WorldWideScience

Sample records for dec computers

  1. Networking DEC and IBM computers

    Science.gov (United States)

    Mish, W. H.

    1983-01-01

    Local Area Networking of DEC and IBM computers within the structure of the ISO-OSI Seven Layer Reference Model at a raw signaling speed of 1 Mops or greater are discussed. After an introduction to the ISO-OSI Reference Model nd the IEEE-802 Draft Standard for Local Area Networks (LANs), there follows a detailed discussion and comparison of the products available from a variety of manufactures to perform this networking task. A summary of these products is presented in a table.

  2. Evaluation of DEC`s GIGAswitch for distributed parallel computing

    Energy Technology Data Exchange (ETDEWEB)

    Chen, H.; Hutchins, J.; Brandt, J.

    1993-10-01

    One of Sandia`s research efforts is to reduce the end-to-end communication delay in a parallel-distributed computing environment. GIGAswitch is DEC`s implementation of a gigabit local area network based on switched FDDI technology. Using the GIGAswitch, the authors intend to minimize the medium access latency suffered by shared-medium FDDI technology. Experimental results show that the GIGAswitch adds 16.5 microseconds of switching and bridging delay to an end-to-end communication. Although the added latency causes a 1.8% throughput degradation and a 5% line efficiency degradation, the availability of dedicated bandwidth is much more than what is available to a workstation on a shared medium. For example, ten directly connected workstations each would have a dedicated bandwidth of 95 Mbps, but if they were sharing the FDDI bandwidth, each would have 10% of the total bandwidth, i.e., less than 10 Mbps. In addition, they have found that when there is no output port contention, the switch`s aggregate bandwidth will scale up to multiples of its port bandwidth. However, with output port contention, the throughput and latency performance suffered significantly. Their mathematical and simulation models indicate that the GIGAswitch line efficiency could be as low as 63% when there are nine input ports contending for the same output port. The data indicate that the delay introduced by contention at the server workstation is 50 times that introduced by the GIGAswitch. The authors conclude that the GIGAswitch meets the performance requirements of today`s high-end workstations and that the switched FDDI technology provides an alternative that utilizes existing workstation interfaces while increasing the aggregate bandwidth. However, because the speed of workstations is increasing by a factor of 2 every 1.5 years, the switched FDDI technology is only good as an interim solution.

  3. Macro-IML manual for DEC PDP 11 computer with controller DEC CA 11-A/BORER type 1,533 A

    International Nuclear Information System (INIS)

    Kubitz, M.; Kind, R.

    1975-03-01

    The IML-implementations follow the Macro-Syntax as given in Appendix A of the document 'CAMAC. The Definitior of IML (A Language For Use in CAMAC Systems)'. This document has been adopted as a description by ESONE and AEC NIM in August/September 74 and has been published in October 74. They have been designed for the DEC PDP 11 computer with the branch controller DEC CA 11-A and the Single Crate Controller BORER Type 1,533 A. For both DEC operating systems, DOS V08/09 and RSX-11D/M a full set of macros has been implemented except the block transfer on special LAM, X-error control statements and the subscript mode. Transfer modes not implemented by the hardware of the CA 11-A are simulated by software. (orig.) [de

  4. DEC Home

    Science.gov (United States)

    , improving, and protecting Alaska's natural resources and environment to enhance the health, safety, economic , Assessment and Restoration Environmental Health Drinking Water Food Safety & Sanitation Laboratory Environmental Conservation Alaska Department of Environmental Conservation Search DEC State of Alaska Conserving

  5. PRO/Mapper: a plotting program for the DEC PRO/300 personal computers utilizing the MAPPER graphics language

    International Nuclear Information System (INIS)

    Wachter, J.W.

    1986-05-01

    PRO/Mapper is an application for the Digital Equipment Corporation PRO/300 series of personal computers that facilitates the preparation of visuals such as graphs, charts, and maps in color or black and white. The user prepares an input data file containing English-language commands and writes it into a file using standard editor. PRO/Mapper then reads these files and draws graphs, maps, boxes, and complex line segments onto the computer screen. Axes, curves, and error bars may be plotted in graphical presentations. The commands of PRO/Mapper are a subset of the commands of the more sophisticated MAPPER program written for mainframe computers. The PRO/Mapper commands were chosen primarily for the production of linear graphs. Command files written for the PRO/300 are upward compatible with the Martin Marietta Energy Systems version of MAPPER and can be used to produce publication-quality slides, drawings, and maps on the various output devices of the Oak Ridge National Laboratory mainframe computers

  6. DEC VT220

    CERN Multimedia

    1983-01-01

    The DEC (Digital Equipment Corporation) VT220 is a text terminal which uses an redesigned keyboard(LK201). The VT220 improved on the earlier VT100 series of terminals with much smaller physical packaging and and a much faster microprocessor.

  7. Computational mechanics - Advances and trends; Proceedings of the Session - Future directions of Computational Mechanics of the ASME Winter Annual Meeting, Anaheim, CA, Dec. 7-12, 1986

    Science.gov (United States)

    Noor, Ahmed K. (Editor)

    1986-01-01

    The papers contained in this volume provide an overview of the advances made in a number of aspects of computational mechanics, identify some of the anticipated industry needs in this area, discuss the opportunities provided by new hardware and parallel algorithms, and outline some of the current government programs in computational mechanics. Papers are included on advances and trends in parallel algorithms, supercomputers for engineering analysis, material modeling in nonlinear finite-element analysis, the Navier-Stokes computer, and future finite-element software systems.

  8. DATA TRANSFER FROM A DEC PDP-11 BASED MASS-SPECTROMETRY DATA STATION TO AN MS-DOS PERSONAL-COMPUTER

    NARCIS (Netherlands)

    RAFFAELLI, A; BRUINS, AP

    This paper describes a simple procedure for obtaining better quality graphic output for mass spectrometry data from data systems equipped with poor quality printing devices. The procedure uses KERMIT, a low cost public domain software, to transfer ASCII tables to a MS-DOS personal computer where

  9. TASAC a computer program for thermal analysis of severe accident conditions. Version 3/01, Dec 1991. Model description and user's guide

    International Nuclear Information System (INIS)

    Stempniewicz, M.; Marks, P.; Salwa, K.

    1992-06-01

    TASAC (Thermal Analysis of Severe Accident Conditions) is computer code developed in the Institute of Atomic Energy written in FORTRAN 77 for the digital computer analysis of PWR rod bundle behaviour during severe accident conditions. The code has the ability to model an early stage of core degradation including heat transfer inside the rods, convective and radiative heat exchange as well as cladding interactions with coolant and fuel, hydrogen generation, melting, relocations and refreezing of fuel rod materials with dissolution of UO 2 and ZrO 2 in liquid phase. The code was applied for the simulation of International Standard Problem number 28, performed on PHEBUS test facility. This report contains the program physical models description, detailed description of input data requirements and results of code verification. The main directions for future TASAC code development are formulated. (author). 20 refs, 39 figs, 4 tabs

  10. TASAC a computer program for thermal analysis of severe accident conditions. Version 3/01, Dec 1991. Model description and user`s guide

    Energy Technology Data Exchange (ETDEWEB)

    Stempniewicz, M; Marks, P; Salwa, K

    1992-06-01

    TASAC (Thermal Analysis of Severe Accident Conditions) is computer code developed in the Institute of Atomic Energy written in FORTRAN 77 for the digital computer analysis of PWR rod bundle behaviour during severe accident conditions. The code has the ability to model an early stage of core degradation including heat transfer inside the rods, convective and radiative heat exchange as well as cladding interactions with coolant and fuel, hydrogen generation, melting, relocations and refreezing of fuel rod materials with dissolution of UO{sub 2} and ZrO{sub 2} in liquid phase. The code was applied for the simulation of International Standard Problem number 28, performed on PHEBUS test facility. This report contains the program physical models description, detailed description of input data requirements and results of code verification. The main directions for future TASAC code development are formulated. (author). 20 refs, 39 figs, 4 tabs.

  11. EAMJ Dec. Repeatability.indd

    African Journals Online (AJOL)

    2008-12-12

    Dec 12, 2008 ... wheeze in the past year, and 174 who did not. Interventions:Administered .... best of three spirometer readings was taken, and any individual with ... all those wheezers with reported ever having asthma, and the 'negatives' to ...

  12. EAMJ Dec. Pathological.indd

    African Journals Online (AJOL)

    2008-12-12

    Dec 12, 2008 ... cardiac-arrhythmias cardio-myopathy, HIV/AIDS, Left Ventricular ... (LVH), infective endocarditis, atrial septal aneurysm, carotid plaques with or ... patients who died had anterior circulation ischaemic stroke as per ... disturbance of cerebral function of sudden onset ..... of strict blood pressure control (15, 32).

  13. Digital Equipment Corporation (DEC): A case study of indecision, innovation and company failure

    NARCIS (Netherlands)

    Goodwin, D.T.

    2016-01-01

    The minicomputer began a revolution in the computer industry and was influential in the industry for over twenty years until superseded by client server computing and the personal computer. The subject of the thesis is a case study of how DEC, which was number two in the world in 1988, became a

  14. Spectral Estimation by the Random Dec Technique

    DEFF Research Database (Denmark)

    Brincker, Rune; Jensen, Jacob L.; Krenk, Steen

    1990-01-01

    This paper contains an empirical study of the accuracy of the Random Dec (RDD) technique. Realizations of the response from a single-degree-of-freedom system loaded by white noise are simulated using an ARMA model. The Autocorrelation function is estimated using the RDD technique and the estimated...

  15. Spectral Estimation by the Random DEC Technique

    DEFF Research Database (Denmark)

    Brincker, Rune; Jensen, J. Laigaard; Krenk, S.

    This paper contains an empirical study of the accuracy of the Random Dec (RDD) technique. Realizations of the response from a single-degree-of-freedom system loaded by white noise are simulated using an ARMA model. The Autocorrelation function is estimated using the RDD technique and the estimated...

  16. Dec 2011 NJS for Prof Anyanwu

    African Journals Online (AJOL)

    Missing intrauterine contraceptive device (IUCD) is a known complication of ... complaints of missing IUCD over an 11 year period, from 1 January 1990 to 31 ... removal were extracted and analysed using tabulations and simple ... Nigerian Journal of Surgery • Dec. ... abdominal pain 5(25%) and string not felt 4(20%).

  17. EAMJ Dec Presure Ulcer 09.indd

    African Journals Online (AJOL)

    2009-12-01

    Dec 1, 2009 ... Geriatric surgery, comprehensive care of the elderly ... Galdin, J.E. Sepsis associated with decubitus ulcer. Amer. J. Med. 1976 ... Ann. Platy. ... A multisite study of the predictive validity of the. Braden scale. Nurs. Res. 1998; 47: ...

  18. EAMJ The Prevalence Dec 09.indd

    African Journals Online (AJOL)

    2009-12-12

    Dec 12, 2009 ... Case definitions: The primary outcome was having a documented ADR after exposure to HAART. The cases were defined according to the guidelines contained in the Kenya National Clinical Manual for. ART providers (8), which mainly follows the criteria used by the AIDSClinical Trials Group (ACTG) (9).

  19. Computer group

    International Nuclear Information System (INIS)

    Bauer, H.; Black, I.; Heusler, A.; Hoeptner, G.; Krafft, F.; Lang, R.; Moellenkamp, R.; Mueller, W.; Mueller, W.F.; Schati, C.; Schmidt, A.; Schwind, D.; Weber, G.

    1983-01-01

    The computer groups has been reorganized to take charge for the general purpose computers DEC10 and VAX and the computer network (Dataswitch, DECnet, IBM - connections to GSI and IPP, preparation for Datex-P). (orig.)

  20. Meshes optimized for discrete exterior calculus (DEC).

    Energy Technology Data Exchange (ETDEWEB)

    Mousley, Sarah C. [Univ. of Illinois, Urbana-Champaign, IL (United States); Deakin, Michael [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Knupp, Patrick [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mitchell, Scott A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-12-01

    We study the optimization of an energy function used by the meshing community to measure and improve mesh quality. This energy is non-traditional because it is dependent on both the primal triangulation and its dual Voronoi (power) diagram. The energy is a measure of the mesh's quality for usage in Discrete Exterior Calculus (DEC), a method for numerically solving PDEs. In DEC, the PDE domain is triangulated and this mesh is used to obtain discrete approximations of the continuous operators in the PDE. The energy of a mesh gives an upper bound on the error of the discrete diagonal approximation of the Hodge star operator. In practice, one begins with an initial mesh and then makes adjustments to produce a mesh of lower energy. However, we have discovered several shortcomings in directly optimizing this energy, e.g. its non-convexity, and we show that the search for an optimized mesh may lead to mesh inversion (malformed triangles). We propose a new energy function to address some of these issues.

  1. TRASYS - THERMAL RADIATION ANALYZER SYSTEM (DEC VAX VERSION WITH NASADIG)

    Science.gov (United States)

    Anderson, G. E.

    1994-01-01

    . The flexible structure of TRASYS allows considerable freedom in the definition and choice of solution method for a thermal radiation problem. The program's flexible structure has also allowed TRASYS to retain the same basic input structure as the authors update it in order to keep up with changing requirements. Among its other important features are the following: 1) up to 3200 node problem size capability with shadowing by intervening opaque or semi-transparent surfaces; 2) choice of diffuse, specular, or diffuse/specular radiant interchange solutions; 3) a restart capability that minimizes recomputing; 4) macroinstructions that automatically provide the executive logic for orbit generation that optimizes the use of previously completed computations; 5) a time variable geometry package that provides automatic pointing of the various parts of an articulated spacecraft and an automatic look-back feature that eliminates redundant form factor calculations; 6) capability to specify submodel names to identify sets of surfaces or components as an entity; and 7) subroutines to perform functions which save and recall the internodal and/or space form factors in subsequent steps for nodes with fixed geometry during a variable geometry run. There are two machine versions of TRASYS v27: a DEC VAX version and a Cray UNICOS version. Both versions require installation of the NASADIG library (MSC-21801 for DEC VAX or COS-10049 for CRAY), which is available from COSMIC either separately or bundled with TRASYS. The NASADIG (NASA Device Independent Graphics Library) plot package provides a pictorial representation of input geometry, orbital/orientation parameters, and heating rate output as a function of time. NASADIG supports Tektronix terminals. The CRAY version of TRASYS v27 is written in FORTRAN 77 for batch or interactive execution and has been implemented on CRAY X-MP and CRAY Y-MP series computers running UNICOS. The standard distribution medium for MSC-21959 (CRAY version

  2. TRASYS - THERMAL RADIATION ANALYZER SYSTEM (DEC VAX VERSION WITHOUT NASADIG)

    Science.gov (United States)

    Vogt, R. A.

    1994-01-01

    . The flexible structure of TRASYS allows considerable freedom in the definition and choice of solution method for a thermal radiation problem. The program's flexible structure has also allowed TRASYS to retain the same basic input structure as the authors update it in order to keep up with changing requirements. Among its other important features are the following: 1) up to 3200 node problem size capability with shadowing by intervening opaque or semi-transparent surfaces; 2) choice of diffuse, specular, or diffuse/specular radiant interchange solutions; 3) a restart capability that minimizes recomputing; 4) macroinstructions that automatically provide the executive logic for orbit generation that optimizes the use of previously completed computations; 5) a time variable geometry package that provides automatic pointing of the various parts of an articulated spacecraft and an automatic look-back feature that eliminates redundant form factor calculations; 6) capability to specify submodel names to identify sets of surfaces or components as an entity; and 7) subroutines to perform functions which save and recall the internodal and/or space form factors in subsequent steps for nodes with fixed geometry during a variable geometry run. There are two machine versions of TRASYS v27: a DEC VAX version and a Cray UNICOS version. Both versions require installation of the NASADIG library (MSC-21801 for DEC VAX or COS-10049 for CRAY), which is available from COSMIC either separately or bundled with TRASYS. The NASADIG (NASA Device Independent Graphics Library) plot package provides a pictorial representation of input geometry, orbital/orientation parameters, and heating rate output as a function of time. NASADIG supports Tektronix terminals. The CRAY version of TRASYS v27 is written in FORTRAN 77 for batch or interactive execution and has been implemented on CRAY X-MP and CRAY Y-MP series computers running UNICOS. The standard distribution medium for MSC-21959 (CRAY version

  3. NASA ARCH- A FILE ARCHIVAL SYSTEM FOR THE DEC VAX

    Science.gov (United States)

    Scott, P. J.

    1994-01-01

    The function of the NASA ARCH system is to provide a permanent storage area for files that are infrequently accessed. The NASA ARCH routines were designed to provide a simple mechanism by which users can easily store and retrieve files. The user treats NASA ARCH as the interface to a black box where files are stored. There are only five NASA ARCH user commands, even though NASA ARCH employs standard VMS directives and the VAX BACKUP utility. Special care is taken to provide the security needed to insure file integrity over a period of years. The archived files may exist in any of three storage areas: a temporary buffer, the main buffer, and a magnetic tape library. When the main buffer fills up, it is transferred to permanent magnetic tape storage and deleted from disk. Files may be restored from any of the three storage areas. A single file, multiple files, or entire directories can be stored and retrieved. archived entities hold the same name, extension, version number, and VMS file protection scheme as they had in the user's account prior to archival. NASA ARCH is capable of handling up to 7 directory levels. Wildcards are supported. User commands include TEMPCOPY, DISKCOPY, DELETE, RESTORE, and DIRECTORY. The DIRECTORY command searches a directory of savesets covering all three archival areas, listing matches according to area, date, filename, or other criteria supplied by the user. The system manager commands include 1) ARCHIVE- to transfer the main buffer to duplicate magnetic tapes, 2) REPORTto determine when the main buffer is full enough to archive, 3) INCREMENT- to back up the partially filled main buffer, and 4) FULLBACKUP- to back up the entire main buffer. On-line help files are provided for all NASA ARCH commands. NASA ARCH is written in DEC VAX DCL for interactive execution and has been implemented on a DEC VAX computer operating under VMS 4.X. This program was developed in 1985.

  4. Dec-POMDPs as Non-Observable MDPs

    NARCIS (Netherlands)

    Oliehoek, F.A.; Amato, C.

    2014-01-01

    A recent insight in the field of decentralized partially observable Markov decision processes (Dec-POMDPs) is that it is possible to convert a Dec-POMDP to a non-observable MDP, which is a special case of POMDP. This technical report provides an overview of this reduction and pointers to related

  5. Dec 2011 NJS for Prof Anyanwu

    African Journals Online (AJOL)

    department of the University of Ilorin Teaching Hospital, Ilorin, Nigeria . Case ... vision with headlights. ... information was entered into computer and analyzed ... The highest incidence of nasal FBs was in the age ... unit of medical science.

  6. 337-- 11 Dec 2009 [final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... deterministic, it can easily be so construed (as clearly illustrated by the Westminster .... from Britain (especially from Calvinist Scotland) and Germany would be sinful ..... The Cambridge history of the Bible 1, pp. 510–541,.

  7. 289-- 14 Dec 2009 [Final Version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... tragedy in a sea of simplifications. The complex .... Different levels of communication often sharpen the discussion. ... resistance, mounting costs and rising discontent on the home front' in ... of Evangelicals in Orlando, Florida).

  8. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... a case study of University of Lagos, 3 faculties within the university constituted the study population ... career advancement, women, academics, information communication ... provides a great development opportunity and.

  9. 281-- 14 Dec 2009--[ Final VERSION].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... reason is that, when it comes to motivation, there is the issue of intention and secondary intention. An example: ... this in Europe are the public health service and agriculture. ... Christians in need and should expect no reward.

  10. 319----14 Dec 2009.indd [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... Creative Commons. Attribution License. 545 ..... this money on an alternative and apparently 'lawful' project, a burial field for foreigners .... Ultimately, however, the success or failure of the Jewish political campaign to discredit ...

  11. 151---8 Dec 2009.indd [ Final version].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... and sustained polemic against Paul himself. (Sim 2002:777). Here Sim .... implicit points resemble Luke's more explicit presentation in .... I now turn my attention. Matthew's ...... in memory of William G. Thompson, pp. 22–41 ...

  12. 161---8 Dec 2009.indd [final version].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... The theory is attractive to practical theologians for two reasons. ... They consider conforming to principles to be of more importance than cultivating harmony. ...... Francis, L.J. & Atkins, P., 2000, Exploring Luke's Gospel: A guide.

  13. 283---14 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... the removal of artificial, man-made barriers' (Stiglitz 2003:xviii). This definition focuses on ..... States that have signed on to the WTO face losing 'most- ..... Retrenched women clothing workers cannot find work in the regulated,.

  14. 195--10 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-10

    Dec 10, 2009 ... Accepted: 25 June 2009. Published: ... This paper will focus on the Leuenberg Agreement as a possible ... to confuse the true meaning of the Confession. ... Differences were minimalised as a matter of terminology and words.

  15. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... 2Justice Development and Peace Commission, Onitsha, Nigeria ... Community information comprises of services offered by libraries and information ... poor and marginalized groups to improve their standard of living and ...

  16. 127 -08 Dec 2009.indd [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... (as opposed to it being entirely superseded by a new 'Christian' identity) and interpreting him as still operating .... the rich enterprise of cultural or social anthropology. ...... millennial hopes were not realised by Paul's messiah.

  17. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... was small. ... organizational effectiveness and one of such .... Instead, contingency-situation theories were developed to indicate that ... development, a company will experience ..... Journal of Applied Psychology 53,. 87-92.

  18. 325-- 11 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... with some light clouds and there are no clouds without water; as there are no birds ... food security as a high priority in many countries. Water and .... The above reasons for the availability of water resources reiterate that all living ... government infrastructure at various levels of agreement and not necessarily ...

  19. 167-- 8 Dec 2009.indd [FINAL VESION].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... canonical scriptures – in the reformed tradition – and were therefore deemed unworthy of dogma and proclamation (Kaiser 2004:6). They could be used for teaching – as the Belgic Confession states – but this rarely, if at all, happened in a reformed congregation. However, a few factors have contributed to a ...

  20. 153--7 Dec 2009.indd [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-07

    Dec 7, 2009 ... Over the past century, many Western mission agencies and ... regard to travel.3 During this time, the evangelical movement influenced Korean Christians to become involved in world ... well as effective mission strategies and policies for the mature .... 'I have had no difficulties in adapting to the culture and.

  1. 185---11 Dec 2009.indd Final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... period conceptions of how to live, despite death, coram Deo. ... analysing the moral sensitivities within these ancient holy texts without ... answer to the first question: No, not in any direct manner (what Smit [1992:316] terms deontological and .... is the case too now that hardly any Christian theologian of the.

  2. 161---8 Dec 2009.indd [final version].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... United Kingdom population norms, preachers within this sample were ... University of Warwick, .... hand, feeling types make judgements based on subjective, personal values. ... and female Bible College students (Francis, Penson & Jones. 2001) .... link between psychological type preference and choice of.

  3. 299---09 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-09

    Dec 9, 2009 ... money laundering, human trafficking and sexual exploitation, sex ... to the transformation and improvement of education, including affordability and access. ... A greater understanding of differences, and what gives rise to them, will hopefully lead to ..... The bridging function of spirituality is premised by two.

  4. 276----14 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... study of authors themselves (the literate few) and in studies of analogy and ..... power. The expectation of future vindication, even taking part in divine judgment ...... Anna Rebecca Solevåg (PhD candidate, Oslo. University ...

  5. 131-7 Dec 2009.indd [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-07

    Dec 7, 2009 ... This interpretation of love that Jesus offers in his story gives ... philosophy, shed light on a possible new reading of sacred texts in which the question of identity ... neither can a home (oikos) offer hospitality to all as that would.

  6. 164----8 Dec 2009 [Final Version].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... the issues in such struggles for justice appear more straightforward to outsiders than they do to ... that produced them, as well as the idea of the gospels as mirrors simply reflecting the ..... such counter-cultural reading communities must never ... to point to the way in which hegemony limits the possibility of.

  7. 278----9 Dec 2009 [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-09

    Dec 9, 2009 ... different to the opening word 'hkyaee' found in Lamentations 1, 2 and. 4. ... Remembrance of events gives way to remembrance .... presence of the Most High and of one's case being subverted. (cf. ... standard reading of Lamentations is the fact that the narrator, ..... The form of Lamentations is that of a long.

  8. 322--14 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... Attribution License. 581. Vol. 65 No. ... are at this time of global financial crisis despite the historic moment in United States and world politics that occurred .... its theory gave rise to the category of 'anti-societal language'. His.

