in FORTRAN 77 for RISC-based Digital Equipment platforms. The memory requirement is approximately 7Mb of main memory. It is available in UNIX tar format on TK50 tape cartridge. The port to DEC RISC ULTRIX was done in 1990. COS and UNICOS are trademarks and Cray is a registered trademark of Cray Research, Inc. IBM, ES/3090, VS FORTRAN, MVS/XA, and VM/XA are registered trademarks of International Business Machines. DEC and ULTRIX are registered trademarks of Digital Equipment Corporation.
337-- 11 Dec 2009 [final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... deterministic, it can easily be so construed (as clearly illustrated by the Westminster .... from Britain (especially from Calvinist Scotland) and Germany would be sinful ..... The Cambridge history of the Bible 1, pp. 510–541,.
283---14 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... the removal of artificial, man-made barriers' (Stiglitz 2003:xviii). This definition focuses on ..... States that have signed on to the WTO face losing 'most- ..... Retrenched women clothing workers cannot find work in the regulated,.
International Nuclear Information System (INIS)
Thomas, J.; Douglas, M.; Watanabe, R.; Henrikson, H.E.; Iqbal, M.Z.; Mitchell, L.W.; O'Callaghan, B.M.G.; Wong, H.T.K.; Melvin, J.D.
1987-01-01
The authors built a high pressure xenon Time Projection Chamber to study double beta decay, a process of fundamental interest which, if observed, would indicate that the neutrino is a massive Majorana particle. Raw data rates from the TPC exceed 200 Kbytes per second. The TPC is operated through a CAMAC interface with a DEC LSI-11/73 computer networked to a Tektronix 6130 workstation. Data is transmitted at about 15 Kbytes per second although the network is capable of transmitting data at 80 Kbytes per second. The only system level programming required was to write a UDP-TCP/IP driver for the DEC-DEQNA Ethenet board on the 11/73
Bancroftian filariasis: long-term effect of the DEC provocative day test on microfilaraemia
DEFF Research Database (Denmark)
Simonsen, Poul Erik; Meyrowitsch, Dan Wolf; Makunde, W.H.
1997-01-01
The diethylcarbamazine (DEC) provocative day test has been widely used for daytime diagnosis of Wuchereria bancrofti infections in areas where microfilariae exhibit nocturnal periodicity. Since DEC is also the primary drug for treatment of bancroftian filariasis, we examined the long term effect...... amicrofilaraemic. No significant reduction of microfilaraemia was observed in the placebo group. The results imply that the DEC provocative day test should not be used as a diagnostic tool in follow-up studies on microfilaraemias....
276----14 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... study of authors themselves (the literate few) and in studies of analogy and ..... power. The expectation of future vindication, even taking part in divine judgment ...... Anna Rebecca Solevåg (PhD candidate, Oslo. University ...
322--14 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... Attribution License. 581. Vol. 65 No. ... are at this time of global financial crisis despite the historic moment in United States and world politics that occurred .... its theory gave rise to the category of 'anti-societal language'. His.
281-- 14 Dec 2009--[ Final VERSION].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... reason is that, when it comes to motivation, there is the issue of intention and secondary intention. An example: ... this in Europe are the public health service and agriculture. ... Christians in need and should expect no reward.
OVERVIEW OF ADVANCED PETROLEUM-BASED FUELS-DIESEL EMISSIONS CONTROL PROGRAM (APBF-DEC)
Energy Technology Data Exchange (ETDEWEB)
Sverdrup, George M.
2000-08-20
The Advanced Petroleum-Based Fuels-Diesel Emissions Control Program (APBF-DEC) began in February 2000 and is supported by government agencies and industry. The purpose of the APBF-DEC program is to identify and evaluate the optimal combinations of fuels, lubricants, diesel engines, and emission control systems to meet the projected emission standards for the 2000 to 2010 time period. APBF-DEC is an outgrowth of the earlier Diesel Emission Control-Sulfur Effects Program (DECSE), whose objective is to determine the impact of the sulfur levels in fuel on emission control systems that could lower the emissions of NOx and particulate matter (PM) from diesel powered vehicles in the 2002 to 2004 period. Results from the DECSE studies of two emission control technologies-diesel particle filter (DPF) and NOx adsorber-will be used in the APBF-DEC program. These data are expected to provide initial information on emission control technology options and the effects of fuel properties (including additives) on the performance of emission control systems.
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... Selective Dissemination of Information (SDI) Services in a Nigerian University: A. Report. 75. Information ... that Libraries that are ICT driven have continued to provide ... take advantage of technology in providing reference and .... 6. Teaching Profile ... history, Varieties of English,. English. Syntax/Semantics,.
299---09 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-09
Dec 9, 2009 ... a country is going, the politics, social justice, whether elections will be ... money laundering, human trafficking and sexual exploitation, sex tourism, the ... to the transformation and improvement of education, including affordability and access. ..... extent do individuals and groups learn from their failures.
310---11 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... sola fides. God has done all this in his love and his sovereignty, ..... them across Europe to countries such as Scotland, England,. Italy and .... faith is, the seed of the word has preceded; where there is preaching there is the ...
299---09 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-09
Dec 9, 2009 ... money laundering, human trafficking and sexual exploitation, sex ... to the transformation and improvement of education, including affordability and access. ... A greater understanding of differences, and what gives rise to them, will hopefully lead to ..... The bridging function of spirituality is premised by two.
Jagielski, J. M.
1994-01-01
The DET/MPS programs model and simulate the Direct Energy Transfer and Multimission Spacecraft Modular Power System in order to aid both in design and in analysis of orbital energy balance. Typically, the DET power system has the solar array directly to the spacecraft bus, and the central building block of MPS is the Standard Power Regulator Unit. DET/MPS allows a minute-by-minute simulation of the power system's performance as it responds to various orbital parameters, focusing its output on solar array output and battery characteristics. While this package is limited in terms of orbital mechanics, it is sufficient to calculate eclipse and solar array data for circular or non-circular orbits. DET/MPS can be adjusted to run one or sequential orbits up to about one week, simulated time. These programs have been used on a variety of Goddard Space Flight Center spacecraft projects. DET/MPS is written in FORTRAN 77 with some VAX-type extensions. Any FORTRAN 77 compiler that includes VAX extensions should be able to compile and run the program with little or no modifications. The compiler must at least support free-form (or tab-delineated) source format and 'do do-while end-do' control structures. DET/MPS is available for three platforms: GSC-13374, for DEC VAX series computers running VMS, is available in DEC VAX Backup format on a 9-track 1600 BPI tape (standard distribution) or TK50 tape cartridge; GSC-13443, for UNIX-based computers, is available on a .25 inch streaming magnetic tape cartridge in UNIX tar format; and GSC-13444, for Macintosh computers running AU/X with either the NKR FORTRAN or AbSoft MacFORTRAN II compilers, is available on a 3.5 inch 800K Macintosh format diskette. Source code and test data are supplied. The UNIX version of DET requires 90K of main memory for execution. DET/MPS was developed in 1990. A/UX and Macintosh are registered trademarks of Apple Computer, Inc. VMS, DEC VAX and TK50 are trademarks of Digital Equipment Corporation. UNIX is a
Spectral Estimation by the Random Dec Technique
DEFF Research Database (Denmark)
Brincker, Rune; Jensen, Jacob L.; Krenk, Steen
1990-01-01
This paper contains an empirical study of the accuracy of the Random Dec (RDD) technique. Realizations of the response from a single-degree-of-freedom system loaded by white noise are simulated using an ARMA model. The Autocorrelation function is estimated using the RDD technique and the estimated...
Spectral Estimation by the Random DEC Technique
DEFF Research Database (Denmark)
Brincker, Rune; Jensen, J. Laigaard; Krenk, S.
This paper contains an empirical study of the accuracy of the Random Dec (RDD) technique. Realizations of the response from a single-degree-of-freedom system loaded by white noise are simulated using an ARMA model. The Autocorrelation function is estimated using the RDD technique and the estimated...
Indian Academy of Sciences (India)
client1
2007-12-05
Dec 5, 2007 ... glycerol and aminoacids such as alanine and proline. They are believed to stabilize cellular proteins and membranes at low temperature and hence called cryoprotectants. The cryoprotec- tive role of glycine betaine (GB) in bacteria is beginning to be understood. Antifreeze Proteins: An Overview. Birds ...
319----14 Dec 2009.indd [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... Creative Commons. Attribution License. 545 ..... this money on an alternative and apparently 'lawful' project, a burial field for foreigners .... Ultimately, however, the success or failure of the Jewish political campaign to discredit ...
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... East zone of Nigeria was examined through a descriptive survey. ... Variables and Utilization (QOLBUVAU) making a return rate of 86.6%. ... sampling technique was adopted as the respondents vary in size ... the structure and location of the library in ... the reviewed literature in this study. ..... The decision.
320--14 dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... Original Research: Boston Papers. A ... From a macro-narrative perspective, the dynamics of Jesus' healing ... After a close reading of these textual exchanges, I suggest that each of these .... critically, this paper will focus on the four Matthean healing ... of economics and the structural dynamics of exchange.
311----10 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-10
Dec 10, 2009 ... Fighting crime in the new South Africa has taken on new challenges under a ... spurred on by Gordon MacDonald's own 'renewed challenge of insisting that my life of following ... Postfoundationalism has emerged from the work of Wentzel van Huyssteen .... contribute to providing a solution in this regard.
161---8 Dec 2009.indd [final version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... The theory is attractive to practical theologians for two reasons. ... They consider conforming to principles to be of more importance than cultivating harmony. ...... Francis, L.J. & Atkins, P., 2000, Exploring Luke's Gospel: A guide.
127 -08 Dec 2009.indd [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... (as opposed to it being entirely superseded by a new 'Christian' identity) and interpreting him as still operating .... the rich enterprise of cultural or social anthropology. ...... millennial hopes were not realised by Paul's messiah.
Displaying DIII-D plasma data using DEC's X window system
International Nuclear Information System (INIS)
Greene, K.L.
1991-11-01
The D3-D tokamak program, funded by the Department of Energy, carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1987 MFITD and MFITPLAY were written/modified. These two programs provide graphical output that allows the users to see, before the next shot, the plasma shape and the locations of the plasma and magnetic flux lines within the tokamak. MFITD performs the computations which calculate the shape and location of the plasma; it also graphically displays a small subset of timeslice data. MFITPLAY graphically displays the full set of timeslice data. Through interactive commands, MFITPLAY also allows the user to control the various aspects of how the data is displayed. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support X windows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface
Vært for @AUforsker på Twitter 5.-11. dec. 2013
DEFF Research Database (Denmark)
Damkjaer, Maja Sonne
2013-01-01
@AUforsker på Twitter: Uafhængigt drevet af forskere fra Aarhus Uni. En forsker = en uge. Bliv klogere på vores forskning, undervisning og hverdag. 5.-11. dec. 2013 bestyret af @Majasdamkjaer Aarhus University, Denmark · au.dk......@AUforsker på Twitter: Uafhængigt drevet af forskere fra Aarhus Uni. En forsker = en uge. Bliv klogere på vores forskning, undervisning og hverdag. 5.-11. dec. 2013 bestyret af @Majasdamkjaer Aarhus University, Denmark · au.dk...
280---14 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... principles which are derived from the covenant order of communion. Ellul (in Kraus .... of a status confessionis refers to the practice of the church as well as to its teaching. .... east Asian countries (except Malaysia), the International. Monetary ... a significant rise in taxes on consumption (VAT). As a result,.
151---8 Dec 2009.indd [ Final version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... and sustained polemic against Paul himself. (Sim 2002:777). Here Sim .... implicit points resemble Luke's more explicit presentation in .... I now turn my attention. Matthew's ...... in memory of William G. Thompson, pp. 22–41 ...
124---14 Dec 2009.indd [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... convinced as Danny Postel (2006:15) was three years ago, during the most .... Every forty days, the masses re-appeared to mourn, as Shi'ite. Muslims do, the ...... the modernising of Islamic countries in a European fashion.
164----8 Dec 2009 [Final Version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... the issues in such struggles for justice appear more straightforward to outsiders than they do to ... that produced them, as well as the idea of the gospels as mirrors simply reflecting the ..... such counter-cultural reading communities must never ... to point to the way in which hegemony limits the possibility of.
278----9 Dec 2009 [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-09
Dec 9, 2009 ... different to the opening word 'hkyaee' found in Lamentations 1, 2 and. 4. ... Remembrance of events gives way to remembrance .... presence of the Most High and of one's case being subverted. (cf. ... standard reading of Lamentations is the fact that the narrator, ..... The form of Lamentations is that of a long.
325-- 11 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... with some light clouds and there are no clouds without water; as there are no birds ... food security as a high priority in many countries. Water and .... The above reasons for the availability of water resources reiterate that all living ... government infrastructure at various levels of agreement and not necessarily ...
308 --- 16 Dec 2009 [ final version].indd
African Journals Online (AJOL)
2009-12-16
Dec 16, 2009 ... Secondly, an effort has to be made to at least try to avoid the fallacies of ... The metaphor says one thing but means something else; it needs to ... New Testament scholarship with literary criticism, defines the parables as narrative ..... the parable in the context of Jesus' public career some forty years.
Computer-based data acquisition system in the Large Coil Test Facility
International Nuclear Information System (INIS)
Gould, S.S.; Layman, L.R.; Million, D.L.
1983-01-01
The utilization of computers for data acquisition and control is of paramount importance on large-scale fusion experiments because they feature the ability to acquire data from a large number of sensors at various sample rates and provide for flexible data interpretation, presentation, reduction, and analysis. In the Large Coil Test Facility (LCTF) a Digital Equipment Corporation (DEC) PDP-11/60 host computer with the DEC RSX-11M operating system coordinates the activities of five DEC LSI-11/23 front-end processors (FEPs) via direct memory access (DMA) communication links. This provides host control of scheduled data acquisition and FEP event-triggered data collection tasks. Four of the five FEPs have no operating system
Meshes optimized for discrete exterior calculus (DEC).
Energy Technology Data Exchange (ETDEWEB)
Mousley, Sarah C. [Univ. of Illinois, Urbana-Champaign, IL (United States); Deakin, Michael [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Knupp, Patrick [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mitchell, Scott A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-12-01
We study the optimization of an energy function used by the meshing community to measure and improve mesh quality. This energy is non-traditional because it is dependent on both the primal triangulation and its dual Voronoi (power) diagram. The energy is a measure of the mesh's quality for usage in Discrete Exterior Calculus (DEC), a method for numerically solving PDEs. In DEC, the PDE domain is triangulated and this mesh is used to obtain discrete approximations of the continuous operators in the PDE. The energy of a mesh gives an upper bound on the error of the discrete diagonal approximation of the Hodge star operator. In practice, one begins with an initial mesh and then makes adjustments to produce a mesh of lower energy. However, we have discovered several shortcomings in directly optimizing this energy, e.g. its non-convexity, and we show that the search for an optimized mesh may lead to mesh inversion (malformed triangles). We propose a new energy function to address some of these issues.
131-7 Dec 2009.indd [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-07
Dec 7, 2009 ... This interpretation of love that Jesus offers in his story gives ... philosophy, shed light on a possible new reading of sacred texts in which the question of identity ... neither can a home (oikos) offer hospitality to all as that would.
161---8 Dec 2009.indd [final version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... United Kingdom population norms, preachers within this sample were ... University of Warwick, .... hand, feeling types make judgements based on subjective, personal values. ... and female Bible College students (Francis, Penson & Jones. 2001) .... link between psychological type preference and choice of.
Pani, SP; Subramanyam Reddy, G; Das, LK; Vanamail, P; Hoti, SL; Ramesh, J; Das, PK
2002-01-01
Background The tolerability and efficacy of single dose albendazole (400 mg), diethylcarbamazine citrate (DEC) (6 mg/kg bodyweight) or co-administration of albendazole (400 mg) + DEC (6 mg/kg bodyweight) was studied in 54 asymptomatic Wuchereria bancrofti microfilaraemic volunteers in a double blind hospital-based clinical study. Results There was no significant difference in the overall incidence of adverse reactions between the three drug groups [42.1% (albendazole), 52.9% (DEC) and 61.1% (...
309 ----10 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-10
Dec 10, 2009 ... parable showed traces of the sola fidei principle of the Reformation, .... (j. Sanh. 6.23c par; j. Hagh. 2.77). This folk-tale ends where Bar .... Egyptian and Jewish accounts. ...... (1989:151), the dogs that licked Lazarus are most probably wild .... and to finance his extravagant building projects (the building of ...
286---15 Dec 2009.indd [Final version] .indd
African Journals Online (AJOL)
2009-12-15
Dec 15, 2009 ... on economic ethics to assess economic processes in relation to how they serve life. ... justice and fellowship – as gifts of God – that serve as an orientation ..... total ban, and pleaded for money to be allowed to make a profit,.
Wadwa, Munisch; Klopfleisch, Robert; Buer, Jan; Westendorf, Astrid M.
2016-01-01
The endocytotic c-type lectin receptor DEC-205 is highly expressed on immature dendritic cells. In previous studies, it was shown that antigen-targeting to DEC-205 is a useful tool for the induction of antigen-specific Foxp3+ regulatory T cells and thereby can prevent inflammatory processes. However, whether this approach is sufficient to mediate tolerance in mucosal tissues like the gut is unknown. In this study, we established a new mouse model in which the adoptive transfer of naive hemagglutinin (HA)-specific CD4+Foxp3– T cells into VILLIN-HA transgenic mice leads to severe colitis. To analyze if antigen-targeting to DEC-205 could protect against inflammation of the gut, VILLIN-HA transgenic mice were injected with an antibody–antigen complex consisting of the immunogenic HA110–120 peptide coupled to an α-DEC-205 antibody (DEC-HA) before adoptive T cell transfer. DEC-HA-treated mice showed significantly less signs of intestinal inflammation as was demonstrated by reduced loss of body weight and histopathology in the gut. Strikingly, abrogated intestinal inflammation was mediated via the conversion of naive HA-specific CD4+Foxp3– T cells into HA-specific CD4+Foxp3+ regulatory T cells. In this study, we provide evidence that antigen-targeting to DEC-205 can be utilized for the induction of tolerance in mucosal organs that are confronted with large numbers of exogenous antigens. PMID:27141310
272--11 Dec 2009 [final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... e o lo g ic a l S tu d ie s http://www.hts.org.za. HTS. Original Research. A rtic le # .... of departure is only possible due to an extra-biblical maxim, to ... John Hart points out ...... Jean-Pierre Changeaux and the philosopher Paul Ricoeur, is ..... De Cruchy, J.W., 1986, The church struggle in South Africa, Collins.
Effects of mutants in bHLH region on structure stability and protein-DNA binding energy in DECs.
Kong, Yi; Wang, Zhen; Jia, Yanfei; Li, Ping; Hao, Shuhua; Wang, Yunshan
2017-07-01
The human DEC subfamily contains two highly conserved members belonging to basic helix-loop-helix (bHLH) transcription factors. This conserved family is spread widely among various species with the function of regulating various crucial molecular signaling pathways. Due to the significance of DECs for important biological processes, their relationship with diseases and the lack of experimentally proven structures, we have implemented a comparative modeling for the bHLH region of DECs as homodimers with themselves and heterodimers with HES-1. Three mutants with predicted roles in reducing intramolecular binding (H57A, R65A, and LL7879AA in DEC1 and LL7071AA in DEC2) were investigated on DEC monomers. Molecular dynamics (MD) simulations were also employed to evaluate the behavior of the mutant molecules in aqueous solution. The monomer was divided into subregions for accurate investigation. The fluctuation in the basic region of mutants was higher than that of wild-type molecules. The binding energy value between protein and DNA obviously increased in the homodimer harboring R65A mutants, which led to more unstable status between protein and DNA. Thus, the mutant R65A interfered DNA-binding affinity. A study on the spatial structures of wild-type and mutant DECs may facilitate functional prediction for mutation effects and dynamic behavior under various conditions and may ultimately help in targeted drug design.
153--7 Dec 2009.indd [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-07
Dec 7, 2009 ... Over the past century, many Western mission agencies and ... regard to travel.3 During this time, the evangelical movement influenced Korean Christians to become involved in world ... well as effective mission strategies and policies for the mature .... 'I have had no difficulties in adapting to the culture and.
Design of Computer Fault Diagnosis and Troubleshooting System ...
African Journals Online (AJOL)
PROF. O. E. OSUAGWU
2013-12-01
Dec 1, 2013 ... 2Department of Computer Science. Cross River University ... owners in dealing with their computer problems especially when the time is limited and human expert is not ..... questions with the system responding to each of the ...
DEFF Research Database (Denmark)
Kristensen, Kasper; Jørgensen, Poul; Jansik, Branislav
2012-01-01
We demonstrate that the divide-expand-consolidate (DEC) scheme – which has previously been used to determine the second-order Møller–Plesset (MP2) correlation energy – can be applied to evaluate the MP2 molecular gradient in a linear-scaling and embarrassingly parallel manner using a set of local......-box manner to ensure that the error in the DEC-MP2 correlation energy compared to a standard MP2 calculation is proportional to a single input threshold denoted the fragment optimization threshold (FOT). The FOT also implicitly controls the error in the DEC-MP2 molecular gradient as substantiated...... by a theoretical analysis and numerical results. The development of the DEC-MP2 molecular gradient is the initial step towards calculating higher order energy derivatives for large molecular systems using the DEC framework, both at the MP2 level of theory and for more accurate coupled-cluster methods....
185---11 Dec 2009.indd Final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... period conceptions of how to live, despite death, coram Deo. ... analysing the moral sensitivities within these ancient holy texts without ... answer to the first question: No, not in any direct manner (what Smit [1992:316] terms deontological and .... is the case too now that hardly any Christian theologian of the.
Managing Associated Risks in Cloud Computer Applications Abstract
African Journals Online (AJOL)
2012-12-01
Dec 1, 2012 ... Cloud Computing, the long-held dream of computing as a utility, has the potential to transform a .... standard approaches to many of the issues, although simple cut .... collapse; So security and privacy are high priorities for all ...
318----14 Dec 2009.indd [ final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... in social behaviour and thinking, including those relating to cosmology ... exercise power through the global economy, as well as by means of their military and ..... local forms of Israelite religion in the face of pressures from the hierocratic .... expression 'telling' is used to refer to a probable act of Jesus (the.
Avaliação da anatomia de molares decíduos por meio de microtomografia computadorizada
Ana Caroline Fumes
2013-01-01
O conhecimento prévio da anatomia interna e externa dos dentes decíduos é de fundamental importância para o sucesso do tratamento endodôntico. O objetivo do presente estudo foi analisar a morfologia das raízes e dos canais radiculares de molares decíduos superiores e inferiores, por meio de microtomografia computadorizada (micro-CT). Foram usados 40 molares decíduos, divididos em quatro grupos, sendo 10 primeiros molares inferiores, 10 segundos molares inferiores, 10 primeiros molares superio...
DEFF Research Database (Denmark)
Simonsen, Paul E; Magesa, Stephen M; Meyrowitsch, Dan W
2005-01-01
The effect of eight half-yearly treatment rounds with diethylcarbamazine (DEC; 6mg/kg bodyweight) on Wuchereria bancrofti-specific circulating filarial antigen (CFA), a marker of adult worm infection, was followed in 79 individuals who were CFA-positive before start of treatment. Half of these we...... values. Repeated DEC therapy thus appears to have a slow but profound and persistent macrofilaricidal effect, which in the long run may be beneficial to populations undergoing DEC-based control interventions by reducing the probability of future morbidity development....
167-- 8 Dec 2009.indd [FINAL VESION].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... canonical scriptures – in the reformed tradition – and were therefore deemed unworthy of dogma and proclamation (Kaiser 2004:6). They could be used for teaching – as the Belgic Confession states – but this rarely, if at all, happened in a reformed congregation. However, a few factors have contributed to a ...
Wu, Yunyan; Liu, Qiang; Yan, Xu; Kato, Yukio; Tanaka, Makiko; Inokuchi, Sadaki; Yoshizawa, Tadashi; Morohashi, Satoko; Kijima, Hiroshi
2016-06-01
Podoplanin is reported involved in the collective cell invasion, another tumor invasion style which is distinct from the single cell invasion, so-called epithelial-mesenchymal transition (EMT). In this study, we investigated the correlation between podoplanin and EMT-related markers in esophageal squamous cell carcinoma (ESCC), and evaluated its linkage with the basic helix-loop-helix (bHLH) transcription factor differentiated embryonic chondrocyte (DEC) 1 and DEC2. Three ESCC cell lines and human squamous cell carcinoma A431 cells were subjected to western blot analyses for podoplanin and EMT markers, as well as the expression of DEC1 and DEC2. By RT-qPCR and western blotting, we found that TGF-β increased the expression of podoplanin and mensenchymal markers (e.g., N-cadherin and vimentin), while decreased the expression of epithelial markers (e.g., Claudin-4 and E-cadherin), accompanied by Smad2 phosphorylation and slug activation. Moreover, TGF-β has different effects on the expression of DEC1 and DEC2, that is, it upregulates DEC1, but downregulates DEC2. Capability of cell proliferation, invasion and migration were further analyzed using CCK-8 assay, Matrigel-invasion assay, and the wound-healing assay, respectively. The proliferation, invasion and migration ability were significantly lost in podoplanin-knockdown cells when compared with the scrambled siRNA group. In addition to these changes, the expression of Claudin-4, but not that of Claudin-1 or E-cadherin, was induced by the siRNA against podoplanin. On the contrary, overexpression of DEC1 and DEC2 exhibits opposite effects on podoplanin, but only slight effect on Claudin-4 was detected. These data indicated that podoplanin is significantly associated with EMT of TE-11 cells, and may be directly or indirectly regulated by bHLH transcription factors DEC1 and DEC2.
Siemionow, Maria; Cwykiel, Joanna; Heydemann, Ahlke; Garcia, Jesus; Marchese, Enza; Siemionow, Krzysztof; Szilagyi, Erzsebet
2018-06-01
Duchenne Muscular Dystrophy (DMD) is a progressive and lethal disease caused by mutations of the dystrophin gene. Currently no cure exists. Stem cell therapies targeting DMD are challenged by limited engraftment and rejection despite the use of immunosuppression. There is an urgent need to introduce new stem cell-based therapies that exhibit low allogenic profiles and improved cell engraftment. In this proof-of-concept study, we develop and test a new human stem cell-based approach to increase engraftment, limit rejection, and restore dystrophin expression in the mdx/scid mouse model of DMD. We introduce two Dystrophin Expressing Chimeric (DEC) cell lines created by ex vivo fusion of human myoblasts (MB) derived from two normal donors (MB N1 /MB N2 ), and normal and DMD donors (MB N /MB DMD ). The efficacy of fusion was confirmed by flow cytometry and confocal microscopy based on donor cell fluorescent labeling (PKH26/PKH67). In vitro, DEC displayed phenotype and genotype of donor parent cells, expressed dystrophin, and maintained proliferation and myogenic differentiation. In vivo, local delivery of both DEC lines (0.5 × 10 6 ) restored dystrophin expression (17.27%±8.05-MB N1 /MB N2 and 23.79%±3.82-MB N /MB DMD ) which correlated with significant improvement of muscle force, contraction and tolerance to fatigue at 90 days after DEC transplant to the gastrocnemius muscles (GM) of dystrophin-deficient mdx/scid mice. This study establishes DEC as a potential therapy for DMD and other types of muscular dystrophies.
DIRECT ENERGY CONVERSION (DEC) FISSION REACTORS - A U.S. NERI PROJECT
International Nuclear Information System (INIS)
Beller, D.; Polansky, G.
2000-01-01
The direct conversion of the electrical energy of charged fission fragments was examined early in the nuclear reactor era, and the first theoretical treatment appeared in the literature in 1957. Most of the experiments conducted during the next ten years to investigate fission fragment direct energy conversion (DEC) were for understanding the nature and control of the charged particles. These experiments verified fundamental physics and identified a number of specific problem areas, but also demonstrated a number of technical challenges that limited DEC performance. Because DEC was insufficient for practical applications, by the late 1960s most R and D ceased in the US. Sporadic interest in the concept appears in the literature until this day, but there have been no recent programs to develop the technology. This has changed with the Nuclear Energy Research Initiative that was funded by the U.S. Congress in 1999. Most of the previous concepts were based on a fission electric cell known as a triode, where a central cathode is coated with a thin layer of nuclear fuel. A fission fragment that leaves the cathode with high kinetic energy and a large positive charge is decelerated as it approaches the anode by a charge differential of several million volts, it then deposits its charge in the anode after its kinetic energy is exhausted. Large numbers of low energy electrons leave the cathode with each fission fragment; they are suppressed by negatively biased on grid wires or by magnetic fields. Other concepts include magnetic collimators and quasi-direct magnetohydrodynamic generation (steady flow or pulsed). We present the basic principles of DEC fission reactors, review the previous research, discuss problem areas in detail and identify technological developments of the last 30 years relevant to overcoming these obstacles. A prognosis for future development of direct energy conversion fission reactors will be presented
NASA ARCH- A FILE ARCHIVAL SYSTEM FOR THE DEC VAX
Scott, P. J.
1994-01-01
The function of the NASA ARCH system is to provide a permanent storage area for files that are infrequently accessed. The NASA ARCH routines were designed to provide a simple mechanism by which users can easily store and retrieve files. The user treats NASA ARCH as the interface to a black box where files are stored. There are only five NASA ARCH user commands, even though NASA ARCH employs standard VMS directives and the VAX BACKUP utility. Special care is taken to provide the security needed to insure file integrity over a period of years. The archived files may exist in any of three storage areas: a temporary buffer, the main buffer, and a magnetic tape library. When the main buffer fills up, it is transferred to permanent magnetic tape storage and deleted from disk. Files may be restored from any of the three storage areas. A single file, multiple files, or entire directories can be stored and retrieved. archived entities hold the same name, extension, version number, and VMS file protection scheme as they had in the user's account prior to archival. NASA ARCH is capable of handling up to 7 directory levels. Wildcards are supported. User commands include TEMPCOPY, DISKCOPY, DELETE, RESTORE, and DIRECTORY. The DIRECTORY command searches a directory of savesets covering all three archival areas, listing matches according to area, date, filename, or other criteria supplied by the user. The system manager commands include 1) ARCHIVE- to transfer the main buffer to duplicate magnetic tapes, 2) REPORTto determine when the main buffer is full enough to archive, 3) INCREMENT- to back up the partially filled main buffer, and 4) FULLBACKUP- to back up the entire main buffer. On-line help files are provided for all NASA ARCH commands. NASA ARCH is written in DEC VAX DCL for interactive execution and has been implemented on a DEC VAX computer operating under VMS 4.X. This program was developed in 1985.
Portable, remotely operated, computer-controlled, quadrupole mass spectrometer for field use
International Nuclear Information System (INIS)
Friesen, R.D.; Newton, J.C.; Smith, C.F.
1982-04-01
A portable, remote-controlled mass spectrometer was required at the Nevada Test Site to analyze prompt post-event gas from the nuclear cavity in support of the underground testing program. A Balzers QMG-511 quadrupole was chosen for its ability to be interfaced to a DEC LSI-11 computer and to withstand the ground movement caused by this field environment. The inlet system valves, the pumps, the pressure and temperature transducers, and the quadrupole mass spectrometer are controlled by a read-only-memory-based DEC LSI-11/2 with a high-speed microwave link to the control point which is typically 30 miles away. The computer at the control point is a DEC LSI-11/23 running the RSX-11 operating system. The instrument was automated as much as possible because the system is run by inexperienced operators at times. The mass spectrometer has been used on an initial field event with excellent performance. The gas analysis system is described, including automation by a novel computer control method which reduces operator errors and allows dynamic access to the system parameters
Estimation of Correlation Functions by the Random DEC Technique
DEFF Research Database (Denmark)
Brincker, Rune; Krenk, Steen; Jensen, Jakob Laigaard
The Random Dec Technique is a versatile technique for characterization of random signals in the time domain. In this paper a short review of the most important properties of the technique is given. The review is mainly based on recently achieved results that are still unpublished, or that has just...
Biyabani, S. R.
1994-01-01
INS3D computes steady-state solutions to the incompressible Navier-Stokes equations. The INS3D approach utilizes pseudo-compressibility combined with an approximate factorization scheme. This computational fluid dynamics (CFD) code has been verified on problems such as flow through a channel, flow over a backwardfacing step and flow over a circular cylinder. Three dimensional cases include flow over an ogive cylinder, flow through a rectangular duct, wind tunnel inlet flow, cylinder-wall juncture flow and flow through multiple posts mounted between two plates. INS3D uses a pseudo-compressibility approach in which a time derivative of pressure is added to the continuity equation, which together with the momentum equations form a set of four equations with pressure and velocity as the dependent variables. The equations' coordinates are transformed for general three dimensional applications. The equations are advanced in time by the implicit, non-iterative, approximately-factored, finite-difference scheme of Beam and Warming. The numerical stability of the scheme depends on the use of higher-order smoothing terms to damp out higher-frequency oscillations caused by second-order central differencing. The artificial compressibility introduces pressure (sound) waves of finite speed (whereas the speed of sound would be infinite in an incompressible fluid). As the solution converges, these pressure waves die out, causing the derivation of pressure with respect to time to approach zero. Thus, continuity is satisfied for the incompressible fluid in the steady state. Computational efficiency is achieved using a diagonal algorithm. A block tri-diagonal option is also available. When a steady-state solution is reached, the modified continuity equation will satisfy the divergence-free velocity field condition. INS3D is capable of handling several different types of boundaries encountered in numerical simulations, including solid-surface, inflow and outflow, and far
48 CFR 52.227-19 - Commercial Computer Software License.
2010-10-01
... Software License. 52.227-19 Section 52.227-19 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.227-19 Commercial Computer Software License. As prescribed in 27.409(g), insert the following clause: Commercial Computer Software License (DEC 2007) (a) Notwithstanding any contrary provisions...
Energy Technology Data Exchange (ETDEWEB)
Bader, Tobias; Finkenzeller, Michael; Trinkl, Christoph; Zoerner, Wilfried [Hochschule Ingolstadt (Germany). Kompetenzfeld Erneuerbare Energien
2010-07-01
The field of competence for renewable energy at the Ingolstadt University (Federal Republic of Germany) examines and optimizes an innovative, solar powered air conditioning system with DEC technology (DEC = Desiccant and Evaporative Cooling) in a multi-functional industrial buildings. In addition to a geothermal heat pump system for basic energy supply of heating and cooling, the building is fitted with two solar thermal solar collector panels and a sorption supported air conditioning system. This air conditioner consists of two units, each with a nominal air flow of 8,000 m{sup 3} per hour. The two solar collector panels provide the heat necessary for the regeneration of the sorption rotors and support the domestic preparation of hot water.
1609.pdf | dec102000 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; currsci; dec102000; 1609.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the ...
The Disasters Emergency Committee (DEC) and the Humanitarian Industry in Britain, 1963-85.
Jones, Andrew
2015-01-01
This article explores the history of modern British humanitarianism. Specifically, it charts the rise of an extensive humanitarian aid 'industry' in Britain, between 1963 and 1985. It does so through a focus on the Disasters Emergency Committee (DEC), an umbrella body for joint emergency fundraising established in 1963. The DEC is an enduring and important presence in the British humanitarian landscape, as it brings together leading aid agencies to make fundraising campaigns on television after major disasters. This article represents the first systematic historical analysis of the DEC, which it uses to illuminate larger questions about the politics of non-state humanitarianism, state-voluntary sector relations, the political impact of television, and the end of empire. It is shown that while DEC appeals fuelled the growth of its members, this was also a problematic process. Many principal aid agencies wished to shift their focus away from short-term disaster relief work to tackling the long-term structural causes of global poverty instead. It is argued that, despite an increasing political focus, humanitarian organizations were constrained from doing so by the power of television; a perceived lack of public support; the interventions of the British government; and competition between aid agencies in a crowded marketplace. Consequently, continued involvement in short-term, apolitical emergency assistance remained a requirement even for agencies sceptical about its value and impact. This analysis complicates linear narratives of a transition from emergency relief to development aid in post-war British humanitarianism, instead presenting the period as characterized by competing and even contradictory trajectories.
Atmospheric processes in reaction of Northern Sumatra Earthquake sequence Dec 2004-Apr 2005
Ouzounov, D.; Pulinets, S.; Cervone, G.; Singh, R.; Taylor, P.
2005-05-01
This work describes our first results in analyzing data from different and independent sources ûemitted long-wavelength radiation (OLR), surface latent heat flux (SHLF) and GPS Total Electron Content (TEC) collected from ground based (GPS) and satellite TIR (thermal infra-red) data sources (NOAA/AVHRR, MODIS). We found atmosphere and ionosphere anomalies one week prior to both the Sumatra-Andaman Islands earthquake (Dec 26, 2004) and M 8.7 - Northern Sumatra, March 28, 2005. We analyzed 118 days of data from December 1, 2004 through April 1, 2005 for the area (0°-10°,north latitude and 90°-100° east longitude) which included 125 earthquakes with M>5.5. Recent analysis of the continuous OLR from the Earth surface indicates anomalous variations (on top of the atmosphere) prior to a number of medium to large earthquakes. In the case of M 9.0 - Sumatra-Andaman Islands event, compared to the reference fields for the months of December between 2001 and 2004, we found strongly OLR anomalous +80 W/m2 signals (two sigma) along the epicentral area on Dec 21, 2004 five days before the event. In the case of M8.7 March 28, 2005 anomalues signatures over the epicenter appears on March 26 is much weaker (only +20W/m2) and have a different topology. Anomalous values of SHLF associated with M9.0 - Sumatra-Andaman Islands were found on Dec 22, 2005 (SLHF +280Wm2) and less intensity on Mar 23, 2005 (SLHF +180Wm2). Ionospheric variations (GPS/TEC) associated with the Northern Sumatra events were determine by five Regional GPS network stations (COCO, BAKO, NTUS, HYDE and BAST2). For every station time series of the vertical TEC (VTEC) were computed together with correlation with the Dst index. On December 22, four days prior to the M9.0 quake GPS/TEC data reach the monthly maximum for COCO with minor DST activity. For the M 8.7-March 28 event, the increased values of GPS/TEC were observed during four days (March 22-25) in quiet geomagnetic background. Our results need additional
2010-10-01
...: Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997) The... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997). 1552.235-78 Section 1552.235-78 Federal...
Performance Evaluation of a Mobile Wireless Computational Grid ...
African Journals Online (AJOL)
PROF. OLIVER OSUAGWA
2015-12-01
Dec 1, 2015 ... Abstract. This work developed and simulated a mathematical model for a mobile wireless computational Grid ... which mobile modes will process the tasks .... evaluation are analytical modelling, simulation ... MATLAB 7.10.0.
Houston, R
2000-01-01
DEC-fortified salt has been used successfully as a principal public health tool to eliminate lymphatic filariasis (LF) in China and, less extensively, in several other countries. Studies from 1967 to the present conducted in Brazil, Japan, Tanzania, India, China, and Taiwan involving administration of DEC salt for 18 days to 1 year, have shown this intervention to be effective for both bancroftian and brugian filariasis, as measured by reductions in both microfilarial density and positivity, and in some studies through reduction in mosquito positivity rates as well. Furthermore, studies suggest specific advantages from using DEC salt, including lack of side effects, particularly for bancroftian filariasis, and ability to reduce prevalence below 1% when used in conjunction with standard regimens of DEC tablets. However, use of DEC salt as a control tool suffers from a concern that health authorities might find it difficult to manage a programme involving a commodity such as salt. In the past decade, the very successful global efforts to eliminate iodine deficiency through universal salt iodization have demonstrated that partnership with the salt industry can be both successful and effective as a public health tool. Use of DEC salt can be most successfully implemented in areas in which (a) there is adequate governmental support for its use and for elimination of filariasis, (b) filariasis-endemic areas are clearly defined, (c) political leaders, health officials and the salt industry agree that DEC salt is an appropriate intervention, (d) the salt industry is well-organized and has known distribution patterns, (e) a successful national salt iodization effort exists, (f) a monitoring system exists that ensures adequacy of salt iodine content during production and that can also measure household coverage, and (g) measurement of impact on transmission of LF with the new antigen or filarial DNA detection methods can be established. There are advantages and disadvantages
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.7258 >orf19.7258; Contig19-2507; 88880..89851; DDI1*; response to DNA alkyl...ation; MQLTISLDHSGDIISVDVPDSLCLEDFKAYLSAETGLEASVQVLKFNGRELVGNATLSELQIHDNDLLQLSKKQVA
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.1278 >orf19.1278; Contig19-10104; complement(13162...4..>132028); ; conserved hypothetical protein; truncated protein IQNNKCSGCNLKLDFPVIHFKCKHSFHQKCLSTNLIATSTESS
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4711 >orf19.4711; Contig19-10212; complement(29836...7..>300616); ; acidic repetitive protein; truncated protein DRSDYNEEDNNDFTRKLNEIQSKESNHEDLAQSEVQEGQKDEPDSVNQ
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ruitment factor; MAKTRSKSAATAAATSPKASPTAAKVTKNKVTKPSTASPSKTTKTKAVKKTTTKKATPKKEEEEKK... Ca19AnnotatedDec2004aaSeq orf19.124 >orf19.124; Contig19-10035; 67601..68698; CIC1*; protease substrate rec
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.3361 >orf19.3361; Contig19-10173; 157397..>158185;... YAT2*; carnitine acetyltransferase; gene family | truncated protein MSTYRFQETLEKLPIPDLVQTCNAYLEALKPLQTEQEHE
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4748 >orf19.4748; Contig19-10215; complement(47336.....47731); MSL1*; U2 snRNA-associated protein; MPSTKRSSSTEYSHKDSKKKVKLDYVNLKPSQTLYVKNLNTKINKKILLHNLYLLFSAFGDIISINLQNGFAFIIFSNLNSATLALRNLKNQDFFDKPLVLNYAVKESKAISQEKQKLQDENDEEVMPSYE*
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2370 >orf19.2370; Contig19-10147; complement(50671..52716); DSL1*; retrogra...de ER-to-golgi transport; MPSIEQQLEDQELYLKDIEQNINKTLSKINKTTLENDNDFRKQFEEIPQDSNTTESN
Cuartero Sala, Mireia; Betbesé Roig, Antoni-Jordi; Universitat Autònoma de Barcelona. Departament de Medicina
2012-01-01
Es tracta d'un estudi observacional prospectiu en 18 pacients afectats de la síndrome de destret respiratori agut que van requerir un canvi de posició de decúbit supí a decúbit pron per tal de millorar l'oxigenació. La hipòtesi de treball era que aquest canvi de posició podia augmentar la pressió intraabdominal i, en conseqüència, alterar la funció renal per causa prerrenal. Foren registrades variables hemodinàmiques, respiratòries i pressions intrabdominals, i valorada la funció renal. La po...
Cuartero Sala, Mireia
2012-01-01
Es tracta d’un estudi observacional prospectiu en 18 pacients afectats de la síndrome de destret respiratori agut que van requerir un canvi de posició de decúbit supí a decúbit pron per tal de millorar l’oxigenació. La hipòtesi de treball era que aquest canvi de posició podia augmentar la pressió intraabdominal i, en conseqüència, alterar la funció renal per causa prerrenal. Foren registrades variables hemodinàmiques, respiratòries i pressions intrabdominals, i valorada la funció renal. La po...
Odonnell, R. A.; Weissinger, D.
1988-01-01
The results of the Independent Orbiter Assessment (IOA) of the Failure Modes and Effects Analysis (FMEA) and Critical Items List (CIL) are presented. The IOA effort first completed an analysis of the Landing/Deceleration (LDG/DEC) hardware, generating draft failure modes and potential critical items. To preserve independence, this analysis was accomplished without reliance upon the results contained within the NASA FMEA/CIL documentation. The IOA contained within the NASA FMEA/CIL documentation. The IOA results were then compared to the NASA FMEA/CIL baseline with proposed Post 51-L updates included. A resolution of each discrepancy from the comparison is provided through additional analysis as required. This report documents the results of that comparison for the Orbiter LDG/DEC hardware. The IOA product for the LDG/DEC analysis consisted of 259 failure mode worksheets that resulted in 124 potential critical items being identified. Comparison was made to the NASA baseline which consisted of 267 FMEA's and 120 CIL items. This comparison produced agreement on all but 75 FMEA's which caused differences in 51 CIL items.
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.710 >orf19.710; Contig19-10065; complement(47186.....>47710); LSC2*; succinate-CoA ligase beta subunit; truncated protein | overlap LGFDDNASFRQEEVFSWRDPTQEDPQEAE
6th International Conference on Computer Science and its Applications
Stojmenovic, Ivan; Jeong, Hwa; Yi, Gangman
2015-01-01
The 6th FTRA International Conference on Computer Science and its Applications (CSA-14) will be held in Guam, USA, Dec. 17 - 19, 2014. CSA-14 presents a comprehensive conference focused on the various aspects of advances in engineering systems in computer science, and applications, including ubiquitous computing, U-Health care system, Big Data, UI/UX for human-centric computing, Computing Service, Bioinformatics and Bio-Inspired Computing and will show recent advances on various aspects of computing technology, Ubiquitous Computing Services and its application.