  9. 318----14 Dec 2009.indd [ final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... in social behaviour and thinking, including those relating to cosmology ... exercise power through the global economy, as well as by means of their military and ..... local forms of Israelite religion in the face of pressures from the hierocratic .... expression 'telling' is used to refer to a probable act of Jesus (the.

  10. 280---14 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... principles which are derived from the covenant order of communion. Ellul (in Kraus .... of a status confessionis refers to the practice of the church as well as to its teaching. .... east Asian countries (except Malaysia), the International. Monetary ... a significant rise in taxes on consumption (VAT). As a result,.

  11. Estimation of Correlation Functions by the Random DEC Technique

    DEFF Research Database (Denmark)

    Brincker, Rune; Krenk, Steen; Jensen, Jakob Laigaard

    The Random Dec Technique is a versatile technique for characterization of random signals in the time domain. In this paper a short review of the most important properties of the technique is given. The review is mainly based on recently achieved results that are still unpublished, or that has just...

  12. 299---09 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-09

    Dec 9, 2009 ... a country is going, the politics, social justice, whether elections will be ... money laundering, human trafficking and sexual exploitation, sex tourism, the ... to the transformation and improvement of education, including affordability and access. ..... extent do individuals and groups learn from their failures.

  13. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... Selective Dissemination of Information (SDI) Services in a Nigerian University: A. Report. 75. Information ... that Libraries that are ICT driven have continued to provide ... take advantage of technology in providing reference and .... 6. Teaching Profile ... history, Varieties of English,. English. Syntax/Semantics,.

  14. 286---15 Dec 2009.indd [Final version] .indd

    African Journals Online (AJOL)

    2009-12-15

    Dec 15, 2009 ... on economic ethics to assess economic processes in relation to how they serve life. ... justice and fellowship – as gifts of God – that serve as an orientation ..... total ban, and pleaded for money to be allowed to make a profit,.

  15. 1609.pdf | dec102000 | currsci | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; currsci; dec102000; 1609.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the ...

  16. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... East zone of Nigeria was examined through a descriptive survey. ... Variables and Utilization (QOLBUVAU) making a return rate of 86.6%. ... sampling technique was adopted as the respondents vary in size ... the structure and location of the library in ... the reviewed literature in this study. ..... The decision.

  17. 308 --- 16 Dec 2009 [ final version].indd

    African Journals Online (AJOL)

    2009-12-16

    Dec 16, 2009 ... Secondly, an effort has to be made to at least try to avoid the fallacies of ... The metaphor says one thing but means something else; it needs to ... New Testament scholarship with literary criticism, defines the parables as narrative ..... the parable in the context of Jesus' public career some forty years.

  18. 309 ----10 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-10

    Dec 10, 2009 ... parable showed traces of the sola fidei principle of the Reformation, .... (j. Sanh. 6.23c par; j. Hagh. 2.77). This folk-tale ends where Bar .... Egyptian and Jewish accounts. ...... (1989:151), the dogs that licked Lazarus are most probably wild .... and to finance his extravagant building projects (the building of ...

  19. Res Dec 07 Final 05-12-07

    Indian Academy of Sciences (India)

    client1

    2007-12-05

    Dec 5, 2007 ... glycerol and aminoacids such as alanine and proline. They are believed to stabilize cellular proteins and membranes at low temperature and hence called cryoprotectants. The cryoprotec- tive role of glycine betaine (GB) in bacteria is beginning to be understood. Antifreeze Proteins: An Overview. Birds ...

  20. 124---14 Dec 2009.indd [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... convinced as Danny Postel (2006:15) was three years ago, during the most .... Every forty days, the masses re-appeared to mourn, as Shi'ite. Muslims do, the ...... the modernising of Islamic countries in a European fashion.

  1. 320--14 dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... Original Research: Boston Papers. A ... From a macro-narrative perspective, the dynamics of Jesus' healing ... After a close reading of these textual exchanges, I suggest that each of these .... critically, this paper will focus on the four Matthean healing ... of economics and the structural dynamics of exchange.

  2. 310---11 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... sola fides. God has done all this in his love and his sovereignty, ..... them across Europe to countries such as Scotland, England,. Italy and .... faith is, the seed of the word has preceded; where there is preaching there is the ...

  3. 311----10 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-10

    Dec 10, 2009 ... Fighting crime in the new South Africa has taken on new challenges under a ... spurred on by Gordon MacDonald's own 'renewed challenge of insisting that my life of following ... Postfoundationalism has emerged from the work of Wentzel van Huyssteen .... contribute to providing a solution in this regard.

  4. 272--11 Dec 2009 [final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... e o lo g ic a l S tu d ie s http://www.hts.org.za. HTS. Original Research. A rtic le # .... of departure is only possible due to an extra-biblical maxim, to ... John Hart points out ...... Jean-Pierre Changeaux and the philosopher Paul Ricoeur, is ..... De Cruchy, J.W., 1986, The church struggle in South Africa, Collins.

  5. ilc-25.pdf | dec2005 | jess | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; jess; dec2005; ilc-25.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held ...

  6. Efficacy and tolerability of treatment with single doses of diethylcarbamazine (DEC) and DEC plus albendazole (ABZ) for three consecutive years in lymphatic filariasis: a field study in India.

    Science.gov (United States)

    Kshirsagar, Nilima A; Gogtay, N J; Garg, B S; Deshmukh, P R; Rajgor, D D; Kadam, V S; Thakur, P A; Gupta, A; Ingole, N S; Lazdins-Helds, J K

    2017-10-01

    Lymphatic filariasis (LF) affects 73 countries, causes morbidity and impedes socioeconomic development. We had found no difference in safety and micro (Mf) and macro filarial action of single-dose diethylcarbamazine (DEC) and DEC + albendazole (ABZ) in an F01 study done in India (year 2000). There was a programmatic need to evaluate safety and efficacy of multiple annual treatments (F02). Subjects (155) from the F01 study, meeting inclusion-exclusion criteria, were enrolled in F02 and treated with further two annual doses of DEC or DEC + ABZ. Efficacy was evaluated for Mf positivity by peripheral smear (PS) and nucleopore (NP) filter, circulating filarial antigen (CFA) and filarial dance sign (FDS) positivity and Mf count at yearly follow-up. Safety was assessed for 5 days after drug administration. Total of 139 subjects evaluated for efficacy (69 DEC and 70 DEC + ABZ group). Mf positivity prevalence declined progressively by 95% (PS), 66% (NP), and 95% (PS) and 86% (NP); CFA positivity prevalence declined by 15% and 9%; FDS by 100% each; Mf count declined by 75.5 and 76.9% with three annual treatment of DEC and DEC + ABZ, respectively. Addition of ABZ did not show any advantage over DEC given as three annual rounds for LF. DEC and DEC + ABZ were well tolerated. There was no correlation between result of CFA and FDS, (both claimed to be indicative of adult worm). Analysis of published studies and our data indicate that macrofilaricidal effect of DEC/DEC + ABZ may be seen in children and not adults, with three or more annual dosing.

  7. Some programming aids for the DEC PDP-10

    International Nuclear Information System (INIS)

    McNamara, B.

    1979-01-01

    A simplified system has been written to help in FORTRAN programming of physics and mathematical problems. The system is described in Appendix A. A magnetic tape has been made of the complete system as used on the DEC-10 by M-Division for Magnetic Fusion related calculations. The system turns out to use many of the locally developed goodies, such as the TEDI text editor, the TV80 graphics system, and Tektronix 4012 videos. The facilities are briefly described in the HLP files on the tape

  8. Rhythmic expression of DEC2 protein in vitro and in vivo.

    Science.gov (United States)

    Sato, Fuyuki; Muragaki, Yasuteru; Kawamoto, Takeshi; Fujimoto, Katsumi; Kato, Yukio; Zhang, Yanping

    2016-06-01

    Basic helix-loop-helix (bHLH) transcription factor DEC2 (bHLHE41/Sharp1) is one of the clock genes that show a circadian rhythm in various tissues. DEC2 regulates differentiation, sleep length, tumor cell invasion and apoptosis. Although studies have been conducted on the rhythmic expression of DEC2 mRNA in various tissues, the precise molecular mechanism of DEC2 expression is poorly understood. In the present study, we examined whether DEC2 protein had a rhythmic expression. Western blot analysis for DEC2 protein revealed a rhythmic expression in mouse liver, lung and muscle and in MCF-7 and U2OS cells. In addition, AMP-activated protein kinase (AMPK) activity (phosphorylation of AMPK) in mouse embryonic fibroblasts (MEFs) exhibited a rhythmic expression under the condition of medium change or glucose-depleted medium. However, the rhythmic expression of DEC2 in MEF gradually decreased in time under these conditions. The medium change affected the levels of DEC2 protein and phosphorylation of AMPK. In addition, the levels of DEC2 protein showed a rhythmic expression in vivo and in MCF-7 and U2OS cells. The results showed that the phosphorylation of AMPK immunoreactivity was strongly detected in the liver and lung of DEC2 knockout mice compared with that of wild-type mice. These results may provide new insights into rhythmic expression and the regulation between DEC2 protein and AMPK activity.

  9. ARC2D - EFFICIENT SOLUTION METHODS FOR THE NAVIER-STOKES EQUATIONS (DEC RISC ULTRIX VERSION)

    Science.gov (United States)

    Biyabani, S. R.

    1994-01-01

    computers to emulate Cray system time calls, which should be easy to modify for other machines as well. The standard distribution media for this version is a 9-track 1600 BPI ASCII Card Image format magnetic tape. The Cray version was developed in 1987. The IBM ES/3090 version is an IBM port of the Cray version. It is written in IBM VS FORTRAN and has the capability of executing in both vector and parallel modes on the MVS/XA operating system and in vector mode on the VM/XA operating system. Various options of the IBM VS FORTRAN compiler provide new features for the ES/3090 version, including 64-bit arithmetic and up to 2 GB of virtual addressability. The IBM ES/3090 version is available only as a 9-track, 1600 BPI IBM IEBCOPY format magnetic tape. The IBM ES/3090 version was developed in 1989. The DEC RISC ULTRIX version is a DEC port of the Cray version. It is written in FORTRAN 77 for RISC-based Digital Equipment platforms. The memory requirement is approximately 7Mb of main memory. It is available in UNIX tar format on TK50 tape cartridge. The port to DEC RISC ULTRIX was done in 1990. COS and UNICOS are trademarks and Cray is a registered trademark of Cray Research, Inc. IBM, ES/3090, VS FORTRAN, MVS/XA, and VM/XA are registered trademarks of International Business Machines. DEC and ULTRIX are registered trademarks of Digital Equipment Corporation.

  10. OL-DEC-MDP Model for Multiagent Online Scheduling with a Time-Dependent Probability of Success

    Directory of Open Access Journals (Sweden)

    Cheng Zhu

    2014-01-01

    Full Text Available Focusing on the on-line multiagent scheduling problem, this paper considers the time-dependent probability of success and processing duration and proposes an OL-DEC-MDP (opportunity loss-decentralized Markov Decision Processes model to include opportunity loss into scheduling decision to improve overall performance. The success probability of job processing as well as the process duration is dependent on the time at which the processing is started. The probability of completing the assigned job by an agent would be higher when the process is started earlier, but the opportunity loss could also be high due to the longer engaging duration. As a result, OL-DEC-MDP model introduces a reward function considering the opportunity loss, which is estimated based on the prediction of the upcoming jobs by a sampling method on the job arrival. Heuristic strategies are introduced in computing the best starting time for an incoming job by each agent, and an incoming job will always be scheduled to the agent with the highest reward among all agents with their best starting policies. The simulation experiments show that the OL-DEC-MDP model will improve the overall scheduling performance compared with models not considering opportunity loss in heavy-loading environment.

  11. Bancroftian filariasis: long-term effect of the DEC provocative day test on microfilaraemia

    DEFF Research Database (Denmark)

    Simonsen, Poul Erik; Meyrowitsch, Dan Wolf; Makunde, W.H.

    1997-01-01

    The diethylcarbamazine (DEC) provocative day test has been widely used for daytime diagnosis of Wuchereria bancrofti infections in areas where microfilariae exhibit nocturnal periodicity. Since DEC is also the primary drug for treatment of bancroftian filariasis, we examined the long term effect...... amicrofilaraemic. No significant reduction of microfilaraemia was observed in the placebo group. The results imply that the DEC provocative day test should not be used as a diagnostic tool in follow-up studies on microfilaraemias....

  12. Atmospheric processes in reaction of Northern Sumatra Earthquake sequence Dec 2004-Apr 2005

    Science.gov (United States)

    Ouzounov, D.; Pulinets, S.; Cervone, G.; Singh, R.; Taylor, P.

    2005-05-01

    This work describes our first results in analyzing data from different and independent sources ûemitted long-wavelength radiation (OLR), surface latent heat flux (SHLF) and GPS Total Electron Content (TEC) collected from ground based (GPS) and satellite TIR (thermal infra-red) data sources (NOAA/AVHRR, MODIS). We found atmosphere and ionosphere anomalies one week prior to both the Sumatra-Andaman Islands earthquake (Dec 26, 2004) and M 8.7 - Northern Sumatra, March 28, 2005. We analyzed 118 days of data from December 1, 2004 through April 1, 2005 for the area (0°-10°,north latitude and 90°-100° east longitude) which included 125 earthquakes with M>5.5. Recent analysis of the continuous OLR from the Earth surface indicates anomalous variations (on top of the atmosphere) prior to a number of medium to large earthquakes. In the case of M 9.0 - Sumatra-Andaman Islands event, compared to the reference fields for the months of December between 2001 and 2004, we found strongly OLR anomalous +80 W/m2 signals (two sigma) along the epicentral area on Dec 21, 2004 five days before the event. In the case of M8.7 March 28, 2005 anomalues signatures over the epicenter appears on March 26 is much weaker (only +20W/m2) and have a different topology. Anomalous values of SHLF associated with M9.0 - Sumatra-Andaman Islands were found on Dec 22, 2005 (SLHF +280Wm2) and less intensity on Mar 23, 2005 (SLHF +180Wm2). Ionospheric variations (GPS/TEC) associated with the Northern Sumatra events were determine by five Regional GPS network stations (COCO, BAKO, NTUS, HYDE and BAST2). For every station time series of the vertical TEC (VTEC) were computed together with correlation with the Dst index. On December 22, four days prior to the M9.0 quake GPS/TEC data reach the monthly maximum for COCO with minor DST activity. For the M 8.7-March 28 event, the increased values of GPS/TEC were observed during four days (March 22-25) in quiet geomagnetic background. Our results need additional

  13. Displaying DIII-D plasma data using DEC's X window system

    International Nuclear Information System (INIS)

    Greene, K.L.

    1991-11-01

    The D3-D tokamak program, funded by the Department of Energy, carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1987 MFITD and MFITPLAY were written/modified. These two programs provide graphical output that allows the users to see, before the next shot, the plasma shape and the locations of the plasma and magnetic flux lines within the tokamak. MFITD performs the computations which calculate the shape and location of the plasma; it also graphically displays a small subset of timeslice data. MFITPLAY graphically displays the full set of timeslice data. Through interactive commands, MFITPLAY also allows the user to control the various aspects of how the data is displayed. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support X windows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface

  14. DECS tries out instructional materials on AIDS prevention education.

    Science.gov (United States)

    1994-01-01

    A national try-out of the newly developed print and non-print instructional materials on AIDS Education is being conducted by the Department of Education, Culture and Sports (DECS) this school year 1993-to 1994. To determine the effectiveness of these materials, various public and private schools in Region IV (Southern Tagalog), VII (Central Visayas) XI (Southern Mindanao) and National Capital Region (Metro, Manila) were chosen as try-out institutions. The AIDS education materials will be tried out in different subjects in some grade and year levels such as civics and culture (grade one); science and health (grades three and six); home economics and livelihood education (grade five); physical education, health and music (second year) and Pilipino Language (third year). The materials for the elementary level consist of posters, cut-out pictures, voice tapes, jingles, talking books and slides, while the secondary school level utilizes modules. For the tertiary level, a Resource Book on AIDS Prevention Education is used by the Teacher Training Institutions and the Non-Formal Education employs the Facilitator's Guide for Levels I-III. These materials will be tried out in both urban and rural schools, with control school and experimental school at each level. full text

  15. Annals of Medical and Health Sciences Research – Jul. - Dec., 2011 ...

    African Journals Online (AJOL)

    EGOLUM

    2011-12-22

    Dec 22, 2011 ... Annals of Medical and Health Sciences Research – Jul. – Dec., 2011 – Vol. ... Method: The study was a cross-sectional survey of pregnant women in Enugu; South-East Nigeria. The ..... Medical Encyclopedia. {Assessed on ...

  16. Stream traffic data archival, querying, and analysis with TransDec.

    Science.gov (United States)

    2011-01-01

    The goal of research was to extend the traffic data analysis of the TransDec (short for : Transportation Decision-Making) system, which was developed under METRANS 09-26 : research grant. The TransDec system is a real-data driven system to support de...

  17. Targeting Antigens to Dec-205 on Dendritic Cells Induces Immune Protection in Experimental Colitis in Mice

    Science.gov (United States)

    Wadwa, Munisch; Klopfleisch, Robert; Buer, Jan; Westendorf, Astrid M.

    2016-01-01

    The endocytotic c-type lectin receptor DEC-205 is highly expressed on immature dendritic cells. In previous studies, it was shown that antigen-targeting to DEC-205 is a useful tool for the induction of antigen-specific Foxp3+ regulatory T cells and thereby can prevent inflammatory processes. However, whether this approach is sufficient to mediate tolerance in mucosal tissues like the gut is unknown. In this study, we established a new mouse model in which the adoptive transfer of naive hemagglutinin (HA)-specific CD4+Foxp3– T cells into VILLIN-HA transgenic mice leads to severe colitis. To analyze if antigen-targeting to DEC-205 could protect against inflammation of the gut, VILLIN-HA transgenic mice were injected with an antibody–antigen complex consisting of the immunogenic HA110–120 peptide coupled to an α-DEC-205 antibody (DEC-HA) before adoptive T cell transfer. DEC-HA-treated mice showed significantly less signs of intestinal inflammation as was demonstrated by reduced loss of body weight and histopathology in the gut. Strikingly, abrogated intestinal inflammation was mediated via the conversion of naive HA-specific CD4+Foxp3– T cells into HA-specific CD4+Foxp3+ regulatory T cells. In this study, we provide evidence that antigen-targeting to DEC-205 can be utilized for the induction of tolerance in mucosal organs that are confronted with large numbers of exogenous antigens. PMID:27141310

  18. SPAM- SPECTRAL ANALYSIS MANAGER (DEC VAX/VMS VERSION)

    Science.gov (United States)

    Solomon, J. E.

    1994-01-01

    machine environments. There is a DEC VAX/VMS version with a central memory requirement of approximately 242K of 8 bit bytes and a machine independent UNIX 4.2 version. The display device currently supported is the Raster Technologies display processor. Other 512 x 512 resolution color display devices, such as De Anza, may be added with minor code modifications. This program was developed in 1986.

  19. Optimization of the DEC-air handling process. Final report; Optimierung der Komponenten des DEC-Klimasystems. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Franzke, U.; Stangl, M.

    2000-02-15

    The energy consumption of buildings caused by air conditioning is high. The main reason is the using of refrigeration machines for dehumidification under the dew point. A reduction of the energy consumption is possible in case of using of desiccant dehumidification. A desiccant cooling air handling unit realizes the dehumidification by desiccants. Further more a heat recovery wheel and a humidifier are necessary. In the framework of the project the desiccant wheel and a high-pressure humidifier are investigated. A refrigeration machine was installed only for theoretical investigations. The investigation was done in the theoretical and experimental way. A new simulation model was developed. The measurement values are used for the verification of the mathematical simulation. In the framework of the project the performance characteristics of the desiccant wheel and the humidifier are optimized. As a result the regeneration temperature is now lower than at the beginning of the work. The humidifier capacity is in the same range at lower fresh water consumption. The components of the desiccant cooling air-handling unit were optimized according their performance characteristic. For the company Klingenburg the market chances will increase in case of more applications. (orig.) [German] Die Klimatisierung von Gebaeuden ist in aller Regel mit einem grossen Energieaufwand verbunden. Hauptursache dafuer ist die Verwendung der Entfeuchtung durch Taupunktunterschreitung unter Nutzung von Kaeltemaschinen. Eine Verringerung des Energieaufwandes ist nur durch Einsatz der sorptiven Luftentfeuchtung moeglich. Eine DEC-Klimaanlage realisiert die Luftentfeuchtung mit Hilfe der Sorption. Sie setzt sich aus verschiedenen Komponenten zusammen. Im Rahmen des Forschungsvorhabens wurden besonders der Sorptionsregenerator und der Kaltdampfgenerator sowohl experimentell als auch theoretisch untersucht und optimiert. Als ergaenzende Systemkomponente kommt die Kaeltemaschine hinzu, die jedoch

  20. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.1278 >orf19.1278; Contig19-10104; complement(13162...4..>132028); ; conserved hypothetical protein; truncated protein IQNNKCSGCNLKLDFPVIHFKCKHSFHQKCLSTNLIATSTESS

  1. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.3361 >orf19.3361; Contig19-10173; 157397..>158185;... YAT2*; carnitine acetyltransferase; gene family | truncated protein MSTYRFQETLEKLPIPDLVQTCNAYLEALKPLQTEQEHE

  2. Scaling Up Optimal Heuristic Search in Dec-POMDPs via Incremental Expansion (extended abstract)

    NARCIS (Netherlands)

    Spaan, M.T.J.; Oliehoek, F.A.; Amato, C.

    2011-01-01

    We advance the state of the art in optimal solving of decentralized partially observable Markov decision processes (Dec-POMDPs), which provide a formal model for multiagent planning under uncertainty.

  3. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.7258 >orf19.7258; Contig19-2507; 88880..89851; DDI1*; response to DNA alkyl...ation; MQLTISLDHSGDIISVDVPDSLCLEDFKAYLSAETGLEASVQVLKFNGRELVGNATLSELQIHDNDLLQLSKKQVA

  4. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2370 >orf19.2370; Contig19-10147; complement(50671..52716); DSL1*; retrogra...de ER-to-golgi transport; MPSIEQQLEDQELYLKDIEQNINKTLSKINKTTLENDNDFRKQFEEIPQDSNTTESN

  5. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ruitment factor; MAKTRSKSAATAAATSPKASPTAAKVTKNKVTKPSTASPSKTTKTKAVKKTTTKKATPKKEEEEKK... Ca19AnnotatedDec2004aaSeq orf19.124 >orf19.124; Contig19-10035; 67601..68698; CIC1*; protease substrate rec

  6. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4748 >orf19.4748; Contig19-10215; complement(47336.....47731); MSL1*; U2 snRNA-associated protein; MPSTKRSSSTEYSHKDSKKKVKLDYVNLKPSQTLYVKNLNTKINKKILLHNLYLLFSAFGDIISINLQNGFAFIIFSNLNSATLALRNLKNQDFFDKPLVLNYAVKESKAISQEKQKLQDENDEEVMPSYE*

  7. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4711 >orf19.4711; Contig19-10212; complement(29836...7..>300616); ; acidic repetitive protein; truncated protein DRSDYNEEDNNDFTRKLNEIQSKESNHEDLAQSEVQEGQKDEPDSVNQ

  8. Real time data acquisition for a time projection chamber using a high speed DEC-RT11 to UNIX UDP-TCP/IP interface

    International Nuclear Information System (INIS)

    Thomas, J.; Douglas, M.; Watanabe, R.; Henrikson, H.E.; Iqbal, M.Z.; Mitchell, L.W.; O'Callaghan, B.M.G.; Wong, H.T.K.; Melvin, J.D.

    1987-01-01

    The authors built a high pressure xenon Time Projection Chamber to study double beta decay, a process of fundamental interest which, if observed, would indicate that the neutrino is a massive Majorana particle. Raw data rates from the TPC exceed 200 Kbytes per second. The TPC is operated through a CAMAC interface with a DEC LSI-11/73 computer networked to a Tektronix 6130 workstation. Data is transmitted at about 15 Kbytes per second although the network is capable of transmitting data at 80 Kbytes per second. The only system level programming required was to write a UDP-TCP/IP driver for the DEC-DEQNA Ethenet board on the 11/73

  9. Design of Computer Fault Diagnosis and Troubleshooting System ...

    African Journals Online (AJOL)

    PROF. O. E. OSUAGWU

    2013-12-01

    Dec 1, 2013 ... 2Department of Computer Science. Cross River University ... owners in dealing with their computer problems especially when the time is limited and human expert is not ..... questions with the system responding to each of the ...

  10. COMPUTING

    CERN Multimedia

    M. Kasemann

    Overview In autumn the main focus was to process and handle CRAFT data and to perform the Summer08 MC production. The operational aspects were well covered by regular Computing Shifts, experts on duty and Computing Run Coordination. At the Computing Resource Board (CRB) in October a model to account for service work at Tier 2s was approved. The computing resources for 2009 were reviewed for presentation at the C-RRB. The quarterly resource monitoring is continuing. Facilities/Infrastructure operations Operations during CRAFT data taking ran fine. This proved to be a very valuable experience for T0 workflows and operations. The transfers of custodial data to most T1s went smoothly. A first round of reprocessing started at the Tier-1 centers end of November; it will take about two weeks. The Computing Shifts procedure was tested full scale during this period and proved to be very efficient: 30 Computing Shifts Persons (CSP) and 10 Computing Resources Coordinators (CRC). The shift program for the shut down w...

  11. Analysis of the stability of underground high-level nuclear waste repository in discontinuous rock mass using 3DEC

    International Nuclear Information System (INIS)

    Kwon, Sang Ki; Park, Jeong Hwa; Choi, Jong Won; Kang, Chul Hyung

    2001-03-01

    For the safe design of a high-level nuclear waste repository in deep location, it is necessary to confirm the stability of the underground excavations under the high overburden pressure and also to investigate the influence of discontinuities such as fault, fracture zone, and joints. In this study, computer simulations using 3DEC, which is a Distince Element (DEM) code, were carried out for determining important parameters on the stability of the disposal tunnel and deposition holes excavated in 500 m deep granite body. The development of plastic zone and stress and strain distributions were analyzed with various modelling conditions with variation on the parameters including joint numbers, tunnel size, joint properties, rock properties, and stress ratio. Furthermore, the influence of fracture zone, which is located around the underground excavations, on the stability of the excavation was investigated. In this study, the variation of stress and strain distribution due to the variation of fracture zone location, dip, and width was analyzed

  12. COMPUTING

    CERN Multimedia

    I. Fisk

    2011-01-01

    Introduction CMS distributed computing system performed well during the 2011 start-up. The events in 2011 have more pile-up and are more complex than last year; this results in longer reconstruction times and harder events to simulate. Significant increases in computing capacity were delivered in April for all computing tiers, and the utilisation and load is close to the planning predictions. All computing centre tiers performed their expected functionalities. Heavy-Ion Programme The CMS Heavy-Ion Programme had a very strong showing at the Quark Matter conference. A large number of analyses were shown. The dedicated heavy-ion reconstruction facility at the Vanderbilt Tier-2 is still involved in some commissioning activities, but is available for processing and analysis. Facilities and Infrastructure Operations Facility and Infrastructure operations have been active with operations and several important deployment tasks. Facilities participated in the testing and deployment of WMAgent and WorkQueue+Request...

  13. COMPUTING

    CERN Multimedia

    P. McBride

    The Computing Project is preparing for a busy year where the primary emphasis of the project moves towards steady operations. Following the very successful completion of Computing Software and Analysis challenge, CSA06, last fall, we have reorganized and established four groups in computing area: Commissioning, User Support, Facility/Infrastructure Operations and Data Operations. These groups work closely together with groups from the Offline Project in planning for data processing and operations. Monte Carlo production has continued since CSA06, with about 30M events produced each month to be used for HLT studies and physics validation. Monte Carlo production will continue throughout the year in the preparation of large samples for physics and detector studies ramping to 50 M events/month for CSA07. Commissioning of the full CMS computing system is a major goal for 2007. Site monitoring is an important commissioning component and work is ongoing to devise CMS specific tests to be included in Service Availa...

  14. COMPUTING

    CERN Multimedia

    M. Kasemann

    Overview During the past three months activities were focused on data operations, testing and re-enforcing shift and operational procedures for data production and transfer, MC production and on user support. Planning of the computing resources in view of the new LHC calendar in ongoing. Two new task forces were created for supporting the integration work: Site Commissioning, which develops tools helping distributed sites to monitor job and data workflows, and Analysis Support, collecting the user experience and feedback during analysis activities and developing tools to increase efficiency. The development plan for DMWM for 2009/2011 was developed at the beginning of the year, based on the requirements from the Physics, Computing and Offline groups (see Offline section). The Computing management meeting at FermiLab on February 19th and 20th was an excellent opportunity discussing the impact and for addressing issues and solutions to the main challenges facing CMS computing. The lack of manpower is particul...

  15. MetaUniDec: High-Throughput Deconvolution of Native Mass Spectra

    Science.gov (United States)

    Reid, Deseree J.; Diesing, Jessica M.; Miller, Matthew A.; Perry, Scott M.; Wales, Jessica A.; Montfort, William R.; Marty, Michael T.

    2018-04-01

    The expansion of native mass spectrometry (MS) methods for both academic and industrial applications has created a substantial need for analysis of large native MS datasets. Existing software tools are poorly suited for high-throughput deconvolution of native electrospray mass spectra from intact proteins and protein complexes. The UniDec Bayesian deconvolution algorithm is uniquely well suited for high-throughput analysis due to its speed and robustness but was previously tailored towards individual spectra. Here, we optimized UniDec for deconvolution, analysis, and visualization of large data sets. This new module, MetaUniDec, centers around a hierarchical data format 5 (HDF5) format for storing datasets that significantly improves speed, portability, and file size. It also includes code optimizations to improve speed and a new graphical user interface for visualization, interaction, and analysis of data. To demonstrate the utility of MetaUniDec, we applied the software to analyze automated collision voltage ramps with a small bacterial heme protein and large lipoprotein nanodiscs. Upon increasing collisional activation, bacterial heme-nitric oxide/oxygen binding (H-NOX) protein shows a discrete loss of bound heme, and nanodiscs show a continuous loss of lipids and charge. By using MetaUniDec to track changes in peak area or mass as a function of collision voltage, we explore the energetic profile of collisional activation in an ultra-high mass range Orbitrap mass spectrometer. [Figure not available: see fulltext.

  16. COMPUTING

    CERN Multimedia

    I. Fisk

    2013-01-01

    Computing activity had ramped down after the completion of the reprocessing of the 2012 data and parked data, but is increasing with new simulation samples for analysis and upgrade studies. Much of the Computing effort is currently involved in activities to improve the computing system in preparation for 2015. Operations Office Since the beginning of 2013, the Computing Operations team successfully re-processed the 2012 data in record time, not only by using opportunistic resources like the San Diego Supercomputer Center which was accessible, to re-process the primary datasets HTMHT and MultiJet in Run2012D much earlier than planned. The Heavy-Ion data-taking period was successfully concluded in February collecting almost 500 T. Figure 3: Number of events per month (data) In LS1, our emphasis is to increase efficiency and flexibility of the infrastructure and operation. Computing Operations is working on separating disk and tape at the Tier-1 sites and the full implementation of the xrootd federation ...

  17. Tolerability and efficacy of single dose albendazole, diethylcarbamazine citrate (DEC) or co-administration of albendazole with DEC in the clearance of Wuchereria bancrofti in asymptomatic microfilaraemic volunteers in Pondicherry, South India: a hospital-based study

    OpenAIRE

    Pani, SP; Subramanyam Reddy, G; Das, LK; Vanamail, P; Hoti, SL; Ramesh, J; Das, PK

    2002-01-01

    Background The tolerability and efficacy of single dose albendazole (400 mg), diethylcarbamazine citrate (DEC) (6 mg/kg bodyweight) or co-administration of albendazole (400 mg) + DEC (6 mg/kg bodyweight) was studied in 54 asymptomatic Wuchereria bancrofti microfilaraemic volunteers in a double blind hospital-based clinical study. Results There was no significant difference in the overall incidence of adverse reactions between the three drug groups [42.1% (albendazole), 52.9% (DEC) and 61.1% (...

  18. Vært for @AUforsker på Twitter 5.-11. dec. 2013

    DEFF Research Database (Denmark)

    Damkjaer, Maja Sonne

    2013-01-01

    @AUforsker på Twitter: Uafhængigt drevet af forskere fra Aarhus Uni. En forsker = en uge. Bliv klogere på vores forskning, undervisning og hverdag. 5.-11. dec. 2013 bestyret af @Majasdamkjaer Aarhus University, Denmark · au.dk......@AUforsker på Twitter: Uafhængigt drevet af forskere fra Aarhus Uni. En forsker = en uge. Bliv klogere på vores forskning, undervisning og hverdag. 5.-11. dec. 2013 bestyret af @Majasdamkjaer Aarhus University, Denmark · au.dk...

  19. COMPUTING

    CERN Multimedia

    I. Fisk

    2010-01-01

    Introduction It has been a very active quarter in Computing with interesting progress in all areas. The activity level at the computing facilities, driven by both organised processing from data operations and user analysis, has been steadily increasing. The large-scale production of simulated events that has been progressing throughout the fall is wrapping-up and reprocessing with pile-up will continue. A large reprocessing of all the proton-proton data has just been released and another will follow shortly. The number of analysis jobs by users each day, that was already hitting the computing model expectations at the time of ICHEP, is now 33% higher. We are expecting a busy holiday break to ensure samples are ready in time for the winter conferences. Heavy Ion An activity that is still in progress is computing for the heavy-ion program. The heavy-ion events are collected without zero suppression, so the event size is much large at roughly 11 MB per event of RAW. The central collisions are more complex and...

  20. COMPUTING

    CERN Multimedia

    M. Kasemann P. McBride Edited by M-C. Sawley with contributions from: P. Kreuzer D. Bonacorsi S. Belforte F. Wuerthwein L. Bauerdick K. Lassila-Perini M-C. Sawley

    Introduction More than seventy CMS collaborators attended the Computing and Offline Workshop in San Diego, California, April 20-24th to discuss the state of readiness of software and computing for collisions. Focus and priority were given to preparations for data taking and providing room for ample dialog between groups involved in Commissioning, Data Operations, Analysis and MC Production. Throughout the workshop, aspects of software, operating procedures and issues addressing all parts of the computing model were discussed. Plans for the CMS participation in STEP’09, the combined scale testing for all four experiments due in June 2009, were refined. The article in CMS Times by Frank Wuerthwein gave a good recap of the highly collaborative atmosphere of the workshop. Many thanks to UCSD and to the organizers for taking care of this workshop, which resulted in a long list of action items and was definitely a success. A considerable amount of effort and care is invested in the estimate of the comput...

  1. TAE+ 5.2 - TRANSPORTABLE APPLICATIONS ENVIRONMENT PLUS, VERSION 5.2 (DEC RISC ULTRIX VERSION)

    Science.gov (United States)

    TAE SUPPORT OFFICE

    1994-01-01

    workstations running ULTRIX (TK50 cartridge in UNIX tar format), (3) HP9000 Series 700/800 computers running HP-UX 9.x and X11/R5 (HP 4mm DDS DAT tape cartridge in UNIX tar format), (4) Sun4 (SPARC) series computers running SunOS (.25 inch tape cartridge in UNIX tar format), and (5) SGI Indigo computers running IRIX (.25 inch IRIS tape cartridge in UNIX tar format). Please contact COSMIC to obtain detailed information about the supported operating system and OSF/Motif releases required for each of these machine versions. An optional Motif Object Code License is available for the Sun4 version of TAE Plus 5.2. Version 5.1 of TAE Plus remains available for DEC VAX computers running VMS, HP9000 Series 300/400 computers running HP-UX, and HP 9000 Series 700/800 computers running HP-UX 8.x and X11/R4. Please contact COSMIC for details on these versions of TAE Plus.

  2. COMPUTING

    CERN Multimedia

    P. McBride

    It has been a very active year for the computing project with strong contributions from members of the global community. The project has focused on site preparation and Monte Carlo production. The operations group has begun processing data from P5 as part of the global data commissioning. Improvements in transfer rates and site availability have been seen as computing sites across the globe prepare for large scale production and analysis as part of CSA07. Preparations for the upcoming Computing Software and Analysis Challenge CSA07 are progressing. Ian Fisk and Neil Geddes have been appointed as coordinators for the challenge. CSA07 will include production tests of the Tier-0 production system, reprocessing at the Tier-1 sites and Monte Carlo production at the Tier-2 sites. At the same time there will be a large analysis exercise at the Tier-2 centres. Pre-production simulation of the Monte Carlo events for the challenge is beginning. Scale tests of the Tier-0 will begin in mid-July and the challenge it...

  3. COMPUTING

    CERN Multimedia

    M. Kasemann

    Introduction During the past six months, Computing participated in the STEP09 exercise, had a major involvement in the October exercise and has been working with CMS sites on improving open issues relevant for data taking. At the same time operations for MC production, real data reconstruction and re-reconstructions and data transfers at large scales were performed. STEP09 was successfully conducted in June as a joint exercise with ATLAS and the other experiments. It gave good indication about the readiness of the WLCG infrastructure with the two major LHC experiments stressing the reading, writing and processing of physics data. The October Exercise, in contrast, was conducted as an all-CMS exercise, where Physics, Computing and Offline worked on a common plan to exercise all steps to efficiently access and analyze data. As one of the major results, the CMS Tier-2s demonstrated to be fully capable for performing data analysis. In recent weeks, efforts were devoted to CMS Computing readiness. All th...

  4. COMPUTING

    CERN Multimedia

    I. Fisk

    2011-01-01

    Introduction It has been a very active quarter in Computing with interesting progress in all areas. The activity level at the computing facilities, driven by both organised processing from data operations and user analysis, has been steadily increasing. The large-scale production of simulated events that has been progressing throughout the fall is wrapping-up and reprocessing with pile-up will continue. A large reprocessing of all the proton-proton data has just been released and another will follow shortly. The number of analysis jobs by users each day, that was already hitting the computing model expectations at the time of ICHEP, is now 33% higher. We are expecting a busy holiday break to ensure samples are ready in time for the winter conferences. Heavy Ion The Tier 0 infrastructure was able to repack and promptly reconstruct heavy-ion collision data. Two copies were made of the data at CERN using a large CASTOR disk pool, and the core physics sample was replicated ...

  5. COMPUTING

    CERN Multimedia

    I. Fisk

    2012-01-01

    Introduction Computing continued with a high level of activity over the winter in preparation for conferences and the start of the 2012 run. 2012 brings new challenges with a new energy, more complex events, and the need to make the best use of the available time before the Long Shutdown. We expect to be resource constrained on all tiers of the computing system in 2012 and are working to ensure the high-priority goals of CMS are not impacted. Heavy ions After a successful 2011 heavy-ion run, the programme is moving to analysis. During the run, the CAF resources were well used for prompt analysis. Since then in 2012 on average 200 job slots have been used continuously at Vanderbilt for analysis workflows. Operations Office As of 2012, the Computing Project emphasis has moved from commissioning to operation of the various systems. This is reflected in the new organisation structure where the Facilities and Data Operations tasks have been merged into a common Operations Office, which now covers everything ...

  6. COMPUTING

    CERN Multimedia

    M. Kasemann

    CCRC’08 challenges and CSA08 During the February campaign of the Common Computing readiness challenges (CCRC’08), the CMS computing team had achieved very good results. The link between the detector site and the Tier0 was tested by gradually increasing the number of parallel transfer streams well beyond the target. Tests covered the global robustness at the Tier0, processing a massive number of very large files and with a high writing speed to tapes.  Other tests covered the links between the different Tiers of the distributed infrastructure and the pre-staging and reprocessing capacity of the Tier1’s: response time, data transfer rate and success rate for Tape to Buffer staging of files kept exclusively on Tape were measured. In all cases, coordination with the sites was efficient and no serious problem was found. These successful preparations prepared the ground for the second phase of the CCRC’08 campaign, in May. The Computing Software and Analysis challen...

  7. COMPUTING

    CERN Multimedia

    I. Fisk

    2010-01-01

    Introduction The first data taking period of November produced a first scientific paper, and this is a very satisfactory step for Computing. It also gave the invaluable opportunity to learn and debrief from this first, intense period, and make the necessary adaptations. The alarm procedures between different groups (DAQ, Physics, T0 processing, Alignment/calibration, T1 and T2 communications) have been reinforced. A major effort has also been invested into remodeling and optimizing operator tasks in all activities in Computing, in parallel with the recruitment of new Cat A operators. The teams are being completed and by mid year the new tasks will have been assigned. CRB (Computing Resource Board) The Board met twice since last CMS week. In December it reviewed the experience of the November data-taking period and could measure the positive improvements made for the site readiness. It also reviewed the policy under which Tier-2 are associated with Physics Groups. Such associations are decided twice per ye...

  8. COMPUTING

    CERN Multimedia

    M. Kasemann

    Introduction More than seventy CMS collaborators attended the Computing and Offline Workshop in San Diego, California, April 20-24th to discuss the state of readiness of software and computing for collisions. Focus and priority were given to preparations for data taking and providing room for ample dialog between groups involved in Commissioning, Data Operations, Analysis and MC Production. Throughout the workshop, aspects of software, operating procedures and issues addressing all parts of the computing model were discussed. Plans for the CMS participation in STEP’09, the combined scale testing for all four experiments due in June 2009, were refined. The article in CMS Times by Frank Wuerthwein gave a good recap of the highly collaborative atmosphere of the workshop. Many thanks to UCSD and to the organizers for taking care of this workshop, which resulted in a long list of action items and was definitely a success. A considerable amount of effort and care is invested in the estimate of the co...

  9. Strontium-90 and cesium-137 in sea fish (from Jun. 1982 to Dec. 1982)

    International Nuclear Information System (INIS)

    1982-01-01

    Strontium-90 and cesium-137 in sea fish (from Jun. to Dec. 1982) were determined. Fish was collected from 22 sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are sown in a table. (Namekawa, K.)

  10. Formatos de vídeo, códec y otros aspectos del montaje audiovisual

    OpenAIRE

    Cuadrado Sánchez, Rocío

    2013-01-01

    Este trabajo es una investigación sobre qué es un formato, qué códec hay en el mercado y los procesos que entran en juego a la hora de crear y desarrollar un proyecto para después compartirlo sin ningún problema

  11. DecAID: a decaying wood advisory model for Oregon and Washington.

    Science.gov (United States)

    Kim Mellen; Bruce G. Marcot; Janet L. Ohmann; Karen L. Waddell; Elizabeth A. Willhite; Bruce B. Hostetler; Susan A. Livingston; Cay. Ogden

    2002-01-01

    DecAID is a knowledge-based advisory model that provides guidance to managers in determining the size, amount, and distribution of dead and decaying wood (dead and partially dead trees and down wood) necessary to maintain wildlife habitat and ecosystem functions. The intent of the model is to update and replace existing snag-wildlife models in Washington and Oregon....

  12. Strontium-90 and cesium-137 in total diet (from Jun. 1982 to Dec. 1982)

    International Nuclear Information System (INIS)

    1982-01-01

    Strontium-90 and cesium-137 in total diet (from Jun. to Dec. 1982) were determined. A full one day ordinary diet including three meals, water, tea and other in-between snacks for five persons was collected as a sample of ''total diet'' from 22 sampling locations. The results are shown in a table. (Namekawa, K.)

  13. Combined DECS Analysis and Next-Generation Sequencing Enable Efficient Detection of Novel Plant RNA Viruses

    Directory of Open Access Journals (Sweden)

    Hironobu Yanagisawa

    2016-03-01

    Full Text Available The presence of high molecular weight double-stranded RNA (dsRNA within plant cells is an indicator of infection with RNA viruses as these possess genomic or replicative dsRNA. DECS (dsRNA isolation, exhaustive amplification, cloning, and sequencing analysis has been shown to be capable of detecting unknown viruses. We postulated that a combination of DECS analysis and next-generation sequencing (NGS would improve detection efficiency and usability of the technique. Here, we describe a model case in which we efficiently detected the presumed genome sequence of Blueberry shoestring virus (BSSV, a member of the genus Sobemovirus, which has not so far been reported. dsRNAs were isolated from BSSV-infected blueberry plants using the dsRNA-binding protein, reverse-transcribed, amplified, and sequenced using NGS. A contig of 4,020 nucleotides (nt that shared similarities with sequences from other Sobemovirus species was obtained as a candidate of the BSSV genomic sequence. Reverse transcription (RT-PCR primer sets based on sequences from this contig enabled the detection of BSSV in all BSSV-infected plants tested but not in healthy controls. A recombinant protein encoded by the putative coat protein gene was bound by the BSSV-antibody, indicating that the candidate sequence was that of BSSV itself. Our results suggest that a combination of DECS analysis and NGS, designated here as “DECS-C,” is a powerful method for detecting novel plant viruses.

  14. Um comentário sobre Gerasa, a cidade de Decápolis

    Directory of Open Access Journals (Sweden)

    Marisa Balsamo Steingberg

    1969-09-01

    Full Text Available Num remoto e quieto vale, junto às montanhas de Gilead, extendem-se as ruínas de Gerasa (Jerash atual, cidade da Decápolis . Sente-se seu poderio através de suas ruas e monumentos em bom estado de conservação: um dos mais complexos de cidade provincial romana.

  15. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.6649; Contig19-10251; complement(36800..38461); BR...87398.1| ... TFIIB related subunit of TFIIIB (BRF1) [Candida ... albicans] pir||B55483 transcr...L Transcription factor IIIB 70 kDa ... subunit (TFIIIB) (B-related factor)

  16. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.710 >orf19.710; Contig19-10065; complement(47186.....>47710); LSC2*; succinate-CoA ligase beta subunit; truncated protein | overlap LGFDDNASFRQEEVFSWRDPTQEDPQEAE

  17. OVERVIEW OF ADVANCED PETROLEUM-BASED FUELS-DIESEL EMISSIONS CONTROL PROGRAM (APBF-DEC)

    Energy Technology Data Exchange (ETDEWEB)

    Sverdrup, George M.

    2000-08-20

    The Advanced Petroleum-Based Fuels-Diesel Emissions Control Program (APBF-DEC) began in February 2000 and is supported by government agencies and industry. The purpose of the APBF-DEC program is to identify and evaluate the optimal combinations of fuels, lubricants, diesel engines, and emission control systems to meet the projected emission standards for the 2000 to 2010 time period. APBF-DEC is an outgrowth of the earlier Diesel Emission Control-Sulfur Effects Program (DECSE), whose objective is to determine the impact of the sulfur levels in fuel on emission control systems that could lower the emissions of NOx and particulate matter (PM) from diesel powered vehicles in the 2002 to 2004 period. Results from the DECSE studies of two emission control technologies-diesel particle filter (DPF) and NOx adsorber-will be used in the APBF-DEC program. These data are expected to provide initial information on emission control technology options and the effects of fuel properties (including additives) on the performance of emission control systems.

  18. We Cannot Walk Away: DEC's Position of Child Abuse, Neglect, and Trauma

    Science.gov (United States)

    Corr, Catherine

    2016-01-01

    This article details two important reasons why supporting young children with disabilities who have experienced abuse and neglect and their families is the responsibility and obligation of the Division for Early Childhood of the Council for Exceptional Children (DEC): (1) Although prevalent in their work, this population is overlooked; and (2)…

  19. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2029; Contig19-10139; 79190..80278; RFC5*; DNA replicationn factor C | lead...ing strand elongation mismatch repair ... (ATPase); >1a5t0 2 329 7 339 1e-22 ... gb|EAL00

  20. FILOSOFIA THEORETICA VoI. 1 No. 1 Dec. 2011 MENTAL ...

    African Journals Online (AJOL)

    JONATHAN CHIMAKONAM OKEKE

    2011-12-01

    Dec 1, 2011 ... investigate the problem of personal identity (Furman and Avila, 146). Others include, Thomas Reid ... disembodied thoughts and memories are the bastion of personal identity. This does not suggest the .... may make a little sense to me when I say that I'm what I think I am, but how far does this go? How do I ...

  1. Hypoxic treatment inhibits insulin-induced chondrogenesis of ATDC5 cells despite upregulation of DEC1

    DEFF Research Database (Denmark)

    Chen, Li; Fink, Trine; Ebbesen, Peter

    2006-01-01

    Chondrogenesis occurs in vivo in a hypoxic environment, in which the hypoxia inducible factor 1, HIF-1, plays a regulatory role, possibly mediated through the transcription factor DEC1. We have analyzed the effect of hypoxia (1% oxygen) alone and in combination with insulin on the chondrogenic di...

  2. ORACLS- OPTIMAL REGULATOR ALGORITHMS FOR THE CONTROL OF LINEAR SYSTEMS (DEC VAX VERSION)

    Science.gov (United States)

    Frisch, H.