FILOSOFIA THEORETICA VoI. 1 No. 1 Dec. 2011 MENTAL ...
African Journals Online (AJOL)
JONATHAN CHIMAKONAM OKEKE
2011-12-01
Dec 1, 2011 ... investigate the problem of personal identity (Furman and Avila, 146). Others include, Thomas Reid ... disembodied thoughts and memories are the bastion of personal identity. This does not suggest the .... may make a little sense to me when I say that I'm what I think I am, but how far does this go? How do I ...
Cloud Computing: Key to IT Development in West Africa
African Journals Online (AJOL)
PROF. O. E. OSUAGWU
2013-12-01
Dec 1, 2013 ... Paper, explores the basic concepts of Cloud Computing and how the emerging technology could be harnessed to .... recovery of information than traditional system. Storage ... quickly meet business demand was an important ...
Some programming aids for the DEC PDP-10
International Nuclear Information System (INIS)
McNamara, B.
1979-01-01
A simplified system has been written to help in FORTRAN programming of physics and mathematical problems. The system is described in Appendix A. A magnetic tape has been made of the complete system as used on the DEC-10 by M-Division for Magnetic Fusion related calculations. The system turns out to use many of the locally developed goodies, such as the TEDI text editor, the TV80 graphics system, and Tektronix 4012 videos. The facilities are briefly described in the HLP files on the tape
Directory of Open Access Journals (Sweden)
Hironobu Yanagisawa
2016-03-01
Full Text Available The presence of high molecular weight double-stranded RNA (dsRNA within plant cells is an indicator of infection with RNA viruses as these possess genomic or replicative dsRNA. DECS (dsRNA isolation, exhaustive amplification, cloning, and sequencing analysis has been shown to be capable of detecting unknown viruses. We postulated that a combination of DECS analysis and next-generation sequencing (NGS would improve detection efficiency and usability of the technique. Here, we describe a model case in which we efficiently detected the presumed genome sequence of Blueberry shoestring virus (BSSV, a member of the genus Sobemovirus, which has not so far been reported. dsRNAs were isolated from BSSV-infected blueberry plants using the dsRNA-binding protein, reverse-transcribed, amplified, and sequenced using NGS. A contig of 4,020 nucleotides (nt that shared similarities with sequences from other Sobemovirus species was obtained as a candidate of the BSSV genomic sequence. Reverse transcription (RT-PCR primer sets based on sequences from this contig enabled the detection of BSSV in all BSSV-infected plants tested but not in healthy controls. A recombinant protein encoded by the putative coat protein gene was bound by the BSSV-antibody, indicating that the candidate sequence was that of BSSV itself. Our results suggest that a combination of DECS analysis and NGS, designated here as “DECS-C,” is a powerful method for detecting novel plant viruses.
Scaling Up Optimal Heuristic Search in Dec-POMDPs via Incremental Expansion (extended abstract)
Spaan, M.T.J.; Oliehoek, F.A.; Amato, C.
2011-01-01
We advance the state of the art in optimal solving of decentralized partially observable Markov decision processes (Dec-POMDPs), which provide a formal model for multiagent planning under uncertainty.
ilc-25.pdf | dec2005 | jess | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; jess; dec2005; ilc-25.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held ...
Displaying DIII-D plasma data using DEC's X window system
International Nuclear Information System (INIS)
Greene, K.L.
1992-01-01
This paper reports on the DIII-D tokamak program funded by the Department of Energy, which carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for each shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support Xwindows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface
Energy Technology Data Exchange (ETDEWEB)
Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas [Department of Chemistry, qLeap Center for Theoretical Chemistry, University of Aarhus, DK-8000 Århus C (Denmark)
2016-07-14
We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.
International Nuclear Information System (INIS)
Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas
2016-01-01
We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.
International Nuclear Information System (INIS)
Ha, Jun Su; Kim, Sungyeop
2014-01-01
The fail safety design is referred to as an inherently safe design concept where the failure of an SSC (System, Structure or Component) leads directly to a safe condition. Usually the fail safe design has been devised based on the design basis accident (DBAs), because the nuclear safety has been assured by securing the capability to safely cope with DBAs. Currently regards have been paid to the DEC (Design Extension Condition) as an extended design consideration. Hence additional attention should be paid to the concept of the fail safe design in order to consider the DEC, accordingly. In this study, a case chosen from the Fukushima accident is studied to discuss the issue associated with the fail safe design in terms of DBA and DEC standpoints. For the fail safe design to be based both on the DBA and the DEC, a Mode Changeable Fail Safe Design (MCFSD) is proposed in this study. Additional discussions on what is needed for the MCFSD to be applied in the nuclear safety are addressed as well. One of the lessons learnt from the Fukushima accident should include considerations on the fail-safe design in a changing regulatory framework. Currently the design extension condition (DEC) including severe accidents should be considered during designing and licensing NPPs. Hence concepts on the fail safe design need to be changed to be based on not only the DBA but also the DEC. In this study, a case on a fail-safe design chosen from the Fukushima accident is studied to discuss the issue associated with the fail safe design in terms of DBA and DEC conditions. For the fail safe design to be based both on the DBA and the DEC, a Mode Changeable Fail Safe Design (MCFSD) is proposed in this study. Additional discussions on what is needed for the MCFSD to be applied in the nuclear safety are addressed as well
7th International Conference on Embedded and Multimedia Computing (EMC-12)
Jeong, Young-Sik; Park, Sang; Chen, Hsing-Chung; Embedded and Multimedia Computing Technology and Service
2012-01-01
The 7th International Conference on Embedded and Multimedia Computing (EMC-12), will be held in Gwangju, Korea on September 6 - 8, 2012. EMC-12 will be the most comprehensive conference focused on the various aspects of advances in Embedded and Multimedia (EM) Computing. EMC-12 will provide an opportunity for academic and industry professionals to discuss the latest issues and progress in the area of EM. In addition, the conference will publish high quality papers which are closely related to the various theories and practical applications in EM. Furthermore, we expect that the conference and its publications will be a trigger for further related research and technology improvements in this important subject. The EMC-12 is the next event, in a series of highly successful International Conference on Embedded and Multimedia Computing, previously held as EMC 2011 (China, Aug. 2011), EMC 2010 (Philippines, Aug. 2010), EM-Com 2009 (Korea, Dec. 2009), UMC-08 (Australia, Oct. 2008), ESO-08(China, Dec. 2008), UMS-08 ...
DecAID: a decaying wood advisory model for Oregon and Washington.
Kim Mellen; Bruce G. Marcot; Janet L. Ohmann; Karen L. Waddell; Elizabeth A. Willhite; Bruce B. Hostetler; Susan A. Livingston; Cay. Ogden
2002-01-01
DecAID is a knowledge-based advisory model that provides guidance to managers in determining the size, amount, and distribution of dead and decaying wood (dead and partially dead trees and down wood) necessary to maintain wildlife habitat and ecosystem functions. The intent of the model is to update and replace existing snag-wildlife models in Washington and Oregon....
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.6649; Contig19-10251; complement(36800..38461); BR...87398.1| ... TFIIB related subunit of TFIIIB (BRF1) [Candida ... albicans] pir||B55483 transcr...L Transcription factor IIIB 70 kDa ... subunit (TFIIIB) (B-related factor)
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2029; Contig19-10139; 79190..80278; RFC5*; DNA replicationn factor C | lead...ing strand elongation mismatch repair ... (ATPase); >1a5t0 2 329 7 339 1e-22 ... gb|EAL00
Efeito da rotação da cabeça na pressão intraocular em decúbito ventral: estudo randomizado
Directory of Open Access Journals (Sweden)
M. Nuri Deniz
2013-04-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: A elevação da pressão intraocular (PIO, que diminui a pressão de perfusão do nervo óptico, é aumentada pelo posicionamento em decúbito ventral. O objetivo de nosso estudo foi comparar o efeito da rotação lateral da cabeça a 45º em decúbito ventral no aumento da PIO de olhos posicionados para cima e olhos posicionados para baixo em pacientes submetidos à nefrolitotomia percutânea (NLPC. MÉTODOS: Quarenta e cinco pacientes foram randomicamente alocados em dois grupos. A PIO dos pacientes foi registrada bilateralmente em posição supina antes do início da operação. Os pacientes foram posicionados em decúbito ventral. A cabeça foi posicionada sobre um apoio sem compressão externa direta em ambos os olhos. Os pacientes do Grupo I foram estritamente mantidos em pronação neutra, enquanto os pacientes do Grupo II foram posicionados em pronação com rotação da cabeça a 45º para o lado direito. No fim da operação, os pacientes foram reposicionados em decúbito dorsal e a PIO foi imediatamente medida. RESULTADOS: Não houve diferença entre os dados demográficos, na duração da cirurgia, perda de sangue e reposição de líquido dos pacientes. Os valores pós-cirúrgicos da PIO em decúbito ventral aumentaram significativamente em comparação com os valores pré-operatórios em ambos os grupos (p < 0,05. Após a cirurgia em decúbito ventral, os valores da PIO nos olhos posicionados para cima no Grupo II foram significativamente menores do que no Grupo I e nos olhos posicionados para baixo no Grupo II (p < 0,05. CONCLUSÃO: A posição em decúbito ventral aumenta a PIO. Nos pacientes posicionados em decúbito ventral com rotação lateral da cabeça a 45º, a PIO nos olhos posicionados para cima foi significativamente menor.
We Cannot Walk Away: DEC's Position of Child Abuse, Neglect, and Trauma
Corr, Catherine
2016-01-01
This article details two important reasons why supporting young children with disabilities who have experienced abuse and neglect and their families is the responsibility and obligation of the Division for Early Childhood of the Council for Exceptional Children (DEC): (1) Although prevalent in their work, this population is overlooked; and (2)…
Nagata, Takeshi
1947-01-01
In in the early morning of Dec. 21, 1946, a great destructive earthquake occurred in southern-western Japan. According to the seismogram obtained in our university, the earthquake motion began at Tokyo from 4 h 20 m 10.4 s on Dec. 21, 1946. The maximum amplitude of NS, EW, and up-down components of the earthquake motion at Tokyo was 12.0 mm, 14.0 mm and 3.0 mm respectively, while the initial motion was composed of 80 μ south, 67 μ west and 20 μ down movements.
Um comentário sobre Gerasa, a cidade de Decápolis
Directory of Open Access Journals (Sweden)
Marisa Balsamo Steingberg
1969-09-01
Full Text Available Num remoto e quieto vale, junto às montanhas de Gilead, extendem-se as ruínas de Gerasa (Jerash atual, cidade da Decápolis . Sente-se seu poderio através de suas ruas e monumentos em bom estado de conservação: um dos mais complexos de cidade provincial romana.
Symbolic computation and abundant travelling wave solutions to ...
Indian Academy of Sciences (India)
2016-12-09
Dec 9, 2016 ... Abstract. In this article, the novel (G /G)-expansion method is successfully applied to construct the abundant travelling wave solutions to the KdV–mKdV equation with the aid of symbolic computation. This equation is one of the most popular equation in soliton physics and appear in many practical scenarios ...
International Nuclear Information System (INIS)
Lengauer, C.
1975-01-01
The described software serves for the control of CAMAC-systems by a PDP-11 Computer with one DEC CA11-A Branch-Driver, respectively up to ten BORER Type 1533A Single-Crate-Controllers under the Operating System DOS V08. The software consists of three parts: 1) a subroutine library for programming in FORTRAN, 2) a macro library for programming in Assembler (for time-critical problems), 3) a loadable CAMAC-Driver for controlling the system by input of single CAMAC-commands at the terminal. Programs which apply the first two parts can be written independently of the CAMAC-Controller used at runtime. (orig.) [de
Directory of Open Access Journals (Sweden)
Néstor Hernando Campos
2012-04-01
Full Text Available Objetivo. Determinar la estructura de las poblaciones de crustáceos decápodos asociados a ensamblajes algales en el litoral rocoso del departamento de Córdoba. Materiales y métodos. Para la recolección de los especímenes se delimitó con un cuadrante de 625 cm2, un área con cinco repeticiones dispuestas al azar en cada estación. Para la separación de las macroalgas desde su disco de fijación en el sustrato, se empleó una espátula metálica. En un recipiente plástico se separaron los crustáceos decápodos del resto del material y se conservaron en alcohol al 70%. Resultados. Se identificaron representantes de 50 especies asociadas a los céspedes algales, agrupadas en 16 familias y 29 géneros. Especies como Acanthonyx petiverii, Epialtus bituberculatus, Eurypanopeus abbreviatus y Pachycheles serratus, presentaron un rango amplio de distribución, siendo características en las dos ecorregiones de estudio. Los cambios en cobertura de algas rojas como Gracilaria mammillaris, Hypnea musciformis y Acanthophora muscoides, determinaron la mayor asociación de crustáceos decápodos en la ecorregión Morrosquillo, mientras que los cambios en cobertura de G. damaecornis y Padina gymnospora, fueron las que determinaron la mayor asociación de crustáceos decápodos en el Darién cordobés. Conclusiones. Los resultados indicaron que las especies de crustáceos decápodos asociados a ensamblajes macroalgales, no se encontraron distribuidas de forma similar en las dos ecorregiones estudiadas, siendo P. armatus la especie con mayor porcentaje de abundancia en la ecorregión Morrosquillo, y E. bituberculatus en el sector comprendido entre los municipios de Moñitos y Los Córdobas.
Terapia pulpar em dentes decíduos: possibilidades terapêuticas baseadas em evidências
Directory of Open Access Journals (Sweden)
Natalino Lourenço Neto
Full Text Available INTRODUÇÃO: A pulpotomia em dentes decíduos é uma técnica conservadora de terapia pulpar amplamente utilizada em Odontopediatria, sendo de fundamental importância para evitar a perda prematura desses dentes, quer seja por alterações provocadas pela cárie dentária ou traumatismo dentário. Apesar de ser uma técnica estudada há muitos anos, causa muitas controvérsias e discussões, principalmente em termos de biocompatibilidade dos medicamentos empregados e pelas dificuldades e falhas no diagnóstico da condição pulpar. OBJETIVO: Por meio de uma revisão sistemática da literatura, no período compreendido entre 2000 e 2011, e com enfoque em estudos clínicos randomizados, revisões sistemáticas e meta-análises, este trabalho teve como objetivo discutir, com base em evidências científicas, alternativas para o tratamento de pulpotomia em dentes decíduos humanos. CONCLUSÃO: As evidências científicas fidedignas com o uso de materiais capeadores pulpares e as técnicas de Eletrocirurgia e Laser de Baixa Potência foram escassas. Desta forma, sugere-se a realização de estudos complementares bem delineados estatisticamente para maiores esclarecimentos. As informações geradas em tais experimentos poderão contribuir para um melhor entendimento dos mecanismos da terapia pulpar, podendo gerar o desenvolvimento de protocolos com novas formas terapêuticas, que visam a melhorar a terapia pulpar em dentes decíduos.
Formatos de vídeo, códec y otros aspectos del montaje audiovisual
Cuadrado Sánchez, Rocío
2013-01-01
Este trabajo es una investigación sobre qué es un formato, qué códec hay en el mercado y los procesos que entran en juego a la hora de crear y desarrollar un proyecto para después compartirlo sin ningún problema
Steam generator transient studies using a simplified two-fluid computer code
International Nuclear Information System (INIS)
Munshi, P.; Bhatnagar, R.; Ram, K.S.
1985-01-01
A simplified two-fluid computer code has been used to simulate reactor-side (or primary-side) transients in a PWR steam generator. The disturbances are modelled as ramp inputs for pressure, internal energy and mass flow-rate for the primary fluid. The CPU time for a transient duration of 4 s is approx. 10 min on a DEC-1090 computer system. The results are thermodynamically consistent and encouraging for further studies. (author)
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available chizosaccharomyces pombe] ref|NP_594201.1| spindle poison ... sensitivity related protein. [Schizosac...charomyces pombe] ... pir||T11624 spindle poison sensitivity protein - fis...inger protein | spindle poison sensitivity related protein; >1rgoA 8 70 40 92 2e-04 ... emb|CAB16391.1| scp3 [S... Ca19AnnotatedDec2004aaSeq orf19.7385; Contig19-2513; 105328..106833; LEE1*; zinc f
Decúbito prono en pacientes con síndrome de distrés respiratorio agudo
Directory of Open Access Journals (Sweden)
Mariano Setten
Full Text Available RESUMEN El síndrome de distrés respiratorio agudo ocupa gran atención en la unidad de cuidados intensivos. A pesar del amplio conocimiento alcanzado sobre la fisiopatología de éste síndrome, el enfoque en la unidad de cuidados intensivos consiste, en gran parte, en un tratamiento de soporte vital y en evitar los efectos secundarios de las terapéuticas invasivas. Si bien, durante los últimos 20 años, se generaron grandes avances en ventilación mecánica con un impacto importante sobre la mortalidad, ésta continúa siendo elevada. Una característica de los pacientes con síndrome de distrés respiratorio agudo, sobre todo los más severos, es la presencia de hipoxemia refractaria debido a la existencia de shunt, pudiendo requerir tratamientos adicionales a la ventilación mecánica, entre ellos la ventilación mecánica en decúbito prono. Este método, recomendado para mejorar la oxigenación por primera vez en 1974, puede ser implementado fácilmente en cualquier unidad de cuidados intensivos con personal entrenado. El decúbito prono tiene un sustento bibliográfico sumamente robusto. Varios ensayos clínicos randomizados han demostrado el efecto del decúbito prono sobre la oxigenación en pacientes con síndrome de distrés respiratorio agudo medida a través de la relación PaO2/FiO2 e incluso su impacto en el aumento de la sobrevida de estos pacientes. Los integrantes del Comité de Kinesiología Intensivista de la Sociedad Argentina de Terapia Intensiva realizaron una revisión narrativa con el objetivo de exponer la evidencia disponible en relación a la implementación del decúbito prono, los cambios producidos en el sistema respiratorio por la aplicación de la maniobra y su impacto sobre la mortalidad. Por último, se sugerirán lineamientos para la toma de decisiones.
Aplicação do triglicerídeos de cadeia média (TCM na prevenção de úlceras de decúbito
Directory of Open Access Journals (Sweden)
Vânia Declair
1994-03-01
Full Text Available Aproximadamente 75.000 das 1.000.000 pessoas hospitalizadas a cada ano desenvolvem Úlceras de Decúbito. Graças à tecnologia avançada, hoje temos várias opções de tratamento destas úlceras, ainda que isto seja dispendioso para os pacientes e hospitais. Porém, melhor que desenvolver um processo curativo, é poder desenvolver um processo preventivo eficaz. Com o objetivo de avaliar a eficácia do uso tópico de triglicerídeos de cadeia média (TCM na prevenção de Úlceras de Decúbito, a autora utilizou o método duplo-cego em 86 pacientes, onde 50% foi submetido ao uso de solução com TCM e 50% ao uso Solução Glicerinada. Em ambos os casos, houve diminuição da instalação de Úlceras de Decúbito, porém, dos pacientes que se submeteram ao uso de solução com TCM, apenas de 2 (dois desenvolveram Úlcera de Decúbito (Grau 1; e dos pacientes que se submeteram ao uso de Solução com Glicerina, 12 (doze desenvolveram Úlcera de Decúbito (Graus 1 e 2. Concluiu-se que o TCM é de grande auxílio na prevenção de Úlceras de Decúbito, tem excelente absorção para uso tópico, forma uma película protetora à pele, previne escoriações devido à sua alta capacidade de hidratação e proporciona nutrição celular local.
International Nuclear Information System (INIS)
Kwon, Sang Ki; Park, Jeong Hwa; Choi, Jong Won; Kang, Chul Hyung
2001-03-01
For the safe design of a high-level nuclear waste repository in deep location, it is necessary to confirm the stability of the underground excavations under the high overburden pressure and also to investigate the influence of discontinuities such as fault, fracture zone, and joints. In this study, computer simulations using 3DEC, which is a Distince Element (DEM) code, were carried out for determining important parameters on the stability of the disposal tunnel and deposition holes excavated in 500 m deep granite body. The development of plastic zone and stress and strain distributions were analyzed with various modelling conditions with variation on the parameters including joint numbers, tunnel size, joint properties, rock properties, and stress ratio. Furthermore, the influence of fracture zone, which is located around the underground excavations, on the stability of the excavation was investigated. In this study, the variation of stress and strain distribution due to the variation of fracture zone location, dip, and width was analyzed
Strontium-90 and cesium-137 in total diet (from Jun. 1982 to Dec. 1982)
International Nuclear Information System (INIS)
1982-01-01
Strontium-90 and cesium-137 in total diet (from Jun. to Dec. 1982) were determined. A full one day ordinary diet including three meals, water, tea and other in-between snacks for five persons was collected as a sample of ''total diet'' from 22 sampling locations. The results are shown in a table. (Namekawa, K.)
Strontium-90 and cesium-137 in sea fish (from Jun. 1982 to Dec. 1982)
International Nuclear Information System (INIS)
1982-01-01
Strontium-90 and cesium-137 in sea fish (from Jun. to Dec. 1982) were determined. Fish was collected from 22 sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are sown in a table. (Namekawa, K.)
Efeito da perda prematura de molares decíduos na sobressaliência
Directory of Open Access Journals (Sweden)
Yérica M García
2011-01-01
Full Text Available A perda precoce de molares decíduos predispõe as maloclusões, entre estas o apinhamento dentário, impactação de dentes permanentes e alteração da relação molar e canino. O objetivo do estudo foi determinar o efeito das perdas precoces dos molares decíduos na relação horizontal incisiva. O estudo é do tipo documentado, retrospetivo e observacional. Foram avaliados os registros ortodônticos (histórias clínicas, fotografias e radiografias de 209 pacientes na faixa etária de 4 a 15 anos de idade. A relação incisiva horizontal foi considerada normal para os pacientes do GRUPO 1, com contato entre a face incisal dos incisivos inferiores e a face palatina dos incisivos superiores. No GRUPO 2, a relação incisiva horizontal foi considerada aumentada, com distância positiva entre eles e no GRUPO 3, a relação incisiva horizontal foi considerada negativa quando as faces incisais dos incisivos superiores e inferiores se encontravam a topo ou em mordida cruzada. Os dados foram analisados através do coeficiente Pearson (p ≤ 0,001. Na análise dos dados coletados, o total de quarenta e cinco pacientes (22% apresentaram perdas prematuras. A prevalência destas perdas não apresentou diferença significativa entre sexos e foi maior no grupo de faixa etária de 7 a 9 anos de idade. Dos pacientes com perda prematura seis (13,3% foram clasificados no GRUPO 1; doze (26,7% no GRUPO 2 e vinte e sete (60% no GRUPO 3. A relação entre o número de molares perdidos e a presença de mordida cruzada anterior foi encontrada, e a média de molares perdidos (4,7 foi maior no GRUPO 3. Os resultados mostraram que as perdas precoces dos molares decíduos apresentam uma relação estatisticamente significante com a mordida cruzada anterior, sugerindo que a falta de suporte oclusal pode favorecer o desenvolvimento protrusivo da mandibula.
Performance of scientific computing platforms with MCNP4B
International Nuclear Information System (INIS)
McLaughlin, H.E.; Hendricks, J.S.
1998-01-01
Several computing platforms were evaluated with the MCNP4B Monte Carlo radiation transport code. The DEC AlphaStation 500/500 was the fastest to run MCNP4B. Compared to the HP 9000-735, the fastest platform 4 yr ago, the AlphaStation is 335% faster, the HP C180 is 133% faster, the SGI Origin 2000 is 82% faster, the Cray T94/4128 is 1% faster, the IBM RS/6000-590 is 93% as fast, the DEC 3000/600 is 81% as fast, the Sun Sparc20 is 57% as fast, the Cray YMP 8/8128 is 57% as fast, the sun Sparc5 is 33% as fast, and the Sun Sparc2 is 13% as fast. All results presented are reproducible and allow for comparison to computer platforms not included in this study. Timing studies are seen to be very problem dependent. The performance gains resulting from advances in software were also investigated. Various compilers and operating systems were seen to have a modest impact on performance, whereas hardware improvements have resulted in a factor of 4 improvement. MCNP4B also ran approximately as fast as MCNP4A
Fragrance material review on 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one.
Scognamiglio, J; Letizia, C S; Api, A M
2013-12-01
A toxicologic and dermatologic review of 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one when used as a fragrance ingredient is presented. 1-Spiro[4.5]dec-7-en-7-yl-4-pent-1-one is a member of the fragrance structural group Alkyl Cyclic Ketones. These fragrances can be described as being composed of an alkyl, R1, and various substituted and bicyclic saturated or unsaturated cyclic hydrocarbons, R2, in which one of the rings may include up to 12 carbons. Alternatively, R2 may be a carbon bridge of C2-C4 carbon chain length between the ketone and cyclic hydrocarbon. This review contains a detailed summary of all published and unpublished toxicology and dermatology papers that are related to this individual fragrance ingredient and is not intended as a stand-alone document. Available data for 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one were evaluated then summarized and includes acute toxicity, skin irritation, mucous membrane (eye) irritation, skin sensitization, phototoxicity, photoallergy, repeated dose, and genotoxicity data. A safety assessment of the entire Alkyl Cyclic Ketones will be published simultaneously with this document; please refer to Belsito et al. (2013) for an overall assessment of the safe use of this material and all Alkyl Cyclic Ketones in fragrances. Copyright © 2013 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Chen, Li; Fink, Trine; Ebbesen, Peter
2006-01-01
Chondrogenesis occurs in vivo in a hypoxic environment, in which the hypoxia inducible factor 1, HIF-1, plays a regulatory role, possibly mediated through the transcription factor DEC1. We have analyzed the effect of hypoxia (1% oxygen) alone and in combination with insulin on the chondrogenic di...
Software For Computer-Security Audits
Arndt, Kate; Lonsford, Emily
1994-01-01
Information relevant to potential breaches of security gathered efficiently. Automated Auditing Tools for VAX/VMS program includes following automated software tools performing noted tasks: Privileged ID Identification, program identifies users and their privileges to circumvent existing computer security measures; Critical File Protection, critical files not properly protected identified; Inactive ID Identification, identifications of users no longer in use found; Password Lifetime Review, maximum lifetimes of passwords of all identifications determined; and Password Length Review, minimum allowed length of passwords of all identifications determined. Written in DEC VAX DCL language.
Radiologic total lung capacity measurement. Development and evaluation of a computer-based system
Energy Technology Data Exchange (ETDEWEB)
Seeley, G.W.; Mazzeo, J.; Borgstrom, M.; Hunter, T.B.; Newell, J.D.; Bjelland, J.C.
1986-11-01
The development of a computer-based radiologic total lung capacity (TLC) measurement system designed to be used by non-physician personnel is detailed. Four operators tested the reliability and validity of the system by measuring inspiratory PA and lateral pediatric chest radiographs with a Graf spark pen interfaced to a DEC VAX 11/780 computer. First results suggest that the ultimate goal of developing an accurate and easy to use TLC measurement system for non-physician personnel is attainable.
International Nuclear Information System (INIS)
Thomas, R.A.
1983-01-01
The Mirror Fusion Test Facility (MFTF-B) control system architecture requires the Supervisory Control and Diagnostic System (SCDS) to communicate with a LSI-11 Local Control Computer (LCC) that in turn communicates via a fiber optic link to CAMAC based control hardware located near the machine. In many cases, the control hardware is very complex and requires a sizable development effort prior to being integrated into the overall MFTF-B system. One such effort was the development of the Electron Cyclotron Resonance Heating (ECRH) system. It became clear that a stand alone computer system was needed to simulate the functions of SCDS. This paper describes the hardware and software necessary to implement the SCDS Simulation Computer (SSC). It consists of a Digital Equipment Corporation (DEC) LSI-11 computer and a Winchester/Floppy disk operating under the DEC RT-11 operating system. All application software for MFTF-B is programmed in PASCAL, which allowed us to adapt procedures originally written for SCDS to the SSC. This nearly identical software interface means that software written during the equipment development will be useful to the SCDS programmers in the integration phase
The UK Human Genome Mapping Project online computing service.
Rysavy, F R; Bishop, M J; Gibbs, G P; Williams, G W
1992-04-01
This paper presents an overview of computing and networking facilities developed by the Medical Research Council to provide online computing support to the Human Genome Mapping Project (HGMP) in the UK. The facility is connected to a number of other computing facilities in various centres of genetics and molecular biology research excellence, either directly via high-speed links or through national and international wide-area networks. The paper describes the design and implementation of the current system, a 'client/server' network of Sun, IBM, DEC and Apple servers, gateways and workstations. A short outline of online computing services currently delivered by this system to the UK human genetics research community is also provided. More information about the services and their availability could be obtained by a direct approach to the UK HGMP-RC.
ORACLS- OPTIMAL REGULATOR ALGORITHMS FOR THE CONTROL OF LINEAR SYSTEMS (DEC VAX VERSION)
Frisch, H.
1994-01-01
, formulates and selects the routines to be used to solve the problem, and specifies the desired output. There are three versions of ORACLS source code available for implementation: CDC, IBM, and DEC. The CDC version has been implemented on a CDC 6000 series computer with a central memory of approximately 13K (octal) of 60 bit words. The CDC version is written in FORTRAN IV, was developed in 1978, and last updated in 1986. The IBM version has been implemented on an IBM 370 series computer with a central memory requirement of approximately 300K of 8 bit bytes. The IBM version is written in FORTRAN IV and was generated in 1981. The DEC version has been implemented on a VAX series computer operating under VMS. The VAX version is written in FORTRAN 77 and was generated in 1986.
International Nuclear Information System (INIS)
Wachter, J.W.
1986-05-01
PRO/Mapper is an application for the Digital Equipment Corporation PRO/300 series of personal computers that facilitates the preparation of visuals such as graphs, charts, and maps in color or black and white. The user prepares an input data file containing English-language commands and writes it into a file using standard editor. PRO/Mapper then reads these files and draws graphs, maps, boxes, and complex line segments onto the computer screen. Axes, curves, and error bars may be plotted in graphical presentations. The commands of PRO/Mapper are a subset of the commands of the more sophisticated MAPPER program written for mainframe computers. The PRO/Mapper commands were chosen primarily for the production of linear graphs. Command files written for the PRO/300 are upward compatible with the Martin Marietta Energy Systems version of MAPPER and can be used to produce publication-quality slides, drawings, and maps on the various output devices of the Oak Ridge National Laboratory mainframe computers
International Nuclear Information System (INIS)
Hayamizu, Kikuko; Aihara, Yuichi
2004-01-01
Two binary mixed solvent systems typically used for lithium batteries were studied by measuring the self-diffusion coefficients of the solvent, lithium ion and anion, independently by using the multi-nuclear pulsed field-gradient spin-echo (PGSE) 1 H, 7 Li and 19 F NMR method. One system was propylene carbonate (PC) and diethyl carbonate (DEC) system and the other binary system was PC and 1,2-dimethoxyethane (DME), and the lithium salt used was LiN(SO 2 CF 3 ) 2 (LiTFSI). The relative ratio of the PC was changed from zero (pure DME and DEC) to 100% (pure PC) in the DME-PC and the DEC-PC systems, respectively. The self-diffusion coefficients of the solvents were measured with and without the lithium salt, and the two solvents had almost the same diffusion coefficient in the DEC-PC system, while DME diffused faster than PC in the DME-PC system. In the electrolytes the solvents diffused the fastest, followed by the anion with the lithium ion diffusing the slowest. The degree of ion dissociation was estimated for each electrolyte by comparing the ionic conductivities estimated from the ion diffusion and those measured directly by the electrochemical method
TAE+ 5.2 - TRANSPORTABLE APPLICATIONS ENVIRONMENT PLUS, VERSION 5.2 (DEC RISC ULTRIX VERSION)
TAE SUPPORT OFFICE
1994-01-01
workstations running ULTRIX (TK50 cartridge in UNIX tar format), (3) HP9000 Series 700/800 computers running HP-UX 9.x and X11/R5 (HP 4mm DDS DAT tape cartridge in UNIX tar format), (4) Sun4 (SPARC) series computers running SunOS (.25 inch tape cartridge in UNIX tar format), and (5) SGI Indigo computers running IRIX (.25 inch IRIS tape cartridge in UNIX tar format). Please contact COSMIC to obtain detailed information about the supported operating system and OSF/Motif releases required for each of these machine versions. An optional Motif Object Code License is available for the Sun4 version of TAE Plus 5.2. Version 5.1 of TAE Plus remains available for DEC VAX computers running VMS, HP9000 Series 300/400 computers running HP-UX, and HP 9000 Series 700/800 computers running HP-UX 8.x and X11/R4. Please contact COSMIC for details on these versions of TAE Plus.
Greenberg, Caprice C; Wind, Jennifer K; Chang, George J; Chen, Ronald C; Schrag, Deborah
2013-03-01
Stakeholder input is a critical component of comparative effectiveness research. To ensure that the research activities of the Developing Evidence to Inform Decisions about Effectiveness (DEcIDE) Network, supported by the Agency for Healthcare Research and Quality, translate into the greatest impact for everyday practice and policy-making in cancer, we were tasked with soliciting stakeholder input regarding priority areas in cancer-related comparative effectiveness research for the DEcIDE Cancer Consortium. Given the increasing emphasis on stakeholder engagement in research, many investigators are facing a similar task, yet there is limited literature to guide such efforts, particularly in cancer care. To help fill this gap, we present our approach to operationalizing stakeholder engagement and discuss it in the context of other recent developments in the area. We describe challenges encountered in convening stakeholders from multiple vantage points to prioritize topics and strategies used to mitigate these barriers. We offer several recommendations regarding how to best solicit stakeholder input to inform comparative effectiveness research in cancer care. These recommendations can inform other initiatives currently facing the challenges of engaging stakeholders in priority setting for cancer.
CLIPS 6.0 - C LANGUAGE INTEGRATED PRODUCTION SYSTEM, VERSION 6.0 (DEC VAX VMS VERSION)
Donnell, B.
1994-01-01
command line version. For the UNIX version of CLIPS 6.0, the command line interface has been successfully implemented on a Sun4 running SunOS, a DECstation running DEC RISC ULTRIX, an SGI Indigo Elan running IRIX, a DEC Alpha AXP running OSF/1, and an IBM RS/6000 running AIX. Command line interface executables are included for Sun4 computers running SunOS 4.1.1 or later and for the DEC RISC ULTRIX platform. The makefiles may have to be modified slightly to be used on other UNIX platforms. The UNIX, Macintosh, and IBM PC versions of CLIPS 6.0 each have a platform specific interface. Source code, a makefile, and an executable for the Windows 3.1 interface version of CLIPS 6.0 are provided only on the IBM PC distribution diskettes. Source code, a makefile, and an executable for the Macintosh interface version of CLIPS 6.0 are provided only on the Macintosh distribution diskettes. Likewise, for the UNIX version of CLIPS 6.0, only source code and a makefile for an X-Windows interface are provided. The X-Windows interface requires MIT's X Window System, Version 11, Release 4 (X11R4), the Athena Widget Set, and the Xmu library. The source code for the Athena Widget Set is provided on the distribution medium. The X-Windows interface has been successfully implemented on a Sun4 running SunOS 4.1.2 with the MIT distribution of X11R4 (not OpenWindows), an SGI Indigo Elan running IRIX 4.0.5, and a DEC Alpha AXP running OSF/1 1.2. The VAX version of CLIPS 6.0 comes only with the generic command line interface. ASCII makefiles for the command line version of CLIPS are provided on all the distribution media for UNIX, VMS, and DOS. Four executables are provided with the IBM PC version: a windowed interface executable for Windows 3.1 built using Borland C++ v3.1, an editor for use with the windowed interface, a command line version of CLIPS for Windows 3.1, and a 386 command line executable for DOS built using Zortech C++ v3.1. All four executables are capable of utilizing extended memory
Monte Carlo simulations on SIMD computer architectures
International Nuclear Information System (INIS)
Burmester, C.P.; Gronsky, R.; Wille, L.T.
1992-01-01
In this paper algorithmic considerations regarding the implementation of various materials science applications of the Monte Carlo technique to single instruction multiple data (SIMD) computer architectures are presented. In particular, implementation of the Ising model with nearest, next nearest, and long range screened Coulomb interactions on the SIMD architecture MasPar MP-1 (DEC mpp-12000) series of massively parallel computers is demonstrated. Methods of code development which optimize processor array use and minimize inter-processor communication are presented including lattice partitioning and the use of processor array spanning tree structures for data reduction. Both geometric and algorithmic parallel approaches are utilized. Benchmarks in terms of Monte Carl updates per second for the MasPar architecture are presented and compared to values reported in the literature from comparable studies on other architectures
Computational strategies for three-dimensional flow simulations on distributed computer systems
Sankar, Lakshmi N.; Weed, Richard A.
1995-08-01
This research effort is directed towards an examination of issues involved in porting large computational fluid dynamics codes in use within the industry to a distributed computing environment. This effort addresses strategies for implementing the distributed computing in a device independent fashion and load balancing. A flow solver called TEAM presently in use at Lockheed Aeronautical Systems Company was acquired to start this effort. The following tasks were completed: (1) The TEAM code was ported to a number of distributed computing platforms including a cluster of HP workstations located in the School of Aerospace Engineering at Georgia Tech; a cluster of DEC Alpha Workstations in the Graphics visualization lab located at Georgia Tech; a cluster of SGI workstations located at NASA Ames Research Center; and an IBM SP-2 system located at NASA ARC. (2) A number of communication strategies were implemented. Specifically, the manager-worker strategy and the worker-worker strategy were tested. (3) A variety of load balancing strategies were investigated. Specifically, the static load balancing, task queue balancing and the Crutchfield algorithm were coded and evaluated. (4) The classical explicit Runge-Kutta scheme in the TEAM solver was replaced with an LU implicit scheme. And (5) the implicit TEAM-PVM solver was extensively validated through studies of unsteady transonic flow over an F-5 wing, undergoing combined bending and torsional motion. These investigations are documented in extensive detail in the dissertation, 'Computational Strategies for Three-Dimensional Flow Simulations on Distributed Computing Systems', enclosed as an appendix.
Computational strategies for three-dimensional flow simulations on distributed computer systems
Sankar, Lakshmi N.; Weed, Richard A.
1995-01-01
This research effort is directed towards an examination of issues involved in porting large computational fluid dynamics codes in use within the industry to a distributed computing environment. This effort addresses strategies for implementing the distributed computing in a device independent fashion and load balancing. A flow solver called TEAM presently in use at Lockheed Aeronautical Systems Company was acquired to start this effort. The following tasks were completed: (1) The TEAM code was ported to a number of distributed computing platforms including a cluster of HP workstations located in the School of Aerospace Engineering at Georgia Tech; a cluster of DEC Alpha Workstations in the Graphics visualization lab located at Georgia Tech; a cluster of SGI workstations located at NASA Ames Research Center; and an IBM SP-2 system located at NASA ARC. (2) A number of communication strategies were implemented. Specifically, the manager-worker strategy and the worker-worker strategy were tested. (3) A variety of load balancing strategies were investigated. Specifically, the static load balancing, task queue balancing and the Crutchfield algorithm were coded and evaluated. (4) The classical explicit Runge-Kutta scheme in the TEAM solver was replaced with an LU implicit scheme. And (5) the implicit TEAM-PVM solver was extensively validated through studies of unsteady transonic flow over an F-5 wing, undergoing combined bending and torsional motion. These investigations are documented in extensive detail in the dissertation, 'Computational Strategies for Three-Dimensional Flow Simulations on Distributed Computing Systems', enclosed as an appendix.
Improved materials management through client/server computing
International Nuclear Information System (INIS)
Brooks, D.; Neilsen, E.; Reagan, R.; Simmons, D.
1992-01-01
This paper reports that materials management and procurement impacts every organization within an electric utility from power generation to customer service. An efficient material management and procurement system can help improve productivity and minimize operating costs. It is no longer sufficient to simply automate materials management using inventory control systems. Smart companies are building centralized data warehouses and use the client/server style of computing to provide real time data access. This paper describes how Alabama Power Company, Southern Company Services and Digital Equipment Corporation transformed two existing applications, a purchase order application within DEC's ALL-IN-1 environment and a materials management application within an IBM CICS environment, into a data warehouse - client/server application. An application server is used to overcome incompatibilities between computing environments and provide easy, real-time access to information residing in multi-vendor environments
Crustáceos decápodos de la cuenca del Río Sinú, Córdoba, Colombia
Directory of Open Access Journals (Sweden)
Jorge Alexander Quirós Rodríguez
2016-09-01
Full Text Available Para evaluar la composición, abundancia y distribución de los crustáceos decápodos en la cuenca del río Sinú, departamento de Córdoba (Colombia, se estudiaron ocho localidades: cuatro en el río Sinú y cuatro en el complejo cenagoso del bajo Sinú. Para ello, se realizaron seis muestreos entre abril de 2005 y mayo de 2006. En total se registraron 458 crustáceos decápodos distribuidos en tres familias, seis géneros y ocho especies. La familia mejor representada fue Trichodactylidae con cuatro géneros y cuatro especies, seguida de Palaemonidae con un género y tres especies, mientras que de la familia Atyidae solo registró una especie. Especies como Macrobrachium carcinus y M. acanthurus, presentaron el rango más amplio de distribución, siendo características tanto para el rio Sinú como para el CCBS. Entre las especies identificadas, Atya crassa en el río Sinú y Trichodactylus quinquedentatus en el CCBS son nuevos registros para el departamento de Córdoba.
Noor, Ahmed K. (Editor)
1986-01-01
The papers contained in this volume provide an overview of the advances made in a number of aspects of computational mechanics, identify some of the anticipated industry needs in this area, discuss the opportunities provided by new hardware and parallel algorithms, and outline some of the current government programs in computational mechanics. Papers are included on advances and trends in parallel algorithms, supercomputers for engineering analysis, material modeling in nonlinear finite-element analysis, the Navier-Stokes computer, and future finite-element software systems.
Analysis of plutonium gamma-ray spectra by small portable computers
International Nuclear Information System (INIS)
Ruhter, W.; Gunnink, R.; Camp, D.; DeCarolis, M.
1985-01-01
A sophisticated program for isotopic analysis of plutonium gamma-ray spectra using small computers has been developed. It is implemented on a DEC LSI-11/2 configured in a portable unit without a mass storage device for use by IAEA inspectors in the field. Only the positions of the 148-keV 241 Pu and 208-keV 237 U peaks are needed as input. Analysis is completed in 90 seconds by fitting isotopic component response functions to peak multiplets. 9 refs., 2 figs., 1 tab
International Nuclear Information System (INIS)
Soroa, Victoria E.; Ozker, K.
1999-01-01
Preliminary tests have been carried out to validate the use of DEC -Tc 99m labelled leukocytes as a more stable substitute for Tc 99m-HMPAO in the diagnosis of infectious and inflammatory diseases. Although in all the patients the infectious focuses have been detected and the results are promissory, further studies with different infections /inflammations are needed to validate the procedure as an alternative routine technique
International Nuclear Information System (INIS)
Sarantites, D.G.
1982-01-01
The scope of this proposal is to assemble an interactive off-line data analysis system based on a DEC VAX 11/780 computer interfaced with an array processor, which is capable of meeting the needs of modern heavy-ion physics experiments involving data of large dimensionality as created in the Spin Spectrometer at the Holifield Heavy-ion Research Facility, to adapt the existing PDP 11 software for the Spin Spectrometer for this computer system in a form completely compatible with other laboratories with VAX 11 computers, and to develop new general and efficient software for automatic but fully interactive data analysis making use of an attach array processor
A versatile computer based system for data acquisition manipulation and presentation
International Nuclear Information System (INIS)
Bardsley, D.J.
1985-12-01
A data acquisition system based on the Microdata M 1600L data logger and a Digital Equipment Corporation (DEC) VT103 computer system has been set up for use in a wide range of research and development projects in the field of fission detectors and associated technology. The philosophy underlying the system and its important features are described. Operating instructions for the logger are given, and its application to experimental measurements is considered. Observations on whole system performance, and recommendations for improvements are made. (U.K.)
DANZA EXPERIMENTAL CONTEMPORANEA. Creación de Mutanza D.E.C.
Directory of Open Access Journals (Sweden)
Claudia Mallarino Flores
2015-06-01
Full Text Available El propósito general de nuestro discurso dancístico es diseñar espacios de comunicación con el contexto; de interlocución con el "otro"; de interpretación del fenómeno vital y de construcción de procesos pedagógico-didácticos para acceder al conocimiento desde la experiencia directa de la interacción corporal con el entorno. Mutanza DEC nace en 1997, por iniciativa personal y de alumnos y egresados de la Facultad de Educación Física: de la UPN, así como de algunos enamorados de la Danza, ajenos a la Facultad, pero cercanos a nuestros intereses. El propósito fundamental de este grupo de personas, en su doble condición de futuros bailarines y maestros, es trabajar el lenguaje de la Danza, como una posibilidad de identificación de la propia dimensión corporal.
DECS tries out instructional materials on AIDS prevention education.