    1994-01-01

    , formulates and selects the routines to be used to solve the problem, and specifies the desired output. There are three versions of ORACLS source code available for implementation: CDC, IBM, and DEC. The CDC version has been implemented on a CDC 6000 series computer with a central memory of approximately 13K (octal) of 60 bit words. The CDC version is written in FORTRAN IV, was developed in 1978, and last updated in 1986. The IBM version has been implemented on an IBM 370 series computer with a central memory requirement of approximately 300K of 8 bit bytes. The IBM version is written in FORTRAN IV and was generated in 1981. The DEC version has been implemented on a VAX series computer operating under VMS. The VAX version is written in FORTRAN 77 and was generated in 1986.

  3. A FORTRAN-compatible program package for the control of CAMAC-systems by a PDP-11 (CA11-A/DEC, Type 1533A/BORER)

    International Nuclear Information System (INIS)

    Lengauer, C.

    1975-01-01

    The described software serves for the control of CAMAC-systems by a PDP-11 Computer with one DEC CA11-A Branch-Driver, respectively up to ten BORER Type 1533A Single-Crate-Controllers under the Operating System DOS V08. The software consists of three parts: 1) a subroutine library for programming in FORTRAN, 2) a macro library for programming in Assembler (for time-critical problems), 3) a loadable CAMAC-Driver for controlling the system by input of single CAMAC-commands at the terminal. Programs which apply the first two parts can be written independently of the CAMAC-Controller used at runtime. (orig.) [de

  4. Dystrophin Expressing Chimeric (DEC) Human Cells Provide a Potential Therapy for Duchenne Muscular Dystrophy.

    Science.gov (United States)

    Siemionow, Maria; Cwykiel, Joanna; Heydemann, Ahlke; Garcia, Jesus; Marchese, Enza; Siemionow, Krzysztof; Szilagyi, Erzsebet

    2018-06-01

    Duchenne Muscular Dystrophy (DMD) is a progressive and lethal disease caused by mutations of the dystrophin gene. Currently no cure exists. Stem cell therapies targeting DMD are challenged by limited engraftment and rejection despite the use of immunosuppression. There is an urgent need to introduce new stem cell-based therapies that exhibit low allogenic profiles and improved cell engraftment. In this proof-of-concept study, we develop and test a new human stem cell-based approach to increase engraftment, limit rejection, and restore dystrophin expression in the mdx/scid mouse model of DMD. We introduce two Dystrophin Expressing Chimeric (DEC) cell lines created by ex vivo fusion of human myoblasts (MB) derived from two normal donors (MB N1 /MB N2 ), and normal and DMD donors (MB N /MB DMD ). The efficacy of fusion was confirmed by flow cytometry and confocal microscopy based on donor cell fluorescent labeling (PKH26/PKH67). In vitro, DEC displayed phenotype and genotype of donor parent cells, expressed dystrophin, and maintained proliferation and myogenic differentiation. In vivo, local delivery of both DEC lines (0.5 × 10 6 ) restored dystrophin expression (17.27%±8.05-MB N1 /MB N2 and 23.79%±3.82-MB N /MB DMD ) which correlated with significant improvement of muscle force, contraction and tolerance to fatigue at 90 days after DEC transplant to the gastrocnemius muscles (GM) of dystrophin-deficient mdx/scid mice. This study establishes DEC as a potential therapy for DMD and other types of muscular dystrophies.

  5. COMPUTING

    CERN Multimedia

    2010-01-01

    Introduction Just two months after the “LHC First Physics” event of 30th March, the analysis of the O(200) million 7 TeV collision events in CMS accumulated during the first 60 days is well under way. The consistency of the CMS computing model has been confirmed during these first weeks of data taking. This model is based on a hierarchy of use-cases deployed between the different tiers and, in particular, the distribution of RECO data to T1s, who then serve data on request to T2s, along a topology known as “fat tree”. Indeed, during this period this model was further extended by almost full “mesh” commissioning, meaning that RECO data were shipped to T2s whenever possible, enabling additional physics analyses compared with the “fat tree” model. Computing activities at the CMS Analysis Facility (CAF) have been marked by a good time response for a load almost evenly shared between ALCA (Alignment and Calibration tasks - highest p...

  6. COMPUTING

    CERN Multimedia

    Contributions from I. Fisk

    2012-01-01

    Introduction The start of the 2012 run has been busy for Computing. We have reconstructed, archived, and served a larger sample of new data than in 2011, and we are in the process of producing an even larger new sample of simulations at 8 TeV. The running conditions and system performance are largely what was anticipated in the plan, thanks to the hard work and preparation of many people. Heavy ions Heavy Ions has been actively analysing data and preparing for conferences.  Operations Office Figure 6: Transfers from all sites in the last 90 days For ICHEP and the Upgrade efforts, we needed to produce and process record amounts of MC samples while supporting the very successful data-taking. This was a large burden, especially on the team members. Nevertheless the last three months were very successful and the total output was phenomenal, thanks to our dedicated site admins who keep the sites operational and the computing project members who spend countless hours nursing the...

  7. COMPUTING

    CERN Multimedia

    M. Kasemann

    Introduction A large fraction of the effort was focused during the last period into the preparation and monitoring of the February tests of Common VO Computing Readiness Challenge 08. CCRC08 is being run by the WLCG collaboration in two phases, between the centres and all experiments. The February test is dedicated to functionality tests, while the May challenge will consist of running at all centres and with full workflows. For this first period, a number of functionality checks of the computing power, data repositories and archives as well as network links are planned. This will help assess the reliability of the systems under a variety of loads, and identifying possible bottlenecks. Many tests are scheduled together with other VOs, allowing the full scale stress test. The data rates (writing, accessing and transfer¬ring) are being checked under a variety of loads and operating conditions, as well as the reliability and transfer rates of the links between Tier-0 and Tier-1s. In addition, the capa...

  8. COMPUTING

    CERN Multimedia

    Matthias Kasemann

    Overview The main focus during the summer was to handle data coming from the detector and to perform Monte Carlo production. The lessons learned during the CCRC and CSA08 challenges in May were addressed by dedicated PADA campaigns lead by the Integration team. Big improvements were achieved in the stability and reliability of the CMS Tier1 and Tier2 centres by regular and systematic follow-up of faults and errors with the help of the Savannah bug tracking system. In preparation for data taking the roles of a Computing Run Coordinator and regular computing shifts monitoring the services and infrastructure as well as interfacing to the data operations tasks are being defined. The shift plan until the end of 2008 is being put together. User support worked on documentation and organized several training sessions. The ECoM task force delivered the report on “Use Cases for Start-up of pp Data-Taking” with recommendations and a set of tests to be performed for trigger rates much higher than the ...

  9. COMPUTING

    CERN Multimedia

    P. MacBride

    The Computing Software and Analysis Challenge CSA07 has been the main focus of the Computing Project for the past few months. Activities began over the summer with the preparation of the Monte Carlo data sets for the challenge and tests of the new production system at the Tier-0 at CERN. The pre-challenge Monte Carlo production was done in several steps: physics generation, detector simulation, digitization, conversion to RAW format and the samples were run through the High Level Trigger (HLT). The data was then merged into three "Soups": Chowder (ALPGEN), Stew (Filtered Pythia) and Gumbo (Pythia). The challenge officially started when the first Chowder events were reconstructed on the Tier-0 on October 3rd. The data operations teams were very busy during the the challenge period. The MC production teams continued with signal production and processing while the Tier-0 and Tier-1 teams worked on splitting the Soups into Primary Data Sets (PDS), reconstruction and skimming. The storage sys...

  10. COMPUTING

    CERN Multimedia

    I. Fisk

    2013-01-01

    Computing operation has been lower as the Run 1 samples are completing and smaller samples for upgrades and preparations are ramping up. Much of the computing activity is focusing on preparations for Run 2 and improvements in data access and flexibility of using resources. Operations Office Data processing was slow in the second half of 2013 with only the legacy re-reconstruction pass of 2011 data being processed at the sites.   Figure 1: MC production and processing was more in demand with a peak of over 750 Million GEN-SIM events in a single month.   Figure 2: The transfer system worked reliably and efficiently and transferred on average close to 520 TB per week with peaks at close to 1.2 PB.   Figure 3: The volume of data moved between CMS sites in the last six months   The tape utilisation was a focus for the operation teams with frequent deletion campaigns from deprecated 7 TeV MC GEN-SIM samples to INVALID datasets, which could be cleaned up...

  11. COMPUTING

    CERN Multimedia

    I. Fisk

    2012-01-01

      Introduction Computing activity has been running at a sustained, high rate as we collect data at high luminosity, process simulation, and begin to process the parked data. The system is functional, though a number of improvements are planned during LS1. Many of the changes will impact users, we hope only in positive ways. We are trying to improve the distributed analysis tools as well as the ability to access more data samples more transparently.  Operations Office Figure 2: Number of events per month, for 2012 Since the June CMS Week, Computing Operations teams successfully completed data re-reconstruction passes and finished the CMSSW_53X MC campaign with over three billion events available in AOD format. Recorded data was successfully processed in parallel, exceeding 1.2 billion raw physics events per month for the first time in October 2012 due to the increase in data-parking rate. In parallel, large efforts were dedicated to WMAgent development and integrati...

  12. COMPUTING

    CERN Multimedia

    I. Fisk

    2011-01-01

    Introduction The Computing Team successfully completed the storage, initial processing, and distribution for analysis of proton-proton data in 2011. There are still a variety of activities ongoing to support winter conference activities and preparations for 2012. Heavy ions The heavy-ion run for 2011 started in early November and has already demonstrated good machine performance and success of some of the more advanced workflows planned for 2011. Data collection will continue until early December. Facilities and Infrastructure Operations Operational and deployment support for WMAgent and WorkQueue+Request Manager components, routinely used in production by Data Operations, are provided. The GlideInWMS and components installation are now deployed at CERN, which is added to the GlideInWMS factory placed in the US. There has been new operational collaboration between the CERN team and the UCSD GlideIn factory operators, covering each others time zones by monitoring/debugging pilot jobs sent from the facto...

  13. 48 CFR 1552.235-78 - Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997).

    Science.gov (United States)

    2010-10-01

    ...: Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997) The... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997). 1552.235-78 Section 1552.235-78 Federal...

  14. Molecular gradient for second-order Møller-Plesset perturbation theory using the divide-expand-consolidate (DEC) scheme

    DEFF Research Database (Denmark)

    Kristensen, Kasper; Jørgensen, Poul; Jansik, Branislav

    2012-01-01

    We demonstrate that the divide-expand-consolidate (DEC) scheme – which has previously been used to determine the second-order Møller–Plesset (MP2) correlation energy – can be applied to evaluate the MP2 molecular gradient in a linear-scaling and embarrassingly parallel manner using a set of local......-box manner to ensure that the error in the DEC-MP2 correlation energy compared to a standard MP2 calculation is proportional to a single input threshold denoted the fragment optimization threshold (FOT). The FOT also implicitly controls the error in the DEC-MP2 molecular gradient as substantiated...... by a theoretical analysis and numerical results. The development of the DEC-MP2 molecular gradient is the initial step towards calculating higher order energy derivatives for large molecular systems using the DEC framework, both at the MP2 level of theory and for more accurate coupled-cluster methods....

  15. COMPUTING

    CERN Multimedia

    M. Kasemann

    CMS relies on a well functioning, distributed computing infrastructure. The Site Availability Monitoring (SAM) and the Job Robot submission have been very instrumental for site commissioning in order to increase availability of more sites such that they are available to participate in CSA07 and are ready to be used for analysis. The commissioning process has been further developed, including "lessons learned" documentation via the CMS twiki. Recently the visualization, presentation and summarizing of SAM tests for sites has been redesigned, it is now developed by the central ARDA project of WLCG. Work to test the new gLite Workload Management System was performed; a 4 times increase in throughput with respect to LCG Resource Broker is observed. CMS has designed and launched a new-generation traffic load generator called "LoadTest" to commission and to keep exercised all data transfer routes in the CMS PhE-DEx topology. Since mid-February, a transfer volume of about 12 P...

  16. DIRECT ENERGY CONVERSION (DEC) FISSION REACTORS - A U.S. NERI PROJECT

    International Nuclear Information System (INIS)

    Beller, D.; Polansky, G.

    2000-01-01

    The direct conversion of the electrical energy of charged fission fragments was examined early in the nuclear reactor era, and the first theoretical treatment appeared in the literature in 1957. Most of the experiments conducted during the next ten years to investigate fission fragment direct energy conversion (DEC) were for understanding the nature and control of the charged particles. These experiments verified fundamental physics and identified a number of specific problem areas, but also demonstrated a number of technical challenges that limited DEC performance. Because DEC was insufficient for practical applications, by the late 1960s most R and D ceased in the US. Sporadic interest in the concept appears in the literature until this day, but there have been no recent programs to develop the technology. This has changed with the Nuclear Energy Research Initiative that was funded by the U.S. Congress in 1999. Most of the previous concepts were based on a fission electric cell known as a triode, where a central cathode is coated with a thin layer of nuclear fuel. A fission fragment that leaves the cathode with high kinetic energy and a large positive charge is decelerated as it approaches the anode by a charge differential of several million volts, it then deposits its charge in the anode after its kinetic energy is exhausted. Large numbers of low energy electrons leave the cathode with each fission fragment; they are suppressed by negatively biased on grid wires or by magnetic fields. Other concepts include magnetic collimators and quasi-direct magnetohydrodynamic generation (steady flow or pulsed). We present the basic principles of DEC fission reactors, review the previous research, discuss problem areas in detail and identify technological developments of the last 30 years relevant to overcoming these obstacles. A prognosis for future development of direct energy conversion fission reactors will be presented

  17. The Disasters Emergency Committee (DEC) and the Humanitarian Industry in Britain, 1963-85.

    Science.gov (United States)

    Jones, Andrew

    2015-01-01

    This article explores the history of modern British humanitarianism. Specifically, it charts the rise of an extensive humanitarian aid 'industry' in Britain, between 1963 and 1985. It does so through a focus on the Disasters Emergency Committee (DEC), an umbrella body for joint emergency fundraising established in 1963. The DEC is an enduring and important presence in the British humanitarian landscape, as it brings together leading aid agencies to make fundraising campaigns on television after major disasters. This article represents the first systematic historical analysis of the DEC, which it uses to illuminate larger questions about the politics of non-state humanitarianism, state-voluntary sector relations, the political impact of television, and the end of empire. It is shown that while DEC appeals fuelled the growth of its members, this was also a problematic process. Many principal aid agencies wished to shift their focus away from short-term disaster relief work to tackling the long-term structural causes of global poverty instead. It is argued that, despite an increasing political focus, humanitarian organizations were constrained from doing so by the power of television; a perceived lack of public support; the interventions of the British government; and competition between aid agencies in a crowded marketplace. Consequently, continued involvement in short-term, apolitical emergency assistance remained a requirement even for agencies sceptical about its value and impact. This analysis complicates linear narratives of a transition from emergency relief to development aid in post-war British humanitarianism, instead presenting the period as characterized by competing and even contradictory trajectories.

  18. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available chizosaccharomyces pombe] ref|NP_594201.1| spindle poison ... sensitivity related protein. [Schizosac...charomyces pombe] ... pir||T11624 spindle poison sensitivity protein - fis...inger protein | spindle poison sensitivity related protein; >1rgoA 8 70 40 92 2e-04 ... emb|CAB16391.1| scp3 [S... Ca19AnnotatedDec2004aaSeq orf19.7385; Contig19-2513; 105328..106833; LEE1*; zinc f

  19. Cloud Computing: Key to IT Development in West Africa

    African Journals Online (AJOL)

    PROF. O. E. OSUAGWU

    2013-12-01

    Dec 1, 2013 ... Paper, explores the basic concepts of Cloud Computing and how the emerging technology could be harnessed to .... recovery of information than traditional system. Storage ... quickly meet business demand was an important ...

  20. Performance Evaluation of a Mobile Wireless Computational Grid ...

    African Journals Online (AJOL)

    PROF. OLIVER OSUAGWA

    2015-12-01

    Dec 1, 2015 ... Abstract. This work developed and simulated a mathematical model for a mobile wireless computational Grid ... which mobile modes will process the tasks .... evaluation are analytical modelling, simulation ... MATLAB 7.10.0.

  1. Effects of mutants in bHLH region on structure stability and protein-DNA binding energy in DECs.

    Science.gov (United States)

    Kong, Yi; Wang, Zhen; Jia, Yanfei; Li, Ping; Hao, Shuhua; Wang, Yunshan

    2017-07-01

    The human DEC subfamily contains two highly conserved members belonging to basic helix-loop-helix (bHLH) transcription factors. This conserved family is spread widely among various species with the function of regulating various crucial molecular signaling pathways. Due to the significance of DECs for important biological processes, their relationship with diseases and the lack of experimentally proven structures, we have implemented a comparative modeling for the bHLH region of DECs as homodimers with themselves and heterodimers with HES-1. Three mutants with predicted roles in reducing intramolecular binding (H57A, R65A, and LL7879AA in DEC1 and LL7071AA in DEC2) were investigated on DEC monomers. Molecular dynamics (MD) simulations were also employed to evaluate the behavior of the mutant molecules in aqueous solution. The monomer was divided into subregions for accurate investigation. The fluctuation in the basic region of mutants was higher than that of wild-type molecules. The binding energy value between protein and DNA obviously increased in the homodimer harboring R65A mutants, which led to more unstable status between protein and DNA. Thus, the mutant R65A interfered DNA-binding affinity. A study on the spatial structures of wild-type and mutant DECs may facilitate functional prediction for mutation effects and dynamic behavior under various conditions and may ultimately help in targeted drug design.

  2. The effect of eight half-yearly single-dose treatments with DEC on Wuchereria bancrofti circulating antigenaemia

    DEFF Research Database (Denmark)

    Simonsen, Paul E; Magesa, Stephen M; Meyrowitsch, Dan W

    2005-01-01

    The effect of eight half-yearly treatment rounds with diethylcarbamazine (DEC; 6mg/kg bodyweight) on Wuchereria bancrofti-specific circulating filarial antigen (CFA), a marker of adult worm infection, was followed in 79 individuals who were CFA-positive before start of treatment. Half of these we...... values. Repeated DEC therapy thus appears to have a slow but profound and persistent macrofilaricidal effect, which in the long run may be beneficial to populations undergoing DEC-based control interventions by reducing the probability of future morbidity development....

  3. Avaliação da anatomia de molares decíduos por meio de microtomografia computadorizada

    OpenAIRE

    Ana Caroline Fumes

    2013-01-01

    O conhecimento prévio da anatomia interna e externa dos dentes decíduos é de fundamental importância para o sucesso do tratamento endodôntico. O objetivo do presente estudo foi analisar a morfologia das raízes e dos canais radiculares de molares decíduos superiores e inferiores, por meio de microtomografia computadorizada (micro-CT). Foram usados 40 molares decíduos, divididos em quatro grupos, sendo 10 primeiros molares inferiores, 10 segundos molares inferiores, 10 primeiros molares superio...

  4. DET/MPS - THE GSFC ENERGY BALANCE PROGRAM, DIRECT ENERGY TRANSFER/MULTIMISSION SPACECRAFT MODULAR POWER SYSTEM (DEC VAX VMS VERSION)

    Science.gov (United States)

    Jagielski, J. M.

    1994-01-01

    The DET/MPS programs model and simulate the Direct Energy Transfer and Multimission Spacecraft Modular Power System in order to aid both in design and in analysis of orbital energy balance. Typically, the DET power system has the solar array directly to the spacecraft bus, and the central building block of MPS is the Standard Power Regulator Unit. DET/MPS allows a minute-by-minute simulation of the power system's performance as it responds to various orbital parameters, focusing its output on solar array output and battery characteristics. While this package is limited in terms of orbital mechanics, it is sufficient to calculate eclipse and solar array data for circular or non-circular orbits. DET/MPS can be adjusted to run one or sequential orbits up to about one week, simulated time. These programs have been used on a variety of Goddard Space Flight Center spacecraft projects. DET/MPS is written in FORTRAN 77 with some VAX-type extensions. Any FORTRAN 77 compiler that includes VAX extensions should be able to compile and run the program with little or no modifications. The compiler must at least support free-form (or tab-delineated) source format and 'do do-while end-do' control structures. DET/MPS is available for three platforms: GSC-13374, for DEC VAX series computers running VMS, is available in DEC VAX Backup format on a 9-track 1600 BPI tape (standard distribution) or TK50 tape cartridge; GSC-13443, for UNIX-based computers, is available on a .25 inch streaming magnetic tape cartridge in UNIX tar format; and GSC-13444, for Macintosh computers running AU/X with either the NKR FORTRAN or AbSoft MacFORTRAN II compilers, is available on a 3.5 inch 800K Macintosh format diskette. Source code and test data are supplied. The UNIX version of DET requires 90K of main memory for execution. DET/MPS was developed in 1990. A/UX and Macintosh are registered trademarks of Apple Computer, Inc. VMS, DEC VAX and TK50 are trademarks of Digital Equipment Corporation. UNIX is a

  5. CLIPS 6.0 - C LANGUAGE INTEGRATED PRODUCTION SYSTEM, VERSION 6.0 (DEC VAX VMS VERSION)

    Science.gov (United States)

    Donnell, B.

    1994-01-01

    command line version. For the UNIX version of CLIPS 6.0, the command line interface has been successfully implemented on a Sun4 running SunOS, a DECstation running DEC RISC ULTRIX, an SGI Indigo Elan running IRIX, a DEC Alpha AXP running OSF/1, and an IBM RS/6000 running AIX. Command line interface executables are included for Sun4 computers running SunOS 4.1.1 or later and for the DEC RISC ULTRIX platform. The makefiles may have to be modified slightly to be used on other UNIX platforms. The UNIX, Macintosh, and IBM PC versions of CLIPS 6.0 each have a platform specific interface. Source code, a makefile, and an executable for the Windows 3.1 interface version of CLIPS 6.0 are provided only on the IBM PC distribution diskettes. Source code, a makefile, and an executable for the Macintosh interface version of CLIPS 6.0 are provided only on the Macintosh distribution diskettes. Likewise, for the UNIX version of CLIPS 6.0, only source code and a makefile for an X-Windows interface are provided. The X-Windows interface requires MIT's X Window System, Version 11, Release 4 (X11R4), the Athena Widget Set, and the Xmu library. The source code for the Athena Widget Set is provided on the distribution medium. The X-Windows interface has been successfully implemented on a Sun4 running SunOS 4.1.2 with the MIT distribution of X11R4 (not OpenWindows), an SGI Indigo Elan running IRIX 4.0.5, and a DEC Alpha AXP running OSF/1 1.2. The VAX version of CLIPS 6.0 comes only with the generic command line interface. ASCII makefiles for the command line version of CLIPS are provided on all the distribution media for UNIX, VMS, and DOS. Four executables are provided with the IBM PC version: a windowed interface executable for Windows 3.1 built using Borland C++ v3.1, an editor for use with the windowed interface, a command line version of CLIPS for Windows 3.1, and a 386 command line executable for DOS built using Zortech C++ v3.1. All four executables are capable of utilizing extended memory

  6. Displaying DIII-D plasma data using DEC's X window system

    International Nuclear Information System (INIS)

    Greene, K.L.

    1992-01-01

    This paper reports on the DIII-D tokamak program funded by the Department of Energy, which carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for each shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support Xwindows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface

  7. Salt fortified with diethylcarbamazine (DEC) as an effective intervention for lymphatic filariasis, with lessons learned from salt iodization programmes.