1994-01-01
A national try-out of the newly developed print and non-print instructional materials on AIDS Education is being conducted by the Department of Education, Culture and Sports (DECS) this school year 1993-to 1994. To determine the effectiveness of these materials, various public and private schools in Region IV (Southern Tagalog), VII (Central Visayas) XI (Southern Mindanao) and National Capital Region (Metro, Manila) were chosen as try-out institutions. The AIDS education materials will be tried out in different subjects in some grade and year levels such as civics and culture (grade one); science and health (grades three and six); home economics and livelihood education (grade five); physical education, health and music (second year) and Pilipino Language (third year). The materials for the elementary level consist of posters, cut-out pictures, voice tapes, jingles, talking books and slides, while the secondary school level utilizes modules. For the tertiary level, a Resource Book on AIDS Prevention Education is used by the Teacher Training Institutions and the Non-Formal Education employs the Facilitator's Guide for Levels I-III. These materials will be tried out in both urban and rural schools, with control school and experimental school at each level. full text
Directory of Open Access Journals (Sweden)
Alessandro Leite Cavalcanti
2008-07-01
Full Text Available Este estudo retrospectivo determinou a prevalência da perda precoce demolares decíduos em pacientes atendidos na clínica de Odontopediatria da Universidade Estadual da Paraíba. Foram examinados 515 prontuários, sendo os dados registrados em um formulário. Foram analisadas as variáveis: gênero, idade, tipo de molar decíduo perdido,arcada dentária (maxilar ou mandibular e lado (direito e esquerdo. Observou-se que a prevalência de perda precoce foi de 15,1%, existindo uma distribuição similar entre os gêneros. Em relação à idade da criança, a maior freqüência de perda acometeu pacientescom sete anos (32,1%. Houve distribuição equitativa da perda dentária entre as arcadas superior e inferior, com 43,6% cada uma, sendo o lado esquerdo o mais acometido (41%. O segundo molar superior esquerdo foi o mais acometido (17,9%, seguido do primeiromolar decíduo superior direito (16,1%. Pode-se concluir que a prevalência de perda precoce foi baixa e que os molares decíduos superiores foram os dentes mais comumente perdidos.This retrospective study determined the prevalence of early loss of deciduous molars in patients enrolled at the Pediatric Dentistry clinic at the State University of Paraíba. A review of 515 patient records were analyzed, registered in a form. The following variables were analyzed: gender, age, type of deciduous molar loss, region (maxilla or mandible and side (right and left. It was observed that the prevalence of early tooth loss was 15.1% and there was a similar distribution between the genders. In regard to age, the greatest frequency of tooth loss involved patients at 7 years old (32.1%. There was a similar distribution of tooth loss between the maxilla and mandible regions, at 43.6% each, with the left side being themost involved (41%. The second upper left deciduous molar was the most commonly missing tooth (17.9%, followed by the first upper right deciduous molar (16.1%. It can be concluded that the
Printing in heterogeneous computer environment at DESY
International Nuclear Information System (INIS)
Jakubowski, Z.
1996-01-01
The number of registered hosts DESY reaches 3500 while the number of print queues approaches 150. The spectrum of used computing environment is very wide: from MAC's and PC's, through SUN, DEC and SGI machines to the IBM mainframe. In 1994 we used 18 tons of paper. We present a solution for providing print services in such an environment for more than 3500 registered users. The availability of the print service is a serious issue. Using centralized printing has a lot of advantages for software administration but creates single point of failure. We solved this problem partially without using expensive software and hardware. The talk provides information about the DESY central central print spooler concept. None of the systems available on the market provides ready to use reliable solution for all platforms used for DESY. We discuss concepts for installation, administration and monitoring large number of printers. We found a solution for printing both on central computing facilities likewise for support of stand-alone workstations. (author)
Interactive computer programs for applied nutrition education.
Wise, A
1985-12-01
DIET2 and DIET3 are programs written for a Dec2050 computer and intended for teaching applied nutrition to students of nutrition, dietetics, home economics, and hotel and institutional administration. DIET2 combines all the facilities of the separate dietary programs already available at Robert Gordon's Institute of Technology into a single package, and extends these to give students a large amount of relevant information about the nutritional balance of foods (including DHSS and NACNE recommendations) prior to choosing them for meals. Students are also helped by the inclusion of typical portion weights. They are presented with an analysis of nutrients and their balance in the menu created, with an easy mechanism for ammendation of the menu and addition of foods which provide the nutrients that are lacking. At any stage the computer can give the proportion of total nutrient provided by each meal. DIET3 is a relatively simple program that displays the nutritional profile of foods and diets semigraphically.
Energy Technology Data Exchange (ETDEWEB)
Franzke, U.; Stangl, M.
2000-02-15
The energy consumption of buildings caused by air conditioning is high. The main reason is the using of refrigeration machines for dehumidification under the dew point. A reduction of the energy consumption is possible in case of using of desiccant dehumidification. A desiccant cooling air handling unit realizes the dehumidification by desiccants. Further more a heat recovery wheel and a humidifier are necessary. In the framework of the project the desiccant wheel and a high-pressure humidifier are investigated. A refrigeration machine was installed only for theoretical investigations. The investigation was done in the theoretical and experimental way. A new simulation model was developed. The measurement values are used for the verification of the mathematical simulation. In the framework of the project the performance characteristics of the desiccant wheel and the humidifier are optimized. As a result the regeneration temperature is now lower than at the beginning of the work. The humidifier capacity is in the same range at lower fresh water consumption. The components of the desiccant cooling air-handling unit were optimized according their performance characteristic. For the company Klingenburg the market chances will increase in case of more applications. (orig.) [German] Die Klimatisierung von Gebaeuden ist in aller Regel mit einem grossen Energieaufwand verbunden. Hauptursache dafuer ist die Verwendung der Entfeuchtung durch Taupunktunterschreitung unter Nutzung von Kaeltemaschinen. Eine Verringerung des Energieaufwandes ist nur durch Einsatz der sorptiven Luftentfeuchtung moeglich. Eine DEC-Klimaanlage realisiert die Luftentfeuchtung mit Hilfe der Sorption. Sie setzt sich aus verschiedenen Komponenten zusammen. Im Rahmen des Forschungsvorhabens wurden besonders der Sorptionsregenerator und der Kaltdampfgenerator sowohl experimentell als auch theoretisch untersucht und optimiert. Als ergaenzende Systemkomponente kommt die Kaeltemaschine hinzu, die jedoch
Silicon tunnel FET with average subthreshold slope of 55 mV/dec at low drain currents
Narimani, K.; Glass, S.; Bernardy, P.; von den Driesch, N.; Zhao, Q. T.; Mantl, S.
2018-05-01
In this paper we present a silicon tunnel FET based on line-tunneling to achieve better subthreshold performance. The fabricated device shows an on-current of Ion = 2.55 × 10-7 A/μm at Vds = Von = Vgs - Voff = -0.5 V for an Ioff = 1 nA/μm and an average SS of 55 mV/dec over two orders of magnitude of Id. Furthermore, the analog figures of merit have been calculated and show that the transconductance efficiency gm/Id beats the MOSFET performance at low currents.
Three assembly programs for the PDP-8E computer
International Nuclear Information System (INIS)
McIlvaine, M.S.; Navarro, E.F.
1976-04-01
In the Atomic Research Center, efforts have been directed towards the utilization of the PDP-8E in the control of various operations, in the storage and retrieval of data and in the on-line and off-line analyses of experimental data. The purpose of this paper is to present three short programs in machine language, two of which were developed specifically to control the operation of the Cal Comp Plotter 565 (Cal Camp Plot data Program) and the TU10 DEC-magtape unit (TM8E Program with Options). The third program, the Maximum Liklihood Activity Profile, was utilized in the mathematical computation of a statistical study
Shimokawa, Takuya; Shoda, Makoto; Sugano, Yasushi
2009-02-01
DyP isozymes (DyP2 and DyP3) from the culture fluid of the fungus Thanatephorus cucumeris Dec 1 by air-membrane surface bioreactor were purified and characterized. The characteristics of DyP2 were almost the same as those of a recombinant DyP reported previously, but different from DyP3.
DATA TRANSFER FROM A DEC PDP-11 BASED MASS-SPECTROMETRY DATA STATION TO AN MS-DOS PERSONAL-COMPUTER
RAFFAELLI, A; BRUINS, AP
This paper describes a simple procedure for obtaining better quality graphic output for mass spectrometry data from data systems equipped with poor quality printing devices. The procedure uses KERMIT, a low cost public domain software, to transfer ASCII tables to a MS-DOS personal computer where
Configuración e Implementación de una Infraestructura cloud computing privada
Segarra Cabedo, Pedro
2014-01-01
Treball final de Grau en Enginyeria Informàtica. Codi: EI1054. Curs acadèmic 2013-2014 Cloud computing (computación en la nube) es un paradigma de computación que permite ofrecer recursos de computación a través de la red. Estos recursos se ofrecen bajo demanda y pueden ser suministrados con una mínima interacción y gestión por parte del proveedor del servicio. La computación en la nube posee algunas características esenciales, destacando la elasticidad, es dec...
Computed tomography of laryngeal carcinoma correlated with histopathological findings
Energy Technology Data Exchange (ETDEWEB)
Cai, Yi-Long
1988-09-01
Since the development of conservation laryngeal surgery and the advent of computed tomography (CT) scanners, a precise preoperative evaluation of the extent of laryngeal cancer has been of prime importance. Eight patients with known carcinoma of the larynx were examined with CT of the larynx prior to surgery, and whole-mount serial sections of the extirpated larynx were compared with the corresponding level of CT sections to evaluate the reliability of CT during my study abroad in Japan from Dec. 1985 through Dec. 1986. 1. The results indicated that CT scanning accurately delineates the anatomic location and pathologic extent of the tumor three-dimensionally in all cases examined. There is also good demonstration of the anterior commissure and preepiglottic, paraglottic and subglottic spaces which are sometimes poorly seen by laryngoscopy or by any other means. 2. Determination of invasion of the laryngeal cartilage by tumor proved to be very difficult to diagnose with CT. 3. The CT images obtained while the patient is breathing quietly, coupled with additional sections at the level of the vocal cord during slight valsalva maneuver afford good visualization of laryngeal tumors. 4. It should be emphasized that a thorough pathologic examination of extirpated specimens with serial sections is essential for laryngeal surgeons, because it is impossible to determine the patient's prognosis without microscopic demonstration of the degree of invasion.
African Journals Online (AJOL)
department of the University of Ilorin Teaching Hospital, Ilorin, Nigeria . Case ... vision with headlights. ... information was entered into computer and analyzed ... The highest incidence of nasal FBs was in the age ... unit of medical science.
Directory of Open Access Journals (Sweden)
Daniel Ferreira da Cunha
2000-06-01
Full Text Available Pressure sores are common among bedridden, elderly, or malnourished patients, and may occur in terminal ill patients because of impaired mobility, fecal or urinary incontinence, and decreased healing capacity. The aim of this study was to compare frequency of pressure sores between malnourished and non-malnourished necropsied adults. METHOD: All (n = 201 adults (age ³ 18 years autopsied between 1986 and 1996 at the Teaching Hospital of Triangulo Mineiro Medical School (Uberaba were eligible for the study. Gender, race, weight, height and main diagnoses were recorded. Ninety-six cases were excluded because of probable body water retention (congestive heart failure, hepatic insufficiency, nephrotic syndrome or pressure sores secondary to peripheral vascular ischemia. Body mass index (BMI was used to define malnourished (BMI 18.5kg/m² groups. RESULTS: Except for weight (42.5kg; range: 28-57 vs. 60; 36-134.5kg and BMI (16.9; range: 12.4-18.5 vs. 22.7; range: 18.5-54.6kg/m², respectively, there were no statistical differences among 43 malnourished and 62 non-malnourished cases in relation to age (54.9 ± 20.4 vs. 52.9 ± 17.9 years, percentage of white persons (74.4 vs. 64.5%, male gender (76.7 vs. 69.3% and main diagnoses. Five malnourished (11.6% and 7 (11.5% non-malnourished cases had pressure sores (p=0.89. CONCLUSION: Pressure sores were equally common findings in necropsied persons with protein-energy malnutrition, as assessed by body mass index.Escaras de decúbito são comuns em pacientes acamados, idosos e subnutridos e podem ocorrer em pacientes terminais devido à imobilidade, incontinência fecal e urinária e imunodepressão. Além disso, a contaminação das Escaras de decúbito aumentam o risco de sepsis e podem piorar o estado nutricional. O objetivo deste estudo foi comparar a freqüência de Escaras de decúbito entre adultos necropsiados com ou sem subnutrição. MÉTODO: Adultos (n=201 necropsiados no Hospital Escola da FMTM
Application of computers in a radiological survey program
International Nuclear Information System (INIS)
Berven, B.A.; Blair, M.S.; Doane, R.W.; Little, C.A.; Perdue, P.T.
1984-01-01
Computers have become increasingly important in data analysis and data management as well as assisting in report preparation in the Oak Ridge National Laboratory (ORNL) Radiological Survey Activities (RASA) Program. The primary function of the RASA program is to collect, analyze, report, and manage data collected to characterize the radiological condition of potentially contaminated sites identified in the Department of Energy's (DOE) remedial action programs. Three different computer systems are routinely utilized in ORNL/RASA operations. Two of these systems are employed in specific functions. A Nuclear Data (ND) 682 is used to perform isotopic analysis of gamma spectroscopic data generated by high-purity germanium detectors for air, water and soil samples. The ND682 employs a 16,000-channel analyzer that is routinely used with four germanium spectrometers. Word processing and data management are accomplished using the INtext system implemented on a DEC PDP-11 computer. A group of personal computers are used to perform a diverse number of functions. These computer systems are Commodore Business Machines (CBM) Model 8032 with a dual floppy disk storage medium and line printers (with optional X-Y plotters). The CBM's are utilized for: (1) data analysis -- raw data from radiation detection instrumentation are stored and manipulated with customized computer programs; (2) data reduction -- raw data are converted into report-ready tables using customized programs; (3) data management -- radionuclide data on each air, water and soil sample are stored on diskettes along with location of archived samples; and (4) program management -- site surveys and report status are tracked by computer files as well as program budget information to provide contemporary information of program status
Improving Reliability in a Stochastic Communication Network
1990-12-01
and GINO. In addition, the following computers were used: a Sun 386i workstation, a Digital Equipment Corporation (DEC) 11/785 miniframe , and a DEC...operating system. The DEC 11/785 miniframe used in the experiment was running Unix Version 4.3 (Berkley System Domain). Maxflo was run on the DEC 11/785...the file was still called Mod- ifyl.for). 4. The Maxflo program was started on the DEC 11/785 miniframe . 5. At this time the Convert.max file, created
Gupta, K. K.
1997-01-01
A multidisciplinary, finite element-based, highly graphics-oriented, linear and nonlinear analysis capability that includes such disciplines as structures, heat transfer, linear aerodynamics, computational fluid dynamics, and controls engineering has been achieved by integrating several new modules in the original STARS (STructural Analysis RoutineS) computer program. Each individual analysis module is general-purpose in nature and is effectively integrated to yield aeroelastic and aeroservoelastic solutions of complex engineering problems. Examples of advanced NASA Dryden Flight Research Center projects analyzed by the code in recent years include the X-29A, F-18 High Alpha Research Vehicle/Thrust Vectoring Control System, B-52/Pegasus Generic Hypersonics, National AeroSpace Plane (NASP), SR-71/Hypersonic Launch Vehicle, and High Speed Civil Transport (HSCT) projects. Extensive graphics capabilities exist for convenient model development and postprocessing of analysis results. The program is written in modular form in standard FORTRAN language to run on a variety of computers, such as the IBM RISC/6000, SGI, DEC, Cray, and personal computer; associated graphics codes use OpenGL and IBM/graPHIGS language for color depiction. This program is available from COSMIC, the NASA agency for distribution of computer programs.
Directory of Open Access Journals (Sweden)
Marilyn K Nations
2008-04-01
Full Text Available This anthropological study critically evaluates Brazilian caregivers' symbolic production and significance of their malnourished offspring's primary teeth, as well as their own, and describes popular dental practices. From January to June 2004, ethnographic interviews of 27 poor, low-literacy mothers were conducted at a public Malnutrition Treatment Center in Fortaleza, Ceará State. Participant observation of clinical pathways and home environments supplemented the data. Content analysis was performed. Results confirm that primary teeth are imbued with cultural significance in Northeast Brazil. Mothers examine mouths, perceive signs of decay, associate primary with permanent tooth healthiness, identify ethnodental illnesses, seek assistance, and perform rituals with exfoliated teeth. The mother's motivation to care for primary teeth is sparked by her memories of past toothache and attempts to avoid stigma and discrimination. Social determinants, not mothers' beliefs or behaviors, are the most critical obstacles to effective dental care. Legitimizing lay knowledge and empowering caregivers and children can improve oral health in Northeast Brazil.Este estudo antropológico analisa a produção simbólica de cuidadoras brasileiras sobre a sua dentição e a de seus filhos desnutridos, descrevendo práticas populares de cuidados em saúde bucal. De janeiro a junho de 2004, foram conduzidas entrevistas etnográficas com 27 cuidadoras, numa instituição pública, no tratamento de desnutrição em Fortaleza, Ceará. A observação participante da dinâmica de atendimento e do ambiente domiciliar suplementaram os dados. Foi utilizada a análise temática. Os resultados confirmam que os dentes decíduos são imbuídos de significados culturais no nordeste brasileiro. As mães examinam as bocas dos filhos, percebem sinais de cárie, associam dentes decíduos saudáveis com permanentes hígidos, identificam enfermidades etnodentárias, procuram assist
Aplicación de un protocolo en cicatrización de ulceras por decúbito
Directory of Open Access Journals (Sweden)
Porras Janeth
1993-04-01
Full Text Available
Las úlceras por decúbito han constituido un problema de enfermería que ha transcendido a lo largo de la historia. Para su solución se han aplicado diversos y variados tratamientos que han evolucionado desde la utilización de medidas caseras, hasta sofisticados materiales, productos y protocolos cuidadosamente investigados en Canadá, Estados Unidos, Inglaterra y otros. En Colombia, la experiencia en el manejo de estos, ha sido el uso indiscriminado y poco sistematizado a medida que van invadiendo el mercado. Existen múltiples factores concurrentes y predisponentes en la formación de las úlceras los cuales han persistido a pesar de las reiteradas alternativas de solución, mediante la aplicación de protocolos de atención que no han logrado su comprobación en el campo clínico.
A hybrid metaheuristic DE/CS algorithm for UCAV three-dimension path planning.
Wang, Gaige; Guo, Lihong; Duan, Hong; Wang, Heqi; Liu, Luo; Shao, Mingzhen
2012-01-01
Three-dimension path planning for uninhabited combat air vehicle (UCAV) is a complicated high-dimension optimization problem, which primarily centralizes on optimizing the flight route considering the different kinds of constrains under complicated battle field environments. A new hybrid metaheuristic differential evolution (DE) and cuckoo search (CS) algorithm is proposed to solve the UCAV three-dimension path planning problem. DE is applied to optimize the process of selecting cuckoos of the improved CS model during the process of cuckoo updating in nest. The cuckoos can act as an agent in searching the optimal UCAV path. And then, the UCAV can find the safe path by connecting the chosen nodes of the coordinates while avoiding the threat areas and costing minimum fuel. This new approach can accelerate the global convergence speed while preserving the strong robustness of the basic CS. The realization procedure for this hybrid metaheuristic approach DE/CS is also presented. In order to make the optimized UCAV path more feasible, the B-Spline curve is adopted for smoothing the path. To prove the performance of this proposed hybrid metaheuristic method, it is compared with basic CS algorithm. The experiment shows that the proposed approach is more effective and feasible in UCAV three-dimension path planning than the basic CS model.
Can We Build a Truly High Performance Computer Which is Flexible and Transparent?
Rojas, Jhonathan Prieto
2013-09-10
State-of-the art computers need high performance transistors, which consume ultra-low power resulting in longer battery lifetime. Billions of transistors are integrated neatly using matured silicon fabrication process to maintain the performance per cost advantage. In that context, low-cost mono-crystalline bulk silicon (100) based high performance transistors are considered as the heart of today\\'s computers. One limitation is silicon\\'s rigidity and brittleness. Here we show a generic batch process to convert high performance silicon electronics into flexible and semi-transparent one while retaining its performance, process compatibility, integration density and cost. We demonstrate high-k/metal gate stack based p-type metal oxide semiconductor field effect transistors on 4 inch silicon fabric released from bulk silicon (100) wafers with sub-threshold swing of 80 mV dec(-1) and on/off ratio of near 10(4) within 10% device uniformity with a minimum bending radius of 5 mm and an average transmittance of similar to 7% in the visible spectrum.
SPAM- SPECTRAL ANALYSIS MANAGER (DEC VAX/VMS VERSION)
Solomon, J. E.
1994-01-01
machine environments. There is a DEC VAX/VMS version with a central memory requirement of approximately 242K of 8 bit bytes and a machine independent UNIX 4.2 version. The display device currently supported is the Raster Technologies display processor. Other 512 x 512 resolution color display devices, such as De Anza, may be added with minor code modifications. This program was developed in 1986.
Long-lasting solar energetic electron injection during the 26 Dec 2013 widespread SEP event
Dresing, N.; Klassen, A.; Temmer, M.; Gomez-Herrero, R.; Heber, B.; Veronig, A.
2017-12-01
The solar energetic particle (SEP) event on 26 Dec 2013 was detected all around the Sun by the two STEREO spacecraft and close-to-Earth observers. While the two STEREOs were separated by 59 degrees and situated at the front side of the associated large coronal event, it was a backside-event for Earth. Nevertheless, significant and long-lasting solar energetic electron anisotropies together with long rise times were observed at all three viewpoints, pointing to an extended electron injection. Although the CME-driven shock appears to account for the SEP event at a first glance a more detailed view reveals a more complex scenario: A CME-CME interaction takes place during the very early phase of the SEP event. Furthermore, four hours after the onset of the event, a second component is measured at all three viewpoints on top of the first SEP increase, mainly consisting of high energy particles. We find that the CME-driven shock alone can hardly account for the observed SEP event in total but a trapping scenario together with ongoing particle acceleration is more likely.
International Nuclear Information System (INIS)
Stempniewicz, M.; Marks, P.; Salwa, K.
1992-06-01
TASAC (Thermal Analysis of Severe Accident Conditions) is computer code developed in the Institute of Atomic Energy written in FORTRAN 77 for the digital computer analysis of PWR rod bundle behaviour during severe accident conditions. The code has the ability to model an early stage of core degradation including heat transfer inside the rods, convective and radiative heat exchange as well as cladding interactions with coolant and fuel, hydrogen generation, melting, relocations and refreezing of fuel rod materials with dissolution of UO 2 and ZrO 2 in liquid phase. The code was applied for the simulation of International Standard Problem number 28, performed on PHEBUS test facility. This report contains the program physical models description, detailed description of input data requirements and results of code verification. The main directions for future TASAC code development are formulated. (author). 20 refs, 39 figs, 4 tabs
Composição florística da floresta estacional decídua montana de Serra das Almas, CE, Brasil
Lima,Jacira Rabelo; Sampaio,Everardo Valadares de Sá Barretto; Rodal,Maria Jesus Nogueira; Araújo,Francisca Soares
2009-01-01
No domínio semi-árido brasileiro, a flora das bacias sedimentares ainda é pouco conhecida, mas os levantamentos já existentes indicam que há grande heterogeneidade florística e fisionômica. Mesmo áreas geográficas próximas podem apresentar dissimilaridade florística. Visando testar esta hipótese, a composição florística e o espectro biológico da floresta estacional decídua de Serra das Almas, estado do Ceará, foram analisados e comparados com os de 14 áreas sedimentares no Nordeste. Foram enc...
The dynamic analysis facility at the Chalk River Nuclear Laboratories
International Nuclear Information System (INIS)
Argue, D.S.; Howatt, W.T.
1979-10-01
The Dynamic Analysis Facility at the Chalk River Nuclear Laboratories (CRNL) of Atomic Energy of Canada Limited (AECL) comprises a Hybrid Computer, consisting of two Applied Dynamic International AD/FIVE analog computers and a Digital Equipment Corporation (DEC) PDP-11/55 digital computer, and a Program Development System based on a DEC PDP-11/45 digital computer. This report describes the functions of the various hardware components of the Dynamic Analysis Facility and the interactions between them. A brief description of the software available to the user is also given. (auth)
Multidimensional Signal Processing for Sensing & Communications
2015-07-29
Spectrum Sensing,” submitted to IEEE Intl. Workshop on Computational Advances in Multi-Sensor Adaptive Processing, Cancun, Mexico , 13-16 Dec. 2015...Sensing,” submitted to IEEE Intl. Workshop on Computational Advances in Multi-Sensor Adaptive Processing, Cancun, Mexico , 13-16 Dec. 2015...diversity in echolocating mammals ,” IEEE Signal Processing Magazine, vol. 26, no. 1, pp. 65- 75, Jan. 2009. DISTRIBUTION A: Distribution approved for
Synthesis and Molecular Structures of (E-non-2-enoic Acid and (E-dec-2-enoic Acid
Directory of Open Access Journals (Sweden)
Marcel Sonneck
2015-10-01
Full Text Available The molecular structures of (E-non-2-enoic acid (C9 and (E-dec-2-enoic acid (C10 are reported. The title compounds were crystallized by slow evaporation of ethanolic solutions at −30 °C. C9 crystallizes in the monoclinic space group P21/c and C10 in the triclinic space group P-1, each with 4 molecules in the unit cell. The unit cell parameters for C9 are: a = 10.6473(4 Å, b = 5.2855(2 Å, c = 17.0313(7 Å; β = 106.0985(10° and V = 920.87(6 Å3. The unit cell parameters for C10 are: a = 4.1405(2 Å, b = 15.2839(6 Å, c = 17.7089(7 Å; α = 68.3291(11°, β = 83.3850(13°, γ = 85.0779(12° and V = 1033.39(8 Å3.
Directory of Open Access Journals (Sweden)
N. K. Oekar
2017-11-01
Full Text Available Lymphatic filariasis or more commonly known as elephantiasis disease has infected more than 120 million people in 80 countries; and more than 40 million of them are unable to work, in addition to disruption of aesthetic values. The problem faced by almost all people in combating this infectious disease is delayed diagnosis. The sufferers do not realize that they have been infected with this disease. A specific and accurate method of early detection is therefore needed. 99mTc-labeled Diethylcarbamazine-citrate (99mTc-DEC has been successfully prepared. However, as part of the discovery and development of new drugs, the fulfillment of pharmaceutical and safety requirements have to be evaluated. Physico-chemical aspects such as stability, purity levels, and other pharmaceutical requirements, as well as pharmacokinetic studies and route of administration, are important parameters to be studied. The stability test showed that after seven months of storage, a preparation in a dry kit retains an efficiency of labeling and a purity level of more than 90 % and its physico-chemical and biological characteristics remained steady. Biodistribution test in Wistar rat showed that the greatest accumulation occurred in the lymphatic system, especially in the popliteal glands and in lumbar and mesenteric lymph nodes. Imaging with a gamma camera after intradermal and intravenous injections to the experimental animals resulted in a positive image that showed 99mTc-DEC accumulation in the target organ. The results of this innovation are expected to contribute significantly to improving public health, particulary in early detection of filarial infections. In addition, this result is expected to be a concrete contribution to the program of "The Global Goal of Elimination of Lymphatic Filariasis as a Public Health Problem by the Year 2020”.
International Nuclear Information System (INIS)
Spimpolo, G.F.
1984-01-01
Two computer programmes have been written for use on a fully automated Siemens SRS200 sequential X-ray-fluorescence spectrometer. The first of these is used to control the spectrometer via an LC200 logic controller using a Data General Nova IV minicomputer; the second is used for the on-line evaluation of the intensity results and the printout of the analytical results. This system is an alternative to the systems offered by Siemens Ltd, which consist of a Process PR310 or Digital DEC PDP1103 computer and the Siemens Spectra 310 software package. The multibatch capabilities of the programmes, with the option of measuring one sample or a tray of samples before the results are calculated, give the new programmes a major advantage over the dedicated software and, together with the elimination of human error in calculation, have resulted in increased efficiency and quality in routine analyses. A description is given of the two programmes, as well as instruction and guidelines to the user
Energy Technology Data Exchange (ETDEWEB)
Stempniewicz, M; Marks, P; Salwa, K
1992-06-01
TASAC (Thermal Analysis of Severe Accident Conditions) is computer code developed in the Institute of Atomic Energy written in FORTRAN 77 for the digital computer analysis of PWR rod bundle behaviour during severe accident conditions. The code has the ability to model an early stage of core degradation including heat transfer inside the rods, convective and radiative heat exchange as well as cladding interactions with coolant and fuel, hydrogen generation, melting, relocations and refreezing of fuel rod materials with dissolution of UO{sub 2} and ZrO{sub 2} in liquid phase. The code was applied for the simulation of International Standard Problem number 28, performed on PHEBUS test facility. This report contains the program physical models description, detailed description of input data requirements and results of code verification. The main directions for future TASAC code development are formulated. (author). 20 refs, 39 figs, 4 tabs.
Crustáceos decápodos asociados a comunidades algales en la región de Santa Marta, Caribe colombiano
Directory of Open Access Journals (Sweden)
Campos C. Néstor Hernando
1995-11-01
Full Text Available Bimonthly sampling during a one year period was carried out on three biotopes in the Santa Marta region (Bahía de Gayraca: Lithothamnion; Bahía de Chengue: Halimeda; Bahra de Concha: Sargassum in order to determine the crustacean population associated with to them. A total of 1309 individuals of 58 species were collected. Only two species appeared at the three habitats, Mithraculus forceps y Pagurus brevidactylus. Some species were found to characterize the habitat sampled in the Santa Marta región. Lysmata wurdemanni has been found in Santa Marta only in Halimeda; some galatheids are frequently found in the Lithothamnion habitat; the spider crabs Acanthonix petiveri and Epialtus brasiliensis were found exclusively in the Sargassum habitat.Con el fin de evaluar las poblaciones de crustáceos decápodos asociadas a comunidades algales, se adelantaron muestreos bimensuales durante un año en tres comunidades de la región de Santa Marta, (Bahía de Gayraca: algas coralinácea del género Uthothamnion; Bahra de Chengue: algas del género Halimeda; Bahía de Concha: algas del género Sargassum. Se recolectaron 1.309 individuos pertenecientes a 58 especies de crustáceos decápodos. Del total de especies, sólo dos estuvieron presentes en los tres hábitats (Mithraculus forceps y Pagurus brevidactylus. Para cada una de las tres comunidades se pudieron identificar algunas especies que las caracterizan en la región de Santa Marta: Lysmata wurdemanni en el área de estudio no ha sido capturada en otro hábitat diferente a Halimeda; miembros de la familia Galatheidae son frecuentes en Uthothamnion; los cangrejos araña Acanthonix Petiveri y Epialtus brasiliensisse encontraron únicamente en Sargassum.
Heffner, R.
2000-01-01
This is the Engineering Test Report, AMSU-A2 METSAT Instrument (S/N 108) Acceptance Level Vibration Test of Dec 1999/Jan 2000 (S/O 784077, OC-454), for the Integrated Advanced Microwave Sounding Unit-A (AMSU-A).
Estudo das características da oclusão na dentição decídua e na mista e fatores associados
Costa, Catiara Terra da
2013-01-01
Conhecer as características oclusais das dentições decídua e mista, seu desenvolvimento, alterações e possíveis fatores influentes é importante para a prevenção e interceptação das maloclusões, tornando-se de grande valor epidemiológico. Para isto, estudos longitudinais são apropriados, pois observam a mesma população em momentos temporais diferentes. Este estudo foi constituído de duas partes: estudo transversal e estudo longitudinal. O estudo transversal investigou a influência dos fatores ...
Computational fluid dynamics in greenhouses: A review
African Journals Online (AJOL)
use
2011-12-05
Dec 5, 2011 ... reduce environmental impact while enhancing crop qua- lity and yields .... within a mild climate, appropriate design and control of ventilation are required .... crucial parameter in the pattern of internal greenhouse temperatures ...
Lippi, Vittorio; Mergner, Thomas
2017-01-01
The high complexity of the human posture and movement control system represents challenges for diagnosis, therapy, and rehabilitation of neurological patients. We envisage that engineering-inspired, model-based approaches will help to deal with the high complexity of the human posture control system. Since the methods of system identification and parameter estimation are limited to systems with only a few DoF, our laboratory proposes a heuristic approach that step-by-step increases complexity when creating a hypothetical human-derived control systems in humanoid robots. This system is then compared with the human control in the same test bed, a posture control laboratory. The human-derived control builds upon the identified disturbance estimation and compensation (DEC) mechanism, whose main principle is to support execution of commanded poses or movements by compensating for external or self-produced disturbances such as gravity effects. In previous robotic implementation, up to 3 interconnected DEC control modules were used in modular control architectures separately for the sagittal plane or the frontal body plane and successfully passed balancing and movement tests. In this study we hypothesized that conflict-free movement coordination between the robot's sagittal and frontal body planes emerges simply from the physical embodiment, not necessarily requiring a full body control. Experiments were performed in the 14 DoF robot Lucy Posturob (i) demonstrating that the mechanical coupling from the robot's body suffices to coordinate the controls in the two planes when the robot produces movements and balancing responses in the intermediate plane, (ii) providing quantitative characterization of the interaction dynamics between body planes including frequency response functions (FRFs), as they are used in human postural control analysis, and (iii) witnessing postural and control stability when all DoFs are challenged together with the emergence of inter
Computational system for activity calculation of radiopharmaceuticals
African Journals Online (AJOL)
STORAGESEVER
2008-12-29
Dec 29, 2008 ... 2National Nuclear Energy Commission, Brazil. Accepted 24 October ... radiopharmaceuticals in use around the world with ... ment with a very important aspects: no profits ends. The tool ... The software interface is showed in ...
Transcription factor DecR (YbaO) controls detoxification of L-cysteine in Escherichia coli.
Shimada, Tomohiro; Tanaka, Kan; Ishihama, Akira
2016-09-01
YbaO is an uncharacterized AsnC-family transcription factor of Escherichia coli. In both Salmonella enterica and Pantoea ananatis, YbaO homologues were identified to regulate the adjacent gene encoding cysteine desulfhydrase for detoxification of cysteine. Using the genomic SELEX (systematic evolution of ligands by exponential enrichment) screening system, we identified the yhaOM operon, located far from the ybaO gene on the E. coli genome, as a single regulatory target of YbaO. In both gel shift assay in vitro and reporter and Northern blot assays in vivo, YbaO was found to regulate the yhaOM promoter. The growth of mutants lacking either ybaO or its targets yhaOM was delayed in the presence of cysteine, indicating involvement of these genes in cysteine detoxification. In the major pathway of cysteine degradation, hydrogen sulfide is produced in wild-type E. coli, but its production was not observed in each of the ybaO, yhaO and yhaM mutants. The yhaOM promoter was activated in the presence of cysteine, implying the role of cysteine in activation of YbaO. Taken together, we propose that YbaO is the cysteine-sensing transcriptional activator of the yhaOM operon, which is involved in the detoxification of cysteine. We then propose the naming of ybaO as decR (regulator of detoxification of cysteine).
On the variation of environmental radioactivity in Dae-Jeon area (Jan. 1977-Dec. 1981)
International Nuclear Information System (INIS)
Oh, H.P.; Oh, H.J.
1982-01-01
This study concerns with gamma-ray exposure in natural background radiation and radioactivities in the air-borne dust, the fall-out, and the rain-out which had been measured in Dae-Jeon area during the period of five years from Jan. 1, 1977 to Dec. 31, 1981. The special survey results from the 22th, 23th, and 24th nuclear explosion tests carred out by Red China are included in this paper. The results of these measurements are as follows: 1. The average value of natural background radiation in the laboratory 20.69μR/hr, and it is found that the natural background was not affected by the nuclear explosion tests. 2. The average value of radioactivity in the air-borne dust is 0.11pμci/cc, and the maximum value of radioactivity during the period is 0.47pμci/cc. 3. The average value of radioactivity of the fall-out is 0.09mci/km 2 -10d, and the maximum value of radioactivity during the period is 0.84mci/km 2 -10d. 4. The average value of radioactivity in the rain-out is 0.45 x 10 -8 μci/cc, and the maximum value of radioactivity during the period is 1.97 x 10 -8 μci/cc. (Author)
Directory of Open Access Journals (Sweden)
Omar Gabriel da Silva Filho
2008-08-01
Full Text Available INTRODUÇÃO: é possível definir a morfologia facial e o padrão de crescimento em idade precoce, a partir da dentadura decídua completa. OBJETIVOS: frente à escassez de trabalhos na literatura pertinente ao assunto, a presente pesquisa explora o diagnóstico epidemiológico da face no estágio de dentadura decídua. METODOLOGIA: a amostra foi composta por 2.009 crianças de etnia brasileira, de ambos os gêneros, entre 3 e 6 anos de idade, no período de dentadura decídua completa, de 20 pré-escolas do município de Bauru/SP. RESULTADOS E CONCLUSÕES: baseando-se nos resultados obtidos no levantamento epidemiológico, foi encontrado - na análise em norma lateral - predomínio de crianças Padrão I (63,22% em relação ao Padrão II (33,10% e Padrão III (3,68%, não havendo diferenças estatisticamente significativas quanto ao gênero. Na análise em norma frontal, houve predomínio do tipo mesofacial (64,56% em relação ao dolicofacial (21,90% e braquifacial (13,54%, sendo que a proporção do tipo braquifacial nas meninas foi significativamente superior em relação aos meninos. Na distribuição dos tipos faciais frontais dentro dos padrões faciais sagitais ficou evidenciada uma manifestação mais freqüente do tipo dolicofacial dentro dos Padrões II e III, sendo encontrado dimorfismo quanto ao gênero, notadamente no Padrão I, onde houve maior manifestação do tipo braquifacial e menor manifestação do dolicofacial no gênero feminino.INTRODUCTION: It is possible to define the facial morphology and growth pattern in early ages, starting from mature deciduous dentition. AIM: Due to the lack of studies about this issue in the deciduous dentition, the current paper aims to present the epidemiologic diagnosis of the face in this stage of the occlusal development. METHODS: The sample was comprised of 2,009 Brazilian children aged between 3 and 6 years, all in the deciduous dentition, from 20 schools in Bauru/SP. RESULTS AND
Operator's guide for VAXGAP, a gamma-ray spectrum analysis package
International Nuclear Information System (INIS)
Killian, E.W.; Femec, D.A.
1992-08-01
This report describes the gamma-ray analysis program VAXGAP, which has continually evolved at the Idaho National Engineering Laboratory over a period of several years. It is an integrated suite of computer programs for performing analyses of pulse-height spectra from high-resolution gamma-ray spectrometers and assorted support functions. VAXGAP programs operate on Digital Equipment Corporation (DEC) VAX computers running the VMS operating system, and were written in VAX FORTRAN and DEC Digital Command Language (DCL). These programs make use of DEC GKS and ReGIS for graphical output on standard terminals and printers, and DEC windows for graphics on workstations and terminals that support the X Window System protocol. This report addresses the use of VAXGAP for data acquisition and control, energy scale calibration, and real-time analyses of background and sample pulse-height spectra. Also addressed are the creation and use efficiency tables and isotope libraries, manipulation of spectrum files and their contents, and graphical display of on-going acquisitions, saved spectra, and mathematical fits to spectral peaks
Directory of Open Access Journals (Sweden)
Teresa Avalos Pereira
2012-07-01
Full Text Available OBJETIVO: Destacar as mudanças ortográficas a serem utilizadas como referencial básico por profissionais, pesquisadores, médicos, professores, alunos e usuários, que estão diretamente vinculados e exercendo atividades nos serviços de saúde em geral, visando à aplicação da ortografia correta na recuperação e produção de seus trabalhos científicos. MÉTODOS: Para a coleta dos dados, foram mostrados alguns exemplos de termos DeCS (Descritores em Ciências da Saúde, analisados conforme a ortografia vigente e comparados com o Vocabulário Ortográfico da Língua Portuguesa (VOLP. RESULTADOS: Foram selecionados e listados exemplos de descritores e/ou termos relacionados às Ciências da Saúde, os quais foram comparados com as respectivas regras do Acordo Ortográfico da Língua Portuguesa e divididos em três itens: acentuação gráfica, o não uso do trema e suas exceções e o uso ou não do hífen. CONCLUSÃO: Este estudo indica algumas diretrizes para as alterações dos descritores de acordo com a Nova Ortografia da Língua Portuguesa, contribuindo para a eficiência na descrição dos conteúdos dos documentos e na sua recuperação.PURPOSE: To indicate orthographic changes to be used as a basic reference for professionals, researchers, doctors, teachers, students and users, which are directly linked and performing activities in health services in general, aimed at implementing the correct orthography in recovery and production of their scientific studies. METHODS: For data collection, were shown some examples of terminology DeCS (Descriptors in Health Science analyzed according to the current spelling and compared with the Orthographic Vocabulary of Portuguese Language (VOLP. RESULTS: It was select and listed examples of key words and/or terms related to Health Sciences, which was compared to the respective rules of the Orthographic Agreement of Portuguese Language, and divided into three items: graphical accentuation, the
International Nuclear Information System (INIS)
Brengle, T.A.; Maron, N.
1980-01-01
Results are presented of comparative timing tests made by running a typical FORTRAN physics simulation code on the following machines: DEC PDP-10 with KI processor; DEC PDP-10, KI processor, and FPS AP-190L; CDC 7600; and CRAY-1. Factors such as DMA overhead, code size for the AP-190L, and the relative utilization of floating point functional units for the different machines are discussed. 1 table
A survey of Strong Convergent Schemes for the Simulation of ...
African Journals Online (AJOL)
PROF. OLIVER OSUAGWA
2014-12-01
Dec 1, 2014 ... 1Department of Mathematics and Computer Science, Benue State University, Makurdi, , 2Department of. Mathematics ... modelling stochastic processes in applied mathematics ..... symbolic computations through its symbolic ...
The Sizing and Optimization Language, (SOL): Computer language for design problems
Lucas, Stephen H.; Scotti, Stephen J.
1988-01-01
The Sizing and Optimization Language, (SOL), a new high level, special purpose computer language was developed to expedite application of numerical optimization to design problems and to make the process less error prone. SOL utilizes the ADS optimization software and provides a clear, concise syntax for describing an optimization problem, the OPTIMIZE description, which closely parallels the mathematical description of the problem. SOL offers language statements which can be used to model a design mathematically, with subroutines or code logic, and with existing FORTRAN routines. In addition, SOL provides error checking and clear output of the optimization results. Because of these language features, SOL is best suited to model and optimize a design concept when the model consits of mathematical expressions written in SOL. For such cases, SOL's unique syntax and error checking can be fully utilized. SOL is presently available for DEC VAX/VMS systems. A SOL package is available which includes the SOL compiler, runtime library routines, and a SOL reference manual.
Energy Technology Data Exchange (ETDEWEB)
Porro, C; Biral, G P [Modena Univ. (Italy). Ist. di Fisiologia Umana; Fonda, S; Baraldi, P [Modena Univ. (Italy). Lab. di Bioingegneria della Clinica Oculistica; Cavazzuti, M [Modena Univ. (Italy). Clinica Neurologica
1984-09-01
A general purpose image processing system is described including B/W TV camera, high resolution image processor and display system (TESAK VDC 501), computer (DEC PDP 11/23) and monochrome and color monitors. Images may be acquired from a microscope equipped with a TV camera or using the TV in direct viewing; the A/D converter and the image processor provides fast (40 ms) and precise (512x512 data points) digitization of TV signal with a 256 gray levels maximum resolution. Computer programs have been developed in order to perform qualitative and quantitative analyses of autoradiographs obtained with the 2-DG method, which are written in FORTRAN and MACRO 11 Assembly Language. They include: (1) procedures designed to recognize errors in acquisition due to possible image shading and correct them via software; (2) routines suitable for qualitative analyses of the whole image or selected regions of it, providing the opportunity for pseudocolor coding, statistics, graphic overlays; (3) programs permitting the conversion of gray levels into metabolic rates of glucose utilization and the display of gray- or color-coded metabolic maps.
Kar, Shantanu K; Dwibedi, Bhagirathi; Das, Birendra K; Agrawala, Bikash K; Ramachandran, Cherubala P; Horton, John
2017-10-01
Once interruption of transmission of lymphatic filariasis is achieved, morbidity prevention and management becomes more important. A study in Brugia malayi filariasis from India has shown sub-clinical lymphatic pathology with potential reversibility. We studied a Wuchereria bancrofti infected population, the major contributor to LF globally. Children aged 5-18 years from Odisha, India were screened for W. bancrofti infection and disease. 102 infected children, 50 with filarial disease and 52 without symptoms were investigated by lymphoscintigraphy and then randomized to receive a supervised single oral dose of DEC and albendazole which was repeated either annually or semi-annually. The lymphatic pathology was evaluated six monthly for two years. Baseline lymphoscintigraphy showed abnormality in lower limb lymphatics in 80% of symptomatic (40/50) and 63·5% (33/52) of asymptomatic children. Progressive improvement in baseline pathology was seen in 70·8, 87·3, 98·6, and 98·6% of cases at 6, 12, 18, and 24 months follow up, while in 4·2, 22·5, 47·9 and 64·8%, pathology reverted to normal. This was independent of age (p = 0·27), symptomatic status (p = 0·57) and semi-annual/bi-annual dosing (p = 0·46). Six of eleven cases showed clinical reduction in lymphedema of legs. A significant proportion of a young W. bancrofti infected population exhibited lymphatic pathology which was reversible with annual dosage of DEC and albendazole. This provides evidence for morbidity prevention & treatment of early lymphedema. It can also be used as a tool to improve community compliance during mass drug administration. ClinicalTrials.gov No CTRI/2013/10/004121.
Directory of Open Access Journals (Sweden)
Luciana Alcoforado
2011-08-01
Full Text Available CONTEXTUALIZAÇÃO: O decúbito lateral apresenta as maiores mudanças em relação à ventilação pulmonar regional e é utilizado na rotina da fisioterapia respiratória. OBJETIVOS: Avaliar a influência do decúbito lateral na deposição pulmonar de radioaerossol durante a inalação em indivíduos jovens e relacionar os efeitos desse decúbito na rotina terapêutica. MÉTODOS: Em estudo randomizado em duas fases, foram incluídos oito homens voluntários saudáveis, com média de idade de 23,6±2,5 anos. Na primeira fase, inalou-se aerossol durante nove minutos no decúbito lateral sorteado e, após intervalo de cinco a sete dias, realizou-se a segunda fase. Para a cintilografia, inalou-se uma dose média de ácido dietilnotriaminopentacético marcado com tecnécio (DTPA - TC99m, com uma atividade radioativa em média de 25 milicuries (mCi. Ao final da inalação, as imagens foram adquiridas em câmaras de cintilação e analisadas por meio da divisão longitudinal e transversal dos pulmões em regiões de interesse (ROI. Para análise estatística, utilizou-se o teste t de Student pareado, considerando significativo pBACKGROUND: The lateral decubitus position leads to the greatest changes in regional pulmonary ventilation and is used in respiratory physical therapy routines. OBJECTIVES: To evaluate the influence of the lateral decubitus position on the pulmonary deposition of inhaled radioaerosol particles in young people and report the effects of the decubitus position on routine therapy. METHODS: Eight healthy male volunteers, mean age 23.6±2.5 years, were included in a randomized study in two phases. In the first phase, aerosol was inhaled for nine minutes in a randomly-selected lateral decubitus position and after an interval of 5 to 7 days, the second phase was conducted. Pulmonary scintigraphy was carried out by inhalation of 25 mCi of 99mTc-DTPA. Following inhalation, images were acquired with scintillation cameras and regions of
Conversion from 8800 to 8800PC - Evaluation and experience
International Nuclear Information System (INIS)
Miner, A.E.; Lawson, B.J.
1998-01-01
Though a final version of the software is pending the 8800PC operating system host computer is a welcomed change from the old Digital (DEC) host computer. The 8800PC host computer uses the Windows NT operating system and has proven to be very user friendly. Descriptive window messages replace the cryptic coding of the DEC host. Though numerous electrical components were replaced, system calibration remained constant. Calibrated Thermoluminescent (TL) output from a randomly selected 8815 field card was measured before and after the upgrade. The % difference, when comparing calibrated output from an upgraded reader to the non upgraded reader, ranged from 0.2 to 3%. The most disappointing aspect of the upgrade experience was the lag time between hardware installation and software completion
Ortega Ortega, Martín Educardo
2015-01-01
Este trabajo de investigación presenta un estudio comparativo de los códecs de voz para comunicaciones de VoIP en la Universidad Católica de Cuenca Sede Azogues, mediante la aplicación de diferentes escenarios reales de pruebas utilizando teléfonos móviles celulares inteligentes con cuentas SIP registradas en aplicaciones softphones y configuradas con la dirección IP interna del servidor de VoIP cuando la conexión sea a través de la red WLAN interna del campus universitario,...
Effects of perfluorochemical distribution and elimination dynamics on cardiopulmonary function.
Miller, T F; Milestone, B; Stern, R; Shaffer, T H; Wolfson, M R
2001-03-01
Based on a physicochemical property profile, we tested the hypothesis that different perfluorochemical (PFC) liquids may have distinct effects on intrapulmonary PFC distribution, lung function, and PFC elimination kinetics during partial liquid ventilation (PLV). Young rabbits were studied in five groups [healthy, PLV with perflubron (PFB) or with perfluorodecalin (DEC); saline lavage injury and conventional mechanical ventilation (CMV); saline lavage injury PLV with PFB or with DEC]. Arterial blood chemistry, respiratory compliance (Cr), quantitative computed tomography of PFC distribution, and PFC loss rate were assessed for 4 h. Initial distribution of PFB was more homogenous than that of DEC; over time, PFB redistributed to dependent regions whereas DEC distribution was relatively constant. PFC loss rate decreased over time in all groups, was higher with DEC than PFB, and was lower with injury. In healthy animals, arterial PO(2) (Pa(O(2))) and Cr decreased with either PFC; the decrease was greater and sustained with DEC. Lavaged animals treated with either PFC demonstrated increased Pa(O(2)), which was sustained with PFB but deteriorated with DEC. Lavaged animals treated with PFB demonstrated increased Cr, higher Pa(O(2)), and lower arterial PCO(2) than with CMV or PLV with DEC. The results indicate that 1) initial distribution and subsequent intrapulmonary redistribution of PFC are related to PFC properties; 2) PFC distribution influences PFC elimination, gas exchange, and Cr; and 3) PFC elimination, gas exchange, and Cr are influenced by PFC properties and lung condition.
International Nuclear Information System (INIS)
Berna, G.A.; Beyer, G.A.; Davis, K.L.; Lanning, D.D.
1997-12-01
FRAPCON-3 is a FORTRAN IV computer code that calculates the steady-state response of light water reactor fuel rods during long-term burnup. The code calculates the temperature, pressure, and deformation of a fuel rod as functions of time-dependent fuel rod power and coolant boundary conditions. The phenomena modeled by the code include (1) heat conduction through the fuel and cladding, (2) cladding elastic and plastic deformation, (3) fuel-cladding mechanical interaction, (4) fission gas release, (5) fuel rod internal gas pressure, (6) heat transfer between fuel and cladding, (7) cladding oxidation, and (8) heat transfer from cladding to coolant. The code contains necessary material properties, water properties, and heat-transfer correlations. The codes' integral predictions of mechanical behavior have not been assessed against a data base, e.g., cladding strain or failure data. Therefore, it is recommended that the code not be used for analyses of cladding stress or strain. FRAPCON-3 is programmed for use on both mainframe computers and UNIX-based workstations such as DEC 5000 or SUN Sparcstation 10. It is also programmed for personal computers with FORTRAN compiler software and at least 8 to 10 megabytes of random access memory (RAM). The FRAPCON-3 code is designed to generate initial conditions for transient fuel rod analysis by the FRAPTRAN computer code (formerly named FRAP-T6)
Energy Technology Data Exchange (ETDEWEB)
Soroa, Victoria E [Hospital de Clinicas Jose de San Martin, Buenos Aires (Argentina). Centro de Medicina Nuclear; Ozker, K [Medical Coll. of Wisconsin, Milwaukee, WI (United States). Dept. of Radiology
1999-07-01
Preliminary tests have been carried out to validate the use of DEC -Tc 99m labelled leukocytes as a more stable substitute for Tc 99m-HMPAO in the diagnosis of infectious and inflammatory diseases. Although in all the patients the infectious focuses have been detected and the results are promissory, further studies with different infections /inflammations are needed to validate the procedure as an alternative routine technique.
CAVALCANTI Alessandro Leite; CHELOTTI Adolpho
1999-01-01
Estudou-se a microinfiltração marginal presente na interface da parede gengival de cavidades classe II em molares decíduos, restaurados com resina composta (auto e fotopolimerizável), através da penetração de uma solução corante. Os preparos cavitários apresentavam a parede gengival em esmalte e foram restaurados segundo 4 diferentes técnicas: 1) resina composta fotopolimerizável; 2) resina composta autopolimerizável; 3) resina composta auto e fotopolimerizável; e 4) ionômero de vidro/resina ...
Directory of Open Access Journals (Sweden)
Vera Mendes SOVIERO
1999-04-01
Full Text Available No intuito de conhecer mais sobre as características da dentição decídua, apresentadas pelas crianças brasileiras, realizou-se um estudo de prevalência do qual participaram 400 crianças, com dentição decídua completa e idade variando de 2 a 6 anos, na cidade de Petrópolis - RJ. O arco tipo I foi o mais prevalente tanto no arco superior (93,2% como no inferior (90,5%, sendo que o superior tipo II foi mais comum no sexo feminino (p For the purpose of ascertaining more information about the characteristics of deciduous dentition presented by the Brazilian children, a prevalence study was performed. Four hundred children with complete deciduous dentitions and age ranging from 2 to 6 years, were examined in Petrópolis - RJ - Brazil. The type I arch was the most prevalent in the upper arch (93.2% and in the lower arch (90.5%. The type II upper arch was more common in the females (p < 0.01. The primate spaces were the most frequent spaces found in both arches. The association between the presence of interdental spaces and age was statistically significant (p < 0.05, suggesting that there is a tendency for the spaces to close with age.
NEXUS/NASCAD- NASA ENGINEERING EXTENDIBLE UNIFIED SOFTWARE SYSTEM WITH NASA COMPUTER AIDED DESIGN
Purves, L. R.
1994-01-01
handle IGES format data, including proposed solid geometry formats. This facilitates interfacing with other CAD systems. NEXUS/NASCAD supports the activities encountered in various engineering projects as follows: 1) Preliminary Design - Geometric models can be built from points, lines, arcs, splines, polygons, drive surfaces, ruled surfaces, and bicubic spline surfaces. Geometric models can be displayed in any view (including hidden line and hidden surface removal) to check design features, 2) Design Analysis - Geometric models and related data structures can be used to build a NASTRAN data deck. Calculated stress data can be added to model data structures and displayed as color variations on the geometric model, 3) Detailed Design - This phase consists of dimensioning and annotating the geometric model and generating manufacturing and assembly drawings, 4) Manufacturing - NASCAD developed geometric model and related data structures can be used to build input for the APT program which generates a cutter location (CL) file describing required tool motions, 5) Assembly - Generation of a robot plan for putting together or taking apart (repair) of a mechanical assembly based on an IGES solid geometry description, and 6) Testing - Correlation of test data can be made with predictions made during the design analysis phase. NEXUS/NASCAD is available by license for a period of ten (10) years to approved licensees. The licensed program product includes the source, executable code, command streams, and one set of documentation. Additional documentation may be purchased separately at any time. The NASTRAN and APT programs are distributed separately from the NEXUS/NASCAD system (contact COSMIC for details). The NEXUS/NASCAD system is written in FORTRAN 77 and PROLOG, with command streams in DEC Control Language (DCL), for interactive execution under VMS on a DEC VAX series computer. All of the PROLOG code deals with the robot strategy planner feature. A minimum recommended
Insight into the Utilization of Cloud and Mobile Computing in a ...
African Journals Online (AJOL)
PROF. OLIVER OSUAGWA
2015-12-01
Dec 1, 2015 ... bewildering array of new systems and services can be confusing for end users. Already, the average ...... should optimize the functionality design to maximally utilize the screen ... is not tied to the sale and is optional. Mobile.
Evaluation of blood perfusion in liver cirrhosis by dynamic contrast enhanced computed tomography
DEFF Research Database (Denmark)
Andersen, Mette L.; Fallentin, Eva; Lauridsen, Carsten Ammitzbøl
2017-01-01
sampling and a DCE-CT. Patients were consecutively recruited from Department of Hepatology, Rigshospitalet from Dec 2015 to June 2017. We excluded patients with severely impaired kidney function (eGFR
Technology 2003: The Fourth National Technology Transfer Conference and Exposition, volume 2
Hackett, Michael (Compiler)
1994-01-01
Proceedings from symposia of the Technology 2003 Conference and Exposition, Dec. 7-9, 1993, Anaheim, CA, are presented. Volume 2 features papers on artificial intelligence, CAD&E, computer hardware, computer software, information management, photonics, robotics, test and measurement, video and imaging, and virtual reality/simulation.
Supervisory control of mobile sensor networks: math formulation, simulation, and implementation.
Giordano, Vincenzo; Ballal, Prasanna; Lewis, Frank; Turchiano, Biagio; Zhang, Jing Bing
2006-08-01
This paper uses a novel discrete-event controller (DEC) for the coordination of cooperating heterogeneous wireless sensor networks (WSNs) containing both unattended ground sensors (UGSs) and mobile sensor robots. The DEC sequences the most suitable tasks for each agent and assigns sensor resources according to the current perception of the environment. A matrix formulation makes this DEC particularly useful for WSN, where missions change and sensor agents may be added or may fail. WSN have peculiarities that complicate their supervisory control. Therefore, this paper introduces several new tools for DEC design and operation, including methods for generating the required supervisory matrices based on mission planning, methods for modifying the matrices in the event of failed nodes, or nodes entering the network, and a novel dynamic priority assignment weighting approach for selecting the most appropriate and useful sensors for a given mission task. The resulting DEC represents a complete dynamical description of the WSN system, which allows a fast programming of deployable WSN, a computer simulation analysis, and an efficient implementation. The DEC is actually implemented on an experimental wireless-sensor-network prototyping system. Both simulation and experimental results are presented to show the effectiveness and versatility of the developed control architecture.
Directory of Open Access Journals (Sweden)
Ana Flávia Granville-Garcia
2008-12-01
Full Text Available Este estudo retrospectivo determinou a prevalência da perda precoce de molares decíduos em pacientes atendidos na clínica de Odontopediatria da Universidade Estadual da Paraíba. Foram examinados 515 prontuários, sendo os dados registrados em um formulário. Foram analisadas as variáveis: gênero, idade, tipo de molar decíduo perdido, arcada dentária (maxilar ou mandibular e lado (direito e esquerdo. Observou-se que a prevalência de perda precoce foi de 15,1%, existindo uma distribuição similar entre os gêneros. Em relação à idade da criança, a maior freqüência de perda acometeu pacientes com sete anos (32,1%. Houve distribuição equitativa da perda dentária entre as arcadas superior e inferior, com 43,6% cada uma, sendo o lado esquerdo o mais acometido (41%. O segundo molar superior esquerdo foi o mais acometido (17,9%, seguido do primeiro molar decíduo superior direito (16,1%. Pode-se concluir que a prevalência de perda precoce foi baixa e que os molares decíduos superiores foram os dentes mais comumente perdidos.This retrospective study determined the prevalence of early loss of deciduous molars in patients enrolled at the Pediatric Dentistry clinic at the State University of Paraíba. A review of 515 patient records were analyzed, registered in a form. The following variables were analyzed: gender, age, type of deciduous molar loss, region (maxilla or mandible and side (right and left. It was observed that the prevalence of early tooth loss was 15.1% and there was a similar distribution between the genders. In regard to age, the greatest frequency of tooth loss involved patients at 7 years old (32.1%. There was a similar distribution of tooth loss between the maxilla and mandible regions, at 43.6% each, with the left side being the most involved (41%. The second upper left deciduous molar was the most commonly missing tooth (17.9%, followed by the first upper right deciduous molar (16.1%. It can be concluded that the
Directory of Open Access Journals (Sweden)
PAULINA GEBAUER
2003-06-01
hormonally mediated effects on the moulting cycle, the quantification of energetic or other costs of delayed metamorphosis, and the analysis of relationships between the effectiveness of adult odors and phylogenetic proximity of larvae and adultsNumerosos invertebrados marinos tienen un ciclo de vida bifásico, el cual incluye una fase larval planctónica y una juvenil-adulta bentónica. La metamorfosis y asentamiento son los eslabones entre estas dos fases del desarrollo. La metamorfosis en muchas especies es gatillada por estímulos físicos y/o químicos, generalmente relacionados con el hábitat parental. Las larvas competentes, en ausencia de estos inductores, pueden retardar la metamorfosis desde algunos días hasta meses. La mayoría de las investigaciones sobre retraso de la metamorfosis han sido realizadas en especies sedentarias o sésiles. En crustáceos decápodos (móviles la cantidad de estudios relacionados con la inducción del asentamiento y metamorfosis por estímulos específicos y la capacidad de retraso de la metamorfosis es mucho menor, y se podría deber a que este grupo no pierde su capacidad de movimiento post-metamorfosis, por lo cual el hábitat de asentamiento y metamorfosis podría no ser tan crucial para este grupo como en las especies sésiles o sedentarias. Sin embargo, en algunas especies de crustáceos decápodos se ha reportado la importancia de la presencia de estímulos específicos para el asentamiento y metamorfosis y la flexibilidad en el momento de la metamorfosis en ausencia de tales estímulos. En general, los estímulos identificados que gatillan la metamorfosis son algunos tipos de substratos, la presencia de adultos conespecíficos o congenéricos. La capacidad de retraso de la metamorfosis en las especies de decápodos estudiadas es limitada y generalmente finaliza con una metamorfosis espontánea. La prolongación del tiempo de desarrollo presenta ventajas ya que aumenta la probabilidad de localizar un hábitat favorable y
International Nuclear Information System (INIS)
Ernst, Michael
1996-01-01
Since computing in HEP left the Mainframe-Path, many institutions demonstrated a successful migration to workstation-based computing, especially for applications requiring a high CPU-to-I/O ratio. However, the difficulties and the complexity starts beyond just providing CPU-Cycles. Critical applications, requiring either sequential access to large amounts of data or to many small sets out of a multi 10-Terabyte Data Repository need technical approaches we have not had so far. Though we felt that we were hardly able to follow technology evolving in the various fields, we recently had to realize that even politics overtook technical evolution - at least in the areas mentioned above. The USA is making peace with Russia. DEC is talking to IBM, SGI communicating with HP. All these things became true, and through, unfortunately, the Cold War lasted 50 years, and-in a relative sense-we were afraid that 50 years seemed to be how long any self respecting high performance computer (or a set of workstations) had to wait for data from its Server, fortunately, we are now facing a similar progress of friendliness, harmony and balance in the former problematic (computing) areas. Buzzwords, mentioned many thousand times in talks describing today's and future requirements, including Functionality, Reliability, Scalability, Modularity and Portability are not just phrases, wishes and dreams any longer. At DESY, we are in the process of demonstrating an architecture that is taking those five issues equally into consideration, including Heterogeneous Computing Platforms with ultimate file system approaches, Heterogeneous Mass Storage Devices and an Open Distributed Hierarchical Mass Storage Management System. This contribution will provide an overview on how far we got and what the next steps will be. (author)
Isodose plotting for pen plotters
International Nuclear Information System (INIS)
Rosen, I.I.
1985-01-01
A general algorithm for treatment plan isodose line plotting is described which is particularly useful for pen plotters. Unlike other methods of plotting isodose lines, this algorithm is designed specifically to reduce pen motion, thereby reducing plotting time and wear on the transport mechanism. Points with the desired dose value are extracted from the dose matrix and stored, sorted into continuous contours, and then plotted. This algorithm has been implemented on DEC PDP-11/60 and VAX-11/780 computers for use with two models of Houston Instrument pen plotters, two models of Tektronix vector graphics terminals, a DEC VT125 raster graphics terminal, and a DEC VS11 color raster graphics terminal. Its execution time is similar to simpler direct-plotting methods
International Nuclear Information System (INIS)
1984-01-01
The AVF cyclotron at the RCNP (Research Center for Nuclear Physics) of Osaka University has been cooperatively used by various researchers of Japanese universities or colleges. This collective report covers papers concerning various studies performed at the AVF during Dec 1982 to Apr 1983. Some of the titles of these papers are as follows : Elastic scattering of 56 MeV polarized deuterons from 12 C and 40 Ca ; Pionic three-nucleon capture reactions ; Measurement on branching ratios of short-lived beta emitter 23 Mg and its hyperfine interactions ; Half-life and branching ratios of short-lived beta emitter 13 O ; 7 Li excitation of the giant resonances in 208 Pb ; Measurements of spin polarization of residual nuclei after light particle emission in heavy ion reactions ; Target dependence of the sequential alpha decay through the narrow resonances of 20 Ne ; Analyzing power of neutron continuum spectra for the 93 Nb (p,nx) reaction and a simple one step OWBA analysis ; Energy dependence of the reaction mechanism for the 3 He and alpha induced reactions ; Medium energy gamma rays following radiative capture of polarized protons on light nuclei. (Aoki, K.)
Is protein structure prediction still an enigma?
African Journals Online (AJOL)
STORAGESEVER
2008-12-29
Dec 29, 2008 ... Computer methods for protein analysis address this problem since they study the .... neighbor methods, molecular dynamic simulation, and approaches .... fuzzy clustering, neural net works, logistic regression, decision tree ...
Automated Patient Information Systems for Federal Government ...
African Journals Online (AJOL)
2012-12-01
Dec 1, 2012 ... *Department of Computer Science, Nnamdi Azikiwe University, PMB5025 Awka, Anambra State, Nigeria boni_eke@yahoo.com. ** Dept of Information Technology, National Open University, Awka .... When funding for project.
African Journals Online (AJOL)
2013-12-07
Dec 7, 2013 ... Department of Mechanical Engineering, College of Engineering and ... piece quality in the CNC (Computer Numerical Control) turning process. An effective approach of optimization techniques genetic algorithm (GA) and ...
Computational analysis to predict functional role of hsa-miR-3065 ...
African Journals Online (AJOL)
2012-12-31
Dec 31, 2012 ... users (IDUs). These TI patients have a faster progression to AIDS, and even after antiretroviral therapy .... tational analysis for 1,527 hsa-miRs to assess their align- ment with all six .... within certain high risk groups, such as IDUs and MSM. (men who ... ers, migrant workers, and prisoners are recognized as.
Post-traumatic myositis ossificans
African Journals Online (AJOL)
2014-12-09
Dec 9, 2014 ... These features represent bone marrow surrounded by a low-signal-intensity ... radiographic or computed tomography (CT) evolution and MRI ... This is an important distinguishing feature from non-benign bone lesions.1.
Indian Academy of Sciences (India)
2016-12-14
Dec 14, 2016 ... Astrophysics and Cosmology Research Unit, School of Mathematics, Statistics and Computer Science, ... radiating star should match with the exterior Vaidya [1] solution ... junction condition must be integrated at the stellar sur-.
Directory of Open Access Journals (Sweden)
Amy Waller
2017-11-01
Full Text Available Abstract Background To assess the scope, volume and quality of research on the acceptability, utilisation and effectiveness of telephone- and computer-delivered interventions for caregivers of people living with dementia. Methods Medline, EMBASE, CINAHL and Cochrane databases were searched (Jan 1990 – Dec 2016. Eligible papers were classified as data-based descriptive, measurement or intervention studies. Intervention studies were first categorised according to mode of delivery (e.g. telephone, computer; then assessed against the Effective Practice and Organisation of Care (EPOC methodological criteria for research design. Impact on health-related outcomes; and the acceptability, feasibility and utilisation of interventions were also assessed. Results The number of publications increased by 13% each year (p < 0.001. Half were descriptive studies (n = 92, 50% describing caregiver views on acceptability, access or utilization of technology. The remainder (n = 89, 48% reported on interventions designed to improve caregiver outcomes. Only 34 met EPOC design criteria. Interventions were delivered via computer (n = 10, multiple modalities (n = 9 or telephone (n = 15. Interventions that incorporated various elements of psycho-education, peer support, skills training and health assessments led to improvements in caregiver wellbeing. While largely acceptable, utilisation of computer-based interventions was variable, with use often decreasing over time. Conclusion Interventions delivered via telephone and computer have the potential to augment existing dementia care. High-quality trials are required to make clear recommendations about the types of interventions that are most effective. Those that provide caregivers with: access to practical strategies to manage care of the person with dementia and their own wellbeing, advice and support from peers and/or clinicians; and that target the dyad should be explored.
Application of tape unit in data acquisition system and its maintenance and trouble shoot
International Nuclear Information System (INIS)
Xing Jianping; Qian Xicheng
1995-01-01
Application of magnetic tape unit in data acquisition system of DEC computer imported from German and its maintenance as well as trouble shoot is described. The system is used for nuclear data acquisition and processing
Future and Feature of Intelligent Systems and Their Societies
African Journals Online (AJOL)
2012-12-01
Dec 1, 2012 ... work covered the consequences of having artificial intelligent systems with us in the near future. Keywords: intelligence, systems, artificial ... AI as science and technology to develop computers that can think and function in.
Indian Academy of Sciences (India)
Prakash
2009-12-09
Dec 9, 2009 ... great educational potential, and the factory kept producing models well into the .... mâché models of animals in elementary schools without mentioning ... technologies, such as video and computer simulation, cannot match.
Current status of the Fastbus Micro-Vax
International Nuclear Information System (INIS)
Siskind, E.J.
1985-01-01
The present hardware, firmware, and software design and status of the Fastbus Micro-VAX, a two board Fastbus module packaging of the DEC Micro-VAX II computing system, is described. The hardware currently features an Intel 80186, equipped with 64 kB of ROM, 32 kB of RAM, and an 82586/82501 Ethernet port, as a front end I/O processor, plus a high bandwidth Fastbus interface implemented in semi-custom ECL 100K VLSI with the Motorola MCA2500ECL macrocell array. Standard 80186 firmware implements multiple Fastbus segment drivers and interrupt receivers software compatible with the UPI, a limited Fastbus interprocessor network, and emulations of the DEC DEQNA Ethernet interface and an MSCP disk interface. Software includes device drivers for the non-DEC devices, plus appropriate standard access subroutines for the Fastbus and network devices
Comparative analysis of ADS gene promoter in seven Artemisia ...
Indian Academy of Sciences (India)
2014-12-23
Dec 23, 2014 ... antimalarial drugs from plants that were used in traditional. Chinese medicine ...... ogy of eukaryotic promoter prediction-a review. Comput. Chem. ... Main J. J. 2006 Antiviral effect of artemisinin from Artemisia annua against a ...
INTERNET5: Shaping an Internet for women's empowerment | IDRC ...
International Development Research Centre (IDRC) Digital Library (Canada)
2017-12-08
Dec 8, 2017 ... Young women learn computer skills, Hyderabad, Pakistan ... works in building social, political, and economic empowerment for women and girls. ... to the Internet and to explore how digital and networking tools can best be ...
Biometric Authentication Systems Attacks: Liveness Detection to the ...
African Journals Online (AJOL)
PROF. OLIVER OSUAGWA
2014-12-01
Dec 1, 2014 ... 1Department of Computer Science, Imo State University, Owerri ... potential to provide security for a variety of applications. BAS are nowadays ... access control, sensitive data protection and on-line tracking systems. Like any ...
Information And Communication Technology To Aid Constructivism ...
African Journals Online (AJOL)
2012-12-01
Dec 1, 2012 ... they are applied to our everyday life and the field of .... reflection of the quality of STEM education that still receives ... revolutionary change of the human- computer interface ... artificial intelligence arose with advent of. MYCIN ...
Air pollution tolerance indices of plants growing around Umuebulu ...
African Journals Online (AJOL)
FRANKLIN
2012-12-03
Dec 3, 2012 ... African Journal of Environmental Science and Technology Vol. 7(1), pp. 1-8, January ... were used to compute the Air pollution tolerance indices (APTI). Results showed .... bags and marked with masking tape. These were ...
Model Development for Auto Spare Parts Inventory Control and ...
African Journals Online (AJOL)
2012-12-01
Dec 1, 2012 ... essential motivating factors for providing control in manufacturing companies has never showed any sign ... The management of these parts can only be done with the aid of a computer; ... perform a discrete event simulation of.
Geostatistics applied to estimation of uranium bearing ore reserves
International Nuclear Information System (INIS)
Urbina Galan, L.I.
1982-01-01
A computer assisted method for assessing uranium-bearing ore deposit reserves is analyzed. Determinations of quality-thickness, namely quality by thickness calculations of mineralization, were obtained by means of a mathematical method known as the theory of rational variables for each drill-hole layer. Geostatistical results were derived based on a Fortrand computer program on a DEC 20/40 system. (author)
International Nuclear Information System (INIS)
Saikia, D.; Hussain, A.M.P.; Kumar, A.; Singh, F.; Avasthi, D.K.
2006-01-01
In an attempt to increase the Li ion diffusivity in gel polymer electrolytes, the effects of Li 3+ ion irradiation in P(VDF-HFP)-(PC + DEC)-LiCF 3 SO 3 electrolyte system, with five different fluences, is studied. Irradiation with swift heavy ions shows enhancement in conductivity at low fluences and decreased in conductivity at higher fluences with respect to pristine polymer electrolyte films. Maximum room temperature ionic conductivity after irradiation is found to be 2.6 x 10 -3 S/cm. This interesting result could be attributed to the fact that, higher fluence provides critical activation energy for cross-linking and crystallization to occur, which results in decrease in ionic conductivity. XRD results show decrease in the degree of crystallinity upon ion irradiation at low fluences (≤10 11 ions/cm 2 ) and increase in crystallinity at high fluences (>10 11 ions/cm 2 ). In FTIR spectra the absorption band intensities around 3025 cm -1 and 2985 cm -1 decrease upon irradiation with a fluence of 5 x 10 1 ions/cm 2 suggesting chain scission and increase upon irradiation with a fluence of 5 x 10 12 ions/cm 2 indicating cross-linking. FTIR analyses corroborate the conductivity and XRD results
African Journals Online (AJOL)
2017-12-02
Dec 2, 2017 ... the ventricles of the brain and the flow and circulation of cerebrospinal fluid ... Selfies 2015: Peer teaching in medical sciences through video clips – .... Also to make some kind of software available in the computer lab. This.
Aretskin-Hariton, Eliot D.; Zinnecker, Alicia Mae; Culley, Dennis E.
2014-01-01
Distributed Engine Control (DEC) is an enabling technology that has the potential to advance the state-of-the-art in gas turbine engine control. To analyze the capabilities that DEC offers, a Hardware-In-the-Loop (HIL) test bed is being developed at NASA Glenn Research Center. This test bed will support a systems-level analysis of control capabilities in closed-loop engine simulations. The structure of the HIL emulates a virtual test cell by implementing the operator functions, control system, and engine on three separate computers. This implementation increases the flexibility and extensibility of the HIL. Here, a method is discussed for implementing these interfaces by connecting the three platforms over a dedicated Local Area Network (LAN). This approach is verified using the Commercial Modular Aero-Propulsion System Simulation 40k (C-MAPSS40k), which is typically implemented on one computer. There are marginal differences between the results from simulation of the typical and the three-computer implementation. Additional analysis of the LAN network, including characterization of network load, packet drop, and latency, is presented. The three-computer setup supports the incorporation of complex control models and proprietary engine models into the HIL framework.
An experimental and modeling study of diethyl carbonate oxidation
Nakamura, Hisashi; Curran, Henry J.; Polo-Có rdoba, Á ngel David; Pitz, William J.; Dagaut, P.; Togbé , Casimir; Sarathy, Mani; Mehl, Marco; Agudelo, John Ramiro; Bustamante, Felipe
2015-01-01
Diethyl carbonate (DEC) is an attractive biofuel that can be used to displace petroleum-derived diesel fuel, thereby reducing CO2 and particulate emissions from diesel engines. A better understanding of DEC combustion characteristics is needed to facilitate its use in internal combustion engines. Toward this goal, ignition delay times for DEC were measured at conditions relevant to internal combustion engines using a rapid compression machine (RCM) and a shock tube. The experimental conditions investigated covered a wide range of temperatures (660-1300K), a pressure of 30bar, and equivalence ratios of 0.5, 1.0 and 2.0 in air. To provide further understanding of the intermediates formed in DEC oxidation, species concentrations were measured in a jet-stirred reactor at 10atm over a temperature range of 500-1200K and at equivalence ratios of 0.5, 1.0 and 2.0. These experimental measurements were used to aid the development and validation of a chemical kinetic model for DEC.The experimental results for ignition in the RCM showed near negative temperature coefficient (NTC) behavior. Six-membered alkylperoxy radical (RO˙2) isomerizations are conventionally thought to initiate low-temperature branching reactions responsible for NTC behavior, but DEC has no such possible 6- and 7-membered ring isomerizations. However, its molecular structure allows for 5-, 8- and 9-membered ring RO˙2 isomerizations. To provide accurate rate constants for these ring structures, ab initio computations for RO˙2⇌Q˙OOH isomerization reactions were performed. These new RO˙2 isomerization rate constants have been implemented in a chemical kinetic model for DEC oxidation. The model simulations have been compared with ignition delay times measured in the RCM near the NTC region. Results of the simulation were also compared with experimental results for ignition in the high-temperature region and for species concentrations in the jet-stirred reactor. Chemical kinetic insights into the
An experimental and modeling study of diethyl carbonate oxidation
Nakamura, Hisashi
2015-04-01
Diethyl carbonate (DEC) is an attractive biofuel that can be used to displace petroleum-derived diesel fuel, thereby reducing CO2 and particulate emissions from diesel engines. A better understanding of DEC combustion characteristics is needed to facilitate its use in internal combustion engines. Toward this goal, ignition delay times for DEC were measured at conditions relevant to internal combustion engines using a rapid compression machine (RCM) and a shock tube. The experimental conditions investigated covered a wide range of temperatures (660-1300K), a pressure of 30bar, and equivalence ratios of 0.5, 1.0 and 2.0 in air. To provide further understanding of the intermediates formed in DEC oxidation, species concentrations were measured in a jet-stirred reactor at 10atm over a temperature range of 500-1200K and at equivalence ratios of 0.5, 1.0 and 2.0. These experimental measurements were used to aid the development and validation of a chemical kinetic model for DEC.The experimental results for ignition in the RCM showed near negative temperature coefficient (NTC) behavior. Six-membered alkylperoxy radical (RO˙2) isomerizations are conventionally thought to initiate low-temperature branching reactions responsible for NTC behavior, but DEC has no such possible 6- and 7-membered ring isomerizations. However, its molecular structure allows for 5-, 8- and 9-membered ring RO˙2 isomerizations. To provide accurate rate constants for these ring structures, ab initio computations for RO˙2⇌Q˙OOH isomerization reactions were performed. These new RO˙2 isomerization rate constants have been implemented in a chemical kinetic model for DEC oxidation. The model simulations have been compared with ignition delay times measured in the RCM near the NTC region. Results of the simulation were also compared with experimental results for ignition in the high-temperature region and for species concentrations in the jet-stirred reactor. Chemical kinetic insights into the
NPL superconducting Linac control system
International Nuclear Information System (INIS)
Swanson, H.E.; Howe, M.A.; Jackson, L.W.; LaCroix, J.M.; Readdy, H.P.; Storm, D.W.; Van Houten, L.P.
1985-01-01
The control system for the NPL Linac is based on a Microvax II host computer connected in a star network with 9 satellite computers. These satellites use single board varsions of DEC's PDP 11 processor. The operator's console uses high performance graphics and touch screen technology to display the current linac status and as the means for interactively controlling the operation of the accelerator
EOI Open Learning: un decálogo para la transformación del aprendizaje
Directory of Open Access Journals (Sweden)
González, Alfonso
2011-12-01
Full Text Available This article covers as a decalogue the most relevant experiences in the transformation held in the last three years by the Industrial Organization School EOI, the eldest business schools in Spain. The education of entrerpreneur managers and entrepreneurs in management requires a response in line with the demands of a society and a market characterized by personalization and humanization of learning that has become the engine of a profound social and economic transformation in which the public, private and citizens come together in achieving the common good. A business school is uniquely positioned to be a laboratory in which to experience the challenges facing learning in today’s society. The concept Open Learning collects the challenges that are facing both training institutions and traditional learning models, with the deep belief of the role of learning in creating a fairer society and a more competitive economy, as well as the crucial importance of technology in this process.
En el presente artículo se recogen en forma de decálogo las experiencias más relevantes en el proceso de transformación abierto en los tres últimos años por la Escuela de Organización Industrial, decana de las escuelas de negocio. La formación de directivos emprendedores y de emprendedores directivos exige una respuesta alineada a las exigencias de una sociedad y de un mercado caracterizados por una personalización y humanización del aprendizaje que se ha convertido en el motor de una profunda transformación social y económica en donde lo público, lo privado y lo ciudadano se funden en la consecución del bien común. Una escuela de negocios tiene unas condiciones excepcionales para ser un laboratorio en el que experimentar los desafíos a los que se enfrenta el aprendizaje en la sociedad actual. Con la expresión Open Learning se pretende recoger los desafíos a los que se están enfrentando tanto las instituciones formativas como los modelos
Directory of Open Access Journals (Sweden)
P.A. Sá
2010-06-01
Full Text Available Compararam-se os efeitos da ventilação espontânea (V E e controlada (V C em equinos submetidos à mudança de decúbito durante anestesia. Dezesseis animais foram equitativamente divididos em dois grupos: V E e V C. Os procedimentos cirúrgicos foram iniciados com os animais em decúbito lateral esquerdo (DLE e, após 75 minutos, os animais foram reposicionados em decúbito lateral direito (DLD. Análises hemogasométricas do sangue arterial foram realizadas após 30 e 75 minutos com os animais posicionados em cada decúbito (M1 e M2 no DLE e M3 e M4 no DLD, respectivamente. Durante a V E, observaram-se hipercapnia (PaCO2 >45mmHg, acidose respiratória (pH The effects of spontaneous (SV and controlled ventilation (CV were compared in horses undergoing changes in body position during anesthesia. Sixteen animals were equally distributed in two groups: SV and CV. All surgical procedures were commenced on left lateral recumbency (LLR and 75 minutes later the animals were repositioned on right lateral recumbency (RLR. Arterial blood gas analyses were performed at 30 and 75 minutes after each recumbency (M1 and M2 for LLR and M3 and M4 for RLR. Hypercapnia (PaCO2 >45mmHg, respiratory acidosis (pH <7.35, and significant decrease in PaO2 after 75min of change in body position (M4: 205.8±124.7mmHg in comparison to PaO2 values before the change of position (M1: 271.8±84.8mmHg were observed during SV. When compared to the SV group, CV resulted in significantly higher PaO2 levels (52 to 96% increase. It was concluded that the change in the body position in spontaneously ventilating halothane-anesthetized horses causes impairment in arterial oxygenation. The use of CV since the beginning of anesthesia prevents the respiratory acidosis and maintains arterial oxygen levels that are closer to values expected during the use of 100% O2.
DEFF Research Database (Denmark)
Kjærgaard, Thomas; Baudin, Pablo; Bykov, Dmytro
2017-01-01
We present a scalable cross-platform hybrid MPI/OpenMP/OpenACC implementation of the Divide–Expand–Consolidate (DEC) formalism with portable performance on heterogeneous HPC architectures. The Divide–Expand–Consolidate formalism is designed to reduce the steep computational scaling of conventiona...
Light Duty Truck Characteristics, Historical Data Base
1979-12-01
The report is a collection of data concerning physical, operating, performance, and market characteristics of light duty trucks for the model years 1972 and 1975 thru 1977. The data is stored on tape in DOT/TSC DEC System 10 computer system. Informat...
Light Truck Characteristics, Historical Data Base
1980-11-01
The report is a description of the data about the physical, operating performance, and market characteristics of light trucks for the model years 1955 through 1977, which is stored on tape in DOT/TSC DEC System 10 computer system. Vehicles are report...
Biases in the perception of self-motion during whole-body acceleration and deceleration
Directory of Open Access Journals (Sweden)
Luc eTremblay
2013-12-01
Full Text Available Several studies have investigated whether vestibular signals can be processed to determine the magnitude of passive body motions. Many of them required subjects to report their perceived displacements offline, i.e. after being submitted to passive displacements. Here, we used a protocol that allowed us to complement these results by asking subjects to report their introspective estimation of their displacement continuously, i.e. during the ongoing body rotation. To this end, participants rotated the handle of a manipulandum around a vertical axis to indicate their perceived change of angular position in space at the same time as they were passively rotated in the dark. The rotation acceleration (Acc and deceleration (Dec lasted either 1.5 s (peak of 60 deg/s2, referred to as being "High" or 3 s (peak of 33 deg/s2, referred to as being "Low". The participants were rotated either counter-clockwise or clockwise, and all combinations of acceleration and deceleration were tested (i.e., AccLow-DecLow; AccLow-DecHigh; AccHigh-DecLow; AccHigh-DecHigh. The participants' perception of body rotation was assessed by computing the gain, i.e. ratio between the amplitude of the perceived rotations (as measured by the rotating manipulandum’s handle and the amplitude of the actual chair rotations. The gain was measured at the end of the rotations, and was also computed separately for the acceleration and deceleration phases. Three salient findings resulted from this experiment: i the gain was much greater during body acceleration than during body deceleration, ii the gain was greater during High compared to Low accelerations and iii the gain measured during the deceleration was influenced by the preceding acceleration (i.e., Low or High. These different effects of the angular stimuli on the perception of body motion can be interpreted in relation to the consequences of body acceleration and deceleration on the vestibular system and on higher-order cognitive
A protocol for the commissioning and quality assurance of new planning computers
International Nuclear Information System (INIS)
Ratcliffe, A.J.; Aukett, R.J.; Bolton, S.C.; Bonnett, D.E.
1995-01-01
Any new radiotherapy planning system needs to be thoroughly tested. Besides checking the accuracy of the algorithm by comparing plans done on the system with measurements done in a phantom, it is desirable for the user to compare the new equipment with a tried and tested system before it is used clinically. To test our recently purchased planning systems, a protocol was developed for running a comparison between these and our existing planning computer, an IGE RTPLAN. A summary of the test protocol that was developed is as follows: (1) A series of plans is created on the old system, to include at least one plan of each common type. The series includes at least one plan with a bone inhomogeneity, and one with an air or lung inhomogeneity, and these plans are computed both with and without inhomogeneity correction. Point dose calculations are made for a number of positions on each plan, including the dose at the centre of the treatment volume. (2) Each of these plans is reproduced as accurately as possible on the new system using the original CT data and patient outlines. (3) The old and new plans, including those with and without inhomogeneity correction are overlaid and compared using the following criteria: (a) how well the volumes of interest coincide, (b) how accurately the positions of the points of interest are reproduced, (c) the doses at the points of interest, (d) the distances between the isodoses defining the dose plateau, (e) the maximum displacement between the corresponding pairs of isodoses in the dose gradient around the tumour. The protocol has been used to test two systems: the (newly developed) Siemens Axiom and the Helax TMS (running on a DEC Alpha). A summary of the results obtained will be presented. These were sufficient to show up several minor problems, particularly in the Axiom system
Computing and Network - Overview
International Nuclear Information System (INIS)
Jakubowski, Z.
1999-01-01
Full text: The responsibility of the Network Group covers: - providing central services like WWW, DNS (Domain Name Server), mail, etc.; - maintenance and support of the Local Area Networks,; - operation of the Wide Area Networks (LAN); - the support of the central UNIX servers and desktop workstations; - VAX/VMS cluster operation and support. The two-processor HP-UNIX K-200 and 6-processor SGI Challenge XL servers were delivering stable services to our users. Both servers were upgraded during the past year. SGI Challenge received additional 256 MB of memory. It was necessary in order to get all benefits of true 64-bit architecture of the SGI IRIX 6.2. The upgrade of our HP K-200 server were problematic so we decided to buy a new powerful machine and join the old and new machine via the fast network. Besides these main servers we have more than 30 workstations from IBM, DEC, HP, SGI and SUN. We observed a real race in PC technology in the past year. Intel processors deliver currently a performance that is comparable with HP or SUN workstations at very low costs. These CPU power is especially visible under Linux that is free Unix-like operating system. The clusters of cheap PC computers should be seriously considered in planning the computing power for the future experiments. The CPU power was further decentralized-smaller but powerful computers cover growing computing demands of our work-groups creating a small ''local computing centers''. The stable network and the concept of central services plays the essential role in this scenario. Unfortunately the network performance for the international communications is persistently unacceptable. We believe that attempts to join the European Quantum project is the only way to achieve the reasonable international network performance. In these plan polish scientific community will gain 34 Mbps international link. The growing costs of the ''real meetings'' give us no alternative to ''virtual meetings'' via the network in the
Performance analysis of a ground-assisted direct evaporative cooling air conditioner
Energy Technology Data Exchange (ETDEWEB)
Heidarinejad, Ghassem; Khalajzadeh, Vahid [Department of Mechanical Engineering, Tarbiat Modares University, P.O. Box 14115-143, Tehran (Iran); Delfani, Shahram [Building and Housing Research Center (BHRC), P O Box 13145-1696, Tehran (Iran)
2010-11-15
In this paper, the results of performance analysis of a ground-assisted hybrid evaporative cooling system in Tehran have been discussed. A Ground Coupled Circuit (GCC) provides the necessary pre-cooling effects, enabling a Direct Evaporative Cooler (DEC) that cools the air even below its wet-bulb temperature. The GCC includes four vertical ground heat exchangers (GHE) which were arrayed in series configuration. In order to have an accurate prediction of the optimum performance of a GCC, a computational fluid dynamic simulation was performed. Simulation results revealed that the combination of GCC and DEC system could provide comfort condition whereas DEC alone did not. Based on the simulation results the cooling effectiveness of a hybrid system is more than 100%. Thus, this novel hybrid system could decrease the air temperature below the ambient wet-bulb temperature. This environmentally clean and energy efficient system can be considered as an alternative to the mechanical vapor compression systems. (author)
Directory of Open Access Journals (Sweden)
CAVALCANTI Alessandro Leite
1999-01-01
Full Text Available Estudou-se a microinfiltração marginal presente na interface da parede gengival de cavidades classe II em molares decíduos, restaurados com resina composta (auto e fotopolimerizável, através da penetração de uma solução corante. Os preparos cavitários apresentavam a parede gengival em esmalte e foram restaurados segundo 4 diferentes técnicas: 1 resina composta fotopolimerizável; 2 resina composta autopolimerizável; 3 resina composta auto e fotopolimerizável; e 4 ionômero de vidro/resina composta. Após a análise estatística dos resultados, concluiu-se que todos os grupos apresentaram microinfiltração em graus variados; todavia, os grupos 2, 3 e 4 apresentaram os menores graus de infiltração.