    Science.gov (United States)

    Houston, R

    2000-01-01

    DEC-fortified salt has been used successfully as a principal public health tool to eliminate lymphatic filariasis (LF) in China and, less extensively, in several other countries. Studies from 1967 to the present conducted in Brazil, Japan, Tanzania, India, China, and Taiwan involving administration of DEC salt for 18 days to 1 year, have shown this intervention to be effective for both bancroftian and brugian filariasis, as measured by reductions in both microfilarial density and positivity, and in some studies through reduction in mosquito positivity rates as well. Furthermore, studies suggest specific advantages from using DEC salt, including lack of side effects, particularly for bancroftian filariasis, and ability to reduce prevalence below 1% when used in conjunction with standard regimens of DEC tablets. However, use of DEC salt as a control tool suffers from a concern that health authorities might find it difficult to manage a programme involving a commodity such as salt. In the past decade, the very successful global efforts to eliminate iodine deficiency through universal salt iodization have demonstrated that partnership with the salt industry can be both successful and effective as a public health tool. Use of DEC salt can be most successfully implemented in areas in which (a) there is adequate governmental support for its use and for elimination of filariasis, (b) filariasis-endemic areas are clearly defined, (c) political leaders, health officials and the salt industry agree that DEC salt is an appropriate intervention, (d) the salt industry is well-organized and has known distribution patterns, (e) a successful national salt iodization effort exists, (f) a monitoring system exists that ensures adequacy of salt iodine content during production and that can also measure household coverage, and (g) measurement of impact on transmission of LF with the new antigen or filarial DNA detection methods can be established. There are advantages and disadvantages

  8. Efeito da perda prematura de molares decíduos na sobressaliência

    Directory of Open Access Journals (Sweden)

    Yérica M García

    2011-01-01

    Full Text Available A perda precoce de molares decíduos predispõe as maloclusões, entre estas o apinhamento dentário, impactação de dentes permanentes e alteração da relação molar e canino. O objetivo do estudo foi determinar o efeito das perdas precoces dos molares decíduos na relação horizontal incisiva. O estudo é do tipo documentado, retrospetivo e observacional. Foram avaliados os registros ortodônticos (histórias clínicas, fotografias e radiografias de 209 pacientes na faixa etária de 4 a 15 anos de idade. A relação incisiva horizontal foi considerada normal para os pacientes do GRUPO 1, com contato entre a face incisal dos incisivos inferiores e a face palatina dos incisivos superiores. No GRUPO 2, a relação incisiva horizontal foi considerada aumentada, com distância positiva entre eles e no GRUPO 3, a relação incisiva horizontal foi considerada negativa quando as faces incisais dos incisivos superiores e inferiores se encontravam a topo ou em mordida cruzada. Os dados foram analisados através do coeficiente Pearson (p ≤ 0,001. Na análise dos dados coletados, o total de quarenta e cinco pacientes (22% apresentaram perdas prematuras. A prevalência destas perdas não apresentou diferença significativa entre sexos e foi maior no grupo de faixa etária de 7 a 9 anos de idade. Dos pacientes com perda prematura seis (13,3% foram clasificados no GRUPO 1; doze (26,7% no GRUPO 2 e vinte e sete (60% no GRUPO 3. A relação entre o número de molares perdidos e a presença de mordida cruzada anterior foi encontrada, e a média de molares perdidos (4,7 foi maior no GRUPO 3. Os resultados mostraram que as perdas precoces dos molares decíduos apresentam uma relação estatisticamente significante com a mordida cruzada anterior, sugerindo que a falta de suporte oclusal pode favorecer o desenvolvimento protrusivo da mandibula.

  9. Efecto del cambio de posición de decúbito supino a decúbito prono en la presión intraabdominal y su relación con la función renal

    OpenAIRE

    Cuartero Sala, Mireia; Betbesé Roig, Antoni-Jordi; Universitat Autònoma de Barcelona. Departament de Medicina

    2012-01-01

    Es tracta d'un estudi observacional prospectiu en 18 pacients afectats de la síndrome de destret respiratori agut que van requerir un canvi de posició de decúbit supí a decúbit pron per tal de millorar l'oxigenació. La hipòtesi de treball era que aquest canvi de posició podia augmentar la pressió intraabdominal i, en conseqüència, alterar la funció renal per causa prerrenal. Foren registrades variables hemodinàmiques, respiratòries i pressions intrabdominals, i valorada la funció renal. La po...

  10. Efecto del cambio de posición de decúbito supino a decúbito prono en la presión intraabdominal y su relación con la función renal

    OpenAIRE

    Cuartero Sala, Mireia

    2012-01-01

    Es tracta d’un estudi observacional prospectiu en 18 pacients afectats de la síndrome de destret respiratori agut que van requerir un canvi de posició de decúbit supí a decúbit pron per tal de millorar l’oxigenació. La hipòtesi de treball era que aquest canvi de posició podia augmentar la pressió intraabdominal i, en conseqüència, alterar la funció renal per causa prerrenal. Foren registrades variables hemodinàmiques, respiratòries i pressions intrabdominals, i valorada la funció renal. La po...

  11. INS3D - NUMERICAL SOLUTION OF THE INCOMPRESSIBLE NAVIER-STOKES EQUATIONS IN THREE-DIMENSIONAL GENERALIZED CURVILINEAR COORDINATES (DEC RISC ULTRIX VERSION)

    Science.gov (United States)

    Biyabani, S. R.

    1994-01-01

    INS3D computes steady-state solutions to the incompressible Navier-Stokes equations. The INS3D approach utilizes pseudo-compressibility combined with an approximate factorization scheme. This computational fluid dynamics (CFD) code has been verified on problems such as flow through a channel, flow over a backwardfacing step and flow over a circular cylinder. Three dimensional cases include flow over an ogive cylinder, flow through a rectangular duct, wind tunnel inlet flow, cylinder-wall juncture flow and flow through multiple posts mounted between two plates. INS3D uses a pseudo-compressibility approach in which a time derivative of pressure is added to the continuity equation, which together with the momentum equations form a set of four equations with pressure and velocity as the dependent variables. The equations' coordinates are transformed for general three dimensional applications. The equations are advanced in time by the implicit, non-iterative, approximately-factored, finite-difference scheme of Beam and Warming. The numerical stability of the scheme depends on the use of higher-order smoothing terms to damp out higher-frequency oscillations caused by second-order central differencing. The artificial compressibility introduces pressure (sound) waves of finite speed (whereas the speed of sound would be infinite in an incompressible fluid). As the solution converges, these pressure waves die out, causing the derivation of pressure with respect to time to approach zero. Thus, continuity is satisfied for the incompressible fluid in the steady state. Computational efficiency is achieved using a diagonal algorithm. A block tri-diagonal option is also available. When a steady-state solution is reached, the modified continuity equation will satisfy the divergence-free velocity field condition. INS3D is capable of handling several different types of boundaries encountered in numerical simulations, including solid-surface, inflow and outflow, and far

  12. Outline of geophysical investigations on the great earthquake in the south-west Japan on Dec. 21, 1946

    Science.gov (United States)

    Nagata, Takeshi

    1947-01-01

    In in the early morning of Dec. 21, 1946, a great destructive earthquake occurred in southern-western Japan. According to the seismogram obtained in our university, the earthquake motion began at Tokyo from 4 h 20 m 10.4 s on Dec. 21, 1946. The maximum amplitude of NS, EW, and up-down components of the earthquake motion at Tokyo was 12.0 mm, 14.0 mm and 3.0 mm respectively, while the initial motion was composed of 80 μ south, 67 μ west and 20 μ down movements.

  13. Podoplanin-mediated TGF-β-induced epithelial-mesenchymal transition and its correlation with bHLH transcription factor DEC in TE-11 cells.

    Science.gov (United States)

    Wu, Yunyan; Liu, Qiang; Yan, Xu; Kato, Yukio; Tanaka, Makiko; Inokuchi, Sadaki; Yoshizawa, Tadashi; Morohashi, Satoko; Kijima, Hiroshi

    2016-06-01

    Podoplanin is reported involved in the collective cell invasion, another tumor invasion style which is distinct from the single cell invasion, so-called epithelial-mesenchymal transition (EMT). In this study, we investigated the correlation between podoplanin and EMT-related markers in esophageal squamous cell carcinoma (ESCC), and evaluated its linkage with the basic helix-loop-helix (bHLH) transcription factor differentiated embryonic chondrocyte (DEC) 1 and DEC2. Three ESCC cell lines and human squamous cell carcinoma A431 cells were subjected to western blot analyses for podoplanin and EMT markers, as well as the expression of DEC1 and DEC2. By RT-qPCR and western blotting, we found that TGF-β increased the expression of podoplanin and mensenchymal markers (e.g., N-cadherin and vimentin), while decreased the expression of epithelial markers (e.g., Claudin-4 and E-cadherin), accompanied by Smad2 phosphorylation and slug activation. Moreover, TGF-β has different effects on the expression of DEC1 and DEC2, that is, it upregulates DEC1, but downregulates DEC2. Capability of cell proliferation, invasion and migration were further analyzed using CCK-8 assay, Matrigel-invasion assay, and the wound-healing assay, respectively. The proliferation, invasion and migration ability were significantly lost in podoplanin-knockdown cells when compared with the scrambled siRNA group. In addition to these changes, the expression of Claudin-4, but not that of Claudin-1 or E-cadherin, was induced by the siRNA against podoplanin. On the contrary, overexpression of DEC1 and DEC2 exhibits opposite effects on podoplanin, but only slight effect on Claudin-4 was detected. These data indicated that podoplanin is significantly associated with EMT of TE-11 cells, and may be directly or indirectly regulated by bHLH transcription factors DEC1 and DEC2.

  14. Optical computing and neural networks; Proceedings of the Meeting, National Chiao Tung Univ., Hsinchu, Taiwan, Dec. 16, 17, 1992

    Science.gov (United States)

    Hsu, Ken-Yuh (Editor); Liu, Hua-Kuang (Editor)

    1992-01-01

    The present conference discusses optical neural networks, photorefractive nonlinear optics, optical pattern recognition, digital and analog processors, and holography and its applications. Attention is given to bifurcating optical information processing, neural structures in digital halftoning, an exemplar-based optical neural net classifier for color pattern recognition, volume storage in photorefractive disks, and microlaser-based compact optical neuroprocessors. Also treated are the optical implementation of a feature-enhanced optical interpattern-associative neural network model and its optical implementation, an optical pattern binary dual-rail logic gate module, a theoretical analysis for holographic associative memories, joint transform correlators, image addition and subtraction via the Talbot effect, and optical wavelet-matched filters. (No individual items are abstracted in this volume)

  15. Optical computing and neural networks; Proceedings of the Meeting, National Chiao Tung Univ., Hsinchu, Taiwan, Dec. 16, 17, 1992

    Science.gov (United States)

    Hsu, Ken-Yuh; Liu, Hua-Kuang

    The present conference discusses optical neural networks, photorefractive nonlinear optics, optical pattern recognition, digital and analog processors, and holography and its applications. Attention is given to bifurcating optical information processing, neural structures in digital halftoning, an exemplar-based optical neural net classifier for color pattern recognition, volume storage in photorefractive disks, and microlaser-based compact optical neuroprocessors. Also treated are the optical implementation of a feature-enhanced optical interpattern-associative neural network model and its optical implementation, an optical pattern binary dual-rail logic gate module, a theoretical analysis for holographic associative memories, joint transform correlators, image addition and subtraction via the Talbot effect, and optical wavelet-matched filters. (No individual items are abstracted in this volume)

  16. Long-lasting solar energetic electron injection during the 26 Dec 2013 widespread SEP event

    Science.gov (United States)

    Dresing, N.; Klassen, A.; Temmer, M.; Gomez-Herrero, R.; Heber, B.; Veronig, A.

    2017-12-01

    The solar energetic particle (SEP) event on 26 Dec 2013 was detected all around the Sun by the two STEREO spacecraft and close-to-Earth observers. While the two STEREOs were separated by 59 degrees and situated at the front side of the associated large coronal event, it was a backside-event for Earth. Nevertheless, significant and long-lasting solar energetic electron anisotropies together with long rise times were observed at all three viewpoints, pointing to an extended electron injection. Although the CME-driven shock appears to account for the SEP event at a first glance a more detailed view reveals a more complex scenario: A CME-CME interaction takes place during the very early phase of the SEP event. Furthermore, four hours after the onset of the event, a second component is measured at all three viewpoints on top of the first SEP increase, mainly consisting of high energy particles. We find that the CME-driven shock alone can hardly account for the observed SEP event in total but a trapping scenario together with ongoing particle acceleration is more likely.

  17. On the variation of environmental radioactivity in Dae-Jeon area (Jan. 1977-Dec. 1981)

    International Nuclear Information System (INIS)

    Oh, H.P.; Oh, H.J.

    1982-01-01

    This study concerns with gamma-ray exposure in natural background radiation and radioactivities in the air-borne dust, the fall-out, and the rain-out which had been measured in Dae-Jeon area during the period of five years from Jan. 1, 1977 to Dec. 31, 1981. The special survey results from the 22th, 23th, and 24th nuclear explosion tests carred out by Red China are included in this paper. The results of these measurements are as follows: 1. The average value of natural background radiation in the laboratory 20.69μR/hr, and it is found that the natural background was not affected by the nuclear explosion tests. 2. The average value of radioactivity in the air-borne dust is 0.11pμci/cc, and the maximum value of radioactivity during the period is 0.47pμci/cc. 3. The average value of radioactivity of the fall-out is 0.09mci/km 2 -10d, and the maximum value of radioactivity during the period is 0.84mci/km 2 -10d. 4. The average value of radioactivity in the rain-out is 0.45 x 10 -8 μci/cc, and the maximum value of radioactivity during the period is 1.97 x 10 -8 μci/cc. (Author)

  18. A hybrid metaheuristic DE/CS algorithm for UCAV three-dimension path planning.

    Science.gov (United States)

    Wang, Gaige; Guo, Lihong; Duan, Hong; Wang, Heqi; Liu, Luo; Shao, Mingzhen

    2012-01-01

    Three-dimension path planning for uninhabited combat air vehicle (UCAV) is a complicated high-dimension optimization problem, which primarily centralizes on optimizing the flight route considering the different kinds of constrains under complicated battle field environments. A new hybrid metaheuristic differential evolution (DE) and cuckoo search (CS) algorithm is proposed to solve the UCAV three-dimension path planning problem. DE is applied to optimize the process of selecting cuckoos of the improved CS model during the process of cuckoo updating in nest. The cuckoos can act as an agent in searching the optimal UCAV path. And then, the UCAV can find the safe path by connecting the chosen nodes of the coordinates while avoiding the threat areas and costing minimum fuel. This new approach can accelerate the global convergence speed while preserving the strong robustness of the basic CS. The realization procedure for this hybrid metaheuristic approach DE/CS is also presented. In order to make the optimized UCAV path more feasible, the B-Spline curve is adopted for smoothing the path. To prove the performance of this proposed hybrid metaheuristic method, it is compared with basic CS algorithm. The experiment shows that the proposed approach is more effective and feasible in UCAV three-dimension path planning than the basic CS model.

  19. DANZA EXPERIMENTAL CONTEMPORANEA. Creación de Mutanza D.E.C.

    Directory of Open Access Journals (Sweden)

    Claudia Mallarino Flores

    2015-06-01

    Full Text Available El propósito general de nuestro discurso dancístico es diseñar espacios de comunicación con el contexto; de interlocución con el "otro"; de interpretación del fenómeno vital y de construcción de procesos pedagógico-didácticos para acceder al conocimiento desde la experiencia directa de la interacción corporal con el entorno. Mutanza DEC nace en 1997, por iniciativa personal y de alumnos y egresados de la Facultad de Educación Física: de la UPN, así como de algunos enamorados de la Danza, ajenos a la Facultad, pero cercanos a nuestros intereses. El propósito fundamental de este grupo de personas, en su doble condición de futuros bailarines y maestros, es trabajar el lenguaje de la Danza, como una posibilidad de identificación de la propia dimensión corporal.

  20. Managing Associated Risks in Cloud Computer Applications Abstract

    African Journals Online (AJOL)

    2012-12-01

    Dec 1, 2012 ... Cloud Computing, the long-held dream of computing as a utility, has the potential to transform a .... standard approaches to many of the issues, although simple cut .... collapse; So security and privacy are high priorities for all ...

  1. 48 CFR 52.227-19 - Commercial Computer Software License.

    Science.gov (United States)

    2010-10-01

    ... Software License. 52.227-19 Section 52.227-19 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.227-19 Commercial Computer Software License. As prescribed in 27.409(g), insert the following clause: Commercial Computer Software License (DEC 2007) (a) Notwithstanding any contrary provisions...

  2. Field test measurements and system optimisation at a solar operated DEC ventilation system at industrial use; Feldtest-Messungen und Systemoptimierung an einer solarbetriebenen DEC-Klimatisierungsanlage im industriellen Einsatz

    Energy Technology Data Exchange (ETDEWEB)

    Bader, Tobias; Finkenzeller, Michael; Trinkl, Christoph; Zoerner, Wilfried [Hochschule Ingolstadt (Germany). Kompetenzfeld Erneuerbare Energien

    2010-07-01

    The field of competence for renewable energy at the Ingolstadt University (Federal Republic of Germany) examines and optimizes an innovative, solar powered air conditioning system with DEC technology (DEC = Desiccant and Evaporative Cooling) in a multi-functional industrial buildings. In addition to a geothermal heat pump system for basic energy supply of heating and cooling, the building is fitted with two solar thermal solar collector panels and a sorption supported air conditioning system. This air conditioner consists of two units, each with a nominal air flow of 8,000 m{sup 3} per hour. The two solar collector panels provide the heat necessary for the regeneration of the sorption rotors and support the domestic preparation of hot water.

  3. Homologous labelling of leukocytes with Tc 99m- dimeric ethylcysteinate (DEC): 'in vitro' and 'in vivo' tests

    International Nuclear Information System (INIS)

    Soroa, Victoria E.; Ozker, K.

    1999-01-01

    Preliminary tests have been carried out to validate the use of DEC -Tc 99m labelled leukocytes as a more stable substitute for Tc 99m-HMPAO in the diagnosis of infectious and inflammatory diseases. Although in all the patients the infectious focuses have been detected and the results are promissory, further studies with different infections /inflammations are needed to validate the procedure as an alternative routine technique

  4. Independent Orbiter Assessment (IOA): Assessment of the landing/deceleration (LDG/DEC) subsystem FMEA/CIL

    Science.gov (United States)

    Odonnell, R. A.; Weissinger, D.

    1988-01-01

    The results of the Independent Orbiter Assessment (IOA) of the Failure Modes and Effects Analysis (FMEA) and Critical Items List (CIL) are presented. The IOA effort first completed an analysis of the Landing/Deceleration (LDG/DEC) hardware, generating draft failure modes and potential critical items. To preserve independence, this analysis was accomplished without reliance upon the results contained within the NASA FMEA/CIL documentation. The IOA contained within the NASA FMEA/CIL documentation. The IOA results were then compared to the NASA FMEA/CIL baseline with proposed Post 51-L updates included. A resolution of each discrepancy from the comparison is provided through additional analysis as required. This report documents the results of that comparison for the Orbiter LDG/DEC hardware. The IOA product for the LDG/DEC analysis consisted of 259 failure mode worksheets that resulted in 124 potential critical items being identified. Comparison was made to the NASA baseline which consisted of 267 FMEA's and 120 CIL items. This comparison produced agreement on all but 75 FMEA's which caused differences in 51 CIL items.

  5. Fragrance material review on 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one.

    Science.gov (United States)

    Scognamiglio, J; Letizia, C S; Api, A M

    2013-12-01

    A toxicologic and dermatologic review of 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one when used as a fragrance ingredient is presented. 1-Spiro[4.5]dec-7-en-7-yl-4-pent-1-one is a member of the fragrance structural group Alkyl Cyclic Ketones. These fragrances can be described as being composed of an alkyl, R1, and various substituted and bicyclic saturated or unsaturated cyclic hydrocarbons, R2, in which one of the rings may include up to 12 carbons. Alternatively, R2 may be a carbon bridge of C2-C4 carbon chain length between the ketone and cyclic hydrocarbon. This review contains a detailed summary of all published and unpublished toxicology and dermatology papers that are related to this individual fragrance ingredient and is not intended as a stand-alone document. Available data for 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one were evaluated then summarized and includes acute toxicity, skin irritation, mucous membrane (eye) irritation, skin sensitization, phototoxicity, photoallergy, repeated dose, and genotoxicity data. A safety assessment of the entire Alkyl Cyclic Ketones will be published simultaneously with this document; please refer to Belsito et al. (2013) for an overall assessment of the safe use of this material and all Alkyl Cyclic Ketones in fragrances. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. EOI Open Learning: un decálogo para la transformación del aprendizaje

    Directory of Open Access Journals (Sweden)

    González, Alfonso

    2011-12-01

    Full Text Available This article covers as a decalogue the most relevant experiences in the transformation held in the last three years by the Industrial Organization School EOI, the eldest business schools in Spain. The education of entrerpreneur managers and entrepreneurs in management requires a response in line with the demands of a society and a market characterized by personalization and humanization of learning that has become the engine of a profound social and economic transformation in which the public, private and citizens come together in achieving the common good. A business school is uniquely positioned to be a laboratory in which to experience the challenges facing learning in today’s society. The concept Open Learning collects the challenges that are facing both training institutions and traditional learning models, with the deep belief of the role of learning in creating a fairer society and a more competitive economy, as well as the crucial importance of technology in this process.

    En el presente artículo se recogen en forma de decálogo las experiencias más relevantes en el proceso de transformación abierto en los tres últimos años por la Escuela de Organización Industrial, decana de las escuelas de negocio. La formación de directivos emprendedores y de emprendedores directivos exige una respuesta alineada a las exigencias de una sociedad y de un mercado caracterizados por una personalización y humanización del aprendizaje que se ha convertido en el motor de una profunda transformación social y económica en donde lo público, lo privado y lo ciudadano se funden en la consecución del bien común. Una escuela de negocios tiene unas condiciones excepcionales para ser un laboratorio en el que experimentar los desafíos a los que se enfrenta el aprendizaje en la sociedad actual. Con la expresión Open Learning se pretende recoger los desafíos a los que se están enfrentando tanto las instituciones formativas como los modelos

  7. VizieR Online Data Catalog: The FIRST Survey Catalog, Version 2014Dec17 (Helfand+ 2015)

    Science.gov (United States)

    Helfand, D. J.; White, R. L.; Becker, R. H.

    2015-05-01

    The Faint Images of the Radio Sky at Twenty centimeters (FIRST) began in 1993. It uses the VLA (Very Large Array, a facility of the National Radio Observatory (NRAO)) at a frequency of 1.4GHz, and it is slated to 10,000 deg2 of the North and South Galactic Caps, to a sensitivity of about 1mJy with an angular resolution of about 5''. The images produced by an automated mapping pipeline have pixels of 1.8'', a typical rms of 0.15mJy, and a resolution of 5''; the images are available on the Internet (see the FIRST home page at http://sundog.stsci.edu/ for details). The source catalogue is derived from the images. This catalog from the 1993 through 2011 observations contains 946,432 sources from the north and south Galactic caps. It covers a total of 10,575 square degrees of the sky (8444 square degrees in the north and 2131 square degrees in the south). In this version of the catalog, images taken in the the new EVLA configuration have been re-reduced using shallower CLEAN thresholds in order to reduce the "CLEAN bias" in those images. Also, the EVLA images are not co-added with older VLA images to avoid problems resulting from the different frequencies and noise properties of the configurations. That leads to small gaps in the sky coverage at boundaries between the EVLA and VLA regions. As a result, the area covered by this release of the catalog is about 60 square degrees smaller than the earlier release of the catalog (13Jun05, also available here as the "first13.dat" file), and the total number of sources is reduced by nearly 25,000. The previous version of the catalog does have sources in the overlap regions, but their flux densities are considered unreliable due to calibration errors. The flux densities should be more accurate in this catalog, biases are smaller, and the incidence of spurious sources is also reduced. Over most of the survey area, the detection limit is 1 mJy. A region along the equatorial strip (RA=21.3 to 3.3hr, Dec=-1 to 1deg) has a deeper

  8. 6th International Conference on Computer Science and its Applications

    CERN Document Server

    Stojmenovic, Ivan; Jeong, Hwa; Yi, Gangman

    2015-01-01

    The 6th FTRA International Conference on Computer Science and its Applications (CSA-14) will be held in Guam, USA, Dec. 17 - 19, 2014. CSA-14 presents a comprehensive conference focused on the various aspects of advances in engineering systems in computer science, and applications, including ubiquitous computing, U-Health care system, Big Data, UI/UX for human-centric computing, Computing Service, Bioinformatics and Bio-Inspired Computing and will show recent advances on various aspects of computing technology, Ubiquitous Computing Services and its application.