A combinatorial enumeration problem of RNA secondary structures
African Journals Online (AJOL)
use
2011-12-21
Dec 21, 2011 ... connection between Discrete Mathematics and Compu- tational Molecular Biology (Chen et al, 2005; Hofacker et ... in Computational Molecular Biology. An RNA molecule is described by its sequences of bases ... Here, a mathematical definition of secondary structure is given (Stein and Waterman 1978).
Estimation Organic Matter Digestibility, Metabolisable Energy ...
African Journals Online (AJOL)
USER
2015-12-04
Dec 4, 2015 ... and gas production kinetic parameters A, c and T1/2 of J. acutus stem and .... The module tops contained a communication system with a computer .... Ørskov & McDonald (1979) model was higher than that of J. acutus seeds, ...
Effect of multiple subcultures on Musa shoots derived from cassava ...
African Journals Online (AJOL)
STORAGESEVER
2008-12-17
Dec 17, 2008 ... INTRODUCTION. Plant starches are suitable for gelling tissue culture media, comparing favorably with the more conventional gelling agent such as agar. Plant starches .... Computer programmes for the statistical analysis of data generated during the study ... 1992) programming language. The General ...
Quantum computers and quantum computations
International Nuclear Information System (INIS)
Valiev, Kamil' A
2005-01-01
This review outlines the principles of operation of quantum computers and their elements. The theory of ideal computers that do not interact with the environment and are immune to quantum decohering processes is presented. Decohering processes in quantum computers are investigated. The review considers methods for correcting quantum computing errors arising from the decoherence of the state of the quantum computer, as well as possible methods for the suppression of the decohering processes. A brief enumeration of proposed quantum computer realizations concludes the review. (reviews of topical problems)
Quantum Computing for Computer Architects
Metodi, Tzvetan
2011-01-01
Quantum computers can (in theory) solve certain problems far faster than a classical computer running any known classical algorithm. While existing technologies for building quantum computers are in their infancy, it is not too early to consider their scalability and reliability in the context of the design of large-scale quantum computers. To architect such systems, one must understand what it takes to design and model a balanced, fault-tolerant quantum computer architecture. The goal of this lecture is to provide architectural abstractions for the design of a quantum computer and to explore
Energy Technology Data Exchange (ETDEWEB)
NONE
2011-03-15
This report is a kind of audit report on a research laboratory, the DEC (Departement d'Etudes des Combustibles, Fuel Study Department) which comprises four departments: a department of analysis and characterization of fuel behaviour (SA3C) which comprises four laboratories, a Plutonium, Uranium and Minor Actinides department (SPUA) which comprises four laboratories, a department for the investigation and simulation of fuel behaviour (four laboratories) and the Leca-Star department (3 laboratories and a project group). The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications on different themes (fundamental research on fuels, fuel design, fabrications, characterizations and property measurements, experimental irradiations, characterization of irradiated fuels and chemical and radio-chemical analysis, modelling and simulation). A more detailed assessment is presented for each theme in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project
Directory of Open Access Journals (Sweden)
Dutra, Giovana Martins Cezar
2007-01-01
Full Text Available O objetivo deste estudo foi comparar o desempenho de dois sistemas de medição de densidade óptica numa amostra composta por segundos molares decíduos, assim como relacionar a presença de lesão de cárie dentinária na superfície oclusal de segundos molares decíduos com os valores de densidade óptica desta superfície, utilizando dois programas de computador. Para isso foi realizada a medição da densidade óptica de 28 radiografias padronizadas de segundos molares decíduos em dois programas de computador diferentes. Os resultados obtidos com o programa Digora® for Windows 2. 1 foram comparados com os obtidos no programa Image Tool for Windows 3. 0. Ainda, os valores de densidade óptica encontrados foram relacionados aos diagnósticos obtidos com o exame dos dentes no estereomicroscópio. Os programas Digora e Image Tool apresentaram valores de densidade óptica semelhantes, sem diferença estatisticamente significativa. Ainda, a densidade óptica observada nos dentes que não apresentavam lesões de cárie dentinárias na superfície oclusal foi diferente daquela cujos dentes possuiam lesão em dentina (p = 0,035. Entretanto, com os resultados obtidos neste estudo não foi possível estabelecer intervalos de densidade óptica correspondentes a superfícies oclusais com presença ou ausência de lesões de cárie em dentina
International Nuclear Information System (INIS)
Tribaldos, V.; Milligen, B.Ph., van; Lopez-Fraguas, A.
1996-01-01
This report contains a detailed description of the TJ-II library and its routines. The library is written in FORTRAN 77 language and is available in the CRAY J916 and DEC Alpha 8400 computers at CIEMAT. This document also contains some examples of its use. (Author)
1988-07-15
Bio . data available upon request) Mr. Brian D. James, Ph.D. (candidate) Computer Data Processing Engineer Responsible for supervising UIC-.EECS/CL DEC...city and surrounding parks such as the Bell Tower, the marvellous Shaanxi Prcvincial Museum with its impressive forest of steles and stone carvings
Operational Based Vision Assessment Research: Depth Perception
2014-11-01
Potential hazards of viewing 3-D stereoscopic television, cinema and computer games: a review. Ophthalmic Physiol Opt 2011; 31:111-22. 75. Watt SJ...the 2012 Interservice/Industry Training, Simulation, and Education Conference (I/ITSEC); 2012 Dec 3-6; Orlando, FL. 82. Blake R, Fox R. The
Privacy-Preserving Computation with Trusted Computing via Scramble-then-Compute
Dang Hung; Dinh Tien Tuan Anh; Chang Ee-Chien; Ooi Beng Chin
2017-01-01
We consider privacy-preserving computation of big data using trusted computing primitives with limited private memory. Simply ensuring that the data remains encrypted outside the trusted computing environment is insufficient to preserve data privacy, for data movement observed during computation could leak information. While it is possible to thwart such leakage using generic solution such as ORAM [42], designing efficient privacy-preserving algorithms is challenging. Besides computation effi...
Computable Frames in Computable Banach Spaces
Directory of Open Access Journals (Sweden)
S.K. Kaushik
2016-06-01
Full Text Available We develop some parts of the frame theory in Banach spaces from the point of view of Computable Analysis. We define computable M-basis and use it to construct a computable Banach space of scalar valued sequences. Computable Xd frames and computable Banach frames are also defined and computable versions of sufficient conditions for their existence are obtained.
Specialized computer architectures for computational aerodynamics
Stevenson, D. K.
1978-01-01
In recent years, computational fluid dynamics has made significant progress in modelling aerodynamic phenomena. Currently, one of the major barriers to future development lies in the compute-intensive nature of the numerical formulations and the relative high cost of performing these computations on commercially available general purpose computers, a cost high with respect to dollar expenditure and/or elapsed time. Today's computing technology will support a program designed to create specialized computing facilities to be dedicated to the important problems of computational aerodynamics. One of the still unresolved questions is the organization of the computing components in such a facility. The characteristics of fluid dynamic problems which will have significant impact on the choice of computer architecture for a specialized facility are reviewed.
CASE/A - COMPUTER AIDED SYSTEM ENGINEERING AND ANALYSIS, ECLSS/ATCS SERIES
Bacskay, A.
1994-01-01
, specific heat, density, and viscosity) is generated at user-selected output intervals and stored for reference. The Integrated Plot Utility (IPU) provides plotting capability for all data output. System utility commands are provided to enable the user to operate more efficiently in the CASE/A environment. The user is able to customize a simulation through optional operations FORTRAN logic. This user-developed code is compiled and linked with a CASE/A model and enables the user to control and timeline component operating parameters during various phases of the iterative solution process. CASE/A provides for transient tracking of the flow stream constituents and determination of their thermodynamic state throughout an ECLSS/ATCS simulation, performing heat transfer, chemical reaction, mass/energy balance, and system pressure drop analysis based on user-specified operating conditions. The program tracks each constituent through all combination and decomposition states while maintaining a mass and energy balance on the overall system. This allows rapid assessment of ECLSS designs, the impact of alternate technologies, and impacts due to changes in metabolic forcing functions, consumables usage, and system control considerations. CASE/A is written in FORTRAN 77 for the DEC VAX/VMS computer series, and requires 12Mb of disk storage and a minimum paging file quota of 20,000 pages. The program operates on the Tektronix 4014 graphics standard and VT100 text standard. The program requires a Tektronix 4014 or later graphics terminal, third party composite graphics/text terminal, or personal computer loaded with appropriate VT100/TEK 4014 emulator software. The use of composite terminals or personal computers with popular emulation software is recommended for enhanced CASE/A operations and general ease of use. The program is available on an unlabeled 9-track 6250 BPI DEC VAX BACKUP format magnetic tape. CASE/A development began in 1985 under contract to NASA/Marshall Space Flight
International Nuclear Information System (INIS)
2011-03-01
This report is a kind of audit report on a research laboratory, the DEC (Departement d'Etudes des Combustibles, Fuel Study Department) which comprises four departments: a department of analysis and characterization of fuel behaviour (SA3C) which comprises four laboratories, a Plutonium, Uranium and Minor Actinides department (SPUA) which comprises four laboratories, a department for the investigation and simulation of fuel behaviour (four laboratories) and the Leca-Star department (3 laboratories and a project group). The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications on different themes (fundamental research on fuels, fuel design, fabrications, characterizations and property measurements, experimental irradiations, characterization of irradiated fuels and chemical and radio-chemical analysis, modelling and simulation). A more detailed assessment is presented for each theme in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project
Integrated minicomputer alpha analysis system
International Nuclear Information System (INIS)
Vasilik, D.G.; Coy, D.E.; Seamons, M.; Henderson, R.W.; Romero, L.L.; Thomson, D.A.
1978-01-01
Approximately 1,000 stack and occupation air samples from plutonium and uranium facilities at LASL are analyzed daily. The concentrations of radio-nuclides in air are determined by measuring absolute alpha activities of particulates collected on air sample filter media. The Integrated Minicomputer Pulse system (IMPULSE) is an interface between many detectors of extremely simple design and a Digital Equipment Corporation (DEC) PDP-11/04 minicomputer. The detectors are photomultiplier tubes faced with zinc sulfide (ZnS). The average detector background is approximately 0.07 cpm. The IMPULSE system includes two mainframes, each of which can hold up to 64 detectors. The current hardware configuration includes 64 detectors in one mainframe and 40 detectors in the other. Each mainframe contains a minicomputer with 28K words of Random Access Memory. One minicomputer controls the detectors in both mainframes. A second computer was added for fail-safe redundancy and to support other laboratory computer requirements. The main minicomputer includes a dual floppy disk system and a dual DEC 'RK05' disk system for mass storage. The RK05 facilitates report generation and trend analysis. The IMPULSE hardware provides for passage of data from the detectors to the computer, and for passage of status and control information from the computer to the detector stations
Computer programming and computer systems
Hassitt, Anthony
1966-01-01
Computer Programming and Computer Systems imparts a "reading knowledge? of computer systems.This book describes the aspects of machine-language programming, monitor systems, computer hardware, and advanced programming that every thorough programmer should be acquainted with. This text discusses the automatic electronic digital computers, symbolic language, Reverse Polish Notation, and Fortran into assembly language. The routine for reading blocked tapes, dimension statements in subroutines, general-purpose input routine, and efficient use of memory are also elaborated.This publication is inten
International Nuclear Information System (INIS)
Carrigan, F.J.
1983-01-01
This methodology comprises two main sections, each executed on a different computer system. The first section, the Geologic Decision Model, has been computerized as an interactive PLATO program. Using the PLATO system, the geologist describes probabilistically the perceived states of geologic processes and conditions. The decision model analyzes this information and computes a probability distribution for mineral occurrence. The second section, the Endowment Simulation Model (program MASTER), is run on the DEC 10 and Cyber 175 computers. Program MASTER takes the product of the Geologic Decision Model, combines it with other data, and produces a probabilistic estimate of mineral endowment for the region being evaluated. Development and testing of the Arizona Appraisal System were carried out simultaneously over a period of about three years. During this period, four geologists from government and industry were called upon four or five times over a period of about a year for a study of the uranium (U 3 O 8 ) endowment in the San Juan Basin of northwestern New Mexico. The results produced by the system consist, for each geologist, of a probability distribution for tons of U 3 O 8 endowment for (1) each partition of each stratigraphic unit, (2) each stratigraphic unit as a whole, (3) ''formations'' or ''merged units'' (groups of stratigraphic units), and (4) the San Juan Basin as a whole (all stratigraphic units). The system also calculates the average distribution across all geologists for the various merged units and for the basin as a whole. The result for the basin as a whole (in thousands of tons) is: mean 3,855, variance 4,108 x 10 9 , and 95th percentile 6,541
Struga, Marta; Kossakowski, Jerzy; Stefańska, Joanna; Zimniak, Andrzej; Koziol, Anna E
2008-06-01
A new quaternary ammonium compound, bis-[2-hydroxy-3-(1,7,8,9,10-pentamethyl-3,5-dioxo-4-aza-tricyclo[5.2.1.0(2,6)]dec-8-en-4-yloxy)-propyl]-dimethyl-ammonium chloride (4), was synthesized. The compound was investigated for antibacterial activity, including Gram-positive cocci and Gram-negative rods, and antifungal activity. Compound 4 showed significant inhibition against Staphylococcus aureus. Research was carried out over 4 standard strains and 40 hospital strains. Elementary analysis and/or MS, (1)H NMR and (13)C NMR spectra confirmed the identity of the products. The molecular structure of 3 was determined by an X-ray analysis.
Karlheinz Schwarz; Rainer Breitling; Christian Allen
2013-01-01
Computation (ISSN 2079-3197; http://www.mdpi.com/journal/computation) is an international scientific open access journal focusing on fundamental work in the field of computational science and engineering. Computational science has become essential in many research areas by contributing to solving complex problems in fundamental science all the way to engineering. The very broad range of application domains suggests structuring this journal into three sections, which are briefly characterized ...
Toxic effects of neem products (Azadirachta indica A. Juss) on ...
African Journals Online (AJOL)
SERVER
2007-12-17
Dec 17, 2007 ... *Corresponding author. E-mail. E-mail: raymondndione@yahoo.fr. Phone: (221) ... others related compounds in neem products exhibit various modes of action .... microscope "Motic" connected to a computer, permitting us to get ..... Bacillus sphaericus Neide as a pathogen of mosquitoes. J. Invert. Pathol., 7: ...
Reliability and Utility of Impression Cytology in the Diagnosis of Dry ...
African Journals Online (AJOL)
2016-12-13
Dec 13, 2016 ... The prevalence of dry eye is considered to be more common ... Department of Surgery, College of Medicine, King Faisal University, 4Department of Biomedical Sciences, ... of computer use[8] and used to evaluate the efficacy of topical ... including a vision-related function scale, ocular surface symptoms.
A combinatorial enumeration problem of RNA secondary structures
African Journals Online (AJOL)
use
2011-12-21
Dec 21, 2011 ... interesting combinatorial questions (Chen et al., 2005;. Liu, 2006; Schmitt and Waterman 1994; Stein and. Waterman 1978). The research on the enumeration of. RNA secondary structures becomes one of the hot topics in Computational Molecular Biology. An RNA molecule is described by its sequences of.
cholangiopathy in a co-hort of hiv positive kenyan patients
African Journals Online (AJOL)
2013-12-01
Dec 1, 2013 ... seven had herpes zoster virus, one had broncho-pneumonia, ten had diarrhoea and thirty two had no infections. Seven patients .... computer and analysed using SPSS package. The results were expressed as mean .... with a history of any opportunistic infections (9). HAART administration accounts for the ...
modelling the behaviour of interface surfaces using the finite eleme
African Journals Online (AJOL)
user
Norwell, M.A.. 36. Wingo, etal, Hardware assisted self-collision for rigid and deformable surfaces, Journal of. Tele-operators and Virtual Environments. Dec., 2004. Vol. 13, No 6 pp 681-691. 37. Brian Von Herzen, etal. Geometric Collisions for Time- dependent parametric surfaces. ACM SIGGRAPH Computer Graphics, Aug.,.
1988-09-01
software programs capable of being used on a microcomputer will be considered for analysis. No software intended for use on a miniframe or mainframe...Dial-A-Log consists of a program written in a computer language called L-10 that is run on a DEC-20 miniframe . The combination of the specific...proliferation of software dealing with microcomputers. Instead, they were geared more towards managing the use of miniframe or mainframe computer
PENGEMBANGAN SISTEM EKSPERIMEN VISKOSITAS BERBASIS PERSONAL KOMPUTER DAN MIKROKONTROLER MCS-51
Yohandri Yohandri
2010-01-01
In this work, viscosity experiment system based on personal computer and microcontroller MCS-51 has been developed. The new model of viscosity experiment system is purposed to perfom the time and viscosity calculation automatically on the personal computer. The graph and statical analysis are used to determine characteristics of LDR sensor and experiment system such as sensitivity, accuracy, and precision. There were four main results of this research as follow : 1). LDR sensor resistance dec...
Erdogan, Yavuz
2009-01-01
The purpose of this paper is to compare the effects of paper-based and computer-based concept mappings on computer hardware achievement, computer anxiety and computer attitude of the eight grade secondary school students. The students were randomly allocated to three groups and were given instruction on computer hardware. The teaching methods used…
Cloud Computing: The Future of Computing
Aggarwal, Kanika
2013-01-01
Cloud computing has recently emerged as a new paradigm for hosting and delivering services over the Internet. Cloud computing is attractive to business owners as it eliminates the requirement for users to plan ahead for provisioning, and allows enterprises to start from the small and increase resources only when there is a rise in service demand. The basic principles of cloud computing is to make the computing be assigned in a great number of distributed computers, rather then local computer ...
1977-01-01
It was the first member of the VAX family of computers, the first commercially available 32-bit computer and the first MIPS (one million instructions per second). It is a family of abandoned mini-computers developed and manufactured by Digital Equipment Corporation (DEC). The name "VAX" comes from an acronym for "Virtual address eXtension" as the successor to the PDP-11. The computer and its operating system (VMS) were designed from scratch. The result was a truly reliable, powerful and user-friendly system. In addition its affordable price has enabled many institutions and universities to acquire it.
2001-12-01
and Lieutenant Namik Kaplan , Turkish Navy. Maj Tiefert’s thesis, “Modeling Control Channel Dynamics of SAAM using NS Network Simulation”, helped lay...DEC99] Deconinck , Dr. ir. Geert, Fault Tolerant Systems, ESAT / Division ACCA , Katholieke Universiteit Leuven, October 1999. [FRE00] Freed...Systems”, Addison-Wesley, 1989. [KAP99] Kaplan , Namik, “Prototyping of an Active and Lightweight Router,” March 1999 [KAT99] Kati, Effraim
Interface design of VSOP'94 computer code for safety analysis
International Nuclear Information System (INIS)
Natsir, Khairina; Andiwijayakusuma, D.; Wahanani, Nursinta Adi; Yazid, Putranto Ilham
2014-01-01
Today, most software applications, also in the nuclear field, come with a graphical user interface. VSOP'94 (Very Superior Old Program), was designed to simplify the process of performing reactor simulation. VSOP is a integrated code system to simulate the life history of a nuclear reactor that is devoted in education and research. One advantage of VSOP program is its ability to calculate the neutron spectrum estimation, fuel cycle, 2-D diffusion, resonance integral, estimation of reactors fuel costs, and integrated thermal hydraulics. VSOP also can be used to comparative studies and simulation of reactor safety. However, existing VSOP is a conventional program, which was developed using Fortran 65 and have several problems in using it, for example, it is only operated on Dec Alpha mainframe platforms and provide text-based output, difficult to use, especially in data preparation and interpretation of results. We develop a GUI-VSOP, which is an interface program to facilitate the preparation of data, run the VSOP code and read the results in a more user friendly way and useable on the Personal 'Computer (PC). Modifications include the development of interfaces on preprocessing, processing and postprocessing. GUI-based interface for preprocessing aims to provide a convenience way in preparing data. Processing interface is intended to provide convenience in configuring input files and libraries and do compiling VSOP code. Postprocessing interface designed to visualized the VSOP output in table and graphic forms. GUI-VSOP expected to be useful to simplify and speed up the process and analysis of safety aspects
Interface design of VSOP'94 computer code for safety analysis
Natsir, Khairina; Yazid, Putranto Ilham; Andiwijayakusuma, D.; Wahanani, Nursinta Adi
2014-09-01
Today, most software applications, also in the nuclear field, come with a graphical user interface. VSOP'94 (Very Superior Old Program), was designed to simplify the process of performing reactor simulation. VSOP is a integrated code system to simulate the life history of a nuclear reactor that is devoted in education and research. One advantage of VSOP program is its ability to calculate the neutron spectrum estimation, fuel cycle, 2-D diffusion, resonance integral, estimation of reactors fuel costs, and integrated thermal hydraulics. VSOP also can be used to comparative studies and simulation of reactor safety. However, existing VSOP is a conventional program, which was developed using Fortran 65 and have several problems in using it, for example, it is only operated on Dec Alpha mainframe platforms and provide text-based output, difficult to use, especially in data preparation and interpretation of results. We develop a GUI-VSOP, which is an interface program to facilitate the preparation of data, run the VSOP code and read the results in a more user friendly way and useable on the Personal 'Computer (PC). Modifications include the development of interfaces on preprocessing, processing and postprocessing. GUI-based interface for preprocessing aims to provide a convenience way in preparing data. Processing interface is intended to provide convenience in configuring input files and libraries and do compiling VSOP code. Postprocessing interface designed to visualized the VSOP output in table and graphic forms. GUI-VSOP expected to be useful to simplify and speed up the process and analysis of safety aspects.
17_99 - 106_Luka Fito_Evidence of Climate Change - Revised LFB B
African Journals Online (AJOL)
user pc
2017-12-02
Dec 2, 2017 ... ABSTRACT. The paper seeks to investigate whether evolv with the projections made by global warming air temperature on a monthly time scale. T. Nigerian Meteorological Agency (NIMET). The coverage of the study area. Descriptive stati were computed for all the stations. coefficient of variation) were also ...
Denise Lins de Sousa
2008-01-01
Um dos principais objetivos do tratamento endodÃntico dos canais radiculares de dentes com polpa necrÃtica consiste em eliminar os microorganismos localizados no sistema de canais radiculares. Dessa forma, esta dissertaÃÃo, constituÃda por um artigo, propÃe-se a avaliar o efeito antibacteriano do preparo quÃmico-mecÃnico e de uma pasta à base de hidrÃxido de cÃlcio sobre bactÃrias presentes em canais radiculares de dentes decÃduos necrosados apÃs trauma bem como verificar a presenÃa dos micro...
Neural computation and the computational theory of cognition.
Piccinini, Gualtiero; Bahar, Sonya
2013-04-01
We begin by distinguishing computationalism from a number of other theses that are sometimes conflated with it. We also distinguish between several important kinds of computation: computation in a generic sense, digital computation, and analog computation. Then, we defend a weak version of computationalism-neural processes are computations in the generic sense. After that, we reject on empirical grounds the common assimilation of neural computation to either analog or digital computation, concluding that neural computation is sui generis. Analog computation requires continuous signals; digital computation requires strings of digits. But current neuroscientific evidence indicates that typical neural signals, such as spike trains, are graded like continuous signals but are constituted by discrete functional elements (spikes); thus, typical neural signals are neither continuous signals nor strings of digits. It follows that neural computation is sui generis. Finally, we highlight three important consequences of a proper understanding of neural computation for the theory of cognition. First, understanding neural computation requires a specially designed mathematical theory (or theories) rather than the mathematical theories of analog or digital computation. Second, several popular views about neural computation turn out to be incorrect. Third, computational theories of cognition that rely on non-neural notions of computation ought to be replaced or reinterpreted in terms of neural computation. Copyright © 2012 Cognitive Science Society, Inc.
NINJA: a noninvasive framework for internal computer security hardening
Allen, Thomas G.; Thomson, Steve
2004-07-01
Vulnerabilities are a growing problem in both the commercial and government sector. The latest vulnerability information compiled by CERT/CC, for the year ending Dec. 31, 2002 reported 4129 vulnerabilities representing a 100% increase over the 2001 [1] (the 2003 report has not been published at the time of this writing). It doesn"t take long to realize that the growth rate of vulnerabilities greatly exceeds the rate at which the vulnerabilities can be fixed. It also doesn"t take long to realize that our nation"s networks are growing less secure at an accelerating rate. As organizations become aware of vulnerabilities they may initiate efforts to resolve them, but quickly realize that the size of the remediation project is greater than their current resources can handle. In addition, many IT tools that suggest solutions to the problems in reality only address "some" of the vulnerabilities leaving the organization unsecured and back to square one in searching for solutions. This paper proposes an auditing framework called NINJA (acronym for Network Investigation Notification Joint Architecture) for noninvasive daily scanning/auditing based on common security vulnerabilities that repeatedly occur in a network environment. This framework is used for performing regular audits in order to harden an organizations security infrastructure. The framework is based on the results obtained by the Network Security Assessment Team (NSAT) which emulates adversarial computer network operations for US Air Force organizations. Auditing is the most time consuming factor involved in securing an organization's network infrastructure. The framework discussed in this paper uses existing scripting technologies to maintain a security hardened system at a defined level of performance as specified by the computer security audit team. Mobile agents which were under development at the time of this writing are used at a minimum to improve the noninvasiveness of our scans. In general, noninvasive
IT Services availability during CERN annual closure Dec 2004-Jan2005
2004-01-01
Mail, CERN Windows (NICE), Web services, LXPLUS, LXBATCH, AFS, Automated tape devices, Castor, Backups, software license servers, Sundev, CVS and Print Servers, CDS Search, Submit and Agenda, InDiCo, EDMS (in collaboration with TS Department), CMS disc servers, the AB NFS servers (SLNFS1, PSNFS1 and MTBNFS1, that PS group runs for AB Department), Campus Network, Remedy, and Security services will be available during the CERN annual closure. The physics database cluster, replication location service as well as accdb, cerndb and admsdb are the only databases available; CCDB will be closed for public access. Problems developing on scheduled services should be addressed within about half a day except around Christmas Eve and Christmas Day (24 and 25 December) and New Year's Eve and New Year's Day (31 December and 1st January). For Administrative Computing Services, ERT (Electronic Recruitment Tool) will be the only service operational; all other AIS applications such as EDH, CET, HRT etc. will be unavailable. Al...
Energy Technology Data Exchange (ETDEWEB)
Sperling, M.; Shreve, D.C.
1978-12-01
The computer code DELPHI is an interactive English language command system for the analysis of airborne radiometric data. The code includes modules for data reduction, data simulation, time filtering, data adjustment and graphical presentation of the results. DELPHI is implemented in FORTRAN on a DEC-10 computer. This volume gives a brief set of operations instructions, samples of the output obtained from hard copies of the display on a Tektronix terminal and finally a listing of the code.
International Nuclear Information System (INIS)
Sperling, M.; Shreve, D.C.
1978-01-01
The computer code DELPHI is an interactive English language command system for the analysis of airborne radiometric data. The code includes modules for data reduction, data simulation, time filtering, data adjustment and graphical presentation of the results. DELPHI is implemented in FORTRAN on a DEC-10 computer. This volume gives a brief set of operations instructions, samples of the output obtained from hard copies of the display on a Tektronix terminal and finally a listing of the code
Neural Computation and the Computational Theory of Cognition
Piccinini, Gualtiero; Bahar, Sonya
2013-01-01
We begin by distinguishing computationalism from a number of other theses that are sometimes conflated with it. We also distinguish between several important kinds of computation: computation in a generic sense, digital computation, and analog computation. Then, we defend a weak version of computationalism--neural processes are computations in the…
Organization of bubble chamber image processing
International Nuclear Information System (INIS)
Gritsaenko, I.A.; Petrovykh, L.P.; Petrovykh, Yu.L.; Fenyuk, A.B.
1985-01-01
A programme of bubble chamber image processing is described. The programme is written in FORTRAN, it is developed for the DEC-10 computer and is designed for operation of semi-automation processing-measurement projects PUOS-2 and PUOS-4. Fornalization of the image processing permits to use it for different physical experiments
Phase separation phenomena in branching conduits. Topical report Dec 78-Dec 81
International Nuclear Information System (INIS)
Saba, N.; Lahey, R.T. Jr.
1982-03-01
The analysis of Light Water Reactor (LWR) Loss-of-Coolant Accidents (LOCA's) requires that one be able to accurately calculate the two-phase flow splits in complex, branching conduits. The purpose of this study is to provide a general method for calculating the phase separation in a branching conduit. The degree of phase separation of a two-phase (air/water) mixture flowing through a plexiglas tee test section was measured. In addition, flow visualization, using high speed photography, was performed. The experimental design considerations, error analysis and the dependence of the observed phase separation on global parameters, such as inlet quality, mass flux and separation angle, are discussed. The pressure gradients were measured along the various conduits and the differential pressure was obtained at the tee junction by extrapolation. It was found that the degree of phase separation was quite pronounced, with the vapor phase preferentially separating into the branch. Using these data, a physically-based empirical model was developed with which to calculate the phasic distribution of a subsonic two-phase mixture in the downstream branches of a branching conduit
Installation of MCNP on 64-bit parallel computers
International Nuclear Information System (INIS)
Meginnis, A.B.; Hendricks, J.S.; McKinney, G.W.
1995-01-01
The Monte Carlo radiation transport code MCNP has been successfully ported to two 64-bit workstations, the SGI and DEC Alpha. We found the biggest problem for installation on these machines to be Fortran and C mismatches in argument passing. Correction of these mismatches enabled, for the first time, dynamic memory allocation on 64-bit workstations. Although the 64-bit hardware is faster because 8-bytes are processed at a time rather than 4-bytes, we found no speed advantage in true 64-bit coding versus implicit double precision when porting an existing code to the 64-bit workstation architecture. We did find that PVM multiasking is very successful and represents a significant performance enhancement for scientific workstations
VizieR Online Data Catalog: The FIRST Survey Catalog, Version 2014Dec17 (Helfand+ 2015)
Helfand, D. J.; White, R. L.; Becker, R. H.
2015-05-01
The Faint Images of the Radio Sky at Twenty centimeters (FIRST) began in 1993. It uses the VLA (Very Large Array, a facility of the National Radio Observatory (NRAO)) at a frequency of 1.4GHz, and it is slated to 10,000 deg2 of the North and South Galactic Caps, to a sensitivity of about 1mJy with an angular resolution of about 5''. The images produced by an automated mapping pipeline have pixels of 1.8'', a typical rms of 0.15mJy, and a resolution of 5''; the images are available on the Internet (see the FIRST home page at http://sundog.stsci.edu/ for details). The source catalogue is derived from the images. This catalog from the 1993 through 2011 observations contains 946,432 sources from the north and south Galactic caps. It covers a total of 10,575 square degrees of the sky (8444 square degrees in the north and 2131 square degrees in the south). In this version of the catalog, images taken in the the new EVLA configuration have been re-reduced using shallower CLEAN thresholds in order to reduce the "CLEAN bias" in those images. Also, the EVLA images are not co-added with older VLA images to avoid problems resulting from the different frequencies and noise properties of the configurations. That leads to small gaps in the sky coverage at boundaries between the EVLA and VLA regions. As a result, the area covered by this release of the catalog is about 60 square degrees smaller than the earlier release of the catalog (13Jun05, also available here as the "first13.dat" file), and the total number of sources is reduced by nearly 25,000. The previous version of the catalog does have sources in the overlap regions, but their flux densities are considered unreliable due to calibration errors. The flux densities should be more accurate in this catalog, biases are smaller, and the incidence of spurious sources is also reduced. Over most of the survey area, the detection limit is 1 mJy. A region along the equatorial strip (RA=21.3 to 3.3hr, Dec=-1 to 1deg) has a deeper
Computer-aided design and computer science technology
Fulton, R. E.; Voigt, S. J.
1976-01-01
A description is presented of computer-aided design requirements and the resulting computer science advances needed to support aerospace design. The aerospace design environment is examined, taking into account problems of data handling and aspects of computer hardware and software. The interactive terminal is normally the primary interface between the computer system and the engineering designer. Attention is given to user aids, interactive design, interactive computations, the characteristics of design information, data management requirements, hardware advancements, and computer science developments.
Directory of Open Access Journals (Sweden)
Karlheinz Schwarz
2013-09-01
Full Text Available Computation (ISSN 2079-3197; http://www.mdpi.com/journal/computation is an international scientific open access journal focusing on fundamental work in the field of computational science and engineering. Computational science has become essential in many research areas by contributing to solving complex problems in fundamental science all the way to engineering. The very broad range of application domains suggests structuring this journal into three sections, which are briefly characterized below. In each section a further focusing will be provided by occasionally organizing special issues on topics of high interests, collecting papers on fundamental work in the field. More applied papers should be submitted to their corresponding specialist journals. To help us achieve our goal with this journal, we have an excellent editorial board to advise us on the exciting current and future trends in computation from methodology to application. We very much look forward to hearing all about the research going on across the world. [...
Interface design of VSOP'94 computer code for safety analysis
Energy Technology Data Exchange (ETDEWEB)
Natsir, Khairina, E-mail: yenny@batan.go.id; Andiwijayakusuma, D.; Wahanani, Nursinta Adi [Center for Development of Nuclear Informatics - National Nuclear Energy Agency, PUSPIPTEK, Serpong, Tangerang, Banten (Indonesia); Yazid, Putranto Ilham [Center for Nuclear Technology, Material and Radiometry- National Nuclear Energy Agency, Jl. Tamansari No.71, Bandung 40132 (Indonesia)
2014-09-30
Today, most software applications, also in the nuclear field, come with a graphical user interface. VSOP'94 (Very Superior Old Program), was designed to simplify the process of performing reactor simulation. VSOP is a integrated code system to simulate the life history of a nuclear reactor that is devoted in education and research. One advantage of VSOP program is its ability to calculate the neutron spectrum estimation, fuel cycle, 2-D diffusion, resonance integral, estimation of reactors fuel costs, and integrated thermal hydraulics. VSOP also can be used to comparative studies and simulation of reactor safety. However, existing VSOP is a conventional program, which was developed using Fortran 65 and have several problems in using it, for example, it is only operated on Dec Alpha mainframe platforms and provide text-based output, difficult to use, especially in data preparation and interpretation of results. We develop a GUI-VSOP, which is an interface program to facilitate the preparation of data, run the VSOP code and read the results in a more user friendly way and useable on the Personal 'Computer (PC). Modifications include the development of interfaces on preprocessing, processing and postprocessing. GUI-based interface for preprocessing aims to provide a convenience way in preparing data. Processing interface is intended to provide convenience in configuring input files and libraries and do compiling VSOP code. Postprocessing interface designed to visualized the VSOP output in table and graphic forms. GUI-VSOP expected to be useful to simplify and speed up the process and analysis of safety aspects.
Computing handbook computer science and software engineering
Gonzalez, Teofilo; Tucker, Allen
2014-01-01
Overview of Computer Science Structure and Organization of Computing Peter J. DenningComputational Thinking Valerie BarrAlgorithms and Complexity Data Structures Mark WeissBasic Techniques for Design and Analysis of Algorithms Edward ReingoldGraph and Network Algorithms Samir Khuller and Balaji RaghavachariComputational Geometry Marc van KreveldComplexity Theory Eric Allender, Michael Loui, and Kenneth ReganFormal Models and Computability Tao Jiang, Ming Li, and Bala
CERN technical training: available places in forthcoming courses
HR Department
The following course sessions are scheduled in the framework of the 2009 CERN Technical Training Programme and places are still available. You can find the full updated Technical Training course programme in our web catalogue. Software and system technologies Developing secure software\t07-DEC-09\t07-DEC-09\t0.5 day\tEnglish PERL 5 - Advanced Aspects\t10-DEC-09\t10-DEC-09\t1 day\tEnglish Project Development using Python\t01-DEC-09\t04-DEC-09\t4 days\tEnglish Electronic design Advanced VHDL for FPGA Design\t30-Nov-09\t04-DEC-09\t5 days\tEnglish LabVIEW - Working efficiently with LabVIEW 8\t07-DEC-09\t07-DEC-09\t1 day\tEnglish LabVIEW Basic I with RADE introduction\t30-Nov-09\t02-DEC-09\t3 days\tEnglish LabVIEW Basics 2\t03-DEC-09\t04-DEC-09\t2 days\tEnglish Mechanical design Office software Dreamweaver CS3 - Level 2\t04-DEC-09\t04-DEC-09\t1 jour\tFrench CERN EDMS - Introduction\t02-dec-09\t02-dec-09\t1 jour\tFrench Sharepoint Designer (Frontpage) - Level 1\t07-DEC-09\t08-DEC-09\t2 days\tEnglish Special course Egroups training\t15-DE...
Computer architecture fundamentals and principles of computer design
Dumas II, Joseph D
2005-01-01
Introduction to Computer ArchitectureWhat is Computer Architecture?Architecture vs. ImplementationBrief History of Computer SystemsThe First GenerationThe Second GenerationThe Third GenerationThe Fourth GenerationModern Computers - The Fifth GenerationTypes of Computer SystemsSingle Processor SystemsParallel Processing SystemsSpecial ArchitecturesQuality of Computer SystemsGenerality and ApplicabilityEase of UseExpandabilityCompatibilityReliabilitySuccess and Failure of Computer Architectures and ImplementationsQuality and the Perception of QualityCost IssuesArchitectural Openness, Market Timi
Discrete event command and control for networked teams with multiple missions
Lewis, Frank L.; Hudas, Greg R.; Pang, Chee Khiang; Middleton, Matthew B.; McMurrough, Christopher
2009-05-01
During mission execution in military applications, the TRADOC Pamphlet 525-66 Battle Command and Battle Space Awareness capabilities prescribe expectations that networked teams will perform in a reliable manner under changing mission requirements, varying resource availability and reliability, and resource faults. In this paper, a Command and Control (C2) structure is presented that allows for computer-aided execution of the networked team decision-making process, control of force resources, shared resource dispatching, and adaptability to change based on battlefield conditions. A mathematically justified networked computing environment is provided called the Discrete Event Control (DEC) Framework. DEC has the ability to provide the logical connectivity among all team participants including mission planners, field commanders, war-fighters, and robotic platforms. The proposed data management tools are developed and demonstrated on a simulation study and an implementation on a distributed wireless sensor network. The results show that the tasks of multiple missions are correctly sequenced in real-time, and that shared resources are suitably assigned to competing tasks under dynamically changing conditions without conflicts and bottlenecks.
Steam Generator Group Project. Progress report on data acquisition/statistical analysis
International Nuclear Information System (INIS)
Doctor, P.G.; Buchanan, J.A.; McIntyre, J.M.; Hof, P.J.; Ercanbrack, S.S.
1984-01-01
A major task of the Steam Generator Group Project (SGGP) is to establish the reliability of the eddy current inservice inspections of PWR steam generator tubing, by comparing the eddy current data to the actual physical condition of the tubes via destructive analyses. This report describes the plans for the computer systems needed to acquire, store and analyze the diverse data to be collected during the project. The real-time acquisition of the baseline eddy current inspection data will be handled using a specially designed data acquisition computer system based on a Digital Equipment Corporation (DEC) PDP-11/44. The data will be archived in digital form for use after the project is completed. Data base management and statistical analyses will be done on a DEC VAX-11/780. Color graphics will be heavily used to summarize the data and the results of the analyses. The report describes the data that will be taken during the project and the statistical methods that will be used to analyze the data. 7 figures, 2 tables
Straight flavor of Binary Number in Decimal Number System
MD. Abdul Awal Ansary; Sushanta Acharjee
2012-01-01
Different number systems are available on the basis of their base numbers. For instance, decimal number system is of base 10, hexadecimal number system which base is 16 and, Binary number system which base is 2 etc. Some numbers systems are easy to understand by the human being and some are easy to understand by electronics machine for instance digital computers. Computers only can understand data and instructions that are stored in binary form, though we input the data and instruction in dec...
Computer surety: computer system inspection guidance. [Contains glossary
Energy Technology Data Exchange (ETDEWEB)
1981-07-01
This document discusses computer surety in NRC-licensed nuclear facilities from the perspective of physical protection inspectors. It gives background information and a glossary of computer terms, along with threats and computer vulnerabilities, methods used to harden computer elements, and computer audit controls.
BONFIRE: benchmarking computers and computer networks
Bouckaert, Stefan; Vanhie-Van Gerwen, Jono; Moerman, Ingrid; Phillips, Stephen; Wilander, Jerker
2011-01-01
The benchmarking concept is not new in the field of computing or computer networking. With “benchmarking tools”, one usually refers to a program or set of programs, used to evaluate the performance of a solution under certain reference conditions, relative to the performance of another solution. Since the 1970s, benchmarking techniques have been used to measure the performance of computers and computer networks. Benchmarking of applications and virtual machines in an Infrastructure-as-a-Servi...
A survey of computational physics introductory computational science
Landau, Rubin H; Bordeianu, Cristian C
2008-01-01
Computational physics is a rapidly growing subfield of computational science, in large part because computers can solve previously intractable problems or simulate natural processes that do not have analytic solutions. The next step beyond Landau's First Course in Scientific Computing and a follow-up to Landau and Páez's Computational Physics, this text presents a broad survey of key topics in computational physics for advanced undergraduates and beginning graduate students, including new discussions of visualization tools, wavelet analysis, molecular dynamics, and computational fluid dynamics
CERN Technical training: Available places in forthcoming courses
HR Department
2010-01-01
The following course sessions are scheduled in the framework of the 2010 CERN Technical Training Programme and places are still available. You can find the full updated Technical Training course programme in our web catalogue. Software and system technologies Emacs - way beyond Text Editing\t09-DEC-10\t09-DEC-10\tEnglish\t3 days ITIL Foundations (version 3) EXAMINATION\t13-DEC-10\t13-DEC-10\tEnglish\t1 hour JAVA 2 Enterprise Edition - Part 2: Enterprise JavaBeans\t13-DEC-10\t15-DEC-10\tEnglish\t3 days JCOP - Joint PVSS-JCOP Framework\t29-Nov-10\t03-DEC-10\tEnglish\t4.5 days Object-oriented Design Patterns\t06-DEC-10\t08-DEC-10\tEnglish\t3 days Oracle - Programming with PL/SQL\t06-DEC-10\t08-DEC-10\tEnglish\t3 days Oracle - SQL\t01-DEC-10\t03-DEC-10\tEnglish\t3 days PERL 5 - Advanced Aspects\t30-Nov-10\t30-Nov-10\tEnglish\t1 day XML - Introduction\t01-DEC-10\t02-DEC-10\tEnglish\t2 days Electronic design Cours de base Automation du bâtiment\t15-DEC-10\t17-DEC-10\tFrench\t3 jours LabVIEW Core I with RADE introduction\t29-Nov-10\t01-DEC-10\tBi...
Riemannian computing in computer vision
Srivastava, Anuj
2016-01-01
This book presents a comprehensive treatise on Riemannian geometric computations and related statistical inferences in several computer vision problems. This edited volume includes chapter contributions from leading figures in the field of computer vision who are applying Riemannian geometric approaches in problems such as face recognition, activity recognition, object detection, biomedical image analysis, and structure-from-motion. Some of the mathematical entities that necessitate a geometric analysis include rotation matrices (e.g. in modeling camera motion), stick figures (e.g. for activity recognition), subspace comparisons (e.g. in face recognition), symmetric positive-definite matrices (e.g. in diffusion tensor imaging), and function-spaces (e.g. in studying shapes of closed contours). · Illustrates Riemannian computing theory on applications in computer vision, machine learning, and robotics · Emphasis on algorithmic advances that will allow re-application in other...
Progress report no.5 for period Jan.1 to Dec.31, 1996
DEFF Research Database (Denmark)
Larsen, Poul Scheel
1996-01-01
nature have been investigated, including flows in industrial process equipment, around aerodynamics structures and ships, and flows over bed forms of importance for sediment transport. The experimental work has included the development of improved techniques, emphasizing optical methods.The objectives...... & Development of experimental techniquesProject 5. Flow over bed formsProject 6. Flow past ship hull.An additional Project 0, defined for budgetary reasons, has covered common activities and indirect actions in the form of collaboration on a small scale with other research groups.General aspects are summarized...... the education and training of researchers within the field of computational and experimental fluid mechanics. This includes 12 Ph.D. candidates fully or partially funded by the program, an aboutequal number of Ph.D. candidates working on associated problems and gaining from the program, as well as a number...
Privacy-Preserving Computation with Trusted Computing via Scramble-then-Compute
Directory of Open Access Journals (Sweden)
Dang Hung
2017-07-01
Full Text Available We consider privacy-preserving computation of big data using trusted computing primitives with limited private memory. Simply ensuring that the data remains encrypted outside the trusted computing environment is insufficient to preserve data privacy, for data movement observed during computation could leak information. While it is possible to thwart such leakage using generic solution such as ORAM [42], designing efficient privacy-preserving algorithms is challenging. Besides computation efficiency, it is critical to keep trusted code bases lean, for large ones are unwieldy to vet and verify. In this paper, we advocate a simple approach wherein many basic algorithms (e.g., sorting can be made privacy-preserving by adding a step that securely scrambles the data before feeding it to the original algorithms. We call this approach Scramble-then-Compute (StC, and give a sufficient condition whereby existing external memory algorithms can be made privacy-preserving via StC. This approach facilitates code-reuse, and its simplicity contributes to a smaller trusted code base. It is also general, allowing algorithm designers to leverage an extensive body of known efficient algorithms for better performance. Our experiments show that StC could offer up to 4.1× speedups over known, application-specific alternatives.
DEFF Research Database (Denmark)
Vallgårda, Anna K. A.; Redström, Johan
2007-01-01
Computational composite is introduced as a new type of composite material. Arguing that this is not just a metaphorical maneuver, we provide an analysis of computational technology as material in design, which shows how computers share important characteristics with other materials used in design...... and architecture. We argue that the notion of computational composites provides a precise understanding of the computer as material, and of how computations need to be combined with other materials to come to expression as material. Besides working as an analysis of computers from a designer’s point of view......, the notion of computational composites may also provide a link for computer science and human-computer interaction to an increasingly rapid development and use of new materials in design and architecture....
2010-04-01
.... 3 Source: The Exchange, New York Stock Exchange magazine, May, Aug., Nov. 1971 and Feb. 1972... November 30, 1971: EC14NO91.096 Exhibit II [Method of Computing the Investment Record of the New York Stock... 54.33 709 5,006 .71 Dec. 1971 56.43 742 5,183 .70 1 Source: New York Stock Exchange Composite Index...
Cloning and characterization of ATP synthase CF1 α gene from ...
African Journals Online (AJOL)
ajl yemi
2011-12-19
Dec 19, 2011 ... Kohler RH, Horn R, Lossl A (1991). Cytoplasmic male sterility in sunflower is correlated with the co-transcription of a new open reading frame with the atpA gene. Mol. Gen. Genet. 227: 369-376. Langmead B, Schatz MC, Lin J, Pop M, Salzberg SL (2009a). Searching for SNPs with cloud computing. Genom.
A neutron time-of-flight data acquisition system
International Nuclear Information System (INIS)
Morris, D.V.
1983-10-01
A neutron time-of-flight scaler system is described for use with the Harwell Linac. The equipment is sufficiently versatile to be used with several types of computers although normally used with DEC PDP 11/45 and PDP 11/34. Using a combination of different input and memory boards most types of experiments can be accommodated. (author)
Computer scientist looks at reliability computations
International Nuclear Information System (INIS)
Rosenthal, A.
1975-01-01
Results from the theory of computational complexity are applied to reliability computations on fault trees and networks. A well known class of problems which almost certainly have no fast solution algorithms is presented. It is shown that even approximately computing the reliability of many systems is difficult enough to be in this class. In the face of this result, which indicates that for general systems the computation time will be exponential in the size of the system, decomposition techniques which can greatly reduce the effective size of a wide variety of realistic systems are explored
Heterotic computing: exploiting hybrid computational devices.
Kendon, Viv; Sebald, Angelika; Stepney, Susan
2015-07-28
Current computational theory deals almost exclusively with single models: classical, neural, analogue, quantum, etc. In practice, researchers use ad hoc combinations, realizing only recently that they can be fundamentally more powerful than the individual parts. A Theo Murphy meeting brought together theorists and practitioners of various types of computing, to engage in combining the individual strengths to produce powerful new heterotic devices. 'Heterotic computing' is defined as a combination of two or more computational systems such that they provide an advantage over either substrate used separately. This post-meeting collection of articles provides a wide-ranging survey of the state of the art in diverse computational paradigms, together with reflections on their future combination into powerful and practical applications. © 2015 The Author(s) Published by the Royal Society. All rights reserved.
Woods, Damien; Naughton, Thomas J.
2008-01-01
We consider optical computers that encode data using images and compute by transforming such images. We give an overview of a number of such optical computing architectures, including descriptions of the type of hardware commonly used in optical computing, as well as some of the computational efficiencies of optical devices. We go on to discuss optical computing from the point of view of computational complexity theory, with the aim of putting some old, and some very recent, re...
International Development Research Centre (IDRC) Digital Library (Canada)
Gloria Lihemo
1 déc. 2015 ... Lisez sur un projet lauréat qui est consacré à la facilitation de l'accès aux informations fiables et opportunes pertinentes au climat pour aider ... rendre les zones urbaines plus sécuritaires et plus inclusives et une autre initiative qui génère des preuves plus profondes et des .... l'inégalité et la criminalité à.
M. Kasemann
Overview In autumn the main focus was to process and handle CRAFT data and to perform the Summer08 MC production. The operational aspects were well covered by regular Computing Shifts, experts on duty and Computing Run Coordination. At the Computing Resource Board (CRB) in October a model to account for service work at Tier 2s was approved. The computing resources for 2009 were reviewed for presentation at the C-RRB. The quarterly resource monitoring is continuing. Facilities/Infrastructure operations Operations during CRAFT data taking ran fine. This proved to be a very valuable experience for T0 workflows and operations. The transfers of custodial data to most T1s went smoothly. A first round of reprocessing started at the Tier-1 centers end of November; it will take about two weeks. The Computing Shifts procedure was tested full scale during this period and proved to be very efficient: 30 Computing Shifts Persons (CSP) and 10 Computing Resources Coordinators (CRC). The shift program for the shut down w...
Computational Intelligence, Cyber Security and Computational Models
Anitha, R; Lekshmi, R; Kumar, M; Bonato, Anthony; Graña, Manuel
2014-01-01
This book contains cutting-edge research material presented by researchers, engineers, developers, and practitioners from academia and industry at the International Conference on Computational Intelligence, Cyber Security and Computational Models (ICC3) organized by PSG College of Technology, Coimbatore, India during December 19–21, 2013. The materials in the book include theory and applications for design, analysis, and modeling of computational intelligence and security. The book will be useful material for students, researchers, professionals, and academicians. It will help in understanding current research trends and findings and future scope of research in computational intelligence, cyber security, and computational models.
Soft computing in computer and information science
Fray, Imed; Pejaś, Jerzy
2015-01-01
This book presents a carefully selected and reviewed collection of papers presented during the 19th Advanced Computer Systems conference ACS-2014. The Advanced Computer Systems conference concentrated from its beginning on methods and algorithms of artificial intelligence. Further future brought new areas of interest concerning technical informatics related to soft computing and some more technological aspects of computer science such as multimedia and computer graphics, software engineering, web systems, information security and safety or project management. These topics are represented in the present book under the categories Artificial Intelligence, Design of Information and Multimedia Systems, Information Technology Security and Software Technologies.
Use of the computer program in a cloud computing
Directory of Open Access Journals (Sweden)
Radovanović Sanja
2013-01-01
Full Text Available Cloud computing represents a specific networking, in which a computer program simulates the operation of one or more server computers. In terms of copyright, all technological processes that take place within the cloud computing are covered by the notion of copying computer programs, and exclusive right of reproduction. However, this right suffers some limitations in order to allow normal use of computer program by users. Based on the fact that the cloud computing is virtualized network, the issue of normal use of the computer program requires to put all aspects of the permitted copying into the context of a specific computing environment and specific processes within the cloud. In this sense, the paper pointed out that the user of a computer program in cloud computing, needs to obtain the consent of the right holder for any act which he undertakes using the program. In other words, the copyright in the cloud computing is a full scale, and thus the freedom of contract (in the case of this particular restriction as well.
Quantum Computing and the Limits of the Efficiently Computable
CERN. Geneva
2015-01-01
I'll discuss how computational complexity---the study of what can and can't be feasibly computed---has been interacting with physics in interesting and unexpected ways. I'll first give a crash course about computer science's P vs. NP problem, as well as about the capabilities and limits of quantum computers. I'll then touch on speculative models of computation that would go even beyond quantum computers, using (for example) hypothetical nonlinearities in the Schrodinger equation. Finally, I'll discuss BosonSampling ---a proposal for a simple form of quantum computing, which nevertheless seems intractable to simulate using a classical computer---as well as the role of computational complexity in the black hole information puzzle.
Directory of Open Access Journals (Sweden)
Maria Paula Mendonça SILVEIRA
2017-05-01
Full Text Available Resumo Introdução O medo de sentir dor é um dos principais motivos pelos quais muitos pacientes evitam submeter-se a tratamento dentário, principalmente as crianças. Em vários procedimentos odontopediátricos, o uso de anestésicos locais se faz necessário. O aparelho Morpheus® se propõe a uma introdução da agulha sem dor e anestesia satisfatória com uso de menor volume de anestésico local. Associando-o à técnica CaZOE, o paciente perceberia a pressão antes da dor, podendo assim evitá-la. Objetivo Avaliar a eficácia anestésica do Morpheus® através da técnica intrasseptal CaZOE na pulpotomia de molares inferiores decíduos. Material e método Dezenove voluntários foram selecionados de acordo com os critérios de inclusão e exclusão. O procedimento foi realizado em sessão única, utilizando 0,9 mL de Articaína 4% com epinefrina 1:100.000, através da técnica anestésica CaZOE, empregando o injetor de anestésicos Morpheus®. Esta foi realizada por um único operador, não envolvido na avaliação dos parâmetros da anestesia, e seguiu as recomendações do fabricante. Para a análise dos dados, foi realizada estatística descritiva. Resultado Dos 19 voluntários, 63% foram do sexo feminino e 37%, do masculino. Em pouco mais da metade da amostra (63%, houve sucesso na realização do procedimento. Os casos de insucesso (37% ocorreram durante a abertura coronária e a amputação da polpa. Conclusão A eficácia anestésica do Morpheus® através da técnica intrasseptal CaZOE na pulpotomia de molares inferiores decíduos foi constatada em 63% da amostra. Para que possa ser comprovada a eficácia desse sistema, são necessários mais estudos.
COMPARATIVE STUDY OF CLOUD COMPUTING AND MOBILE CLOUD COMPUTING
Nidhi Rajak*, Diwakar Shukla
2018-01-01
Present era is of Information and Communication Technology (ICT) and there are number of researches are going on Cloud Computing and Mobile Cloud Computing such security issues, data management, load balancing and so on. Cloud computing provides the services to the end user over Internet and the primary objectives of this computing are resource sharing and pooling among the end users. Mobile Cloud Computing is a combination of Cloud Computing and Mobile Computing. Here, data is stored in...
Ulmann, Bernd
2013-01-01
This book is a comprehensive introduction to analog computing. As most textbooks about this powerful computing paradigm date back to the 1960s and 1970s, it fills a void and forges a bridge from the early days of analog computing to future applications. The idea of analog computing is not new. In fact, this computing paradigm is nearly forgotten, although it offers a path to both high-speed and low-power computing, which are in even more demand now than they were back in the heyday of electronic analog computers.
CERN Technical Training: available places in forthcoming courses
HR Department
The following course sessions are scheduled in the framework of the 2009 CERN Technical Training Programme and places are still available. You can find the full updated Technical Training course programme in our web catalogue. Software and system technologies Developing secure software 07-DEC-09 07-DEC-09 0.5 day English JCOP - Joint PVSS-JCOP Framework 23-Nov-09 27-Nov-09 4.5 days English Oracle Database SQL Tuning 07-DEC-09 09-DEC-09 3 days English PERL 5 - Advanced Aspects 10-DEC-09 10-DEC-09 1 day English Project Development using Python 01-DEC-09 04-DEC-09 4 days English Python - Hands-on Introduction 08-DEC-09 10-DEC-09 3 days English Secure coding for Perl 26-Nov-09 26-Nov-09 1 day English Secure coding for PHP 25-Nov-09 25-Nov-09 1 day English Electronic design Advanced VHDL for FPGA Design 30-Nov-09 04-DEC-09 5 days English LabVIEW - Working efficiently with LabVIEW 8 07-DEC-09 07-DEC-09 1 day English LabVIEW Basic I with RADE introduction 30-Nov-09 02-DEC-09 3 days English LabVIEW Basics 2 03-D...
Quantum Computing's Classical Problem, Classical Computing's Quantum Problem
Van Meter, Rodney
2013-01-01
Tasked with the challenge to build better and better computers, quantum computing and classical computing face the same conundrum: the success of classical computing systems. Small quantum computing systems have been demonstrated, and intermediate-scale systems are on the horizon, capable of calculating numeric results or simulating physical systems far beyond what humans can do by hand. However, to be commercially viable, they must surpass what our wildly successful, highly advanced classica...
Cook, Perry R.
This chapter covers algorithms, technologies, computer languages, and systems for computer music. Computer music involves the application of computers and other digital/electronic technologies to music composition, performance, theory, history, and the study of perception. The field combines digital signal processing, computational algorithms, computer languages, hardware and software systems, acoustics, psychoacoustics (low-level perception of sounds from the raw acoustic signal), and music cognition (higher-level perception of musical style, form, emotion, etc.).
International Nuclear Information System (INIS)
Kondoh, Y.; Kondo, M.; Shimoda, K.; Takahashi, T.; Osuga, K.
2003-07-01
It is shown that with the use of the fusion output and/or environmental thermal energy, innovative open systems for permanent auto-working (PA) direct energy converting (DEC) from the thermal to the electrical (TE) and further to the chemical potential (TEC) energies, abbreviated as PA-TEC-DEC systems, can be used for new auto-working electrical power plants and the plants of the compressible and conveyable hydrogen gas resources at various regions in the whole world. It is analytically shown that the same physical mechanism by free electrons and electrical potential determined by temperature in conductors, which include semiconductors, leads to the Peltier effect and the Seebeck one. It is analytically proved that the energy conservation law is exactly satisfied in a simple form where the net absorbed thermal power is directly transferred to the electrical power and to the chemical power in the PA-TEC-DEC systems. It is analytically and experimentally clarified that the long distance separation between two π type elements of the heat absorption side and the production one of the Peltier effect circuit system or between the higher temperature side and the lower one of the Seebeck effect circuit one does not change mechanisms of the heat pumping by the Peltier effect and of the TE-DEC by the Seebeck effect. The proposed systems gives us freedom of no using the fossil fuel, such as coals, oils, and natural gases that yield serious greenhouse effect all over the earth, and the plant of nuclear fissions that left radiating wastes, i.e., no more environmental pollutions. The PA-TEC-DEC systems can be applicable for several km scale systems to the micro ones, such as the plants of the electrical power and the hydrogen gas resources, compact transportable hydrogen gas producers, the refrigerators, the air conditions, home electrical apparatuses, and further the computer elements. (author)
Directory of Open Access Journals (Sweden)
Dirce Yamada Kataoka
2006-10-01
Full Text Available OBJETIVO: verificar as prevalências dos diferentes tipos de relacionamentos ântero-posteriores entre os arcos dentários decíduos, bem como o possível dimorfismo sexual, em crianças nipo-brasileiras na faixa etária dos dois aos seis anos de idade. METODOLOGIA: foram avaliadas por inspeção visual 310 crianças nipo-brasileiras, matriculadas em 19 escolas do estado de São Paulo, sendo 154 do gênero masculino e 156 do feminino. Os resultados foram submetidos ao teste do qui-quadrado e revelaram ausência de dimorfismo sexual para a maioria dos relacionamentos analisados, permitindo apresentar os resultados conjuntamente para ambos os gêneros. RESULTADOS: as prevalências dos relacionamentos entre os segundos molares decíduos foram: 47,4% para o degrau mesial, 41,3% para o plano terminal reto, 5,5% para o degrau distal e 5,8% para os casos com assimetrias. Para os relacionamentos entre os caninos decíduos, conforme Foster e Hamilton, constataram-se prevalências de 77,4% para a Classe 1, 6,8% para a Classe 2, 6,8% para a Classe 3 e 9% para as relações assimétricas. Apenas a Classe 2 apresentou dimorfismo sexual, sendo de 3,9% para o feminino e de 9,7% para o masculino. Quanto à sobressaliência verificaram-se prevalências de 71,3% para a normal, 14,2% para a aumentada, 7,4% para a mordida cruzada anterior e 7,1% para a mordida topo-a-topo. RESULTADOS: concluiu-se que a maioria das crianças nipo-brasileiras avaliadas neste estudo, apresentaram um relacionamento ântero-posterior normal entre os arcos decíduos, merecendo atenção uma ligeira tendência para o desenvolvimento da Classe 3.AIM: the purpose of this cross-sectional study was to verify the prevalences of different types of anteroposterior relationships between deciduous dental arches and its possible sexual dimorphism, in Japanese-Brazilian children from 2 to 6 years of age. METHODS: a total of 310 Japanese-Brazilian children from 19 schools in São Paulo, Brazil
Directory of Open Access Journals (Sweden)
K. Shalini
2013-01-01
Full Text Available Green computing is all about using computers in a smarter and eco-friendly way. It is the environmentally responsible use of computers and related resources which includes the implementation of energy-efficient central processing units, servers and peripherals as well as reduced resource consumption and proper disposal of electronic waste .Computers certainly make up a large part of many people lives and traditionally are extremely damaging to the environment. Manufacturers of computer and its parts have been espousing the green cause to help protect environment from computers and electronic waste in any way.Research continues into key areas such as making the use of computers as energy-efficient as Possible, and designing algorithms and systems for efficiency-related computer technologies.
Computational biomechanics for medicine imaging, modeling and computing
Doyle, Barry; Wittek, Adam; Nielsen, Poul; Miller, Karol
2016-01-01
The Computational Biomechanics for Medicine titles provide an opportunity for specialists in computational biomechanics to present their latest methodologies and advancements. This volume comprises eighteen of the newest approaches and applications of computational biomechanics, from researchers in Australia, New Zealand, USA, UK, Switzerland, Scotland, France and Russia. Some of the interesting topics discussed are: tailored computational models; traumatic brain injury; soft-tissue mechanics; medical image analysis; and clinically-relevant simulations. One of the greatest challenges facing the computational engineering community is to extend the success of computational mechanics to fields outside traditional engineering, in particular to biology, the biomedical sciences, and medicine. We hope the research presented within this book series will contribute to overcoming this grand challenge.
Synthetic Computation: Chaos Computing, Logical Stochastic Resonance, and Adaptive Computing
Kia, Behnam; Murali, K.; Jahed Motlagh, Mohammad-Reza; Sinha, Sudeshna; Ditto, William L.
Nonlinearity and chaos can illustrate numerous behaviors and patterns, and one can select different patterns from this rich library of patterns. In this paper we focus on synthetic computing, a field that engineers and synthesizes nonlinear systems to obtain computation. We explain the importance of nonlinearity, and describe how nonlinear systems can be engineered to perform computation. More specifically, we provide an overview of chaos computing, a field that manually programs chaotic systems to build different types of digital functions. Also we briefly describe logical stochastic resonance (LSR), and then extend the approach of LSR to realize combinational digital logic systems via suitable concatenation of existing logical stochastic resonance blocks. Finally we demonstrate how a chaotic system can be engineered and mated with different machine learning techniques, such as artificial neural networks, random searching, and genetic algorithm, to design different autonomous systems that can adapt and respond to environmental conditions.
Explorations in computing an introduction to computer science
Conery, John S
2010-01-01
Introduction Computation The Limits of Computation Algorithms A Laboratory for Computational ExperimentsThe Ruby WorkbenchIntroducing Ruby and the RubyLabs environment for computational experimentsInteractive Ruby Numbers Variables Methods RubyLabs The Sieve of EratosthenesAn algorithm for finding prime numbersThe Sieve Algorithm The mod Operator Containers Iterators Boolean Values and the delete if Method Exploring the Algorithm The sieve Method A Better Sieve Experiments with the Sieve A Journey of a Thousand MilesIteration as a strategy for solving computational problemsSearching and Sortin
Computer Networking Laboratory for Undergraduate Computer Technology Program
National Research Council Canada - National Science Library
Naghedolfeizi, Masoud
2000-01-01
...) To improve the quality of education in the existing courses related to computer networks and data communications as well as other computer science courses such programming languages and computer...
Mathematics, Physics and Computer Sciences The computation of ...
African Journals Online (AJOL)
Mathematics, Physics and Computer Sciences The computation of system matrices for biquadraticsquare finite ... Global Journal of Pure and Applied Sciences ... The computation of system matrices for biquadraticsquare finite elements.
Computability, complexity, and languages fundamentals of theoretical computer science
Davis, Martin D; Rheinboldt, Werner
1983-01-01
Computability, Complexity, and Languages: Fundamentals of Theoretical Computer Science provides an introduction to the various aspects of theoretical computer science. Theoretical computer science is the mathematical study of models of computation. This text is composed of five parts encompassing 17 chapters, and begins with an introduction to the use of proofs in mathematics and the development of computability theory in the context of an extremely simple abstract programming language. The succeeding parts demonstrate the performance of abstract programming language using a macro expa
International Nuclear Information System (INIS)
Woodford, Curtis; Yartsev, Slav; Dar, A. Rashid; Bauman, Glenn; Van Dyk, Jake
2007-01-01
Purpose: To evaluate gross tumor volume (GTV) changes for patients with non-small-cell lung cancer by using daily megavoltage (MV) computed tomography (CT) studies acquired before each treatment fraction on helical tomotherapy and to relate the potential benefit of adaptive image-guided radiotherapy to changes in GTV. Methods and Materials: Seventeen patients were prescribed 30 fractions of radiotherapy on helical tomotherapy for non-small-cell lung cancer at London Regional Cancer Program from Dec 2005 to March 2007. The GTV was contoured on the daily MVCT studies of each patient. Adapted plans were created using merged MVCT-kilovoltage CT image sets to investigate the advantages of replanning for patients with differing GTV regression characteristics. Results: Average GTV change observed over 30 fractions was -38%, ranging from -12 to -87%. No significant correlation was observed between GTV change and patient's physical or tumor features. Patterns of GTV changes in the 17 patients could be divided broadly into three groups with distinctive potential for benefit from adaptive planning. Conclusions: Changes in GTV are difficult to predict quantitatively based on patient or tumor characteristics. If changes occur, there are points in time during the treatment course when it may be appropriate to adapt the plan to improve sparing of normal tissues. If GTV decreases by greater than 30% at any point in the first 20 fractions of treatment, adaptive planning is appropriate to further improve the therapeutic ratio
A large-scale computer facility for computational aerodynamics
International Nuclear Information System (INIS)
Bailey, F.R.; Balhaus, W.F.
1985-01-01
The combination of computer system technology and numerical modeling have advanced to the point that computational aerodynamics has emerged as an essential element in aerospace vehicle design methodology. To provide for further advances in modeling of aerodynamic flow fields, NASA has initiated at the Ames Research Center the Numerical Aerodynamic Simulation (NAS) Program. The objective of the Program is to develop a leading-edge, large-scale computer facility, and make it available to NASA, DoD, other Government agencies, industry and universities as a necessary element in ensuring continuing leadership in computational aerodynamics and related disciplines. The Program will establish an initial operational capability in 1986 and systematically enhance that capability by incorporating evolving improvements in state-of-the-art computer system technologies as required to maintain a leadership role. This paper briefly reviews the present and future requirements for computational aerodynamics and discusses the Numerical Aerodynamic Simulation Program objectives, computational goals, and implementation plans
The race for a new internet rival academics are competing to create a new, faster internet.
Dodson, S
2001-01-01
From Dec 1, Europe's research communities will be able to hook up to the fastest network in the world, serving more than 3000 academic and research institutions and operating in 32 countries. When the LHC becomes operational in 2005, terabytes of data will be generated. The idea is that computers held on the networks could be connected to share processing power and hard disc space. They will be locked in to a grid to imitate one super computer. Apart from the computing advantages, this new network will actively promote collaboration between institutions enabling them to work on projects on scales too large for individual groups to manage alone.
Operating procedures: Fusion Experiments Analysis Facility
Energy Technology Data Exchange (ETDEWEB)
Lerche, R.A.; Carey, R.W.
1984-03-20
The Fusion Experiments Analysis Facility (FEAF) is a computer facility based on a DEC VAX 11/780 computer. It became operational in late 1982. At that time two manuals were written to aid users and staff in their interactions with the facility. This manual is designed as a reference to assist the FEAF staff in carrying out their responsibilities. It is meant to supplement equipment and software manuals supplied by the vendors. Also this manual provides the FEAF staff with a set of consistent, written guidelines for the daily operation of the facility.
Operating procedures: Fusion Experiments Analysis Facility
International Nuclear Information System (INIS)
Lerche, R.A.; Carey, R.W.
1984-01-01
The Fusion Experiments Analysis Facility (FEAF) is a computer facility based on a DEC VAX 11/780 computer. It became operational in late 1982. At that time two manuals were written to aid users and staff in their interactions with the facility. This manual is designed as a reference to assist the FEAF staff in carrying out their responsibilities. It is meant to supplement equipment and software manuals supplied by the vendors. Also this manual provides the FEAF staff with a set of consistent, written guidelines for the daily operation of the facility
Smith, Paul H.
1988-01-01
The Computer Science Program provides advanced concepts, techniques, system architectures, algorithms, and software for both space and aeronautics information sciences and computer systems. The overall goal is to provide the technical foundation within NASA for the advancement of computing technology in aerospace applications. The research program is improving the state of knowledge of fundamental aerospace computing principles and advancing computing technology in space applications such as software engineering and information extraction from data collected by scientific instruments in space. The program includes the development of special algorithms and techniques to exploit the computing power provided by high performance parallel processors and special purpose architectures. Research is being conducted in the fundamentals of data base logic and improvement techniques for producing reliable computing systems.
Scarani, Valerio
1998-01-01
The aim of this thesis was to explain what quantum computing is. The information for the thesis was gathered from books, scientific publications, and news articles. The analysis of the information revealed that quantum computing can be broken down to three areas: theories behind quantum computing explaining the structure of a quantum computer, known quantum algorithms, and the actual physical realizations of a quantum computer. The thesis reveals that moving from classical memor...
On teaching computer ethics within a computer science department.
Quinn, Michael J
2006-04-01
The author has surveyed a quarter of the accredited undergraduate computer science programs in the United States. More than half of these programs offer a 'social and ethical implications of computing' course taught by a computer science faculty member, and there appears to be a trend toward teaching ethics classes within computer science departments. Although the decision to create an 'in house' computer ethics course may sometimes be a pragmatic response to pressure from the accreditation agency, this paper argues that teaching ethics within a computer science department can provide students and faculty members with numerous benefits. The paper lists topics that can be covered in a computer ethics course and offers some practical suggestions for making the course successful.
Parallel quantum computing in a single ensemble quantum computer
International Nuclear Information System (INIS)
Long Guilu; Xiao, L.
2004-01-01
We propose a parallel quantum computing mode for ensemble quantum computer. In this mode, some qubits are in pure states while other qubits are in mixed states. It enables a single ensemble quantum computer to perform 'single-instruction-multidata' type of parallel computation. Parallel quantum computing can provide additional speedup in Grover's algorithm and Shor's algorithm. In addition, it also makes a fuller use of qubit resources in an ensemble quantum computer. As a result, some qubits discarded in the preparation of an effective pure state in the Schulman-Varizani and the Cleve-DiVincenzo algorithms can be reutilized
ELASTIC CLOUD COMPUTING ARCHITECTURE AND SYSTEM FOR HETEROGENEOUS SPATIOTEMPORAL COMPUTING
Directory of Open Access Journals (Sweden)
X. Shi
2017-10-01
Full Text Available Spatiotemporal computation implements a variety of different algorithms. When big data are involved, desktop computer or standalone application may not be able to complete the computation task due to limited memory and computing power. Now that a variety of hardware accelerators and computing platforms are available to improve the performance of geocomputation, different algorithms may have different behavior on different computing infrastructure and platforms. Some are perfect for implementation on a cluster of graphics processing units (GPUs, while GPUs may not be useful on certain kind of spatiotemporal computation. This is the same situation in utilizing a cluster of Intel's many-integrated-core (MIC or Xeon Phi, as well as Hadoop or Spark platforms, to handle big spatiotemporal data. Furthermore, considering the energy efficiency requirement in general computation, Field Programmable Gate Array (FPGA may be a better solution for better energy efficiency when the performance of computation could be similar or better than GPUs and MICs. It is expected that an elastic cloud computing architecture and system that integrates all of GPUs, MICs, and FPGAs could be developed and deployed to support spatiotemporal computing over heterogeneous data types and computational problems.
Elastic Cloud Computing Architecture and System for Heterogeneous Spatiotemporal Computing
Shi, X.
2017-10-01
Spatiotemporal computation implements a variety of different algorithms. When big data are involved, desktop computer or standalone application may not be able to complete the computation task due to limited memory and computing power. Now that a variety of hardware accelerators and computing platforms are available to improve the performance of geocomputation, different algorithms may have different behavior on different computing infrastructure and platforms. Some are perfect for implementation on a cluster of graphics processing units (GPUs), while GPUs may not be useful on certain kind of spatiotemporal computation. This is the same situation in utilizing a cluster of Intel's many-integrated-core (MIC) or Xeon Phi, as well as Hadoop or Spark platforms, to handle big spatiotemporal data. Furthermore, considering the energy efficiency requirement in general computation, Field Programmable Gate Array (FPGA) may be a better solution for better energy efficiency when the performance of computation could be similar or better than GPUs and MICs. It is expected that an elastic cloud computing architecture and system that integrates all of GPUs, MICs, and FPGAs could be developed and deployed to support spatiotemporal computing over heterogeneous data types and computational problems.
Fry, T F
2014-01-01
Further Computer Appreciation is a comprehensive cover of the principles and aspects in computer appreciation. The book starts by describing the development of computers from the first to the third computer generations, to the development of processors and storage systems, up to the present position of computers and future trends. The text tackles the basic elements, concepts and functions of digital computers, computer arithmetic, input media and devices, and computer output. The basic central processor functions, data storage and the organization of data by classification of computer files,
Furht, Borko
In the introductory chapter we define the concept of cloud computing and cloud services, and we introduce layers and types of cloud computing. We discuss the differences between cloud computing and cloud services. New technologies that enabled cloud computing are presented next. We also discuss cloud computing features, standards, and security issues. We introduce the key cloud computing platforms, their vendors, and their offerings. We discuss cloud computing challenges and the future of cloud computing.
International Conference of Intelligence Computation and Evolutionary Computation ICEC 2012
Intelligence Computation and Evolutionary Computation
2013-01-01
2012 International Conference of Intelligence Computation and Evolutionary Computation (ICEC 2012) is held on July 7, 2012 in Wuhan, China. This conference is sponsored by Information Technology & Industrial Engineering Research Center. ICEC 2012 is a forum for presentation of new research results of intelligent computation and evolutionary computation. Cross-fertilization of intelligent computation, evolutionary computation, evolvable hardware and newly emerging technologies is strongly encouraged. The forum aims to bring together researchers, developers, and users from around the world in both industry and academia for sharing state-of-art results, for exploring new areas of research and development, and to discuss emerging issues facing intelligent computation and evolutionary computation.
ZIVIS: A City Computing Platform Based on Volunteer Computing
International Nuclear Information System (INIS)
Antoli, B.; Castejon, F.; Giner, A.; Losilla, G.; Reynolds, J. M.; Rivero, A.; Sangiao, S.; Serrano, F.; Tarancon, A.; Valles, R.; Velasco, J. L.
2007-01-01
Abstract Volunteer computing has come up as a new form of distributed computing. Unlike other computing paradigms like Grids, which use to be based on complex architectures, volunteer computing has demonstrated a great ability to integrate dispersed, heterogeneous computing resources with ease. This article presents ZIVIS, a project which aims to deploy a city-wide computing platform in Zaragoza (Spain). ZIVIS is based on BOINC (Berkeley Open Infrastructure for Network Computing), a popular open source framework to deploy volunteer and desktop grid computing systems. A scientific code which simulates the trajectories of particles moving inside a stellarator fusion device, has been chosen as the pilot application of the project. In this paper we describe the approach followed to port the code to the BOINC framework as well as some novel techniques, based on standard Grid protocols, we have used to access the output data present in the BOINC server from a remote visualizer. (Author)
Chandrasekaran, K
2014-01-01
ForewordPrefaceComputing ParadigmsLearning ObjectivesPreambleHigh-Performance ComputingParallel ComputingDistributed ComputingCluster ComputingGrid ComputingCloud ComputingBiocomputingMobile ComputingQuantum ComputingOptical ComputingNanocomputingNetwork ComputingSummaryReview PointsReview QuestionsFurther ReadingCloud Computing FundamentalsLearning ObjectivesPreambleMotivation for Cloud ComputingThe Need for Cloud ComputingDefining Cloud ComputingNIST Definition of Cloud ComputingCloud Computing Is a ServiceCloud Computing Is a Platform5-4-3 Principles of Cloud computingFive Essential Charact
I. Fisk
2013-01-01
Computing activity had ramped down after the completion of the reprocessing of the 2012 data and parked data, but is increasing with new simulation samples for analysis and upgrade studies. Much of the Computing effort is currently involved in activities to improve the computing system in preparation for 2015. Operations Office Since the beginning of 2013, the Computing Operations team successfully re-processed the 2012 data in record time, not only by using opportunistic resources like the San Diego Supercomputer Center which was accessible, to re-process the primary datasets HTMHT and MultiJet in Run2012D much earlier than planned. The Heavy-Ion data-taking period was successfully concluded in February collecting almost 500 T. Figure 3: Number of events per month (data) In LS1, our emphasis is to increase efficiency and flexibility of the infrastructure and operation. Computing Operations is working on separating disk and tape at the Tier-1 sites and the full implementation of the xrootd federation ...
Directory of Open Access Journals (Sweden)
BOGDAN OANCEA
2012-05-01
Full Text Available Since the first idea of using GPU to general purpose computing, things have evolved over the years and now there are several approaches to GPU programming. GPU computing practically began with the introduction of CUDA (Compute Unified Device Architecture by NVIDIA and Stream by AMD. These are APIs designed by the GPU vendors to be used together with the hardware that they provide. A new emerging standard, OpenCL (Open Computing Language tries to unify different GPU general computing API implementations and provides a framework for writing programs executed across heterogeneous platforms consisting of both CPUs and GPUs. OpenCL provides parallel computing using task-based and data-based parallelism. In this paper we will focus on the CUDA parallel computing architecture and programming model introduced by NVIDIA. We will present the benefits of the CUDA programming model. We will also compare the two main approaches, CUDA and AMD APP (STREAM and the new framwork, OpenCL that tries to unify the GPGPU computing models.
Directory of Open Access Journals (Sweden)
Evgeniy K. Khenner
2016-01-01
Full Text Available Abstract. The aim of the research is to draw attention of the educational community to the phenomenon of computational thinking which actively discussed in the last decade in the foreign scientific and educational literature, to substantiate of its importance, practical utility and the right on affirmation in Russian education.Methods. The research is based on the analysis of foreign studies of the phenomenon of computational thinking and the ways of its formation in the process of education; on comparing the notion of «computational thinking» with related concepts used in the Russian scientific and pedagogical literature.Results. The concept «computational thinking» is analyzed from the point of view of intuitive understanding and scientific and applied aspects. It is shown as computational thinking has evolved in the process of development of computers hardware and software. The practice-oriented interpretation of computational thinking which dominant among educators is described along with some ways of its formation. It is shown that computational thinking is a metasubject result of general education as well as its tool. From the point of view of the author, purposeful development of computational thinking should be one of the tasks of the Russian education.Scientific novelty. The author gives a theoretical justification of the role of computational thinking schemes as metasubject results of learning. The dynamics of the development of this concept is described. This process is connected with the evolution of computer and information technologies as well as increase of number of the tasks for effective solutions of which computational thinking is required. Author substantiated the affirmation that including «computational thinking » in the set of pedagogical concepts which are used in the national education system fills an existing gap.Practical significance. New metasubject result of education associated with
Fast computation of the characteristics method on vector computers
International Nuclear Information System (INIS)
Kugo, Teruhiko
2001-11-01
Fast computation of the characteristics method to solve the neutron transport equation in a heterogeneous geometry has been studied. Two vector computation algorithms; an odd-even sweep (OES) method and an independent sequential sweep (ISS) method have been developed and their efficiency to a typical fuel assembly calculation has been investigated. For both methods, a vector computation is 15 times faster than a scalar computation. From a viewpoint of comparison between the OES and ISS methods, the followings are found: 1) there is a small difference in a computation speed, 2) the ISS method shows a faster convergence and 3) the ISS method saves about 80% of computer memory size compared with the OES method. It is, therefore, concluded that the ISS method is superior to the OES method as a vectorization method. In the vector computation, a table-look-up method to reduce computation time of an exponential function saves only 20% of a whole computation time. Both the coarse mesh rebalance method and the Aitken acceleration method are effective as acceleration methods for the characteristics method, a combination of them saves 70-80% of outer iterations compared with a free iteration. (author)
1982-01-01
Parallel Computations focuses on parallel computation, with emphasis on algorithms used in a variety of numerical and physical applications and for many different types of parallel computers. Topics covered range from vectorization of fast Fourier transforms (FFTs) and of the incomplete Cholesky conjugate gradient (ICCG) algorithm on the Cray-1 to calculation of table lookups and piecewise functions. Single tridiagonal linear systems and vectorized computation of reactive flow are also discussed.Comprised of 13 chapters, this volume begins by classifying parallel computers and describing techn
Natural Computing in Computational Finance Volume 4
O’Neill, Michael; Maringer, Dietmar
2012-01-01
This book follows on from Natural Computing in Computational Finance Volumes I, II and III. As in the previous volumes of this series, the book consists of a series of chapters each of which was selected following a rigorous, peer-reviewed, selection process. The chapters illustrate the application of a range of cutting-edge natural computing and agent-based methodologies in computational finance and economics. The applications explored include option model calibration, financial trend reversal detection, enhanced indexation, algorithmic trading, corporate payout determination and agent-based modeling of liquidity costs, and trade strategy adaptation. While describing cutting edge applications, the chapters are written so that they are accessible to a wide audience. Hence, they should be of interest to academics, students and practitioners in the fields of computational finance and economics.
Computer technology and computer programming research and strategies
Antonakos, James L
2011-01-01
Covering a broad range of new topics in computer technology and programming, this volume discusses encryption techniques, SQL generation, Web 2.0 technologies, and visual sensor networks. It also examines reconfigurable computing, video streaming, animation techniques, and more. Readers will learn about an educational tool and game to help students learn computer programming. The book also explores a new medical technology paradigm centered on wireless technology and cloud computing designed to overcome the problems of increasing health technology costs.
International Nuclear Information System (INIS)
Deutsch, D.
1992-01-01
As computers become ever more complex, they inevitably become smaller. This leads to a need for components which are fabricated and operate on increasingly smaller size scales. Quantum theory is already taken into account in microelectronics design. This article explores how quantum theory will need to be incorporated into computers in future in order to give them their components functionality. Computation tasks which depend on quantum effects will become possible. Physicists may have to reconsider their perspective on computation in the light of understanding developed in connection with universal quantum computers. (UK)
Moncarz, Roger
2000-01-01
Looks at computer engineers and describes their job, employment outlook, earnings, and training and qualifications. Provides a list of resources related to computer engineering careers and the computer industry. (JOW)
Enticknap, Nicholas
2014-01-01
Computer Jargon Explained is a feature in Computer Weekly publications that discusses 68 of the most commonly used technical computing terms. The book explains what the terms mean and why the terms are important to computer professionals. The text also discusses how the terms relate to the trends and developments that are driving the information technology industry. Computer jargon irritates non-computer people and in turn causes problems for computer people. The technology and the industry are changing so rapidly; it is very hard even for professionals to keep updated. Computer people do not
Rosenthal, L E
1986-10-01
Software is the component in a computer system that permits the hardware to perform the various functions that a computer system is capable of doing. The history of software and its development can be traced to the early nineteenth century. All computer systems are designed to utilize the "stored program concept" as first developed by Charles Babbage in the 1850s. The concept was lost until the mid-1940s, when modern computers made their appearance. Today, because of the complex and myriad tasks that a computer system can perform, there has been a differentiation of types of software. There is software designed to perform specific business applications. There is software that controls the overall operation of a computer system. And there is software that is designed to carry out specialized tasks. Regardless of types, software is the most critical component of any computer system. Without it, all one has is a collection of circuits, transistors, and silicone chips.
Computer Series, 3: Computer Graphics for Chemical Education.
Soltzberg, Leonard J.
1979-01-01
Surveys the current scene in computer graphics from the point of view of a chemistry educator. Discusses the scope of current applications of computer graphics in chemical education, and provides information about hardware and software systems to promote communication with vendors of computer graphics equipment. (HM)
Jagielski, J. M.
1994-01-01
The DET/MPS programs model and simulate the Direct Energy Transfer and Multimission Spacecraft Modular Power System in order to aid both in design and in analysis of orbital energy balance. Typically, the DET power system has the solar array directly to the spacecraft bus, and the central building block of MPS is the Standard Power Regulator Unit. DET/MPS allows a minute-by-minute simulation of the power system's performance as it responds to various orbital parameters, focusing its output on solar array output and battery characteristics. While this package is limited in terms of orbital mechanics, it is sufficient to calculate eclipse and solar array data for circular or non-circular orbits. DET/MPS can be adjusted to run one or sequential orbits up to about one week, simulated time. These programs have been used on a variety of Goddard Space Flight Center spacecraft projects. DET/MPS is written in FORTRAN 77 with some VAX-type extensions. Any FORTRAN 77 compiler that includes VAX extensions should be able to compile and run the program with little or no modifications. The compiler must at least support free-form (or tab-delineated) source format and 'do do-while end-do' control structures. DET/MPS is available for three platforms: GSC-13374, for DEC VAX series computers running VMS, is available in DEC VAX Backup format on a 9-track 1600 BPI tape (standard distribution) or TK50 tape cartridge; GSC-13443, for UNIX-based computers, is available on a .25 inch streaming magnetic tape cartridge in UNIX tar format; and GSC-13444, for Macintosh computers running AU/X with either the NKR FORTRAN or AbSoft MacFORTRAN II compilers, is available on a 3.5 inch 800K Macintosh format diskette. Source code and test data are supplied. The UNIX version of DET requires 90K of main memory for execution. DET/MPS was developed in 1990. A/UX and Macintosh are registered trademarks of Apple Computer, Inc. VMS, DEC VAX and TK50 are trademarks of Digital Equipment Corporation. UNIX is a
Jagielski, J. M.
1994-01-01
The DET/MPS programs model and simulate the Direct Energy Transfer and Multimission Spacecraft Modular Power System in order to aid both in design and in analysis of orbital energy balance. Typically, the DET power system has the solar array directly to the spacecraft bus, and the central building block of MPS is the Standard Power Regulator Unit. DET/MPS allows a minute-by-minute simulation of the power system's performance as it responds to various orbital parameters, focusing its output on solar array output and battery characteristics. While this package is limited in terms of orbital mechanics, it is sufficient to calculate eclipse and solar array data for circular or non-circular orbits. DET/MPS can be adjusted to run one or sequential orbits up to about one week, simulated time. These programs have been used on a variety of Goddard Space Flight Center spacecraft projects. DET/MPS is written in FORTRAN 77 with some VAX-type extensions. Any FORTRAN 77 compiler that includes VAX extensions should be able to compile and run the program with little or no modifications. The compiler must at least support free-form (or tab-delineated) source format and 'do do-while end-do' control structures. DET/MPS is available for three platforms: GSC-13374, for DEC VAX series computers running VMS, is available in DEC VAX Backup format on a 9-track 1600 BPI tape (standard distribution) or TK50 tape cartridge; GSC-13443, for UNIX-based computers, is available on a .25 inch streaming magnetic tape cartridge in UNIX tar format; and GSC-13444, for Macintosh computers running AU/X with either the NKR FORTRAN or AbSoft MacFORTRAN II compilers, is available on a 3.5 inch 800K Macintosh format diskette. Source code and test data are supplied. The UNIX version of DET requires 90K of main memory for execution. DET/MPS was developed in 1990. A/UX and Macintosh are registered trademarks of Apple Computer, Inc. VMS, DEC VAX and TK50 are trademarks of Digital Equipment Corporation. UNIX is a
Framework for Computation Offloading in Mobile Cloud Computing
Directory of Open Access Journals (Sweden)
Dejan Kovachev
2012-12-01
Full Text Available The inherently limited processing power and battery lifetime of mobile phones hinder the possible execution of computationally intensive applications like content-based video analysis or 3D modeling. Offloading of computationally intensive application parts from the mobile platform into a remote cloud infrastructure or nearby idle computers addresses this problem. This paper presents our Mobile Augmentation Cloud Services (MACS middleware which enables adaptive extension of Android application execution from a mobile client into the cloud. Applications are developed by using the standard Android development pattern. The middleware does the heavy lifting of adaptive application partitioning, resource monitoring and computation offloading. These elastic mobile applications can run as usual mobile application, but they can also use remote computing resources transparently. Two prototype applications using the MACS middleware demonstrate the benefits of the approach. The evaluation shows that applications, which involve costly computations, can benefit from offloading with around 95% energy savings and significant performance gains compared to local execution only.