  9. Considerations on Fail Safe Design for Design Basis Accident (DBA) vs. Design Extension Condition (DEC): Lesson Learnt from the Fukushima Accident

    International Nuclear Information System (INIS)

    Ha, Jun Su; Kim, Sungyeop

    2014-01-01

    The fail safety design is referred to as an inherently safe design concept where the failure of an SSC (System, Structure or Component) leads directly to a safe condition. Usually the fail safe design has been devised based on the design basis accident (DBAs), because the nuclear safety has been assured by securing the capability to safely cope with DBAs. Currently regards have been paid to the DEC (Design Extension Condition) as an extended design consideration. Hence additional attention should be paid to the concept of the fail safe design in order to consider the DEC, accordingly. In this study, a case chosen from the Fukushima accident is studied to discuss the issue associated with the fail safe design in terms of DBA and DEC standpoints. For the fail safe design to be based both on the DBA and the DEC, a Mode Changeable Fail Safe Design (MCFSD) is proposed in this study. Additional discussions on what is needed for the MCFSD to be applied in the nuclear safety are addressed as well. One of the lessons learnt from the Fukushima accident should include considerations on the fail-safe design in a changing regulatory framework. Currently the design extension condition (DEC) including severe accidents should be considered during designing and licensing NPPs. Hence concepts on the fail safe design need to be changed to be based on not only the DBA but also the DEC. In this study, a case on a fail-safe design chosen from the Fukushima accident is studied to discuss the issue associated with the fail safe design in terms of DBA and DEC conditions. For the fail safe design to be based both on the DBA and the DEC, a Mode Changeable Fail Safe Design (MCFSD) is proposed in this study. Additional discussions on what is needed for the MCFSD to be applied in the nuclear safety are addressed as well

  10. Terapia pulpar em dentes decíduos: possibilidades terapêuticas baseadas em evidências

    Directory of Open Access Journals (Sweden)

    Natalino Lourenço Neto

    Full Text Available INTRODUÇÃO: A pulpotomia em dentes decíduos é uma técnica conservadora de terapia pulpar amplamente utilizada em Odontopediatria, sendo de fundamental importância para evitar a perda prematura desses dentes, quer seja por alterações provocadas pela cárie dentária ou traumatismo dentário. Apesar de ser uma técnica estudada há muitos anos, causa muitas controvérsias e discussões, principalmente em termos de biocompatibilidade dos medicamentos empregados e pelas dificuldades e falhas no diagnóstico da condição pulpar. OBJETIVO: Por meio de uma revisão sistemática da literatura, no período compreendido entre 2000 e 2011, e com enfoque em estudos clínicos randomizados, revisões sistemáticas e meta-análises, este trabalho teve como objetivo discutir, com base em evidências científicas, alternativas para o tratamento de pulpotomia em dentes decíduos humanos. CONCLUSÃO: As evidências científicas fidedignas com o uso de materiais capeadores pulpares e as técnicas de Eletrocirurgia e Laser de Baixa Potência foram escassas. Desta forma, sugere-se a realização de estudos complementares bem delineados estatisticamente para maiores esclarecimentos. As informações geradas em tais experimentos poderão contribuir para um melhor entendimento dos mecanismos da terapia pulpar, podendo gerar o desenvolvimento de protocolos com novas formas terapêuticas, que visam a melhorar a terapia pulpar em dentes decíduos.

  11. Decúbito prono en pacientes con síndrome de distrés respiratorio agudo

    Directory of Open Access Journals (Sweden)

    Mariano Setten

    Full Text Available RESUMEN El síndrome de distrés respiratorio agudo ocupa gran atención en la unidad de cuidados intensivos. A pesar del amplio conocimiento alcanzado sobre la fisiopatología de éste síndrome, el enfoque en la unidad de cuidados intensivos consiste, en gran parte, en un tratamiento de soporte vital y en evitar los efectos secundarios de las terapéuticas invasivas. Si bien, durante los últimos 20 años, se generaron grandes avances en ventilación mecánica con un impacto importante sobre la mortalidad, ésta continúa siendo elevada. Una característica de los pacientes con síndrome de distrés respiratorio agudo, sobre todo los más severos, es la presencia de hipoxemia refractaria debido a la existencia de shunt, pudiendo requerir tratamientos adicionales a la ventilación mecánica, entre ellos la ventilación mecánica en decúbito prono. Este método, recomendado para mejorar la oxigenación por primera vez en 1974, puede ser implementado fácilmente en cualquier unidad de cuidados intensivos con personal entrenado. El decúbito prono tiene un sustento bibliográfico sumamente robusto. Varios ensayos clínicos randomizados han demostrado el efecto del decúbito prono sobre la oxigenación en pacientes con síndrome de distrés respiratorio agudo medida a través de la relación PaO2/FiO2 e incluso su impacto en el aumento de la sobrevida de estos pacientes. Los integrantes del Comité de Kinesiología Intensivista de la Sociedad Argentina de Terapia Intensiva realizaron una revisión narrativa con el objetivo de exponer la evidencia disponible en relación a la implementación del decúbito prono, los cambios producidos en el sistema respiratorio por la aplicación de la maniobra y su impacto sobre la mortalidad. Por último, se sugerirán lineamientos para la toma de decisiones.

  12. Silicon tunnel FET with average subthreshold slope of 55 mV/dec at low drain currents

    Science.gov (United States)

    Narimani, K.; Glass, S.; Bernardy, P.; von den Driesch, N.; Zhao, Q. T.; Mantl, S.

    2018-05-01

    In this paper we present a silicon tunnel FET based on line-tunneling to achieve better subthreshold performance. The fabricated device shows an on-current of Ion = 2.55 × 10-7 A/μm at Vds = Von = Vgs - Voff = -0.5 V for an Ioff = 1 nA/μm and an average SS of 55 mV/dec over two orders of magnitude of Id. Furthermore, the analog figures of merit have been calculated and show that the transconductance efficiency gm/Id beats the MOSFET performance at low currents.

  13. Stakeholder engagement for comparative effectiveness research in cancer care: experience of the DEcIDE Cancer Consortium.

    Science.gov (United States)

    Greenberg, Caprice C; Wind, Jennifer K; Chang, George J; Chen, Ronald C; Schrag, Deborah

    2013-03-01

    Stakeholder input is a critical component of comparative effectiveness research. To ensure that the research activities of the Developing Evidence to Inform Decisions about Effectiveness (DEcIDE) Network, supported by the Agency for Healthcare Research and Quality, translate into the greatest impact for everyday practice and policy-making in cancer, we were tasked with soliciting stakeholder input regarding priority areas in cancer-related comparative effectiveness research for the DEcIDE Cancer Consortium. Given the increasing emphasis on stakeholder engagement in research, many investigators are facing a similar task, yet there is limited literature to guide such efforts, particularly in cancer care. To help fill this gap, we present our approach to operationalizing stakeholder engagement and discuss it in the context of other recent developments in the area. We describe challenges encountered in convening stakeholders from multiple vantage points to prioritize topics and strategies used to mitigate these barriers. We offer several recommendations regarding how to best solicit stakeholder input to inform comparative effectiveness research in cancer care. These recommendations can inform other initiatives currently facing the challenges of engaging stakeholders in priority setting for cancer.

  14. Symbolic computation and abundant travelling wave solutions to ...

    Indian Academy of Sciences (India)

    2016-12-09

    Dec 9, 2016 ... Abstract. In this article, the novel (G /G)-expansion method is successfully applied to construct the abundant travelling wave solutions to the KdV–mKdV equation with the aid of symbolic computation. This equation is one of the most popular equation in soliton physics and appear in many practical scenarios ...

  15. Progress report no.5 for period Jan.1 to Dec.31, 1996

    DEFF Research Database (Denmark)

    Larsen, Poul Scheel

    1996-01-01

    nature have been investigated, including flows in industrial process equipment, around aerodynamics structures and ships, and flows over bed forms of importance for sediment transport. The experimental work has included the development of improved techniques, emphasizing optical methods.The objectives...... & Development of experimental techniquesProject 5. Flow over bed formsProject 6. Flow past ship hull.An additional Project 0, defined for budgetary reasons, has covered common activities and indirect actions in the form of collaboration on a small scale with other research groups.General aspects are summarized...... the education and training of researchers within the field of computational and experimental fluid mechanics. This includes 12 Ph.D. candidates fully or partially funded by the program, an aboutequal number of Ph.D. candidates working on associated problems and gaining from the program, as well as a number...

  16. Aplicación de un protocolo en cicatrización de ulceras por decúbito

    Directory of Open Access Journals (Sweden)

    Porras Janeth

    1993-04-01

    Full Text Available

    Las úlceras por decúbito han constituido un problema de enfermería que ha transcendido a lo largo de la historia. Para su solución se han aplicado diversos y variados tratamientos que han evolucionado desde la utilización de medidas caseras, hasta sofisticados materiales, productos y protocolos cuidadosamente investigados en Canadá, Estados Unidos, Inglaterra y otros. En Colombia, la experiencia en el manejo de estos, ha sido el uso indiscriminado y poco sistematizado a medida que van invadiendo el mercado. Existen múltiples factores concurrentes y predisponentes en la formación de las úlceras los cuales han persistido a pesar de las reiteradas alternativas de solución, mediante la aplicación de protocolos de atención que no han logrado su comprobación en el campo clínico.

  17. Human-Derived Disturbance Estimation and Compensation (DEC) Method Lends Itself to a Modular Sensorimotor Control in a Humanoid Robot.

    Science.gov (United States)

    Lippi, Vittorio; Mergner, Thomas

    2017-01-01

    The high complexity of the human posture and movement control system represents challenges for diagnosis, therapy, and rehabilitation of neurological patients. We envisage that engineering-inspired, model-based approaches will help to deal with the high complexity of the human posture control system. Since the methods of system identification and parameter estimation are limited to systems with only a few DoF, our laboratory proposes a heuristic approach that step-by-step increases complexity when creating a hypothetical human-derived control systems in humanoid robots. This system is then compared with the human control in the same test bed, a posture control laboratory. The human-derived control builds upon the identified disturbance estimation and compensation (DEC) mechanism, whose main principle is to support execution of commanded poses or movements by compensating for external or self-produced disturbances such as gravity effects. In previous robotic implementation, up to 3 interconnected DEC control modules were used in modular control architectures separately for the sagittal plane or the frontal body plane and successfully passed balancing and movement tests. In this study we hypothesized that conflict-free movement coordination between the robot's sagittal and frontal body planes emerges simply from the physical embodiment, not necessarily requiring a full body control. Experiments were performed in the 14 DoF robot Lucy Posturob (i) demonstrating that the mechanical coupling from the robot's body suffices to coordinate the controls in the two planes when the robot produces movements and balancing responses in the intermediate plane, (ii) providing quantitative characterization of the interaction dynamics between body planes including frequency response functions (FRFs), as they are used in human postural control analysis, and (iii) witnessing postural and control stability when all DoFs are challenged together with the emergence of inter

  18. IT Services availability during CERN annual closure Dec 2004-Jan2005

    CERN Multimedia

    2004-01-01

    Mail, CERN Windows (NICE), Web services, LXPLUS, LXBATCH, AFS, Automated tape devices, Castor, Backups, software license servers, Sundev, CVS and Print Servers, CDS Search, Submit and Agenda, InDiCo, EDMS (in collaboration with TS Department), CMS disc servers, the AB NFS servers (SLNFS1, PSNFS1 and MTBNFS1, that PS group runs for AB Department), Campus Network, Remedy, and Security services will be available during the CERN annual closure. The physics database cluster, replication location service as well as accdb, cerndb and admsdb are the only databases available; CCDB will be closed for public access. Problems developing on scheduled services should be addressed within about half a day except around Christmas Eve and Christmas Day (24 and 25 December) and New Year's Eve and New Year's Day (31 December and 1st January). For Administrative Computing Services, ERT (Electronic Recruitment Tool) will be the only service operational; all other AIS applications such as EDH, CET, HRT etc. will be unavailable. Al...

  19. Efeito da rotação da cabeça na pressão intraocular em decúbito ventral: estudo randomizado

    Directory of Open Access Journals (Sweden)

    M. Nuri Deniz

    2013-04-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A elevação da pressão intraocular (PIO, que diminui a pressão de perfusão do nervo óptico, é aumentada pelo posicionamento em decúbito ventral. O objetivo de nosso estudo foi comparar o efeito da rotação lateral da cabeça a 45º em decúbito ventral no aumento da PIO de olhos posicionados para cima e olhos posicionados para baixo em pacientes submetidos à nefrolitotomia percutânea (NLPC. MÉTODOS: Quarenta e cinco pacientes foram randomicamente alocados em dois grupos. A PIO dos pacientes foi registrada bilateralmente em posição supina antes do início da operação. Os pacientes foram posicionados em decúbito ventral. A cabeça foi posicionada sobre um apoio sem compressão externa direta em ambos os olhos. Os pacientes do Grupo I foram estritamente mantidos em pronação neutra, enquanto os pacientes do Grupo II foram posicionados em pronação com rotação da cabeça a 45º para o lado direito. No fim da operação, os pacientes foram reposicionados em decúbito dorsal e a PIO foi imediatamente medida. RESULTADOS: Não houve diferença entre os dados demográficos, na duração da cirurgia, perda de sangue e reposição de líquido dos pacientes. Os valores pós-cirúrgicos da PIO em decúbito ventral aumentaram significativamente em comparação com os valores pré-operatórios em ambos os grupos (p < 0,05. Após a cirurgia em decúbito ventral, os valores da PIO nos olhos posicionados para cima no Grupo II foram significativamente menores do que no Grupo I e nos olhos posicionados para baixo no Grupo II (p < 0,05. CONCLUSÃO: A posição em decúbito ventral aumenta a PIO. Nos pacientes posicionados em decúbito ventral com rotação lateral da cabeça a 45º, a PIO nos olhos posicionados para cima foi significativamente menor.

  20. STAR- A SIMPLE TOOL FOR AUTOMATED REASONING SUPPORTING HYBRID APPLICATIONS OF ARTIFICIAL INTELLIGENCE (DEC VAX VERSION)

    Science.gov (United States)

    Borchardt, G. C.

    1994-01-01

    /output required, and displays the results. The STAR interpreter is written in the C language for interactive execution. It has been implemented on a VAX 11/780 computer operating under VMS, and the UNIX version has been implemented on a Sun Microsystems 2/170 workstation. STAR has a memory requirement of approximately 200K of 8 bit bytes, excluding externally compiled functions and application-dependent symbolic definitions. This program was developed in 1985.

  1. Purification and characterization of two DyP isozymes from Thanatephorus cucumeris Dec 1 specifically expressed in an air-membrane surface bioreactor.

    Science.gov (United States)

    Shimokawa, Takuya; Shoda, Makoto; Sugano, Yasushi

    2009-02-01

    DyP isozymes (DyP2 and DyP3) from the culture fluid of the fungus Thanatephorus cucumeris Dec 1 by air-membrane surface bioreactor were purified and characterized. The characteristics of DyP2 were almost the same as those of a recombinant DyP reported previously, but different from DyP3.

  2. Ion and solvent diffusion and ion conduction of PC-DEC and PC-DME binary solvent electrolytes of LiN(SO2CF3)2

    International Nuclear Information System (INIS)

    Hayamizu, Kikuko; Aihara, Yuichi

    2004-01-01

    Two binary mixed solvent systems typically used for lithium batteries were studied by measuring the self-diffusion coefficients of the solvent, lithium ion and anion, independently by using the multi-nuclear pulsed field-gradient spin-echo (PGSE) 1 H, 7 Li and 19 F NMR method. One system was propylene carbonate (PC) and diethyl carbonate (DEC) system and the other binary system was PC and 1,2-dimethoxyethane (DME), and the lithium salt used was LiN(SO 2 CF 3 ) 2 (LiTFSI). The relative ratio of the PC was changed from zero (pure DME and DEC) to 100% (pure PC) in the DME-PC and the DEC-PC systems, respectively. The self-diffusion coefficients of the solvents were measured with and without the lithium salt, and the two solvents had almost the same diffusion coefficient in the DEC-PC system, while DME diffused faster than PC in the DME-PC system. In the electrolytes the solvents diffused the fastest, followed by the anion with the lithium ion diffusing the slowest. The degree of ion dissociation was estimated for each electrolyte by comparing the ionic conductivities estimated from the ion diffusion and those measured directly by the electrochemical method

  3. Computer-based data acquisition system in the Large Coil Test Facility

    International Nuclear Information System (INIS)

    Gould, S.S.; Layman, L.R.; Million, D.L.

    1983-01-01

    The utilization of computers for data acquisition and control is of paramount importance on large-scale fusion experiments because they feature the ability to acquire data from a large number of sensors at various sample rates and provide for flexible data interpretation, presentation, reduction, and analysis. In the Large Coil Test Facility (LCTF) a Digital Equipment Corporation (DEC) PDP-11/60 host computer with the DEC RSX-11M operating system coordinates the activities of five DEC LSI-11/23 front-end processors (FEPs) via direct memory access (DMA) communication links. This provides host control of scheduled data acquisition and FEP event-triggered data collection tasks. Four of the five FEPs have no operating system

  4. Transcription factor DecR (YbaO) controls detoxification of L-cysteine in Escherichia coli.

    Science.gov (United States)

    Shimada, Tomohiro; Tanaka, Kan; Ishihama, Akira

    2016-09-01

    YbaO is an uncharacterized AsnC-family transcription factor of Escherichia coli. In both Salmonella enterica and Pantoea ananatis, YbaO homologues were identified to regulate the adjacent gene encoding cysteine desulfhydrase for detoxification of cysteine. Using the genomic SELEX (systematic evolution of ligands by exponential enrichment) screening system, we identified the yhaOM operon, located far from the ybaO gene on the E. coli genome, as a single regulatory target of YbaO. In both gel shift assay in vitro and reporter and Northern blot assays in vivo, YbaO was found to regulate the yhaOM promoter. The growth of mutants lacking either ybaO or its targets yhaOM was delayed in the presence of cysteine, indicating involvement of these genes in cysteine detoxification. In the major pathway of cysteine degradation, hydrogen sulfide is produced in wild-type E. coli, but its production was not observed in each of the ybaO, yhaO and yhaM mutants. The yhaOM promoter was activated in the presence of cysteine, implying the role of cysteine in activation of YbaO. Taken together, we propose that YbaO is the cysteine-sensing transcriptional activator of the yhaOM operon, which is involved in the detoxification of cysteine. We then propose the naming of ybaO as decR (regulator of detoxification of cysteine).

  5. The fifteenth period report on the cooperative utilization of the AVF cyclotron at Osaka University RCNP (Dec 1982 - Apr 1983)

    International Nuclear Information System (INIS)

    1984-01-01

    The AVF cyclotron at the RCNP (Research Center for Nuclear Physics) of Osaka University has been cooperatively used by various researchers of Japanese universities or colleges. This collective report covers papers concerning various studies performed at the AVF during Dec 1982 to Apr 1983. Some of the titles of these papers are as follows : Elastic scattering of 56 MeV polarized deuterons from 12 C and 40 Ca ; Pionic three-nucleon capture reactions ; Measurement on branching ratios of short-lived beta emitter 23 Mg and its hyperfine interactions ; Half-life and branching ratios of short-lived beta emitter 13 O ; 7 Li excitation of the giant resonances in 208 Pb ; Measurements of spin polarization of residual nuclei after light particle emission in heavy ion reactions ; Target dependence of the sequential alpha decay through the narrow resonances of 20 Ne ; Analyzing power of neutron continuum spectra for the 93 Nb (p,nx) reaction and a simple one step OWBA analysis ; Energy dependence of the reaction mechanism for the 3 He and alpha induced reactions ; Medium energy gamma rays following radiative capture of polarized protons on light nuclei. (Aoki, K.)

  6. Synthesis and Molecular Structures of (E-non-2-enoic Acid and (E-dec-2-enoic Acid

    Directory of Open Access Journals (Sweden)

    Marcel Sonneck

    2015-10-01

    Full Text Available The molecular structures of (E-non-2-enoic acid (C9 and (E-dec-2-enoic acid (C10 are reported. The title compounds were crystallized by slow evaporation of ethanolic solutions at −30 °C. C9 crystallizes in the monoclinic space group P21/c and C10 in the triclinic space group P-1, each with 4 molecules in the unit cell. The unit cell parameters for C9 are: a = 10.6473(4 Å, b = 5.2855(2 Å, c = 17.0313(7 Å; β = 106.0985(10° and V = 920.87(6 Å3. The unit cell parameters for C10 are: a = 4.1405(2 Å, b = 15.2839(6 Å, c = 17.7089(7 Å; α = 68.3291(11°, β = 83.3850(13°, γ = 85.0779(12° and V = 1033.39(8 Å3.

  7. ROSSA newsletter - Dec 2015

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gloria Lihemo

    1 déc. 2015 ... Lisez sur un projet lauréat qui est consacré à la facilitation de l'accès aux informations fiables et opportunes pertinentes au climat pour aider ... rendre les zones urbaines plus sécuritaires et plus inclusives et une autre initiative qui génère des preuves plus profondes et des .... l'inégalité et la criminalité à.

  8. The molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory: The DEC-RI-MP2 gradient

    Energy Technology Data Exchange (ETDEWEB)

    Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas [Department of Chemistry, qLeap Center for Theoretical Chemistry, University of Aarhus, DK-8000 Århus C (Denmark)

    2016-07-14

    We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.

  9. The molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory: The DEC-RI-MP2 gradient

    International Nuclear Information System (INIS)

    Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas

    2016-01-01

    We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.

  10. Crustáceos decápodos asociados a ensamblajes macroalgales en el litoral rocoso de Córdoba, Caribe colombiano

    Directory of Open Access Journals (Sweden)

    Néstor Hernando Campos

    2012-04-01

    Full Text Available Objetivo. Determinar la estructura de las poblaciones de crustáceos decápodos asociados a ensamblajes algales en el litoral rocoso del departamento de Córdoba. Materiales y métodos. Para la recolección de los especímenes se delimitó con un cuadrante de 625 cm2, un área con cinco repeticiones dispuestas al azar en cada estación. Para la separación de las macroalgas desde su disco de fijación en el sustrato, se empleó una espátula metálica. En un recipiente plástico se separaron los crustáceos decápodos del resto del material y se conservaron en alcohol al 70%. Resultados. Se identificaron representantes de 50 especies asociadas a los céspedes algales, agrupadas en 16 familias y 29 géneros. Especies como Acanthonyx petiverii, Epialtus bituberculatus, Eurypanopeus abbreviatus y Pachycheles serratus, presentaron un rango amplio de distribución, siendo características en las dos ecorregiones de estudio. Los cambios en cobertura de algas rojas como Gracilaria mammillaris, Hypnea musciformis y Acanthophora muscoides, determinaron la mayor asociación de crustáceos decápodos en la ecorregión Morrosquillo, mientras que los cambios en cobertura de G. damaecornis y Padina gymnospora, fueron las que determinaron la mayor asociación de crustáceos decápodos en el Darién cordobés. Conclusiones. Los resultados indicaron que las especies de crustáceos decápodos asociados a ensamblajes macroalgales, no se encontraron distribuidas de forma similar en las dos ecorregiones estudiadas, siendo P. armatus la especie con mayor porcentaje de abundancia en la ecorregión Morrosquillo, y E. bituberculatus en el sector comprendido entre los municipios de Moñitos y Los Córdobas.

  11. Software For Computer-Security Audits

    Science.gov (United States)

    Arndt, Kate; Lonsford, Emily

    1994-01-01

    Information relevant to potential breaches of security gathered efficiently. Automated Auditing Tools for VAX/VMS program includes following automated software tools performing noted tasks: Privileged ID Identification, program identifies users and their privileges to circumvent existing computer security measures; Critical File Protection, critical files not properly protected identified; Inactive ID Identification, identifications of users no longer in use found; Password Lifetime Review, maximum lifetimes of passwords of all identifications determined; and Password Length Review, minimum allowed length of passwords of all identifications determined. Written in DEC VAX DCL language.

  12. Steam generator transient studies using a simplified two-fluid computer code

    International Nuclear Information System (INIS)

    Munshi, P.; Bhatnagar, R.; Ram, K.S.

    1985-01-01

    A simplified two-fluid computer code has been used to simulate reactor-side (or primary-side) transients in a PWR steam generator. The disturbances are modelled as ramp inputs for pressure, internal energy and mass flow-rate for the primary fluid. The CPU time for a transient duration of 4 s is approx. 10 min on a DEC-1090 computer system. The results are thermodynamically consistent and encouraging for further studies. (author)

  13. Radiologic total lung capacity measurement. Development and evaluation of a computer-based system

    Energy Technology Data Exchange (ETDEWEB)

    Seeley, G.W.; Mazzeo, J.; Borgstrom, M.; Hunter, T.B.; Newell, J.D.; Bjelland, J.C.

    1986-11-01

    The development of a computer-based radiologic total lung capacity (TLC) measurement system designed to be used by non-physician personnel is detailed. Four operators tested the reliability and validity of the system by measuring inspiratory PA and lateral pediatric chest radiographs with a Graf spark pen interfaced to a DEC VAX 11/780 computer. First results suggest that the ultimate goal of developing an accurate and easy to use TLC measurement system for non-physician personnel is attainable.

  14. Prevalência de perda precoce de molares decíduos: estudo retrospectivo = Prevalence of early loss of deciduous molars: a retrospective study

    Directory of Open Access Journals (Sweden)

    Alessandro Leite Cavalcanti

    2008-07-01

    Full Text Available Este estudo retrospectivo determinou a prevalência da perda precoce demolares decíduos em pacientes atendidos na clínica de Odontopediatria da Universidade Estadual da Paraíba. Foram examinados 515 prontuários, sendo os dados registrados em um formulário. Foram analisadas as variáveis: gênero, idade, tipo de molar decíduo perdido,arcada dentária (maxilar ou mandibular e lado (direito e esquerdo. Observou-se que a prevalência de perda precoce foi de 15,1%, existindo uma distribuição similar entre os gêneros. Em relação à idade da criança, a maior freqüência de perda acometeu pacientescom sete anos (32,1%. Houve distribuição equitativa da perda dentária entre as arcadas superior e inferior, com 43,6% cada uma, sendo o lado esquerdo o mais acometido (41%. O segundo molar superior esquerdo foi o mais acometido (17,9%, seguido do primeiromolar decíduo superior direito (16,1%. Pode-se concluir que a prevalência de perda precoce foi baixa e que os molares decíduos superiores foram os dentes mais comumente perdidos.This retrospective study determined the prevalence of early loss of deciduous molars in patients enrolled at the Pediatric Dentistry clinic at the State University of Paraíba. A review of 515 patient records were analyzed, registered in a form. The following variables were analyzed: gender, age, type of deciduous molar loss, region (maxilla or mandible and side (right and left. It was observed that the prevalence of early tooth loss was 15.1% and there was a similar distribution between the genders. In regard to age, the greatest frequency of tooth loss involved patients at 7 years old (32.1%. There was a similar distribution of tooth loss between the maxilla and mandible regions, at 43.6% each, with the left side being themost involved (41%. The second upper left deciduous molar was the most commonly missing tooth (17.9%, followed by the first upper right deciduous molar (16.1%. It can be concluded that the

  15. Estudo das características da oclusão na dentição decídua e na mista e fatores associados

    OpenAIRE

    Costa, Catiara Terra da

    2013-01-01

    Conhecer as características oclusais das dentições decídua e mista, seu desenvolvimento, alterações e possíveis fatores influentes é importante para a prevenção e interceptação das maloclusões, tornando-se de grande valor epidemiológico. Para isto, estudos longitudinais são apropriados, pois observam a mesma população em momentos temporais diferentes. Este estudo foi constituído de duas partes: estudo transversal e estudo longitudinal. O estudo transversal investigou a influência dos fatores ...

  16. Crustáceos decápodos de la cuenca del Río Sinú, Córdoba, Colombia

    Directory of Open Access Journals (Sweden)

    Jorge Alexander Quirós Rodríguez

    2016-09-01

    Full Text Available Para evaluar la composición, abundancia y distribución de los crustáceos decápodos en la cuenca del río Sinú, departamento de Córdoba (Colombia, se estudiaron ocho localidades: cuatro en el río Sinú y cuatro en el complejo cenagoso del bajo Sinú. Para ello, se realizaron seis muestreos entre abril de 2005 y mayo de 2006. En total se registraron 458 crustáceos decápodos distribuidos en tres familias, seis géneros y ocho especies. La familia mejor representada fue Trichodactylidae con cuatro géneros y cuatro especies, seguida de Palaemonidae con un género y tres especies, mientras que de la familia Atyidae solo registró una especie. Especies como Macrobrachium carcinus y M. acanthurus, presentaron el rango más amplio de distribución, siendo características tanto para el rio Sinú como para el CCBS. Entre las especies identificadas, Atya crassa en el río Sinú y Trichodactylus quinquedentatus en el CCBS son nuevos registros para el departamento de Córdoba.

  17. Optical Computing

    OpenAIRE

    Woods, Damien; Naughton, Thomas J.

    2008-01-01

    We consider optical computers that encode data using images and compute by transforming such images. We give an overview of a number of such optical computing architectures, including descriptions of the type of hardware commonly used in optical computing, as well as some of the computational efficiencies of optical devices. We go on to discuss optical computing from the point of view of computational complexity theory, with the aim of putting some old, and some very recent, re...

  18. Monte Carlo simulations on SIMD computer architectures

    International Nuclear Information System (INIS)

    Burmester, C.P.; Gronsky, R.; Wille, L.T.

    1992-01-01

    In this paper algorithmic considerations regarding the implementation of various materials science applications of the Monte Carlo technique to single instruction multiple data (SIMD) computer architectures are presented. In particular, implementation of the Ising model with nearest, next nearest, and long range screened Coulomb interactions on the SIMD architecture MasPar MP-1 (DEC mpp-12000) series of massively parallel computers is demonstrated. Methods of code development which optimize processor array use and minimize inter-processor communication are presented including lattice partitioning and the use of processor array spanning tree structures for data reduction. Both geometric and algorithmic parallel approaches are utilized. Benchmarks in terms of Monte Carl updates per second for the MasPar architecture are presented and compared to values reported in the literature from comparable studies on other architectures

  19. Interactive computer programs for applied nutrition education.

    Science.gov (United States)

    Wise, A

    1985-12-01

    DIET2 and DIET3 are programs written for a Dec2050 computer and intended for teaching applied nutrition to students of nutrition, dietetics, home economics, and hotel and institutional administration. DIET2 combines all the facilities of the separate dietary programs already available at Robert Gordon's Institute of Technology into a single package, and extends these to give students a large amount of relevant information about the nutritional balance of foods (including DHSS and NACNE recommendations) prior to choosing them for meals. Students are also helped by the inclusion of typical portion weights. They are presented with an analysis of nutrients and their balance in the menu created, with an easy mechanism for ammendation of the menu and addition of foods which provide the nutrients that are lacking. At any stage the computer can give the proportion of total nutrient provided by each meal. DIET3 is a relatively simple program that displays the nutritional profile of foods and diets semigraphically.

  20. Composição florística da floresta estacional decídua montana de Serra das Almas, CE, Brasil

    OpenAIRE

    Lima,Jacira Rabelo; Sampaio,Everardo Valadares de Sá Barretto; Rodal,Maria Jesus Nogueira; Araújo,Francisca Soares

    2009-01-01

    No domínio semi-árido brasileiro, a flora das bacias sedimentares ainda é pouco conhecida, mas os levantamentos já existentes indicam que há grande heterogeneidade florística e fisionômica. Mesmo áreas geográficas próximas podem apresentar dissimilaridade florística. Visando testar esta hipótese, a composição florística e o espectro biológico da floresta estacional decídua de Serra das Almas, estado do Ceará, foram analisados e comparados com os de 14 áreas sedimentares no Nordeste. Foram enc...

  1. Cultural significance of primary teeth for caregivers in Northeast Brazil O significado cultural dos dentes decíduos para cuidadoras no Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Marilyn K Nations

    2008-04-01

    Full Text Available This anthropological study critically evaluates Brazilian caregivers' symbolic production and significance of their malnourished offspring's primary teeth, as well as their own, and describes popular dental practices. From January to June 2004, ethnographic interviews of 27 poor, low-literacy mothers were conducted at a public Malnutrition Treatment Center in Fortaleza, Ceará State. Participant observation of clinical pathways and home environments supplemented the data. Content analysis was performed. Results confirm that primary teeth are imbued with cultural significance in Northeast Brazil. Mothers examine mouths, perceive signs of decay, associate primary with permanent tooth healthiness, identify ethnodental illnesses, seek assistance, and perform rituals with exfoliated teeth. The mother's motivation to care for primary teeth is sparked by her memories of past toothache and attempts to avoid stigma and discrimination. Social determinants, not mothers' beliefs or behaviors, are the most critical obstacles to effective dental care. Legitimizing lay knowledge and empowering caregivers and children can improve oral health in Northeast Brazil.Este estudo antropológico analisa a produção simbólica de cuidadoras brasileiras sobre a sua dentição e a de seus filhos desnutridos, descrevendo práticas populares de cuidados em saúde bucal. De janeiro a junho de 2004, foram conduzidas entrevistas etnográficas com 27 cuidadoras, numa instituição pública, no tratamento de desnutrição em Fortaleza, Ceará. A observação participante da dinâmica de atendimento e do ambiente domiciliar suplementaram os dados. Foi utilizada a análise temática. Os resultados confirmam que os dentes decíduos são imbuídos de significados culturais no nordeste brasileiro. As mães examinam as bocas dos filhos, percebem sinais de cárie, associam dentes decíduos saudáveis com permanentes hígidos, identificam enfermidades etnodentárias, procuram assist

  2. Computer Engineers.

    Science.gov (United States)

    Moncarz, Roger

    2000-01-01

    Looks at computer engineers and describes their job, employment outlook, earnings, and training and qualifications. Provides a list of resources related to computer engineering careers and the computer industry. (JOW)

  3. Technetium-99m-Labeled Diethylcarbamazine Citrate (99mTc-DEC as a New Diagnostic Agent for Lymphatic Filariasis Detection

    Directory of Open Access Journals (Sweden)

    N. K. Oekar

    2017-11-01

    Full Text Available Lymphatic filariasis or more commonly known as elephantiasis disease has infected more than 120 million people in 80 countries; and more than 40 million of them are unable to work, in addition to disruption of aesthetic values. The problem faced by almost all people in combating this infectious disease is delayed diagnosis. The sufferers do not realize that they have been infected with this disease. A specific and accurate method of early detection is therefore needed. 99mTc-labeled Diethylcarbamazine-citrate (99mTc-DEC has been successfully prepared. However, as part of the discovery and development of new drugs, the fulfillment of pharmaceutical and safety requirements have to be evaluated. Physico-chemical aspects such as stability, purity levels, and other pharmaceutical requirements, as well as pharmacokinetic studies and route of administration, are important parameters to be studied. The stability test showed that after seven months of storage, a preparation in a dry kit retains an efficiency of labeling and a purity level of more than 90 % and its physico-chemical and biological characteristics remained steady. Biodistribution test in Wistar rat showed that the greatest accumulation occurred in the lymphatic system, especially in the popliteal glands and in lumbar and mesenteric lymph nodes. Imaging with a gamma camera after intradermal and intravenous injections to the experimental animals resulted in a positive image that showed 99mTc-DEC accumulation in the target organ. The results of this innovation are expected to contribute significantly to improving public health, particulary in early detection of filarial infections. In addition, this result is expected to be a concrete contribution to the program of "The Global Goal of Elimination of Lymphatic Filariasis as a Public Health Problem by the Year 2020”.

  4. Crustáceos decápodos asociados a comunidades algales en la región de Santa Marta, Caribe colombiano

    Directory of Open Access Journals (Sweden)

    Campos C. Néstor Hernando

    1995-11-01

    Full Text Available Bimonthly sampling during a one year period was carried out on three biotopes in the Santa Marta region (Bahía de Gayraca: Lithothamnion; Bahía de Chengue: Halimeda; Bahra de Concha: Sargassum in order to determine the crustacean population associated with to them. A total of 1309 individuals of 58 species were collected. Only two species appeared at the three habitats, Mithraculus forceps y Pagurus brevidactylus. Some species were found to characterize the habitat sampled in the Santa Marta región. Lysmata wurdemanni has been found in Santa Marta only in Halimeda; some galatheids are frequently found in the Lithothamnion habitat; the spider crabs Acanthonix petiveri and Epialtus brasiliensis were found exclusively in the Sargassum habitat.Con el fin de evaluar las poblaciones de crustáceos decápodos asociadas a comunidades algales, se adelantaron muestreos bimensuales durante un año en tres comunidades de la región de Santa Marta, (Bahía de Gayraca: algas coralinácea del género Uthothamnion; Bahra de Chengue: algas del género Halimeda; Bahía de Concha: algas del género Sargassum. Se recolectaron 1.309 individuos pertenecientes a 58 especies de crustáceos decápodos. Del total de especies, sólo dos estuvieron presentes en los tres hábitats (Mithraculus forceps y Pagurus brevidactylus. Para cada una de las tres comunidades se pudieron identificar algunas especies que las caracterizan en la región de Santa Marta: Lysmata wurdemanni en el área de estudio no ha sido capturada en otro hábitat diferente a Halimeda; miembros de la familia Galatheidae son frecuentes en Uthothamnion; los cangrejos araña Acanthonix Petiveri y Epialtus brasiliensisse encontraron únicamente en Sargassum.

  5. Lymphatic pathology in asymptomatic and symptomatic children with Wuchereria bancrofti infection in children from Odisha, India and its reversal with DEC and albendazole treatment.

    Science.gov (United States)

    Kar, Shantanu K; Dwibedi, Bhagirathi; Das, Birendra K; Agrawala, Bikash K; Ramachandran, Cherubala P; Horton, John

    2017-10-01

    Once interruption of transmission of lymphatic filariasis is achieved, morbidity prevention and management becomes more important. A study in Brugia malayi filariasis from India has shown sub-clinical lymphatic pathology with potential reversibility. We studied a Wuchereria bancrofti infected population, the major contributor to LF globally. Children aged 5-18 years from Odisha, India were screened for W. bancrofti infection and disease. 102 infected children, 50 with filarial disease and 52 without symptoms were investigated by lymphoscintigraphy and then randomized to receive a supervised single oral dose of DEC and albendazole which was repeated either annually or semi-annually. The lymphatic pathology was evaluated six monthly for two years. Baseline lymphoscintigraphy showed abnormality in lower limb lymphatics in 80% of symptomatic (40/50) and 63·5% (33/52) of asymptomatic children. Progressive improvement in baseline pathology was seen in 70·8, 87·3, 98·6, and 98·6% of cases at 6, 12, 18, and 24 months follow up, while in 4·2, 22·5, 47·9 and 64·8%, pathology reverted to normal. This was independent of age (p = 0·27), symptomatic status (p = 0·57) and semi-annual/bi-annual dosing (p = 0·46). Six of eleven cases showed clinical reduction in lymphedema of legs. A significant proportion of a young W. bancrofti infected population exhibited lymphatic pathology which was reversible with annual dosage of DEC and albendazole. This provides evidence for morbidity prevention & treatment of early lymphedema. It can also be used as a tool to improve community compliance during mass drug administration. ClinicalTrials.gov No CTRI/2013/10/004121.

  6. Computer Music

    Science.gov (United States)

    Cook, Perry R.

    This chapter covers algorithms, technologies, computer languages, and systems for computer music. Computer music involves the application of computers and other digital/electronic technologies to music composition, performance, theory, history, and the study of perception. The field combines digital signal processing, computational algorithms, computer languages, hardware and software systems, acoustics, psychoacoustics (low-level perception of sounds from the raw acoustic signal), and music cognition (higher-level perception of musical style, form, emotion, etc.).

  7. Aplicação do triglicerídeos de cadeia média (TCM na prevenção de úlceras de decúbito

    Directory of Open Access Journals (Sweden)

    Vânia Declair

    1994-03-01

    Full Text Available Aproximadamente 75.000 das 1.000.000 pessoas hospitalizadas a cada ano desenvolvem Úlceras de Decúbito. Graças à tecnologia avançada, hoje temos várias opções de tratamento destas úlceras, ainda que isto seja dispendioso para os pacientes e hospitais. Porém, melhor que desenvolver um processo curativo, é poder desenvolver um processo preventivo eficaz. Com o objetivo de avaliar a eficácia do uso tópico de triglicerídeos de cadeia média (TCM na prevenção de Úlceras de Decúbito, a autora utilizou o método duplo-cego em 86 pacientes, onde 50% foi submetido ao uso de solução com TCM e 50% ao uso Solução Glicerinada. Em ambos os casos, houve diminuição da instalação de Úlceras de Decúbito, porém, dos pacientes que se submeteram ao uso de solução com TCM, apenas de 2 (dois desenvolveram Úlcera de Decúbito (Grau 1; e dos pacientes que se submeteram ao uso de Solução com Glicerina, 12 (doze desenvolveram Úlcera de Decúbito (Graus 1 e 2. Concluiu-se que o TCM é de grande auxílio na prevenção de Úlceras de Decúbito, tem excelente absorção para uso tópico, forma uma película protetora à pele, previne escoriações devido à sua alta capacidade de hidratação e proporciona nutrição celular local.

  8. Multi-dimensional modeling of a thermal energy storage canister. M.S. Thesis - Cleveland State Univ., Dec. 1990

    Science.gov (United States)

    Kerslake, Thomas W.

    1991-01-01

    The Solar Dynamic Power Module being developed for Space Station Freedom uses a eutectic mixture of LiF-CaF2 phase change material (PCM) contained in toroidal canisters for thermal energy storage. Presented are the results from heat transfer analyses of a PCM containment canister. One and two dimensional finite difference computer models are developed to analyze heat transfer in the canister walls, PCM, void, and heat engine working fluid coolant. The modes of heat transfer considered include conduction in canister walls and solid PCM, conduction and pseudo-free convection in liquid PCM, conduction and radiation across PCM vapor filled void regions, and forced convection in the heat engine working fluid. Void shape, location, growth or shrinkage (due to density difference between the solid and liquid PCM phases) are prescribed based on engineering judgment. The PCM phase change process is analyzed using the enthalpy method. The discussion of the results focuses on how canister thermal performance is affected by free convection in the liquid PCM and void heat transfer. Characterizing these effects is important for interpreting the relationship between ground-based canister performance (in 1-g) and expected on-orbit performance (in micro-g). Void regions accentuate canister hot spots and temperature gradients due to their large thermal resistance. Free convection reduces the extent of PCM superheating and lowers canister temperatures during a portion of the PCM thermal charge period. Surprisingly small differences in canister thermal performance result from operation on the ground and operation on-orbit. This lack of a strong gravity dependency is attributed to the large contribution of container walls in overall canister energy redistribution by conduction.

  9. Analog computing

    CERN Document Server

    Ulmann, Bernd

    2013-01-01

    This book is a comprehensive introduction to analog computing. As most textbooks about this powerful computing paradigm date back to the 1960s and 1970s, it fills a void and forges a bridge from the early days of analog computing to future applications. The idea of analog computing is not new. In fact, this computing paradigm is nearly forgotten, although it offers a path to both high-speed and low-power computing, which are in even more demand now than they were back in the heyday of electronic analog computers.

  10. Computational composites

    DEFF Research Database (Denmark)

    Vallgårda, Anna K. A.; Redström, Johan

    2007-01-01

    Computational composite is introduced as a new type of composite material. Arguing that this is not just a metaphorical maneuver, we provide an analysis of computational technology as material in design, which shows how computers share important characteristics with other materials used in design...... and architecture. We argue that the notion of computational composites provides a precise understanding of the computer as material, and of how computations need to be combined with other materials to come to expression as material. Besides working as an analysis of computers from a designer’s point of view......, the notion of computational composites may also provide a link for computer science and human-computer interaction to an increasingly rapid development and use of new materials in design and architecture....

  11. Quantum Computing

    OpenAIRE

    Scarani, Valerio

    1998-01-01

    The aim of this thesis was to explain what quantum computing is. The information for the thesis was gathered from books, scientific publications, and news articles. The analysis of the information revealed that quantum computing can be broken down to three areas: theories behind quantum computing explaining the structure of a quantum computer, known quantum algorithms, and the actual physical realizations of a quantum computer. The thesis reveals that moving from classical memor...

  12. Pressure sores among malnourished necropsied adults - preliminary data Escaras de decúbito em adultos necropsiados com subnutrição - dados preliminares

    Directory of Open Access Journals (Sweden)

    Daniel Ferreira da Cunha

    2000-06-01

    Full Text Available Pressure sores are common among bedridden, elderly, or malnourished patients, and may occur in terminal ill patients because of impaired mobility, fecal or urinary incontinence, and decreased healing capacity. The aim of this study was to compare frequency of pressure sores between malnourished and non-malnourished necropsied adults. METHOD: All (n = 201 adults (age ³ 18 years autopsied between 1986 and 1996 at the Teaching Hospital of Triangulo Mineiro Medical School (Uberaba were eligible for the study. Gender, race, weight, height and main diagnoses were recorded. Ninety-six cases were excluded because of probable body water retention (congestive heart failure, hepatic insufficiency, nephrotic syndrome or pressure sores secondary to peripheral vascular ischemia. Body mass index (BMI was used to define malnourished (BMI 18.5kg/m² groups. RESULTS: Except for weight (42.5kg; range: 28-57 vs. 60; 36-134.5kg and BMI (16.9; range: 12.4-18.5 vs. 22.7; range: 18.5-54.6kg/m², respectively, there were no statistical differences among 43 malnourished and 62 non-malnourished cases in relation to age (54.9 ± 20.4 vs. 52.9 ± 17.9 years, percentage of white persons (74.4 vs. 64.5%, male gender (76.7 vs. 69.3% and main diagnoses. Five malnourished (11.6% and 7 (11.5% non-malnourished cases had pressure sores (p=0.89. CONCLUSION: Pressure sores were equally common findings in necropsied persons with protein-energy malnutrition, as assessed by body mass index.Escaras de decúbito são comuns em pacientes acamados, idosos e subnutridos e podem ocorrer em pacientes terminais devido à imobilidade, incontinência fecal e urinária e imunodepressão. Além disso, a contaminação das Escaras de decúbito aumentam o risco de sepsis e podem piorar o estado nutricional. O objetivo deste estudo foi comparar a freqüência de Escaras de decúbito entre adultos necropsiados com ou sem subnutrição. MÉTODO: Adultos (n=201 necropsiados no Hospital Escola da FMTM

  13. The UK Human Genome Mapping Project online computing service.

    Science.gov (United States)

    Rysavy, F R; Bishop, M J; Gibbs, G P; Williams, G W

    1992-04-01

    This paper presents an overview of computing and networking facilities developed by the Medical Research Council to provide online computing support to the Human Genome Mapping Project (HGMP) in the UK. The facility is connected to a number of other computing facilities in various centres of genetics and molecular biology research excellence, either directly via high-speed links or through national and international wide-area networks. The paper describes the design and implementation of the current system, a 'client/server' network of Sun, IBM, DEC and Apple servers, gateways and workstations. A short outline of online computing services currently delivered by this system to the UK human genetics research community is also provided. More information about the services and their availability could be obtained by a direct approach to the UK HGMP-RC.

  14. Padrão facial na dentadura decídua: estudo epidemiológico Facial pattern in the deciduous dentition: epidemiologic study

    Directory of Open Access Journals (Sweden)

    Omar Gabriel da Silva Filho

    2008-08-01

    Full Text Available INTRODUÇÃO: é possível definir a morfologia facial e o padrão de crescimento em idade precoce, a partir da dentadura decídua completa. OBJETIVOS: frente à escassez de trabalhos na literatura pertinente ao assunto, a presente pesquisa explora o diagnóstico epidemiológico da face no estágio de dentadura decídua. METODOLOGIA: a amostra foi composta por 2.009 crianças de etnia brasileira, de ambos os gêneros, entre 3 e 6 anos de idade, no período de dentadura decídua completa, de 20 pré-escolas do município de Bauru/SP. RESULTADOS E CONCLUSÕES: baseando-se nos resultados obtidos no levantamento epidemiológico, foi encontrado - na análise em norma lateral - predomínio de crianças Padrão I (63,22% em relação ao Padrão II (33,10% e Padrão III (3,68%, não havendo diferenças estatisticamente significativas quanto ao gênero. Na análise em norma frontal, houve predomínio do tipo mesofacial (64,56% em relação ao dolicofacial (21,90% e braquifacial (13,54%, sendo que a proporção do tipo braquifacial nas meninas foi significativamente superior em relação aos meninos. Na distribuição dos tipos faciais frontais dentro dos padrões faciais sagitais ficou evidenciada uma manifestação mais freqüente do tipo dolicofacial dentro dos Padrões II e III, sendo encontrado dimorfismo quanto ao gênero, notadamente no Padrão I, onde houve maior manifestação do tipo braquifacial e menor manifestação do dolicofacial no gênero feminino.INTRODUCTION: It is possible to define the facial morphology and growth pattern in early ages, starting from mature deciduous dentition. AIM: Due to the lack of studies about this issue in the deciduous dentition, the current paper aims to present the epidemiologic diagnosis of the face in this stage of the occlusal development. METHODS: The sample was comprised of 2,009 Brazilian children aged between 3 and 6 years, all in the deciduous dentition, from 20 schools in Bauru/SP. RESULTS AND

  15. Portable, remotely operated, computer-controlled, quadrupole mass spectrometer for field use

    International Nuclear Information System (INIS)

    Friesen, R.D.; Newton, J.C.; Smith, C.F.