Center for computer security: Computer Security Group conference. Summary
Energy Technology Data Exchange (ETDEWEB)
None
1982-06-01
Topics covered include: computer security management; detection and prevention of computer misuse; certification and accreditation; protection of computer security, perspective from a program office; risk analysis; secure accreditation systems; data base security; implementing R and D; key notarization system; DOD computer security center; the Sandia experience; inspector general's report; and backup and contingency planning. (GHT)
Single-crystal diffraction instrument TriCS at SINQ
Schefer, J.; Könnecke, M.; Murasik, A.; Czopnik, A.; Strässle, Th; Keller, P.; Schlumpf, N.
2000-03-01
The single-crystal diffractometer TriCS at the Swiss Continuous Spallation Source (SINQ) is presently in the commissioning phase. A two-dimensional wire detector produced by EMBL was delivered in March 1999. The instrument is presently tested with a single detector. First measurements on magnetic structures have been performed. The instrument is remotely controlled using JAVA-based software and a UNIX DEC-α host computer.
Montecarlo Simulations for a Lep Experiment with Unix Workstation Clusters
Bonesini, M.; Calegari, A.; Rossi, P.; Rossi, V.
Modular systems of RISC CPU based computers have been implemented for large productions of Montecarlo simulated events for the DELPHI experiment at CERN. From a pilot system based on DEC 5000 CPU’s, a full size system based on a CONVEX C3820 UNIX supercomputer and a cluster of HP 735 workstations has been put into operation as a joint effort between INFN Milano and CILEA.
Pascal-SC a computer language for scientific computation
Bohlender, Gerd; von Gudenberg, Jürgen Wolff; Rheinboldt, Werner; Siewiorek, Daniel
1987-01-01
Perspectives in Computing, Vol. 17: Pascal-SC: A Computer Language for Scientific Computation focuses on the application of Pascal-SC, a programming language developed as an extension of standard Pascal, in scientific computation. The publication first elaborates on the introduction to Pascal-SC, a review of standard Pascal, and real floating-point arithmetic. Discussions focus on optimal scalar product, standard functions, real expressions, program structure, simple extensions, real floating-point arithmetic, vector and matrix arithmetic, and dynamic arrays. The text then examines functions a
CERN. Geneva
2008-01-01
What if people could play computer games and accomplish work without even realizing it? What if billions of people collaborated to solve important problems for humanity or generate training data for computers? My work aims at a general paradigm for doing exactly that: utilizing human processing power to solve computational problems in a distributed manner. In particular, I focus on harnessing human time and energy for addressing problems that computers cannot yet solve. Although computers have advanced dramatically in many respects over the last 50 years, they still do not possess the basic conceptual intelligence or perceptual capabilities...
Würtz, Rolf P
2008-01-01
Organic Computing is a research field emerging around the conviction that problems of organization in complex systems in computer science, telecommunications, neurobiology, molecular biology, ethology, and possibly even sociology can be tackled scientifically in a unified way. From the computer science point of view, the apparent ease in which living systems solve computationally difficult problems makes it inevitable to adopt strategies observed in nature for creating information processing machinery. In this book, the major ideas behind Organic Computing are delineated, together with a sparse sample of computational projects undertaken in this new field. Biological metaphors include evolution, neural networks, gene-regulatory networks, networks of brain modules, hormone system, insect swarms, and ant colonies. Applications are as diverse as system design, optimization, artificial growth, task allocation, clustering, routing, face recognition, and sign language understanding.
Mobile cloud computing for computation offloading: Issues and challenges
Directory of Open Access Journals (Sweden)
Khadija Akherfi
2018-01-01
Full Text Available Despite the evolution and enhancements that mobile devices have experienced, they are still considered as limited computing devices. Today, users become more demanding and expect to execute computational intensive applications on their smartphone devices. Therefore, Mobile Cloud Computing (MCC integrates mobile computing and Cloud Computing (CC in order to extend capabilities of mobile devices using offloading techniques. Computation offloading tackles limitations of Smart Mobile Devices (SMDs such as limited battery lifetime, limited processing capabilities, and limited storage capacity by offloading the execution and workload to other rich systems with better performance and resources. This paper presents the current offloading frameworks, computation offloading techniques, and analyzes them along with their main critical issues. In addition, it explores different important parameters based on which the frameworks are implemented such as offloading method and level of partitioning. Finally, it summarizes the issues in offloading frameworks in the MCC domain that requires further research.
Directory of Open Access Journals (Sweden)
Anamaria Şiclovan
2013-02-01
Full Text Available Cloud computing was and it will be a new way of providing Internet services and computers. This calculation approach is based on many existing services, such as the Internet, grid computing, Web services. Cloud computing as a system aims to provide on demand services more acceptable as price and infrastructure. It is exactly the transition from computer to a service offered to the consumers as a product delivered online. This paper is meant to describe the quality of cloud computing services, analyzing the advantages and characteristics offered by it. It is a theoretical paper.Keywords: Cloud computing, QoS, quality of cloud computing
Building a cluster computer for the computing grid of tomorrow
International Nuclear Information System (INIS)
Wezel, J. van; Marten, H.
2004-01-01
The Grid Computing Centre Karlsruhe takes part in the development, test and deployment of hardware and cluster infrastructure, grid computing middleware, and applications for particle physics. The construction of a large cluster computer with thousands of nodes and several PB data storage capacity is a major task and focus of research. CERN based accelerator experiments will use GridKa, one of only 8 world wide Tier-1 computing centers, for its huge computer demands. Computing and storage is provided already for several other running physics experiments on the exponentially expanding cluster. (orig.)
Energy Technology Data Exchange (ETDEWEB)
1991-10-23
An account of the Caltech Concurrent Computation Program (C{sup 3}P), a five year project that focused on answering the question: Can parallel computers be used to do large-scale scientific computations '' As the title indicates, the question is answered in the affirmative, by implementing numerous scientific applications on real parallel computers and doing computations that produced new scientific results. In the process of doing so, C{sup 3}P helped design and build several new computers, designed and implemented basic system software, developed algorithms for frequently used mathematical computations on massively parallel machines, devised performance models and measured the performance of many computers, and created a high performance computing facility based exclusively on parallel computers. While the initial focus of C{sup 3}P was the hypercube architecture developed by C. Seitz, many of the methods developed and lessons learned have been applied successfully on other massively parallel architectures.
Silvis-Cividjian, N.
This book provides a concise introduction to Pervasive Computing, otherwise known as Internet of Things (IoT) and Ubiquitous Computing (Ubicomp) which addresses the seamless integration of computing systems within everyday objects. By introducing the core topics and exploring assistive pervasive
New computational paradigms changing conceptions of what is computable
Cooper, SB; Sorbi, Andrea
2007-01-01
This superb exposition of a complex subject examines new developments in the theory and practice of computation from a mathematical perspective. It covers topics ranging from classical computability to complexity, from biocomputing to quantum computing.
Feigenbaum, Edward A.; Nielsen, Norman R.
1969-01-01
This article provides a current status report on the computing and computer science activities at Stanford University, focusing on the Computer Science Department, the Stanford Computation Center, the recently established regional computing network, and the Institute for Mathematical Studies in the Social Sciences. Also considered are such topics…
Computing networks from cluster to cloud computing
Vicat-Blanc, Pascale; Guillier, Romaric; Soudan, Sebastien
2013-01-01
"Computing Networks" explores the core of the new distributed computing infrastructures we are using today: the networking systems of clusters, grids and clouds. It helps network designers and distributed-application developers and users to better understand the technologies, specificities, constraints and benefits of these different infrastructures' communication systems. Cloud Computing will give the possibility for millions of users to process data anytime, anywhere, while being eco-friendly. In order to deliver this emerging traffic in a timely, cost-efficient, energy-efficient, and
Directory of Open Access Journals (Sweden)
Paul M. Torrens
2016-09-01
Full Text Available Streetscapes have presented a long-standing interest in many fields. Recently, there has been a resurgence of attention on streetscape issues, catalyzed in large part by computing. Because of computing, there is more understanding, vistas, data, and analysis of and on streetscape phenomena than ever before. This diversity of lenses trained on streetscapes permits us to address long-standing questions, such as how people use information while mobile, how interactions with people and things occur on streets, how we might safeguard crowds, how we can design services to assist pedestrians, and how we could better support special populations as they traverse cities. Amid each of these avenues of inquiry, computing is facilitating new ways of posing these questions, particularly by expanding the scope of what-if exploration that is possible. With assistance from computing, consideration of streetscapes now reaches across scales, from the neurological interactions that form among place cells in the brain up to informatics that afford real-time views of activity over whole urban spaces. For some streetscape phenomena, computing allows us to build realistic but synthetic facsimiles in computation, which can function as artificial laboratories for testing ideas. In this paper, I review the domain science for studying streetscapes from vantages in physics, urban studies, animation and the visual arts, psychology, biology, and behavioral geography. I also review the computational developments shaping streetscape science, with particular emphasis on modeling and simulation as informed by data acquisition and generation, data models, path-planning heuristics, artificial intelligence for navigation and way-finding, timing, synthetic vision, steering routines, kinematics, and geometrical treatment of collision detection and avoidance. I also discuss the implications that the advances in computing streetscapes might have on emerging developments in cyber
Abstract quantum computing machines and quantum computational logics
Chiara, Maria Luisa Dalla; Giuntini, Roberto; Sergioli, Giuseppe; Leporini, Roberto
2016-06-01
Classical and quantum parallelism are deeply different, although it is sometimes claimed that quantum Turing machines are nothing but special examples of classical probabilistic machines. We introduce the concepts of deterministic state machine, classical probabilistic state machine and quantum state machine. On this basis, we discuss the question: To what extent can quantum state machines be simulated by classical probabilistic state machines? Each state machine is devoted to a single task determined by its program. Real computers, however, behave differently, being able to solve different kinds of problems. This capacity can be modeled, in the quantum case, by the mathematical notion of abstract quantum computing machine, whose different programs determine different quantum state machines. The computations of abstract quantum computing machines can be linguistically described by the formulas of a particular form of quantum logic, termed quantum computational logic.
Directory of Open Access Journals (Sweden)
Ana Lúcia da Silva Lima
2006-02-01
Full Text Available In general, perennial species contain higher concentrations of certain secondary compounds, such as phenolics, lower levels of nitrogenous compounds, and greater specific leaf mass (SLM than deciduous species. The aim of this study was to verify whether the comparative data reported in the literature regarding deciduous and evergreen species, also applies to four selected species of a semideciduous tropical forest (a remnant of the Atlantic Forest. The four species chosen for this study, each with apparently different leaf life spans, were two semideciduous (Hymenaea courbaril L. var. stilbocarpa (Hayne Lee et Lang., and Lonchocarpus guilleminianus (Tul. Malme, and two deciduous (Enterolobium contortisiliquum (Vell. Morong., and Peltophorum dubium (Spreng. Taub.. Plants were grown in a greenhouse in plastic pots containing soil taken from their natural habitat. Mature leaves were harvested for determination of the SLM and contents of phenolic compounds, tannins, nitrate, protein, free amino acids, chlorophyll, and nitrogen. Data registered are in agreement with those of the literature. Leaves with the longest life span had the highest content of phenolics and the lowest levels of tannins, nitrate, protein, amino acids, chlorophyll and nitrogen, as well as presenting the greatest SLM.Em geral as espécies perenifólias possuem maior concentração de alguns compostos secundários, como por exemplo fenóis, menor concentração de compostos nitrogenados e maior massa foliar específica (MFE, quando comparadas a espécies decíduas. O objetivo deste trabalho foi verificar se as observações encontradas na literatura, comparando espécies perenifólias e decíduas aplicam-se também a quatro espécies de uma mata semidecídua, remanescente da Mata Atlântica. Das quatro espécies usadas neste estudo, que aparentemente apresentavam longevidades foliares diferentes, duas eram semidecíduas (Hymenaea courbaril L. var. stilbocarpa (Hayne Lee et Lang. e
Applied Parallel Computing Industrial Computation and Optimization
DEFF Research Database (Denmark)
Madsen, Kaj; NA NA NA Olesen, Dorte
Proceedings and the Third International Workshop on Applied Parallel Computing in Industrial Problems and Optimization (PARA96)......Proceedings and the Third International Workshop on Applied Parallel Computing in Industrial Problems and Optimization (PARA96)...
Illustrated computer tomography
International Nuclear Information System (INIS)
Takahashi, S.
1983-01-01
This book provides the following information: basic aspects of computed tomography; atlas of computed tomography of the normal adult; clinical application of computed tomography; and radiotherapy planning and computed tomography
Louis, David N.; Feldman, Michael; Carter, Alexis B.; Dighe, Anand S.; Pfeifer, John D.; Bry, Lynn; Almeida, Jonas S.; Saltz, Joel; Braun, Jonathan; Tomaszewski, John E.; Gilbertson, John R.; Sinard, John H.; Gerber, Georg K.; Galli, Stephen J.; Golden, Jeffrey A.; Becich, Michael J.
2016-01-01
Context We define the scope and needs within the new discipline of computational pathology, a discipline critical to the future of both the practice of pathology and, more broadly, medical practice in general. Objective To define the scope and needs of computational pathology. Data Sources A meeting was convened in Boston, Massachusetts, in July 2014 prior to the annual Association of Pathology Chairs meeting, and it was attended by a variety of pathologists, including individuals highly invested in pathology informatics as well as chairs of pathology departments. Conclusions The meeting made recommendations to promote computational pathology, including clearly defining the field and articulating its value propositions; asserting that the value propositions for health care systems must include means to incorporate robust computational approaches to implement data-driven methods that aid in guiding individual and population health care; leveraging computational pathology as a center for data interpretation in modern health care systems; stating that realizing the value proposition will require working with institutional administrations, other departments, and pathology colleagues; declaring that a robust pipeline should be fostered that trains and develops future computational pathologists, for those with both pathology and non-pathology backgrounds; and deciding that computational pathology should serve as a hub for data-related research in health care systems. The dissemination of these recommendations to pathology and bioinformatics departments should help facilitate the development of computational pathology. PMID:26098131
An integrated, multi-vendor distributed data acquisition system
International Nuclear Information System (INIS)
Butner, D.N.; Drlik, M.; Meyer, W.H.; Moller, J.M.; Preckshot, G.G.
1988-01-01
A distributed data acquisition system that uses various computer hardware and software is being developed to support magnetic fusion experiments at Lawrence Livermore National Laboratory (LLNL). The experimental sequence of operations is controlled by a supervisory program, which coordinates software running on Digital Equipment Corporation (DEC) VAX computers, Hewlett-Packard (HP) UNIX-based workstations, and HP BASIC desktop computers. An interprocess communication system (IPCS) allows programs to communicate with one another in a standard manner regardless of program location in the network or of operating system and hardware differences. We discuss the design and implementation of this data acquisition system with particular emphasis on the coordination model and the IPCS. 5 refs., 3 figs
Directory of Open Access Journals (Sweden)
SORIN-CIPRIAN TEIUŞAN
2009-01-01
Full Text Available What is computer-assisted accounting? Where is the place and what is the role of the computer in the financial-accounting activity? What is the position and importance of the computer in the accountant’s activity? All these are questions that require scientific research in order to find the answers. The paper approaches the issue of the support granted to the accountant to organize and manage the accounting activity by the computer. Starting from the notions of accounting and computer, the concept of computer-assisted accounting is introduced, it has a general character and it refers to the accounting performed with the help of the computer or using the computer to automate the procedures performed by the person who is doing the accounting activity; this is a concept used to define the computer applications of the accounting activity. The arguments regarding the use of the computer to assist accounting targets the accounting informatization, the automating of the financial-accounting activities and the endowment with modern technology of the contemporary accounting.
CERN technical training: available places in forthcoming courses
HR Department
The following course sessions are scheduled in the framework of the 2009 CERN Technical Training Programme and places are still available. You can find the full updated Technical Training course programme in our web catalogue. Software and system technologies Developing secure software\t07-DEC-09\t07-DEC-09\t0.5 day\tEnglish PERL 5 - Advanced Aspects\t10-DEC-09\t10-DEC-09\t1 day\tEnglish Electronic design LabVIEW - Working efficiently with LabVIEW 8\t07-DEC-09\t07-DEC-09\t1 day\tEnglish Mechanical design Office software Sharepoint Designer (Frontpage) - Level 1\t07-DEC-09\t08-DEC-09\t2 days\tEnglish Special course Egroups training\t15-DEC-09\t15-DEC-09\t0.5 jour\tFrench If you are interested in attending any of the above course sessions, please talk to your supervisor and/or your DTO, and apply electronically via EDH from the course description pages that can be found here under ‘Technical Training’ with the detailed course program. Registration for all courses is always open – se...
Engineering computations at the national magnetic fusion energy computer center
International Nuclear Information System (INIS)
Murty, S.
1983-01-01
The National Magnetic Fusion Energy Computer Center (NMFECC) was established by the U.S. Department of Energy's Division of Magnetic Fusion Energy (MFE). The NMFECC headquarters is located at Lawrence Livermore National Laboratory. Its purpose is to apply large-scale computational technology and computing techniques to the problems of controlled thermonuclear research. In addition to providing cost effective computing services, the NMFECC also maintains a large collection of computer codes in mathematics, physics, and engineering that is shared by the entire MFE research community. This review provides a broad perspective of the NMFECC, and a list of available codes at the NMFECC for engineering computations is given
Reversible computing fundamentals, quantum computing, and applications
De Vos, Alexis
2010-01-01
Written by one of the few top internationally recognized experts in the field, this book concentrates on those topics that will remain fundamental, such as low power computing, reversible programming languages, and applications in thermodynamics. It describes reversible computing from various points of view: Boolean algebra, group theory, logic circuits, low-power electronics, communication, software, quantum computing. It is this multidisciplinary approach that makes it unique.Backed by numerous examples, this is useful for all levels of the scientific and academic community, from undergr
Democratizing Computer Science
Margolis, Jane; Goode, Joanna; Ryoo, Jean J.
2015-01-01
Computer science programs are too often identified with a narrow stratum of the student population, often white or Asian boys who have access to computers at home. But because computers play such a huge role in our world today, all students can benefit from the study of computer science and the opportunity to build skills related to computing. The…
Touchable Computing: Computing-Inspired Bio-Detection.
Chen, Yifan; Shi, Shaolong; Yao, Xin; Nakano, Tadashi
2017-12-01
We propose a new computing-inspired bio-detection framework called touchable computing (TouchComp). Under the rubric of TouchComp, the best solution is the cancer to be detected, the parameter space is the tissue region at high risk of malignancy, and the agents are the nanorobots loaded with contrast medium molecules for tracking purpose. Subsequently, the cancer detection procedure (CDP) can be interpreted from the computational optimization perspective: a population of externally steerable agents (i.e., nanorobots) locate the optimal solution (i.e., cancer) by moving through the parameter space (i.e., tissue under screening), whose landscape (i.e., a prescribed feature of tissue environment) may be altered by these agents but the location of the best solution remains unchanged. One can then infer the landscape by observing the movement of agents by applying the "seeing-is-sensing" principle. The term "touchable" emphasizes the framework's similarity to controlling by touching the screen with a finger, where the external field for controlling and tracking acts as the finger. Given this analogy, we aim to answer the following profound question: can we look to the fertile field of computational optimization algorithms for solutions to achieve effective cancer detection that are fast, accurate, and robust? Along this line of thought, we consider the classical particle swarm optimization (PSO) as an example and propose the PSO-inspired CDP, which differs from the standard PSO by taking into account realistic in vivo propagation and controlling of nanorobots. Finally, we present comprehensive numerical examples to demonstrate the effectiveness of the PSO-inspired CDP for different blood flow velocity profiles caused by tumor-induced angiogenesis. The proposed TouchComp bio-detection framework may be regarded as one form of natural computing that employs natural materials to compute.
International Conference on Computer, Communication and Computational Sciences
Mishra, Krishn; Tiwari, Shailesh; Singh, Vivek
2017-01-01
Exchange of information and innovative ideas are necessary to accelerate the development of technology. With advent of technology, intelligent and soft computing techniques came into existence with a wide scope of implementation in engineering sciences. Keeping this ideology in preference, this book includes the insights that reflect the ‘Advances in Computer and Computational Sciences’ from upcoming researchers and leading academicians across the globe. It contains high-quality peer-reviewed papers of ‘International Conference on Computer, Communication and Computational Sciences (ICCCCS 2016), held during 12-13 August, 2016 in Ajmer, India. These papers are arranged in the form of chapters. The content of the book is divided into two volumes that cover variety of topics such as intelligent hardware and software design, advanced communications, power and energy optimization, intelligent techniques used in internet of things, intelligent image processing, advanced software engineering, evolutionary and ...
Hyndman, D E
2013-01-01
Analog and Hybrid Computing focuses on the operations of analog and hybrid computers. The book first outlines the history of computing devices that influenced the creation of analog and digital computers. The types of problems to be solved on computers, computing systems, and digital computers are discussed. The text looks at the theory and operation of electronic analog computers, including linear and non-linear computing units and use of analog computers as operational amplifiers. The monograph examines the preparation of problems to be deciphered on computers. Flow diagrams, methods of ampl
Hardware for soft computing and soft computing for hardware
Nedjah, Nadia
2014-01-01
Single and Multi-Objective Evolutionary Computation (MOEA), Genetic Algorithms (GAs), Artificial Neural Networks (ANNs), Fuzzy Controllers (FCs), Particle Swarm Optimization (PSO) and Ant colony Optimization (ACO) are becoming omnipresent in almost every intelligent system design. Unfortunately, the application of the majority of these techniques is complex and so requires a huge computational effort to yield useful and practical results. Therefore, dedicated hardware for evolutionary, neural and fuzzy computation is a key issue for designers. With the spread of reconfigurable hardware such as FPGAs, digital as well as analog hardware implementations of such computation become cost-effective. The idea behind this book is to offer a variety of hardware designs for soft computing techniques that can be embedded in any final product. Also, to introduce the successful application of soft computing technique to solve many hard problem encountered during the design of embedded hardware designs. Reconfigurable em...
Directory of Open Access Journals (Sweden)
David Collu
2009-12-01
Full Text Available A series of twenty arylpiperazine derivatives of 1,7,8,9-tetrachloro-10,10-dimethoxy-4-azatricyclo[5.2.1.02,6]dec-8-ene-3,5-dione have been prepared. These derivatives were tested in vitro with the aim of identifying novel lead compounds active against emergent and re-emergent human and cattle infectious diseases (AIDS, hepatitis B and C, tuberculosis, bovine viral diarrhea. In particular, these compounds were evaluated in vitro against representatives of different virus classes, such as a HIV-1 (Retrovirus, a HBV (Hepadnavirus and the single-stranded RNA+ viruses Yellow fever virus (YFV and Bovine viral diarrhea virus (BVDV, both belonging to the Flaviridae. Compounds 2c, 2g and 3d showed a modest activity against CVB-2. The molecular structures of the starting imide 1 and one of propyl-piperazine derivatives, 3b, have been determined by an X-ray crystallography study.
3rd International Conference on Computational Mathematics and Computational Geometry
Ravindran, Anton
2016-01-01
This volume presents original research contributed to the 3rd Annual International Conference on Computational Mathematics and Computational Geometry (CMCGS 2014), organized and administered by Global Science and Technology Forum (GSTF). Computational Mathematics and Computational Geometry are closely related subjects, but are often studied by separate communities and published in different venues. This volume is unique in its combination of these topics. After the conference, which took place in Singapore, selected contributions chosen for this volume and peer-reviewed. The section on Computational Mathematics contains papers that are concerned with developing new and efficient numerical algorithms for mathematical sciences or scientific computing. They also cover analysis of such algorithms to assess accuracy and reliability. The parts of this project that are related to Computational Geometry aim to develop effective and efficient algorithms for geometrical applications such as representation and computati...
Program For Engineering Electrical Connections
Billitti, Joseph W.
1990-01-01
DFACS is interactive multiuser computer-aided-engineering software tool for system-level electrical integration and cabling engineering. Purpose of program to provide engineering community with centralized data base for putting in and gaining access to data on functional definition of system, details of end-circuit pinouts in systems and subsystems, and data on wiring harnesses. Objective, to provide instantaneous single point of interchange of information, thus avoiding error-prone, time-consuming, and costly shuttling of data along multiple paths. Designed to operate on DEC VAX mini or micro computer using Version 5.0/03 of INGRES.
International Nuclear Information System (INIS)
DAVENPORT, J.
2006-01-01
Computational Science is an integral component of Brookhaven's multi science mission, and is a reflection of the increased role of computation across all of science. Brookhaven currently has major efforts in data storage and analysis for the Relativistic Heavy Ion Collider (RHIC) and the ATLAS detector at CERN, and in quantum chromodynamics. The Laboratory is host for the QCDOC machines (quantum chromodynamics on a chip), 10 teraflop/s computers which boast 12,288 processors each. There are two here, one for the Riken/BNL Research Center and the other supported by DOE for the US Lattice Gauge Community and other scientific users. A 100 teraflop/s supercomputer will be installed at Brookhaven in the coming year, managed jointly by Brookhaven and Stony Brook, and funded by a grant from New York State. This machine will be used for computational science across Brookhaven's entire research program, and also by researchers at Stony Brook and across New York State. With Stony Brook, Brookhaven has formed the New York Center for Computational Science (NYCCS) as a focal point for interdisciplinary computational science, which is closely linked to Brookhaven's Computational Science Center (CSC). The CSC has established a strong program in computational science, with an emphasis on nanoscale electronic structure and molecular dynamics, accelerator design, computational fluid dynamics, medical imaging, parallel computing and numerical algorithms. We have been an active participant in DOES SciDAC program (Scientific Discovery through Advanced Computing). We are also planning a major expansion in computational biology in keeping with Laboratory initiatives. Additional laboratory initiatives with a dependence on a high level of computation include the development of hydrodynamics models for the interpretation of RHIC data, computational models for the atmospheric transport of aerosols, and models for combustion and for energy utilization. The CSC was formed to bring together
Computational Biology and High Performance Computing 2000
Energy Technology Data Exchange (ETDEWEB)
Simon, Horst D.; Zorn, Manfred D.; Spengler, Sylvia J.; Shoichet, Brian K.; Stewart, Craig; Dubchak, Inna L.; Arkin, Adam P.
2000-10-19
The pace of extraordinary advances in molecular biology has accelerated in the past decade due in large part to discoveries coming from genome projects on human and model organisms. The advances in the genome project so far, happening well ahead of schedule and under budget, have exceeded any dreams by its protagonists, let alone formal expectations. Biologists expect the next phase of the genome project to be even more startling in terms of dramatic breakthroughs in our understanding of human biology, the biology of health and of disease. Only today can biologists begin to envision the necessary experimental, computational and theoretical steps necessary to exploit genome sequence information for its medical impact, its contribution to biotechnology and economic competitiveness, and its ultimate contribution to environmental quality. High performance computing has become one of the critical enabling technologies, which will help to translate this vision of future advances in biology into reality. Biologists are increasingly becoming aware of the potential of high performance computing. The goal of this tutorial is to introduce the exciting new developments in computational biology and genomics to the high performance computing community.
I. Fisk
2011-01-01
Introduction CMS distributed computing system performed well during the 2011 start-up. The events in 2011 have more pile-up and are more complex than last year; this results in longer reconstruction times and harder events to simulate. Significant increases in computing capacity were delivered in April for all computing tiers, and the utilisation and load is close to the planning predictions. All computing centre tiers performed their expected functionalities. Heavy-Ion Programme The CMS Heavy-Ion Programme had a very strong showing at the Quark Matter conference. A large number of analyses were shown. The dedicated heavy-ion reconstruction facility at the Vanderbilt Tier-2 is still involved in some commissioning activities, but is available for processing and analysis. Facilities and Infrastructure Operations Facility and Infrastructure operations have been active with operations and several important deployment tasks. Facilities participated in the testing and deployment of WMAgent and WorkQueue+Request...
Usage of Cloud Computing Simulators and Future Systems For Computational Research
Lakshminarayanan, Ramkumar; Ramalingam, Rajasekar
2016-01-01
Cloud Computing is an Internet based computing, whereby shared resources, software and information, are provided to computers and devices on demand, like the electricity grid. Currently, IaaS (Infrastructure as a Service), PaaS (Platform as a Service) and SaaS (Software as a Service) are used as a business model for Cloud Computing. Nowadays, the adoption and deployment of Cloud Computing is increasing in various domains, forcing researchers to conduct research in the area of Cloud Computing ...
Future Computer Requirements for Computational Aerodynamics
1978-01-01
Recent advances in computational aerodynamics are discussed as well as motivations for and potential benefits of a National Aerodynamic Simulation Facility having the capability to solve fluid dynamic equations at speeds two to three orders of magnitude faster than presently possible with general computers. Two contracted efforts to define processor architectures for such a facility are summarized.
Perbandingan Kemampuan Embedded Computer dengan General Purpose Computer untuk Pengolahan Citra
Directory of Open Access Journals (Sweden)
Herryawan Pujiharsono
2017-08-01
Full Text Available Perkembangan teknologi komputer membuat pengolahan citra saat ini banyak dikembangkan untuk dapat membantu manusia di berbagai bidang pekerjaan. Namun, tidak semua bidang pekerjaan dapat dikembangkan dengan pengolahan citra karena tidak mendukung penggunaan komputer sehingga mendorong pengembangan pengolahan citra dengan mikrokontroler atau mikroprosesor khusus. Perkembangan mikrokontroler dan mikroprosesor memungkinkan pengolahan citra saat ini dapat dikembangkan dengan embedded computer atau single board computer (SBC. Penelitian ini bertujuan untuk menguji kemampuan embedded computer dalam mengolah citra dan membandingkan hasilnya dengan komputer pada umumnya (general purpose computer. Pengujian dilakukan dengan mengukur waktu eksekusi dari empat operasi pengolahan citra yang diberikan pada sepuluh ukuran citra. Hasil yang diperoleh pada penelitian ini menunjukkan bahwa optimasi waktu eksekusi embedded computer lebih baik jika dibandingkan dengan general purpose computer dengan waktu eksekusi rata-rata embedded computer adalah 4-5 kali waktu eksekusi general purpose computer dan ukuran citra maksimal yang tidak membebani CPU terlalu besar untuk embedded computer adalah 256x256 piksel dan untuk general purpose computer adalah 400x300 piksel.
Wechsler, Harry
1990-01-01
The book is suitable for advanced courses in computer vision and image processing. In addition to providing an overall view of computational vision, it contains extensive material on topics that are not usually covered in computer vision texts (including parallel distributed processing and neural networks) and considers many real applications.
Kendon, Vivien M; Nemoto, Kae; Munro, William J
2010-08-13
We briefly review what a quantum computer is, what it promises to do for us and why it is so hard to build one. Among the first applications anticipated to bear fruit is the quantum simulation of quantum systems. While most quantum computation is an extension of classical digital computation, quantum simulation differs fundamentally in how the data are encoded in the quantum computer. To perform a quantum simulation, the Hilbert space of the system to be simulated is mapped directly onto the Hilbert space of the (logical) qubits in the quantum computer. This type of direct correspondence is how data are encoded in a classical analogue computer. There is no binary encoding, and increasing precision becomes exponentially costly: an extra bit of precision doubles the size of the computer. This has important consequences for both the precision and error-correction requirements of quantum simulation, and significant open questions remain about its practicality. It also means that the quantum version of analogue computers, continuous-variable quantum computers, becomes an equally efficient architecture for quantum simulation. Lessons from past use of classical analogue computers can help us to build better quantum simulators in future.
Clark, D
1981-01-01
Computers for Image-Making tells the computer non-expert all he needs to know about Computer Animation. In the hands of expert computer engineers, computer picture-drawing systems have, since the earliest days of computing, produced interesting and useful images. As a result of major technological developments since then, it no longer requires the expert's skill to draw pictures; anyone can do it, provided they know how to use the appropriate machinery. This collection of specially commissioned articles reflects the diversity of user applications in this expanding field
Lanzagorta, Marco
2009-01-01
In this text we present a technical overview of the emerging field of quantum computation along with new research results by the authors. What distinguishes our presentation from that of others is our focus on the relationship between quantum computation and computer science. Specifically, our emphasis is on the computational model of quantum computing rather than on the engineering issues associated with its physical implementation. We adopt this approach for the same reason that a book on computer programming doesn't cover the theory and physical realization of semiconductors. Another distin
Wolinski, Christophe Czeslaw [Los Alamos, NM; Gokhale, Maya B [Los Alamos, NM; McCabe, Kevin Peter [Los Alamos, NM
2011-01-18
Fabric-based computing systems and methods are disclosed. A fabric-based computing system can include a polymorphous computing fabric that can be customized on a per application basis and a host processor in communication with said polymorphous computing fabric. The polymorphous computing fabric includes a cellular architecture that can be highly parameterized to enable a customized synthesis of fabric instances for a variety of enhanced application performances thereof. A global memory concept can also be included that provides the host processor random access to all variables and instructions associated with the polymorphous computing fabric.
2016-09-01
respectively. A length of dispersive fiber and a computer are used to first “decode” the optical interference signal into dispersed optical wave-packet...AWARD NUMBER: W81XWH-15-1-0008 TITLE: Cost-Effective Magnetoencephalography Based on Time-Encoded Optical Fiber Interferometry for Epilepsy...10 Dec 2014 - 9 Jun 2016 4. TITLE AND SUBTITLE 5a.16 CONTRACT NUMBER Encoded Optical Fiber Interferometry for Epilepsy and Tinnitus Diagnosis 5b
Know Your Personal Computer Introduction to Computers
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 1. Know Your Personal Computer Introduction to Computers. Siddhartha Kumar Ghoshal. Series Article Volume 1 Issue 1 January 1996 pp 48-55. Fulltext. Click here to view fulltext PDF. Permanent link:
P. McBride
The Computing Project is preparing for a busy year where the primary emphasis of the project moves towards steady operations. Following the very successful completion of Computing Software and Analysis challenge, CSA06, last fall, we have reorganized and established four groups in computing area: Commissioning, User Support, Facility/Infrastructure Operations and Data Operations. These groups work closely together with groups from the Offline Project in planning for data processing and operations. Monte Carlo production has continued since CSA06, with about 30M events produced each month to be used for HLT studies and physics validation. Monte Carlo production will continue throughout the year in the preparation of large samples for physics and detector studies ramping to 50 M events/month for CSA07. Commissioning of the full CMS computing system is a major goal for 2007. Site monitoring is an important commissioning component and work is ongoing to devise CMS specific tests to be included in Service Availa...
M. Kasemann
Overview During the past three months activities were focused on data operations, testing and re-enforcing shift and operational procedures for data production and transfer, MC production and on user support. Planning of the computing resources in view of the new LHC calendar in ongoing. Two new task forces were created for supporting the integration work: Site Commissioning, which develops tools helping distributed sites to monitor job and data workflows, and Analysis Support, collecting the user experience and feedback during analysis activities and developing tools to increase efficiency. The development plan for DMWM for 2009/2011 was developed at the beginning of the year, based on the requirements from the Physics, Computing and Offline groups (see Offline section). The Computing management meeting at FermiLab on February 19th and 20th was an excellent opportunity discussing the impact and for addressing issues and solutions to the main challenges facing CMS computing. The lack of manpower is particul...
M. Kasemann P. McBride Edited by M-C. Sawley with contributions from: P. Kreuzer D. Bonacorsi S. Belforte F. Wuerthwein L. Bauerdick K. Lassila-Perini M-C. Sawley
Introduction More than seventy CMS collaborators attended the Computing and Offline Workshop in San Diego, California, April 20-24th to discuss the state of readiness of software and computing for collisions. Focus and priority were given to preparations for data taking and providing room for ample dialog between groups involved in Commissioning, Data Operations, Analysis and MC Production. Throughout the workshop, aspects of software, operating procedures and issues addressing all parts of the computing model were discussed. Plans for the CMS participation in STEP’09, the combined scale testing for all four experiments due in June 2009, were refined. The article in CMS Times by Frank Wuerthwein gave a good recap of the highly collaborative atmosphere of the workshop. Many thanks to UCSD and to the organizers for taking care of this workshop, which resulted in a long list of action items and was definitely a success. A considerable amount of effort and care is invested in the estimate of the comput...
Parallel computers and three-dimensional computational electromagnetics
International Nuclear Information System (INIS)
Madsen, N.K.
1994-01-01
The authors have continued to enhance their ability to use new massively parallel processing computers to solve time-domain electromagnetic problems. New vectorization techniques have improved the performance of their code DSI3D by factors of 5 to 15, depending on the computer used. New radiation boundary conditions and far-field transformations now allow the computation of radar cross-section values for complex objects. A new parallel-data extraction code has been developed that allows the extraction of data subsets from large problems, which have been run on parallel computers, for subsequent post-processing on workstations with enhanced graphics capabilities. A new charged-particle-pushing version of DSI3D is under development. Finally, DSI3D has become a focal point for several new Cooperative Research and Development Agreement activities with industrial companies such as Lockheed Advanced Development Company, Varian, Hughes Electron Dynamics Division, General Atomic, and Cray
Energy Technology Data Exchange (ETDEWEB)
DAVENPORT, J.
2006-11-01
Computational Science is an integral component of Brookhaven's multi science mission, and is a reflection of the increased role of computation across all of science. Brookhaven currently has major efforts in data storage and analysis for the Relativistic Heavy Ion Collider (RHIC) and the ATLAS detector at CERN, and in quantum chromodynamics. The Laboratory is host for the QCDOC machines (quantum chromodynamics on a chip), 10 teraflop/s computers which boast 12,288 processors each. There are two here, one for the Riken/BNL Research Center and the other supported by DOE for the US Lattice Gauge Community and other scientific users. A 100 teraflop/s supercomputer will be installed at Brookhaven in the coming year, managed jointly by Brookhaven and Stony Brook, and funded by a grant from New York State. This machine will be used for computational science across Brookhaven's entire research program, and also by researchers at Stony Brook and across New York State. With Stony Brook, Brookhaven has formed the New York Center for Computational Science (NYCCS) as a focal point for interdisciplinary computational science, which is closely linked to Brookhaven's Computational Science Center (CSC). The CSC has established a strong program in computational science, with an emphasis on nanoscale electronic structure and molecular dynamics, accelerator design, computational fluid dynamics, medical imaging, parallel computing and numerical algorithms. We have been an active participant in DOES SciDAC program (Scientific Discovery through Advanced Computing). We are also planning a major expansion in computational biology in keeping with Laboratory initiatives. Additional laboratory initiatives with a dependence on a high level of computation include the development of hydrodynamics models for the interpretation of RHIC data, computational models for the atmospheric transport of aerosols, and models for combustion and for energy utilization. The CSC was formed to
Awofala, Adeneye O. A.; Akinoso, Sabainah O.; Fatade, Alfred O.
2017-01-01
The study investigated attitudes towards computer and computer self-efficacy as predictors of computer anxiety among 310 preservice mathematics teachers from five higher institutions of learning in Lagos and Ogun States of Nigeria using the quantitative research method within the blueprint of the descriptive survey design. Data collected were…
International Nuclear Information System (INIS)
Steane, Andrew
1998-01-01
The subject of quantum computing brings together ideas from classical information theory, computer science, and quantum physics. This review aims to summarize not just quantum computing, but the whole subject of quantum information theory. Information can be identified as the most general thing which must propagate from a cause to an effect. It therefore has a fundamentally important role in the science of physics. However, the mathematical treatment of information, especially information processing, is quite recent, dating from the mid-20th century. This has meant that the full significance of information as a basic concept in physics is only now being discovered. This is especially true in quantum mechanics. The theory of quantum information and computing puts this significance on a firm footing, and has led to some profound and exciting new insights into the natural world. Among these are the use of quantum states to permit the secure transmission of classical information (quantum cryptography), the use of quantum entanglement to permit reliable transmission of quantum states (teleportation), the possibility of preserving quantum coherence in the presence of irreversible noise processes (quantum error correction), and the use of controlled quantum evolution for efficient computation (quantum computation). The common theme of all these insights is the use of quantum entanglement as a computational resource. It turns out that information theory and quantum mechanics fit together very well. In order to explain their relationship, this review begins with an introduction to classical information theory and computer science, including Shannon's theorem, error correcting codes, Turing machines and computational complexity. The principles of quantum mechanics are then outlined, and the Einstein, Podolsky and Rosen (EPR) experiment described. The EPR-Bell correlations, and quantum entanglement in general, form the essential new ingredient which distinguishes quantum from
Energy Technology Data Exchange (ETDEWEB)
Steane, Andrew [Department of Atomic and Laser Physics, University of Oxford, Clarendon Laboratory, Oxford (United Kingdom)
1998-02-01
The subject of quantum computing brings together ideas from classical information theory, computer science, and quantum physics. This review aims to summarize not just quantum computing, but the whole subject of quantum information theory. Information can be identified as the most general thing which must propagate from a cause to an effect. It therefore has a fundamentally important role in the science of physics. However, the mathematical treatment of information, especially information processing, is quite recent, dating from the mid-20th century. This has meant that the full significance of information as a basic concept in physics is only now being discovered. This is especially true in quantum mechanics. The theory of quantum information and computing puts this significance on a firm footing, and has led to some profound and exciting new insights into the natural world. Among these are the use of quantum states to permit the secure transmission of classical information (quantum cryptography), the use of quantum entanglement to permit reliable transmission of quantum states (teleportation), the possibility of preserving quantum coherence in the presence of irreversible noise processes (quantum error correction), and the use of controlled quantum evolution for efficient computation (quantum computation). The common theme of all these insights is the use of quantum entanglement as a computational resource. It turns out that information theory and quantum mechanics fit together very well. In order to explain their relationship, this review begins with an introduction to classical information theory and computer science, including Shannon's theorem, error correcting codes, Turing machines and computational complexity. The principles of quantum mechanics are then outlined, and the Einstein, Podolsky and Rosen (EPR) experiment described. The EPR-Bell correlations, and quantum entanglement in general, form the essential new ingredient which distinguishes quantum from
Seventh Medical Image Computing and Computer Assisted Intervention Conference (MICCAI 2012)
Miller, Karol; Nielsen, Poul; Computational Biomechanics for Medicine : Models, Algorithms and Implementation
2013-01-01
One of the greatest challenges for mechanical engineers is to extend the success of computational mechanics to fields outside traditional engineering, in particular to biology, biomedical sciences, and medicine. This book is an opportunity for computational biomechanics specialists to present and exchange opinions on the opportunities of applying their techniques to computer-integrated medicine. Computational Biomechanics for Medicine: Models, Algorithms and Implementation collects the papers from the Seventh Computational Biomechanics for Medicine Workshop held in Nice in conjunction with the Medical Image Computing and Computer Assisted Intervention conference. The topics covered include: medical image analysis, image-guided surgery, surgical simulation, surgical intervention planning, disease prognosis and diagnostics, injury mechanism analysis, implant and prostheses design, and medical robotics.
2003-12-01
Computation and today’s microprocessors with the approach to operating system architecture, and the controversy between microkernels and monolithic kernels...Both Spatial Computation and microkernels break away a relatively monolithic architecture into in- dividual lightweight pieces, well specialized...for their particular functionality. Spatial Computation removes global signals and control, in the same way microkernels remove the global address
Water Quality Management Studies. West Point Lake, Chattahoochee River, Alabama-Georgia.
1984-08-01
Dec. Jan. Feb. Mar. Alpr . May June July Aug. Sept. Oct. Nov. Dec. 30V 00 7. 5 ft0 25 CH-13 N Ahadkee Crook . .. -. S Apr. "%Y June July Rug. Sept...Jm I y %g Spt.Ot N- Jn Alpr . May June Jl jg t.O.Nv.acJn.Fob. Mar. Api.. May June July Aus. Sept. Oct. Nov. Dec. EXPLIRTION SI- LrNE OF EOIJRL DISSOLVED...Sept. Oct. Nov. Dec. 0 3 IL25 :* ..... C Alpr . May June July Rug. Sept. Oct. Nov. Dec. Jan. Feb. Mar. Apr. May June July Rug. Sept. Oct. Nov. Dec
Computing Nash equilibria through computational intelligence methods
Pavlidis, N. G.; Parsopoulos, K. E.; Vrahatis, M. N.
2005-03-01
Nash equilibrium constitutes a central solution concept in game theory. The task of detecting the Nash equilibria of a finite strategic game remains a challenging problem up-to-date. This paper investigates the effectiveness of three computational intelligence techniques, namely, covariance matrix adaptation evolution strategies, particle swarm optimization, as well as, differential evolution, to compute Nash equilibria of finite strategic games, as global minima of a real-valued, nonnegative function. An issue of particular interest is to detect more than one Nash equilibria of a game. The performance of the considered computational intelligence methods on this problem is investigated using multistart and deflection.
A Lightweight Distributed Framework for Computational Offloading in Mobile Cloud Computing
Shiraz, Muhammad; Gani, Abdullah; Ahmad, Raja Wasim; Adeel Ali Shah, Syed; Karim, Ahmad; Rahman, Zulkanain Abdul
2014-01-01
The latest developments in mobile computing technology have enabled intensive applications on the modern Smartphones. However, such applications are still constrained by limitations in processing potentials, storage capacity and battery lifetime of the Smart Mobile Devices (SMDs). Therefore, Mobile Cloud Computing (MCC) leverages the application processing services of computational clouds for mitigating resources limitations in SMDs. Currently, a number of computational offloading frameworks are proposed for MCC wherein the intensive components of the application are outsourced to computational clouds. Nevertheless, such frameworks focus on runtime partitioning of the application for computational offloading, which is time consuming and resources intensive. The resource constraint nature of SMDs require lightweight procedures for leveraging computational clouds. Therefore, this paper presents a lightweight framework which focuses on minimizing additional resources utilization in computational offloading for MCC. The framework employs features of centralized monitoring, high availability and on demand access services of computational clouds for computational offloading. As a result, the turnaround time and execution cost of the application are reduced. The framework is evaluated by testing prototype application in the real MCC environment. The lightweight nature of the proposed framework is validated by employing computational offloading for the proposed framework and the latest existing frameworks. Analysis shows that by employing the proposed framework for computational offloading, the size of data transmission is reduced by 91%, energy consumption cost is minimized by 81% and turnaround time of the application is decreased by 83.5% as compared to the existing offloading frameworks. Hence, the proposed framework minimizes additional resources utilization and therefore offers lightweight solution for computational offloading in MCC. PMID:25127245
A lightweight distributed framework for computational offloading in mobile cloud computing.
Directory of Open Access Journals (Sweden)
Muhammad Shiraz
Full Text Available The latest developments in mobile computing technology have enabled intensive applications on the modern Smartphones. However, such applications are still constrained by limitations in processing potentials, storage capacity and battery lifetime of the Smart Mobile Devices (SMDs. Therefore, Mobile Cloud Computing (MCC leverages the application processing services of computational clouds for mitigating resources limitations in SMDs. Currently, a number of computational offloading frameworks are proposed for MCC wherein the intensive components of the application are outsourced to computational clouds. Nevertheless, such frameworks focus on runtime partitioning of the application for computational offloading, which is time consuming and resources intensive. The resource constraint nature of SMDs require lightweight procedures for leveraging computational clouds. Therefore, this paper presents a lightweight framework which focuses on minimizing additional resources utilization in computational offloading for MCC. The framework employs features of centralized monitoring, high availability and on demand access services of computational clouds for computational offloading. As a result, the turnaround time and execution cost of the application are reduced. The framework is evaluated by testing prototype application in the real MCC environment. The lightweight nature of the proposed framework is validated by employing computational offloading for the proposed framework and the latest existing frameworks. Analysis shows that by employing the proposed framework for computational offloading, the size of data transmission is reduced by 91%, energy consumption cost is minimized by 81% and turnaround time of the application is decreased by 83.5% as compared to the existing offloading frameworks. Hence, the proposed framework minimizes additional resources utilization and therefore offers lightweight solution for computational offloading in MCC.
DEFF Research Database (Denmark)
Vallgårda, Anna K. A.
to understand the computer as a material like any other material we would use for design, like wood, aluminum, or plastic. That as soon as the computer forms a composition with other materials it becomes just as approachable and inspiring as other smart materials. I present a series of investigations of what...... Computational Composite, and Telltale). Through the investigations, I show how the computer can be understood as a material and how it partakes in a new strand of materials whose expressions come to be in context. I uncover some of their essential material properties and potential expressions. I develop a way...
Girls and Computing: Female Participation in Computing in Schools
Zagami, Jason; Boden, Marie; Keane, Therese; Moreton, Bronwyn; Schulz, Karsten
2015-01-01
Computer education, with a focus on Computer Science, has become a core subject in the Australian Curriculum and the focus of national innovation initiatives. Equal participation by girls, however, remains unlikely based on their engagement with computing in recent decades. In seeking to understand why this may be the case, a Delphi consensus…
DEFF Research Database (Denmark)
Krogh, Simon
2013-01-01
with technological changes, the paradigmatic pendulum has swung between increased centralization on one side and a focus on distributed computing that pushes IT power out to end users on the other. With the introduction of outsourcing and cloud computing, centralization in large data centers is again dominating...... the IT scene. In line with the views presented by Nicolas Carr in 2003 (Carr, 2003), it is a popular assumption that cloud computing will be the next utility (like water, electricity and gas) (Buyya, Yeo, Venugopal, Broberg, & Brandic, 2009). However, this assumption disregards the fact that most IT production......), for instance, in establishing and maintaining trust between the involved parties (Sabherwal, 1999). So far, research in cloud computing has neglected this perspective and focused entirely on aspects relating to technology, economy, security and legal questions. While the core technologies of cloud computing (e...
International Nuclear Information System (INIS)
Kuesters, H.
1985-01-01
With this publication, the author presents the requirements that a user specific software should fulfill to reach an effective practice rationalisation through computer usage and the hardware configuration necessary as basic equipment. This should make it more difficult in the future for sales representatives to sell radiologists unusable computer systems. Furthermore, questions shall be answered that were asked by computer interested radiologists during the system presentation. On the one hand there still exists a prejudice against programmes of standard texts and on the other side undefined fears, that handling a computer is to difficult and that one has to learn a computer language first to be able to work with computers. Finally, it i pointed out, the real competitive advantages can be obtained through computer usage. (orig.) [de
Computability and unsolvability
Davis, Martin
1985-01-01
""A clearly written, well-presented survey of an intriguing subject."" - Scientific American. Classic text considers general theory of computability, computable functions, operations on computable functions, Turing machines self-applied, unsolvable decision problems, applications of general theory, mathematical logic, Kleene hierarchy, computable functionals, classification of unsolvable decision problems and more.
Unconventional Quantum Computing Devices
Lloyd, Seth
2000-01-01
This paper investigates a variety of unconventional quantum computation devices, including fermionic quantum computers and computers that exploit nonlinear quantum mechanics. It is shown that unconventional quantum computing devices can in principle compute some quantities more rapidly than `conventional' quantum computers.
Evolution of the Argonne Tandem Linear Accelerator System (ATLAS) control system
International Nuclear Information System (INIS)
Power, M.; Munson, F.
2012-01-01
Given that the Argonne Tandem Linear Accelerator System (ATLAS) recently celebrated its 25. anniversary, this paper will explore the past, present, and future of the ATLAS Control System, and how it has evolved along with the accelerator and control system technology. ATLAS as we know it today, originated with a Tandem Van de Graff in the sixties. With the addition of the Booster section in the late seventies, came the first computerized control. ATLAS itself was placed into service on June 25, 1985, and was the world's first superconducting linear accelerator for ions. Since its dedication as a National User Facility, more than a thousand experiments by more than 2,000 users worldwide, have taken advantage of the unique capabilities it provides. Today, ATLAS continues to be a user facility for physicists who study the particles that form the heart of atoms. Its most recent addition, CARIBU (Californium Rare Isotope Breeder Upgrade), creates special beams that feed into ATLAS. ATLAS is similar to a living organism, changing and responding to new technological challenges and research needs. As it continues to evolve, so does the control system: from the original days using a DEC PDP-11/34 computer and two CAMAC crates, to a DEC Alpha computer running Vsystem software and more than twenty CAMAC crates, to distributed computers and VME systems. Future upgrades are also in the planning stages that will continue to evolve the control system. (authors)
Prof Anyanwu 2009 dec edition...
African Journals Online (AJOL)
User
Sometimes presents with symptoms similar to those of postdural puncture headache, and can therefore be easily misdiagnosed, especially in a parturient that has undergone spinal anaesthesia. This is particularly significant because of the difference in the management between both conditions. Whereas the former might.
African Journals Online (AJOL)
androgen receptor (AR) gene. Phyllodes tumours are usually solitary and unilateral. Rarely, multifocal phyllodes tumour has been detected in a single breast it is very rare in men. Malignant phyllodes occasionally occur following a previous fibroadenoma or on its own. It is characterized by rapidity of growth and common in.
JMBR Journal - dec 2012 - gan...
African Journals Online (AJOL)
Mrs Musa
%, while 71.6% of the patients were discharged to the ward. Introduction. Intensive care has been defined as a service for patients with potentially recoverable conditions who can benefit from more detailed observation and invasive treatment ...
JMBR Journal - dec 2012 - gan...
African Journals Online (AJOL)
Mrs Musa
Benin City, Edo State, Nigeria. It provides specialist medical services, including ophthalmic services. ... Benin Teaching Hospital, Benin City, Nigeria - A Preliminary Report.....45 about where to get eye care services, patient For the .... rate, and with good surgical outcome will. 1. Patel D, Baker H, Murdoch I. Barriers to uptake.
JMBR Journal - dec 2012 - gan...
African Journals Online (AJOL)
Mrs Musa
and sepsis, avascular necrosis of the fermur, retinopathy and osteomylitis. Stroke is often recurrent and can lead to major functional deficit. Although from this study the incidence of dysmenorrhea amongst subjects with HbSS genotype was highest compared to subjects with HbAA and HbAS, none of the HbSS subjects with.
African Journals Online (AJOL)
Background: Hepatitis C virus (HCV) and human immunodeficiency virus (HIV) infections are major health problems worldwide. HCV/HIV ... severe fibrosis, a higher frequency of cirrhosis, and. 9 increased deaths from liver disease . ... considered in stable HIV individuals with pergylated interferon combined with ribavarin.
African Journals Online (AJOL)
HIV Seroprevalence Among Surgical Specialty Outpatients at a Teaching Hospital. *Omole-Ohonsi A ... The risk of transmission of the infection from patients to health workers, and from mother to child is very high ... pre-test counseling is employed in the management .... to have to have more migrants among them, with.
African Journals Online (AJOL)
(HNSCC) in Northern Nigeria and to review risk factors and prevention strategies. Methods:- ... Some other African countries show a relative high .... and is reported to contribute 75% in HNSCC. ... esteem; Family that is having parents who are ... and siblings, being critical element for programme ... adolescent smoking.
African Journals Online (AJOL)
Keywords:prostate cancer, prognostic factors, tumour makers, biological markers. ... treatment outcome and survival, the concept of .... Race is a well known risk factor for developing prostate cancer. However this disease also behaves differently in men of different races. Whether this is due to patient related factors or to ...
African Journals Online (AJOL)
women of reproductive age who presented with history of amenorrhea and lower abdominal pains could prove useful ... of cases that advance beyond 12 weeks of gestation. 1, 2, 3 .... assisted reproduction or difficulties during the ET. 1, 6, 7,9, ...
2010-06-02
... 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer Match No. 1048, IRS... Services (CMS). ACTION: Notice of renewal of an existing computer matching program (CMP) that has an...'' section below for comment period. DATES: Effective Dates: CMS filed a report of the Computer Matching...
Advances in unconventional computing
2017-01-01
The unconventional computing is a niche for interdisciplinary science, cross-bred of computer science, physics, mathematics, chemistry, electronic engineering, biology, material science and nanotechnology. The aims of this book are to uncover and exploit principles and mechanisms of information processing in and functional properties of physical, chemical and living systems to develop efficient algorithms, design optimal architectures and manufacture working prototypes of future and emergent computing devices. This first volume presents theoretical foundations of the future and emergent computing paradigms and architectures. The topics covered are computability, (non-)universality and complexity of computation; physics of computation, analog and quantum computing; reversible and asynchronous devices; cellular automata and other mathematical machines; P-systems and cellular computing; infinity and spatial computation; chemical and reservoir computing. The book is the encyclopedia, the first ever complete autho...
NET-COMPUTER: Internet Computer Architecture and its Application in E-Commerce
Directory of Open Access Journals (Sweden)
P. O. Umenne
2012-12-01
Full Text Available Research in Intelligent Agents has yielded interesting results, some of which have been translated into commercial ventures. Intelligent Agents are executable software components that represent the user, perform tasks on behalf of the user and when the task terminates, the Agents send the result to the user. Intelligent Agents are best suited for the Internet: a collection of computers connected together in a world-wide computer network. Swarm and HYDRA computer architectures for Agents’ execution were developed at the University of Surrey, UK in the 90s. The objective of the research was to develop a software-based computer architecture on which Agents execution could be explored. The combination of Intelligent Agents and HYDRA computer architecture gave rise to a new computer concept: the NET-Computer in which the computing resources reside on the Internet. The Internet computers form the hardware and software resources, and the user is provided with a simple interface to access the Internet and run user tasks. The Agents autonomously roam the Internet (NET-Computer executing the tasks. A growing segment of the Internet is E-Commerce for online shopping for products and services. The Internet computing resources provide a marketplace for product suppliers and consumers alike. Consumers are looking for suppliers selling products and services, while suppliers are looking for buyers. Searching the vast amount of information available on the Internet causes a great deal of problems for both consumers and suppliers. Intelligent Agents executing on the NET-Computer can surf through the Internet and select specific information of interest to the user. The simulation results show that Intelligent Agents executing HYDRA computer architecture could be applied in E-Commerce.
Computational intelligence synergies of fuzzy logic, neural networks and evolutionary computing
Siddique, Nazmul
2013-01-01
Computational Intelligence: Synergies of Fuzzy Logic, Neural Networks and Evolutionary Computing presents an introduction to some of the cutting edge technological paradigms under the umbrella of computational intelligence. Computational intelligence schemes are investigated with the development of a suitable framework for fuzzy logic, neural networks and evolutionary computing, neuro-fuzzy systems, evolutionary-fuzzy systems and evolutionary neural systems. Applications to linear and non-linear systems are discussed with examples. Key features: Covers all the aspect
Parton, K C
2014-01-01
The Digital Computer focuses on the principles, methodologies, and applications of the digital computer. The publication takes a look at the basic concepts involved in using a digital computer, simple autocode examples, and examples of working advanced design programs. Discussions focus on transformer design synthesis program, machine design analysis program, solution of standard quadratic equations, harmonic analysis, elementary wage calculation, and scientific calculations. The manuscript then examines commercial and automatic programming, how computers work, and the components of a computer
International Nuclear Information System (INIS)
Lemke, H.U.; Jaffe, C.C.; Felix, R.
1993-01-01
The proceedings of the CAR'93 symposium present the 126 oral papers and the 58 posters contributed to the four Technical Sessions entitled: (1) Image Management, (2) Medical Workstations, (3) Digital Image Generation - DIG, and (4) Application Systems - AS. Topics discussed in Session (1) are: picture archiving and communication systems, teleradiology, hospital information systems and radiological information systems, technology assessment and implications, standards, and data bases. Session (2) deals with computer vision, computer graphics, design and application, man computer interaction. Session (3) goes into the details of the diagnostic examination methods such as digital radiography, MRI, CT, nuclear medicine, ultrasound, digital angiography, and multimodality imaging. Session (4) is devoted to computer-assisted techniques, as there are: computer assisted radiological diagnosis, knowledge based systems, computer assisted radiation therapy and computer assisted surgical planning. (UWA). 266 figs [de
The Research of the Parallel Computing Development from the Angle of Cloud Computing
Peng, Zhensheng; Gong, Qingge; Duan, Yanyu; Wang, Yun
2017-10-01
Cloud computing is the development of parallel computing, distributed computing and grid computing. The development of cloud computing makes parallel computing come into people’s lives. Firstly, this paper expounds the concept of cloud computing and introduces two several traditional parallel programming model. Secondly, it analyzes and studies the principles, advantages and disadvantages of OpenMP, MPI and Map Reduce respectively. Finally, it takes MPI, OpenMP models compared to Map Reduce from the angle of cloud computing. The results of this paper are intended to provide a reference for the development of parallel computing.
Disciplines, models, and computers: the path to computational quantum chemistry.
Lenhard, Johannes
2014-12-01
Many disciplines and scientific fields have undergone a computational turn in the past several decades. This paper analyzes this sort of turn by investigating the case of computational quantum chemistry. The main claim is that the transformation from quantum to computational quantum chemistry involved changes in three dimensions. First, on the side of instrumentation, small computers and a networked infrastructure took over the lead from centralized mainframe architecture. Second, a new conception of computational modeling became feasible and assumed a crucial role. And third, the field of computa- tional quantum chemistry became organized in a market-like fashion and this market is much bigger than the number of quantum theory experts. These claims will be substantiated by an investigation of the so-called density functional theory (DFT), the arguably pivotal theory in the turn to computational quantum chemistry around 1990.
Pacing a data transfer operation between compute nodes on a parallel computer
Blocksome, Michael A [Rochester, MN
2011-09-13
Methods, systems, and products are disclosed for pacing a data transfer between compute nodes on a parallel computer that include: transferring, by an origin compute node, a chunk of an application message to a target compute node; sending, by the origin compute node, a pacing request to a target direct memory access (`DMA`) engine on the target compute node using a remote get DMA operation; determining, by the origin compute node, whether a pacing response to the pacing request has been received from the target DMA engine; and transferring, by the origin compute node, a next chunk of the application message if the pacing response to the pacing request has been received from the target DMA engine.
A Computational Fluid Dynamics Algorithm on a Massively Parallel Computer
Jespersen, Dennis C.; Levit, Creon
1989-01-01
The discipline of computational fluid dynamics is demanding ever-increasing computational power to deal with complex fluid flow problems. We investigate the performance of a finite-difference computational fluid dynamics algorithm on a massively parallel computer, the Connection Machine. Of special interest is an implicit time-stepping algorithm; to obtain maximum performance from the Connection Machine, it is necessary to use a nonstandard algorithm to solve the linear systems that arise in the implicit algorithm. We find that the Connection Machine ran achieve very high computation rates on both explicit and implicit algorithms. The performance of the Connection Machine puts it in the same class as today's most powerful conventional supercomputers.
Computer performance evaluation of FACOM 230-75 computer system, (2)
International Nuclear Information System (INIS)
Fujii, Minoru; Asai, Kiyoshi
1980-08-01
In this report are described computer performance evaluations for FACOM230-75 computers in JAERI. The evaluations are performed on following items: (1) Cost/benefit analysis of timesharing terminals, (2) Analysis of the response time of timesharing terminals, (3) Analysis of throughout time for batch job processing, (4) Estimation of current potential demands for computer time, (5) Determination of appropriate number of card readers and line printers. These evaluations are done mainly from the standpoint of cost reduction of computing facilities. The techniques adapted are very practical ones. This report will be useful for those people who are concerned with the management of computing installation. (author)
Baeten, J.C.M.; Luttik, S.P.; Tilburg, van P.J.A.; Natarajan, R.; Ojo, A.
2011-01-01
We enhance the notion of a computation of the classical theory of computing with the notion of interaction. In this way, we enhance a Turing machine as a model of computation to a Reactive Turing Machine that is an abstract model of a computer as it is used nowadays, always interacting with the user
Farrell, Robert G.; Lenchner, Jonathan; Kephjart, Jeffrey O.; Webb, Alan M.; Muller, MIchael J.; Erikson, Thomas D.; Melville, David O.; Bellamy, Rachel K.E.; Gruen, Daniel M.; Connell, Jonathan H.; Soroker, Danny; Aaron, Andy; Trewin, Shari M.; Ashoori, Maryam; Ellis, Jason B.
2016-01-01
IBM Research is engaged in a research program in symbiotic cognitive computing to investigate how to embed cognitive computing in physical spaces. This article proposes 5 key principles of symbiotic cognitive computing. We describe how these principles are applied in a particular symbiotic cognitive computing environment and in an illustrative application.
Opportunity for Realizing Ideal Computing System using Cloud Computing Model
Sreeramana Aithal; Vaikunth Pai T
2017-01-01
An ideal computing system is a computing system with ideal characteristics. The major components and their performance characteristics of such hypothetical system can be studied as a model with predicted input, output, system and environmental characteristics using the identified objectives of computing which can be used in any platform, any type of computing system, and for application automation, without making modifications in the form of structure, hardware, and software coding by an exte...
Deitel, Harvey M
1985-01-01
Computers and Data Processing provides information pertinent to the advances in the computer field. This book covers a variety of topics, including the computer hardware, computer programs or software, and computer applications systems.Organized into five parts encompassing 19 chapters, this book begins with an overview of some of the fundamental computing concepts. This text then explores the evolution of modern computing systems from the earliest mechanical calculating devices to microchips. Other chapters consider how computers present their results and explain the storage and retrieval of
I. Fisk
2010-01-01
Introduction It has been a very active quarter in Computing with interesting progress in all areas. The activity level at the computing facilities, driven by both organised processing from data operations and user analysis, has been steadily increasing. The large-scale production of simulated events that has been progressing throughout the fall is wrapping-up and reprocessing with pile-up will continue. A large reprocessing of all the proton-proton data has just been released and another will follow shortly. The number of analysis jobs by users each day, that was already hitting the computing model expectations at the time of ICHEP, is now 33% higher. We are expecting a busy holiday break to ensure samples are ready in time for the winter conferences. Heavy Ion An activity that is still in progress is computing for the heavy-ion program. The heavy-ion events are collected without zero suppression, so the event size is much large at roughly 11 MB per event of RAW. The central collisions are more complex and...
Tourlakis, George
2012-01-01
Learn the skills and acquire the intuition to assess the theoretical limitations of computer programming Offering an accessible approach to the topic, Theory of Computation focuses on the metatheory of computing and the theoretical boundaries between what various computational models can do and not do—from the most general model, the URM (Unbounded Register Machines), to the finite automaton. A wealth of programming-like examples and easy-to-follow explanations build the general theory gradually, which guides readers through the modeling and mathematical analysis of computational pheno
Computer hardware fault administration
Archer, Charles J.; Megerian, Mark G.; Ratterman, Joseph D.; Smith, Brian E.
2010-09-14
Computer hardware fault administration carried out in a parallel computer, where the parallel computer includes a plurality of compute nodes. The compute nodes are coupled for data communications by at least two independent data communications networks, where each data communications network includes data communications links connected to the compute nodes. Typical embodiments carry out hardware fault administration by identifying a location of a defective link in the first data communications network of the parallel computer and routing communications data around the defective link through the second data communications network of the parallel computer.
Directory of Open Access Journals (Sweden)
Gisele Faria
2005-12-01
Full Text Available The aim of this study was to evaluate the antibacterial action of root canal mechanical preparation using 2.5% sodium hypochlorite as the irrigating solution and a calcium hydroxide paste as the antibacterial intracanal dressing in human primary teeth root canals with pulp necrosis and apical periodontitis by means of microbial culture. A total of 26 root canals of human primary teeth with pulp necrosis and apical periodontitis were used. Samples were collected before, 72h after biomechanical treatment and 72h after removal of the intracanal dressing. Comparison by Wilcoxon test showed that root canal mechanical preparation effectively eliminated all microorganisms in 20% of the root canals, and the intracanal dressing in 62.5%; however, the cumulative action of biomechanical treatment and intracanal dressing eliminated the microorganisms of 70% of the root canals (pO objetivo do presente estudo foi avaliar, por meio de cultura bacteriológica, a ação antibacteriana do preparo biomecânico utilizando como solução irrigadora o hipoclorito de sódio a 2,5% e da pasta Calen utilizada como curativo de demora em canais radiculares de dentes decíduos de humanos com necrose pulpar e lesão periapical. Foram selecionados 26 dentes decíduos de humanos portadores de necrose pulpar e lesão periapical. As colheitas microbiológicas foram efetuadas antes e 72 horas após o preparo biomecânico e 72 horas após a remoção do curativo de demora. A comparação por meio do teste de Wilcoxon mostrou que o preparo biomecânico foi eficaz na eliminação dos microrganismos dos canais radiculares em 20% dos casos e o curativo de demora em 62,5%, enquanto que a ação cumulativa do preparo biomecânico e do curativo de demora eliminou os microrganismos em 70,0% dos casos (p<0.001. Pôde-se concluir que o preparo biomecânico, isoladamente, apresentou resultados microbiológicos inferiores àqueles obtidos quando o mesmo foi associado ao curativo de demora
Pulmonary lobar volumetry using novel volumetric computer-aided diagnosis and computed tomography
Iwano, Shingo; Kitano, Mariko; Matsuo, Keiji; Kawakami, Kenichi; Koike, Wataru; Kishimoto, Mariko; Inoue, Tsutomu; Li, Yuanzhong; Naganawa, Shinji
2013-01-01
OBJECTIVES To compare the accuracy of pulmonary lobar volumetry using the conventional number of segments method and novel volumetric computer-aided diagnosis using 3D computed tomography images. METHODS We acquired 50 consecutive preoperative 3D computed tomography examinations for lung tumours reconstructed at 1-mm slice thicknesses. We calculated the lobar volume and the emphysematous lobar volume volumetry computer-aided diagnosis system could more precisely measure lobar volumes than the conventional number of segments method. Because semi-automatic computer-aided diagnosis and automatic computer-aided diagnosis were complementary, in clinical use, it would be more practical to first measure volumes by automatic computer-aided diagnosis, and then use semi-automatic measurements if automatic computer-aided diagnosis failed. PMID:23526418
Elementary EFL Teachers' Computer Phobia and Computer Self-Efficacy in Taiwan
Chen, Kate Tzuching
2012-01-01
The advent and application of computer and information technology has increased the overall success of EFL teaching; however, such success is hard to assess, and teachers prone to computer avoidance face negative consequences. Two major obstacles are high computer phobia and low computer self-efficacy. However, little research has been carried out…
Directory of Open Access Journals (Sweden)
George SUCIU
2013-01-01
Full Text Available The cloud computing paradigm has been defined from several points of view, the main two directions being either as an evolution of the grid and distributed computing paradigm, or, on the contrary, as a disruptive revolution in the classical paradigms of operating systems, network layers and web applications. This paper presents a distributed cloud computing platform called SlapOS, which unifies technologies and communication protocols into a new technology model for offering any application as a service. Both cloud and distributed computing can be efficient methods for optimizing resources that are aggregated from a grid of standard PCs hosted in homes, offices and small data centers. The paper fills a gap in the existing distributed computing literature by providing a distributed cloud computing model which can be applied for deploying various applications.
Computers and Computation. Readings from Scientific American.
Fenichel, Robert R.; Weizenbaum, Joseph
A collection of articles from "Scientific American" magazine has been put together at this time because the current period in computer science is one of consolidation rather than innovation. A few years ago, computer science was moving so swiftly that even the professional journals were more archival than informative; but today it is…
International Nuclear Information System (INIS)
Lloyd, S.
1992-01-01
Digital computers are machines that can be programmed to perform logical and arithmetical operations. Contemporary digital computers are ''universal,'' in the sense that a program that runs on one computer can, if properly compiled, run on any other computer that has access to enough memory space and time. Any one universal computer can simulate the operation of any other; and the set of tasks that any such machine can perform is common to all universal machines. Since Bennett's discovery that computation can be carried out in a non-dissipative fashion, a number of Hamiltonian quantum-mechanical systems have been proposed whose time-evolutions over discrete intervals are equivalent to those of specific universal computers. The first quantum-mechanical treatment of computers was given by Benioff, who exhibited a Hamiltonian system with a basis whose members corresponded to the logical states of a Turing machine. In order to make the Hamiltonian local, in the sense that its structure depended only on the part of the computation being performed at that time, Benioff found it necessary to make the Hamiltonian time-dependent. Feynman discovered a way to make the computational Hamiltonian both local and time-independent by incorporating the direction of computation in the initial condition. In Feynman's quantum computer, the program is a carefully prepared wave packet that propagates through different computational states. Deutsch presented a quantum computer that exploits the possibility of existing in a superposition of computational states to perform tasks that a classical computer cannot, such as generating purely random numbers, and carrying out superpositions of computations as a method of parallel processing. In this paper, we show that such computers, by virtue of their common function, possess a common form for their quantum dynamics
Bosworth, Seymour; Whyne, Eric
2012-01-01
The classic and authoritative reference in the field of computer security, now completely updated and revised With the continued presence of large-scale computers; the proliferation of desktop, laptop, and handheld computers; and the vast international networks that interconnect them, the nature and extent of threats to computer security have grown enormously. Now in its fifth edition, Computer Security Handbook continues to provide authoritative guidance to identify and to eliminate these threats where possible, as well as to lessen any losses attributable to them. With seventy-seven chapter
Jajodia, Sushil; Samarati, Pierangela; Singhal, Anoop; Swarup, Vipin; Wang, Cliff
2014-01-01
This book presents a range of cloud computing security challenges and promising solution paths. The first two chapters focus on practical considerations of cloud computing. In Chapter 1, Chandramouli, Iorga, and Chokani describe the evolution of cloud computing and the current state of practice, followed by the challenges of cryptographic key management in the cloud. In Chapter 2, Chen and Sion present a dollar cost model of cloud computing and explore the economic viability of cloud computing with and without security mechanisms involving cryptographic mechanisms. The next two chapters addres
Energy Technology Data Exchange (ETDEWEB)
DAVENPORT, J.
2005-11-01
The Brookhaven Computational Science Center brings together researchers in biology, chemistry, physics, and medicine with applied mathematicians and computer scientists to exploit the remarkable opportunities for scientific discovery which have been enabled by modern computers. These opportunities are especially great in computational biology and nanoscience, but extend throughout science and technology and include, for example, nuclear and high energy physics, astrophysics, materials and chemical science, sustainable energy, environment, and homeland security. To achieve our goals we have established a close alliance with applied mathematicians and computer scientists at Stony Brook and Columbia Universities.
Sosinsky, Barrie
2010-01-01
The complete reference guide to the hot technology of cloud computingIts potential for lowering IT costs makes cloud computing a major force for both IT vendors and users; it is expected to gain momentum rapidly with the launch of Office Web Apps later this year. Because cloud computing involves various technologies, protocols, platforms, and infrastructure elements, this comprehensive reference is just what you need if you'll be using or implementing cloud computing.Cloud computing offers significant cost savings by eliminating upfront expenses for hardware and software; its growing popularit
Weber, Rebecca
2012-01-01
What can we compute--even with unlimited resources? Is everything within reach? Or are computations necessarily drastically limited, not just in practice, but theoretically? These questions are at the heart of computability theory. The goal of this book is to give the reader a firm grounding in the fundamentals of computability theory and an overview of currently active areas of research, such as reverse mathematics and algorithmic randomness. Turing machines and partial recursive functions are explored in detail, and vital tools and concepts including coding, uniformity, and diagonalization are described explicitly. From there the material continues with universal machines, the halting problem, parametrization and the recursion theorem, and thence to computability for sets, enumerability, and Turing reduction and degrees. A few more advanced topics round out the book before the chapter on areas of research. The text is designed to be self-contained, with an entire chapter of preliminary material including re...
Cartoon computation: quantum-like computing without quantum mechanics
International Nuclear Information System (INIS)
Aerts, Diederik; Czachor, Marek
2007-01-01
We present a computational framework based on geometric structures. No quantum mechanics is involved, and yet the algorithms perform tasks analogous to quantum computation. Tensor products and entangled states are not needed-they are replaced by sets of basic shapes. To test the formalism we solve in geometric terms the Deutsch-Jozsa problem, historically the first example that demonstrated the potential power of quantum computation. Each step of the algorithm has a clear geometric interpretation and allows for a cartoon representation. (fast track communication)
Digital optical computers at the optoelectronic computing systems center
Jordan, Harry F.
1991-01-01
The Digital Optical Computing Program within the National Science Foundation Engineering Research Center for Opto-electronic Computing Systems has as its specific goal research on optical computing architectures suitable for use at the highest possible speeds. The program can be targeted toward exploiting the time domain because other programs in the Center are pursuing research on parallel optical systems, exploiting optical interconnection and optical devices and materials. Using a general purpose computing architecture as the focus, we are developing design techniques, tools and architecture for operation at the speed of light limit. Experimental work is being done with the somewhat low speed components currently available but with architectures which will scale up in speed as faster devices are developed. The design algorithms and tools developed for a general purpose, stored program computer are being applied to other systems such as optimally controlled optical communication networks.
International Nuclear Information System (INIS)
Nodarse, F.F.; Ivanov, V.G.
1991-01-01
Using BLACKBOARD architecture and qualitative model, an expert systm was developed to assist the use in defining the computers method for High Energy Physics computing. The COMEX system requires an IBM AT personal computer or compatible with than 640 Kb RAM and hard disk. 5 refs.; 9 figs
International Nuclear Information System (INIS)
Pugatch, V.M.
2001-01-01
The creation of the rapid and sensitive system for the determination of the Alpha-radioactivity in the Environmental samples has been determined as the main goal of the Research Contract No. 7200RO/RB. As a result of the first stage of the research accomplished in the year 1993, the prototype of the system based on the combination of the laser photoionization mass spectrometry and many-channel alpha-spectrometer has been built and tested. To improve the sensitivity it was proposed to add one more stage to the laser photoionization mass-spectrometer. To develop the high position sensitivity of the system it was proposed to include into the alpha-radiometer SI strip-detector with submicron position sensitivity. Hardware and software for the laser-semiconductor monitoring system of alpha-radionuclides in the environment have been further developed and tested in frames of the IAEA Research Contract No. 7200/R1/RB. Optimization of the sample evaporation with one more stage of photoionization has been successfully performed in the laser photoionization mass-spectrometer. The automatization of the measurement procedure is under way by means of the IBM PC-386 and specially designed electronic units. The evaluated sensitivity of the new set-up is in the range of 1.0 Bq/kg. A bulk measurement of the alpha-radioactivity concentration in soil samples from the Chernobyl region (100 km) have been performed by means of thick samples method and built under this contract alpha-radiometer with large area SI semiconductor detectors. The lowest detectable level was in the range 100 Bq/kg without any radiochemical separation. Comparison with the data obtained for the same probes by means of the thin sample (with radiochemical separation) has shown higher Pu-concentration values obtained by means of the thick samples. For the first time the Sl-strip-detector with 128 channels has been applied for the alpha-radiometry purposes. Different read-out electronics (including the most sophisticated one used in high energy physics experiments) has been studied and tested. The most suitable set (preamplifier, shaper, discriminator) of electronics has been found and built for the test measurements with the 128-channel Sl-strip-detector produced for the purposes of the alpha-radiometry by Kiev firm 'Detector'. The studies have been performed to use for the alpha-radiometry purposes sub-micron position sensitivity of the Sl-strip-detector. Such high accuracy of the position measurements could be useful for some radiobiological applications if the cell level accuracy of the tracer radioactive element position is concerned. Another application of the Sl-strip-detectors for alpha-radiometry purposes could be realized for the detection of the radioactive contamination spots with high position accuracy
Bioinspired computation in combinatorial optimization: algorithms and their computational complexity
DEFF Research Database (Denmark)
Neumann, Frank; Witt, Carsten
2012-01-01
Bioinspired computation methods, such as evolutionary algorithms and ant colony optimization, are being applied successfully to complex engineering and combinatorial optimization problems, and it is very important that we understand the computational complexity of these algorithms. This tutorials...... problems. Classical single objective optimization is examined first. They then investigate the computational complexity of bioinspired computation applied to multiobjective variants of the considered combinatorial optimization problems, and in particular they show how multiobjective optimization can help...... to speed up bioinspired computation for single-objective optimization problems. The tutorial is based on a book written by the authors with the same title. Further information about the book can be found at www.bioinspiredcomputation.com....
DEFF Research Database (Denmark)
Jochum, Elizabeth Ann; Putnam, Lance
2017-01-01
Artists increasingly utilize computational tools to generate art works. Computational approaches to art making open up new ways of thinking about agency in interactive art because they invite participation and allow for unpredictable outcomes. Computational art is closely linked...... to the participatory turn in visual art, wherein spectators physically participate in visual art works. Unlike purely physical methods of interaction, computer assisted interactivity affords artists and spectators more nuanced control of artistic outcomes. Interactive art brings together human bodies, computer code......, and nonliving objects to create emergent art works. Computation is more than just a tool for artists, it is a medium for investigating new aesthetic possibilities for choreography and composition. We illustrate this potential through two artistic projects: an improvisational dance performance between a human...
Marinos, Alexandros; Briscoe, Gerard
Cloud Computing is rising fast, with its data centres growing at an unprecedented rate. However, this has come with concerns over privacy, efficiency at the expense of resilience, and environmental sustainability, because of the dependence on Cloud vendors such as Google, Amazon and Microsoft. Our response is an alternative model for the Cloud conceptualisation, providing a paradigm for Clouds in the community, utilising networked personal computers for liberation from the centralised vendor model. Community Cloud Computing (C3) offers an alternative architecture, created by combing the Cloud with paradigms from Grid Computing, principles from Digital Ecosystems, and sustainability from Green Computing, while remaining true to the original vision of the Internet. It is more technically challenging than Cloud Computing, having to deal with distributed computing issues, including heterogeneous nodes, varying quality of service, and additional security constraints. However, these are not insurmountable challenges, and with the need to retain control over our digital lives and the potential environmental consequences, it is a challenge we must pursue.
Arnold, J. O.
1987-01-01
With the advent of supercomputers, modern computational chemistry algorithms and codes, a powerful tool was created to help fill NASA's continuing need for information on the properties of matter in hostile or unusual environments. Computational resources provided under the National Aerodynamics Simulator (NAS) program were a cornerstone for recent advancements in this field. Properties of gases, materials, and their interactions can be determined from solutions of the governing equations. In the case of gases, for example, radiative transition probabilites per particle, bond-dissociation energies, and rates of simple chemical reactions can be determined computationally as reliably as from experiment. The data are proving to be quite valuable in providing inputs to real-gas flow simulation codes used to compute aerothermodynamic loads on NASA's aeroassist orbital transfer vehicles and a host of problems related to the National Aerospace Plane Program. Although more approximate, similar solutions can be obtained for ensembles of atoms simulating small particles of materials with and without the presence of gases. Computational chemistry has application in studying catalysis, properties of polymers, all of interest to various NASA missions, including those previously mentioned. In addition to discussing these applications of computational chemistry within NASA, the governing equations and the need for supercomputers for their solution is outlined.
Nurses' computer literacy and attitudes towards the use of computers in health care.
Gürdaş Topkaya, Sati; Kaya, Nurten
2015-05-01
This descriptive and cross-sectional study was designed to address nurses' computer literacy and attitudes towards the use of computers in health care and to determine the correlation between these two variables. This study was conducted with the participation of 688 nurses who worked at two university-affiliated hospitals. These nurses were chosen using a stratified random sampling method. The data were collected using the Multicomponent Assessment of Computer Literacy and the Pretest for Attitudes Towards Computers in Healthcare Assessment Scale v. 2. The nurses, in general, had positive attitudes towards computers, and their computer literacy was good. Computer literacy in general had significant positive correlations with individual elements of computer competency and with attitudes towards computers. If the computer is to be an effective and beneficial part of the health-care system, it is necessary to help nurses improve their computer competency. © 2014 Wiley Publishing Asia Pty Ltd.
Shen, Wenfeng; Wei, Daming; Xu, Weimin; Zhu, Xin; Yuan, Shizhong
2010-10-01
Biological computations like electrocardiological modelling and simulation usually require high-performance computing environments. This paper introduces an implementation of parallel computation for computer simulation of electrocardiograms (ECGs) in a personal computer environment with an Intel CPU of Core (TM) 2 Quad Q6600 and a GPU of Geforce 8800GT, with software support by OpenMP and CUDA. It was tested in three parallelization device setups: (a) a four-core CPU without a general-purpose GPU, (b) a general-purpose GPU plus 1 core of CPU, and (c) a four-core CPU plus a general-purpose GPU. To effectively take advantage of a multi-core CPU and a general-purpose GPU, an algorithm based on load-prediction dynamic scheduling was developed and applied to setting (c). In the simulation with 1600 time steps, the speedup of the parallel computation as compared to the serial computation was 3.9 in setting (a), 16.8 in setting (b), and 20.0 in setting (c). This study demonstrates that a current PC with a multi-core CPU and a general-purpose GPU provides a good environment for parallel computations in biological modelling and simulation studies. Copyright 2010 Elsevier Ireland Ltd. All rights reserved.
A Web-based Distributed Voluntary Computing Platform for Large Scale Hydrological Computations
Demir, I.; Agliamzanov, R.
2014-12-01
Distributed volunteer computing can enable researchers and scientist to form large parallel computing environments to utilize the computing power of the millions of computers on the Internet, and use them towards running large scale environmental simulations and models to serve the common good of local communities and the world. Recent developments in web technologies and standards allow client-side scripting languages to run at speeds close to native application, and utilize the power of Graphics Processing Units (GPU). Using a client-side scripting language like JavaScript, we have developed an open distributed computing framework that makes it easy for researchers to write their own hydrologic models, and run them on volunteer computers. Users will easily enable their websites for visitors to volunteer sharing their computer resources to contribute running advanced hydrological models and simulations. Using a web-based system allows users to start volunteering their computational resources within seconds without installing any software. The framework distributes the model simulation to thousands of nodes in small spatial and computational sizes. A relational database system is utilized for managing data connections and queue management for the distributed computing nodes. In this paper, we present a web-based distributed volunteer computing platform to enable large scale hydrological simulations and model runs in an open and integrated environment.
Visual ergonomics and computer work--is it all about computer glasses?
Jonsson, Christina
2012-01-01
The Swedish Provisions on Work with Display Screen Equipment and the EU Directive on the minimum safety and health requirements for work with display screen equipment cover several important visual ergonomics aspects. But a review of cases and questions to the Swedish Work Environment Authority clearly shows that most attention is given to the demands for eyesight tests and special computer glasses. Other important visual ergonomics factors are at risk of being neglected. Today computers are used everywhere, both at work and at home. Computers can be laptops, PDA's, tablet computers, smart phones, etc. The demands on eyesight tests and computer glasses still apply but the visual demands and the visual ergonomics conditions are quite different compared to the use of a stationary computer. Based on this review, we raise the question if the demand on the employer to provide the employees with computer glasses is outdated.
Computing with concepts, computing with numbers: Llull, Leibniz, and Boole
Uckelman, S.L.
2010-01-01
We consider two ways to understand "reasoning as computation", one which focuses on the computation of concept symbols and the other on the computation of number symbols. We illustrate these two ways with Llull’s Ars Combinatoria and Leibniz’s attempts to arithmetize language, respectively. We then
Processing computed tomography images by using personal computer
International Nuclear Information System (INIS)
Seto, Kazuhiko; Fujishiro, Kazuo; Seki, Hirofumi; Yamamoto, Tetsuo.
1994-01-01
Processing of CT images was attempted by using a popular personal computer. The program for image-processing was made with C compiler. The original images, acquired with CT scanner (TCT-60A, Toshiba), were transferred to the computer by 8-inch flexible diskette. Many fundamental image-processing, such as displaying image to the monitor, calculating CT value and drawing the profile curve. The result showed that a popular personal computer had ability to process CT images. It seemed that 8-inch flexible diskette was still useful medium of transferring image data. (author)
Artificial Intelligence in Space Platforms.
1984-12-01
computer algorithms, there still appears to be a need for Artificial Inteligence techniques in the navigation area. The reason is that navigaion, in...RD-RI32 679 ARTIFICIAL INTELLIGENCE IN SPACE PLRTFORNSMU AIR FORCE 1/ INST OF TECH WRIGHT-PRTTERSON AFB OH SCHOOL OF ENGINEERING M A WRIGHT DEC 94...i4 Preface The purpose of this study was to analyze the feasibility of implementing Artificial Intelligence techniques to increase autonomy for
Information Extraction from Large-Multi-Layer Social Networks
2015-08-06
mization [4]. Methods that fall into this category include spec- tral algorithms, modularity methods, and methods that rely on statistical inference...Snijders and Chris Baerveldt, “A multilevel network study of the effects of delinquent behavior on friendship evolution,” Journal of mathematical sociol- ogy...1970. [10] Ulrike Luxburg, “A tutorial on spectral clustering,” Statistics and Computing, vol. 17, no. 4, pp. 395–416, Dec. 2007. [11] R. A. Fisher, “On
International Nuclear Information System (INIS)
Ethier, C.R.
2004-01-01
Computational biomechanics is a fast-growing field that integrates modern biological techniques and computer modelling to solve problems of medical and biological interest. Modelling of blood flow in the large arteries is the best-known application of computational biomechanics, but there are many others. Described here is work being carried out in the laboratory on the modelling of blood flow in the coronary arteries and on the transport of viral particles in the eye. (author)