    1982-04-01

    A portable, remote-controlled mass spectrometer was required at the Nevada Test Site to analyze prompt post-event gas from the nuclear cavity in support of the underground testing program. A Balzers QMG-511 quadrupole was chosen for its ability to be interfaced to a DEC LSI-11 computer and to withstand the ground movement caused by this field environment. The inlet system valves, the pumps, the pressure and temperature transducers, and the quadrupole mass spectrometer are controlled by a read-only-memory-based DEC LSI-11/2 with a high-speed microwave link to the control point which is typically 30 miles away. The computer at the control point is a DEC LSI-11/23 running the RSX-11 operating system. The instrument was automated as much as possible because the system is run by inexperienced operators at times. The mass spectrometer has been used on an initial field event with excellent performance. The gas analysis system is described, including automation by a novel computer control method which reduces operator errors and allows dynamic access to the system parameters

  16. Integrated Advanced Microwave Sounding Unit-A (AMSU-A). Engineering Test Report: AMSU-A2 METSAT Instrument (S/N 108) Acceptance Level Vibration Tests of Dec 1999/Jan 2000 (S/O 784077, OC-454)

    Science.gov (United States)

    Heffner, R.

    2000-01-01

    This is the Engineering Test Report, AMSU-A2 METSAT Instrument (S/N 108) Acceptance Level Vibration Test of Dec 1999/Jan 2000 (S/O 784077, OC-454), for the Integrated Advanced Microwave Sounding Unit-A (AMSU-A).

  17. Three assembly programs for the PDP-8E computer

    International Nuclear Information System (INIS)

    McIlvaine, M.S.; Navarro, E.F.

    1976-04-01

    In the Atomic Research Center, efforts have been directed towards the utilization of the PDP-8E in the control of various operations, in the storage and retrieval of data and in the on-line and off-line analyses of experimental data. The purpose of this paper is to present three short programs in machine language, two of which were developed specifically to control the operation of the Cal Comp Plotter 565 (Cal Camp Plot data Program) and the TU10 DEC-magtape unit (TM8E Program with Options). The third program, the Maximum Liklihood Activity Profile, was utilized in the mathematical computation of a statistical study

  18. Computational Medicine

    DEFF Research Database (Denmark)

    Nygaard, Jens Vinge

    2017-01-01

    The Health Technology Program at Aarhus University applies computational biology to investigate the heterogeneity of tumours......The Health Technology Program at Aarhus University applies computational biology to investigate the heterogeneity of tumours...

  19. Grid Computing

    Indian Academy of Sciences (India)

    A computing grid interconnects resources such as high performancecomputers, scientific databases, and computercontrolledscientific instruments of cooperating organizationseach of which is autonomous. It precedes and is quitedifferent from cloud computing, which provides computingresources by vendors to customers ...

  20. Green Computing

    Directory of Open Access Journals (Sweden)

    K. Shalini

    2013-01-01

    Full Text Available Green computing is all about using computers in a smarter and eco-friendly way. It is the environmentally responsible use of computers and related resources which includes the implementation of energy-efficient central processing units, servers and peripherals as well as reduced resource consumption and proper disposal of electronic waste .Computers certainly make up a large part of many people lives and traditionally are extremely damaging to the environment. Manufacturers of computer and its parts have been espousing the green cause to help protect environment from computers and electronic waste in any way.Research continues into key areas such as making the use of computers as energy-efficient as Possible, and designing algorithms and systems for efficiency-related computer technologies.

  1. Quantum computers and quantum computations

    International Nuclear Information System (INIS)

    Valiev, Kamil' A

    2005-01-01

    This review outlines the principles of operation of quantum computers and their elements. The theory of ideal computers that do not interact with the environment and are immune to quantum decohering processes is presented. Decohering processes in quantum computers are investigated. The review considers methods for correcting quantum computing errors arising from the decoherence of the state of the quantum computer, as well as possible methods for the suppression of the decohering processes. A brief enumeration of proposed quantum computer realizations concludes the review. (reviews of topical problems)

  2. Quantum Computing for Computer Architects

    CERN Document Server

    Metodi, Tzvetan

    2011-01-01

    Quantum computers can (in theory) solve certain problems far faster than a classical computer running any known classical algorithm. While existing technologies for building quantum computers are in their infancy, it is not too early to consider their scalability and reliability in the context of the design of large-scale quantum computers. To architect such systems, one must understand what it takes to design and model a balanced, fault-tolerant quantum computer architecture. The goal of this lecture is to provide architectural abstractions for the design of a quantum computer and to explore

  3. Report by the AERES on the unit: Fuel Study Department (DEC) under the supervision of the establishments and bodies: Atomic Energy and Alternative Energies Commission (CEA)

    International Nuclear Information System (INIS)

    2011-03-01

    This report is a kind of audit report on a research laboratory, the DEC (Departement d'Etudes des Combustibles, Fuel Study Department) which comprises four departments: a department of analysis and characterization of fuel behaviour (SA3C) which comprises four laboratories, a Plutonium, Uranium and Minor Actinides department (SPUA) which comprises four laboratories, a department for the investigation and simulation of fuel behaviour (four laboratories) and the Leca-Star department (3 laboratories and a project group). The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications on different themes (fundamental research on fuels, fuel design, fabrications, characterizations and property measurements, experimental irradiations, characterization of irradiated fuels and chemical and radio-chemical analysis, modelling and simulation). A more detailed assessment is presented for each theme in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project

  4. Ionic conduction studies in Li3+ ion irradiated P(VDF-HFP)-(PC + DEC)-LiCF3SO3 gel polymer electrolyte

    International Nuclear Information System (INIS)

    Saikia, D.; Hussain, A.M.P.; Kumar, A.; Singh, F.; Avasthi, D.K.

    2006-01-01

    In an attempt to increase the Li ion diffusivity in gel polymer electrolytes, the effects of Li 3+ ion irradiation in P(VDF-HFP)-(PC + DEC)-LiCF 3 SO 3 electrolyte system, with five different fluences, is studied. Irradiation with swift heavy ions shows enhancement in conductivity at low fluences and decreased in conductivity at higher fluences with respect to pristine polymer electrolyte films. Maximum room temperature ionic conductivity after irradiation is found to be 2.6 x 10 -3 S/cm. This interesting result could be attributed to the fact that, higher fluence provides critical activation energy for cross-linking and crystallization to occur, which results in decrease in ionic conductivity. XRD results show decrease in the degree of crystallinity upon ion irradiation at low fluences (≤10 11 ions/cm 2 ) and increase in crystallinity at high fluences (>10 11 ions/cm 2 ). In FTIR spectra the absorption band intensities around 3025 cm -1 and 2985 cm -1 decrease upon irradiation with a fluence of 5 x 10 1 ions/cm 2 suggesting chain scission and increase upon irradiation with a fluence of 5 x 10 12 ions/cm 2 indicating cross-linking. FTIR analyses corroborate the conductivity and XRD results

  5. Delayed metamorphosis in decapod crustaceans: evidence and consequences Retraso de la metamorfosis en crustáceos decápodos: evidencias y consecuencias

    Directory of Open Access Journals (Sweden)

    PAULINA GEBAUER

    2003-06-01

    hormonally mediated effects on the moulting cycle, the quantification of energetic or other costs of delayed metamorphosis, and the analysis of relationships between the effectiveness of adult odors and phylogenetic proximity of larvae and adultsNumerosos invertebrados marinos tienen un ciclo de vida bifásico, el cual incluye una fase larval planctónica y una juvenil-adulta bentónica. La metamorfosis y asentamiento son los eslabones entre estas dos fases del desarrollo. La metamorfosis en muchas especies es gatillada por estímulos físicos y/o químicos, generalmente relacionados con el hábitat parental. Las larvas competentes, en ausencia de estos inductores, pueden retardar la metamorfosis desde algunos días hasta meses. La mayoría de las investigaciones sobre retraso de la metamorfosis han sido realizadas en especies sedentarias o sésiles. En crustáceos decápodos (móviles la cantidad de estudios relacionados con la inducción del asentamiento y metamorfosis por estímulos específicos y la capacidad de retraso de la metamorfosis es mucho menor, y se podría deber a que este grupo no pierde su capacidad de movimiento post-metamorfosis, por lo cual el hábitat de asentamiento y metamorfosis podría no ser tan crucial para este grupo como en las especies sésiles o sedentarias. Sin embargo, en algunas especies de crustáceos decápodos se ha reportado la importancia de la presencia de estímulos específicos para el asentamiento y metamorfosis y la flexibilidad en el momento de la metamorfosis en ausencia de tales estímulos. En general, los estímulos identificados que gatillan la metamorfosis son algunos tipos de substratos, la presencia de adultos conespecíficos o congenéricos. La capacidad de retraso de la metamorfosis en las especies de decápodos estudiadas es limitada y generalmente finaliza con una metamorfosis espontánea. La prolongación del tiempo de desarrollo presenta ventajas ya que aumenta la probabilidad de localizar un hábitat favorable y

  6. Pervasive Computing

    NARCIS (Netherlands)

    Silvis-Cividjian, N.

    This book provides a concise introduction to Pervasive Computing, otherwise known as Internet of Things (IoT) and Ubiquitous Computing (Ubicomp) which addresses the seamless integration of computing systems within everyday objects. By introducing the core topics and exploring assistive pervasive

  7. Computational vision

    CERN Document Server

    Wechsler, Harry

    1990-01-01

    The book is suitable for advanced courses in computer vision and image processing. In addition to providing an overall view of computational vision, it contains extensive material on topics that are not usually covered in computer vision texts (including parallel distributed processing and neural networks) and considers many real applications.

  8. Spatial Computation

    Science.gov (United States)

    2003-12-01

    Computation and today’s microprocessors with the approach to operating system architecture, and the controversy between microkernels and monolithic kernels...Both Spatial Computation and microkernels break away a relatively monolithic architecture into in- dividual lightweight pieces, well specialized...for their particular functionality. Spatial Computation removes global signals and control, in the same way microkernels remove the global address

  9. Parallel computations

    CERN Document Server

    1982-01-01

    Parallel Computations focuses on parallel computation, with emphasis on algorithms used in a variety of numerical and physical applications and for many different types of parallel computers. Topics covered range from vectorization of fast Fourier transforms (FFTs) and of the incomplete Cholesky conjugate gradient (ICCG) algorithm on the Cray-1 to calculation of table lookups and piecewise functions. Single tridiagonal linear systems and vectorized computation of reactive flow are also discussed.Comprised of 13 chapters, this volume begins by classifying parallel computers and describing techn

  10. Human Computation

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    What if people could play computer games and accomplish work without even realizing it? What if billions of people collaborated to solve important problems for humanity or generate training data for computers? My work aims at a general paradigm for doing exactly that: utilizing human processing power to solve computational problems in a distributed manner. In particular, I focus on harnessing human time and energy for addressing problems that computers cannot yet solve. Although computers have advanced dramatically in many respects over the last 50 years, they still do not possess the basic conceptual intelligence or perceptual capabilities...

  11. Quantum computation

    International Nuclear Information System (INIS)

    Deutsch, D.

    1992-01-01

    As computers become ever more complex, they inevitably become smaller. This leads to a need for components which are fabricated and operate on increasingly smaller size scales. Quantum theory is already taken into account in microelectronics design. This article explores how quantum theory will need to be incorporated into computers in future in order to give them their components functionality. Computation tasks which depend on quantum effects will become possible. Physicists may have to reconsider their perspective on computation in the light of understanding developed in connection with universal quantum computers. (UK)

  12. Computer software.

    Science.gov (United States)

    Rosenthal, L E

    1986-10-01

    Software is the component in a computer system that permits the hardware to perform the various functions that a computer system is capable of doing. The history of software and its development can be traced to the early nineteenth century. All computer systems are designed to utilize the "stored program concept" as first developed by Charles Babbage in the 1850s. The concept was lost until the mid-1940s, when modern computers made their appearance. Today, because of the complex and myriad tasks that a computer system can perform, there has been a differentiation of types of software. There is software designed to perform specific business applications. There is software that controls the overall operation of a computer system. And there is software that is designed to carry out specialized tasks. Regardless of types, software is the most critical component of any computer system. Without it, all one has is a collection of circuits, transistors, and silicone chips.

  13. Computer sciences

    Science.gov (United States)

    Smith, Paul H.

    1988-01-01

    The Computer Science Program provides advanced concepts, techniques, system architectures, algorithms, and software for both space and aeronautics information sciences and computer systems. The overall goal is to provide the technical foundation within NASA for the advancement of computing technology in aerospace applications. The research program is improving the state of knowledge of fundamental aerospace computing principles and advancing computing technology in space applications such as software engineering and information extraction from data collected by scientific instruments in space. The program includes the development of special algorithms and techniques to exploit the computing power provided by high performance parallel processors and special purpose architectures. Research is being conducted in the fundamentals of data base logic and improvement techniques for producing reliable computing systems.

  14. Computational strategies for three-dimensional flow simulations on distributed computer systems

    Science.gov (United States)

    Sankar, Lakshmi N.; Weed, Richard A.

    1995-08-01

    This research effort is directed towards an examination of issues involved in porting large computational fluid dynamics codes in use within the industry to a distributed computing environment. This effort addresses strategies for implementing the distributed computing in a device independent fashion and load balancing. A flow solver called TEAM presently in use at Lockheed Aeronautical Systems Company was acquired to start this effort. The following tasks were completed: (1) The TEAM code was ported to a number of distributed computing platforms including a cluster of HP workstations located in the School of Aerospace Engineering at Georgia Tech; a cluster of DEC Alpha Workstations in the Graphics visualization lab located at Georgia Tech; a cluster of SGI workstations located at NASA Ames Research Center; and an IBM SP-2 system located at NASA ARC. (2) A number of communication strategies were implemented. Specifically, the manager-worker strategy and the worker-worker strategy were tested. (3) A variety of load balancing strategies were investigated. Specifically, the static load balancing, task queue balancing and the Crutchfield algorithm were coded and evaluated. (4) The classical explicit Runge-Kutta scheme in the TEAM solver was replaced with an LU implicit scheme. And (5) the implicit TEAM-PVM solver was extensively validated through studies of unsteady transonic flow over an F-5 wing, undergoing combined bending and torsional motion. These investigations are documented in extensive detail in the dissertation, 'Computational Strategies for Three-Dimensional Flow Simulations on Distributed Computing Systems', enclosed as an appendix.

  15. Computational strategies for three-dimensional flow simulations on distributed computer systems

    Science.gov (United States)

    Sankar, Lakshmi N.; Weed, Richard A.

    1995-01-01

    This research effort is directed towards an examination of issues involved in porting large computational fluid dynamics codes in use within the industry to a distributed computing environment. This effort addresses strategies for implementing the distributed computing in a device independent fashion and load balancing. A flow solver called TEAM presently in use at Lockheed Aeronautical Systems Company was acquired to start this effort. The following tasks were completed: (1) The TEAM code was ported to a number of distributed computing platforms including a cluster of HP workstations located in the School of Aerospace Engineering at Georgia Tech; a cluster of DEC Alpha Workstations in the Graphics visualization lab located at Georgia Tech; a cluster of SGI workstations located at NASA Ames Research Center; and an IBM SP-2 system located at NASA ARC. (2) A number of communication strategies were implemented. Specifically, the manager-worker strategy and the worker-worker strategy were tested. (3) A variety of load balancing strategies were investigated. Specifically, the static load balancing, task queue balancing and the Crutchfield algorithm were coded and evaluated. (4) The classical explicit Runge-Kutta scheme in the TEAM solver was replaced with an LU implicit scheme. And (5) the implicit TEAM-PVM solver was extensively validated through studies of unsteady transonic flow over an F-5 wing, undergoing combined bending and torsional motion. These investigations are documented in extensive detail in the dissertation, 'Computational Strategies for Three-Dimensional Flow Simulations on Distributed Computing Systems', enclosed as an appendix.

  16. Prof Anyanwu 2009 dec edition...

    African Journals Online (AJOL)

    User

    Sometimes presents with symptoms similar to those of postdural puncture headache, and can therefore be easily misdiagnosed, especially in a parturient that has undergone spinal anaesthesia. This is particularly significant because of the difference in the management between both conditions. Whereas the former might.

  17. JMBR Journal - dec 2012 - gan...

    African Journals Online (AJOL)

    Mrs Musa

    Benin City, Edo State, Nigeria. It provides specialist medical services, including ophthalmic services. ... Benin Teaching Hospital, Benin City, Nigeria - A Preliminary Report.....45 about where to get eye care services, patient For the .... rate, and with good surgical outcome will. 1. Patel D, Baker H, Murdoch I. Barriers to uptake.

  18. JOS JOURNAL JULY - DEC 2011

    African Journals Online (AJOL)

    Keywords:prostate cancer, prognostic factors, tumour makers, biological markers. ... treatment outcome and survival, the concept of .... Race is a well known risk factor for developing prostate cancer. However this disease also behaves differently in men of different races. Whether this is due to patient related factors or to ...

  19. JOS JOURNAL JULY - DEC 2011

    African Journals Online (AJOL)

    Background: Hepatitis C virus (HCV) and human immunodeficiency virus (HIV) infections are major health problems worldwide. HCV/HIV ... severe fibrosis, a higher frequency of cirrhosis, and. 9 increased deaths from liver disease . ... considered in stable HIV individuals with pergylated interferon combined with ribavarin.

  20. JMBR Journal - dec 2012 - gan...

    African Journals Online (AJOL)

    Mrs Musa

    and sepsis, avascular necrosis of the fermur, retinopathy and osteomylitis. Stroke is often recurrent and can lead to major functional deficit. Although from this study the incidence of dysmenorrhea amongst subjects with HbSS genotype was highest compared to subjects with HbAA and HbAS, none of the HbSS subjects with.

  1. JOS JOURNAL JULY - DEC 2011

    African Journals Online (AJOL)

    androgen receptor (AR) gene. Phyllodes tumours are usually solitary and unilateral. Rarely, multifocal phyllodes tumour has been detected in a single breast it is very rare in men. Malignant phyllodes occasionally occur following a previous fibroadenoma or on its own. It is characterized by rapidity of growth and common in.

  2. JOS JOURNAL JULY - DEC 2011

    African Journals Online (AJOL)

    (HNSCC) in Northern Nigeria and to review risk factors and prevention strategies. Methods:- ... Some other African countries show a relative high .... and is reported to contribute 75% in HNSCC. ... esteem; Family that is having parents who are ... and siblings, being critical element for programme ... adolescent smoking.

  3. JOS JOURNAL JULY - DEC 2011

    African Journals Online (AJOL)

    HIV Seroprevalence Among Surgical Specialty Outpatients at a Teaching Hospital. *Omole-Ohonsi A ... The risk of transmission of the infection from patients to health workers, and from mother to child is very high ... pre-test counseling is employed in the management .... to have to have more migrants among them, with.

  4. JMBR Journal - dec 2012 - gan...

    African Journals Online (AJOL)

    Mrs Musa

    %, while 71.6% of the patients were discharged to the ward. Introduction. Intensive care has been defined as a service for patients with potentially recoverable conditions who can benefit from more detailed observation and invasive treatment ...

  5. JOS JOURNAL JULY - DEC 2011

    African Journals Online (AJOL)

    women of reproductive age who presented with history of amenorrhea and lower abdominal pains could prove useful ... of cases that advance beyond 12 weeks of gestation. 1, 2, 3 .... assisted reproduction or difficulties during the ET. 1, 6, 7,9, ...

  6. Computer programming and computer systems

    CERN Document Server

    Hassitt, Anthony

    1966-01-01

    Computer Programming and Computer Systems imparts a "reading knowledge? of computer systems.This book describes the aspects of machine-language programming, monitor systems, computer hardware, and advanced programming that every thorough programmer should be acquainted with. This text discusses the automatic electronic digital computers, symbolic language, Reverse Polish Notation, and Fortran into assembly language. The routine for reading blocked tapes, dimension statements in subroutines, general-purpose input routine, and efficient use of memory are also elaborated.This publication is inten

  7. Organic Computing

    CERN Document Server

    Würtz, Rolf P

    2008-01-01

    Organic Computing is a research field emerging around the conviction that problems of organization in complex systems in computer science, telecommunications, neurobiology, molecular biology, ethology, and possibly even sociology can be tackled scientifically in a unified way. From the computer science point of view, the apparent ease in which living systems solve computationally difficult problems makes it inevitable to adopt strategies observed in nature for creating information processing machinery. In this book, the major ideas behind Organic Computing are delineated, together with a sparse sample of computational projects undertaken in this new field. Biological metaphors include evolution, neural networks, gene-regulatory networks, networks of brain modules, hormone system, insect swarms, and ant colonies. Applications are as diverse as system design, optimization, artificial growth, task allocation, clustering, routing, face recognition, and sign language understanding.

  8. Computational biomechanics

    International Nuclear Information System (INIS)

    Ethier, C.R.

    2004-01-01

    Computational biomechanics is a fast-growing field that integrates modern biological techniques and computer modelling to solve problems of medical and biological interest. Modelling of blood flow in the large arteries is the best-known application of computational biomechanics, but there are many others. Described here is work being carried out in the laboratory on the modelling of blood flow in the coronary arteries and on the transport of viral particles in the eye. (author)

  9. Ação antimicrobiana de pastas obturadoras usadas em dentes decíduos = Antimicrobial action of root canal filling pastes used in deciduous teeth

    Directory of Open Access Journals (Sweden)

    Vargas-Ferreira, Fabiana

    2010-01-01

    Full Text Available Objetivo: Este estudo avaliou a ação antimicrobiana de pastas, uma à base de iodofórmio conhecida por Pasta Guedes-Pinto (PGP e outra modificada pela adição de digluconato de clorexidina (CHX a 2% em substituição ao paramonoclorofenol canforado da formulação original da PGP. Metodologia: A ação antimicrobiana das duas pastas foi testada contra Staphylococcus aureus, Staphylococcus epidermidis, Streptococcus oralis, Enterococcus faecalis, Escherichia coli e Bacillus subtilis. O método empregado foi o de Diluição em Meio Sólido, Difusão em Ágar. Dezoito placas de Petri com 20 mL de BHIA foram inoculados com 0,1 mL das suspensões microbianas. Discos de papel foram imersos nas soluções experimentais por 1 min e colocados sobre a superfície de BHIA em cada placa. As placas foram mantidas em temperatura ambiente por 1 h e então incubadas a 37ºC por 48 h. O diâmetro da inibição microbiana foi medida ao redor dos discos de papel. Os dados foram pelo teste U de Mann-Whitney (a=0,05. Resultados: A PGP teve ação bacteriostática contra todos os microrganismos e também bactericida exceto para Enterococcus faecalis e Bacillus subtilis. A CHX apresentou ação bacteriostática e bactericida contra todos os microrganismos. Não houve diferença estatística significante quanto à efetividade antimicrobiana entre as pastas avaliadas. Conclusão: Ambas as pastas apresentaram ação antimicrobiana contra quase todos os microrganismos encontrados em infecções endodônticas de dentes decíduos

  10. Computational Composites

    DEFF Research Database (Denmark)

    Vallgårda, Anna K. A.

    to understand the computer as a material like any other material we would use for design, like wood, aluminum, or plastic. That as soon as the computer forms a composition with other materials it becomes just as approachable and inspiring as other smart materials. I present a series of investigations of what...... Computational Composite, and Telltale). Through the investigations, I show how the computer can be understood as a material and how it partakes in a new strand of materials whose expressions come to be in context. I uncover some of their essential material properties and potential expressions. I develop a way...

  11. GPGPU COMPUTING

    Directory of Open Access Journals (Sweden)

    BOGDAN OANCEA

    2012-05-01

    Full Text Available Since the first idea of using GPU to general purpose computing, things have evolved over the years and now there are several approaches to GPU programming. GPU computing practically began with the introduction of CUDA (Compute Unified Device Architecture by NVIDIA and Stream by AMD. These are APIs designed by the GPU vendors to be used together with the hardware that they provide. A new emerging standard, OpenCL (Open Computing Language tries to unify different GPU general computing API implementations and provides a framework for writing programs executed across heterogeneous platforms consisting of both CPUs and GPUs. OpenCL provides parallel computing using task-based and data-based parallelism. In this paper we will focus on the CUDA parallel computing architecture and programming model introduced by NVIDIA. We will present the benefits of the CUDA programming model. We will also compare the two main approaches, CUDA and AMD APP (STREAM and the new framwork, OpenCL that tries to unify the GPGPU computing models.

  12. Quantum Computing

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 9. Quantum Computing - Building Blocks of a Quantum Computer. C S Vijay Vishal Gupta. General Article Volume 5 Issue 9 September 2000 pp 69-81. Fulltext. Click here to view fulltext PDF. Permanent link:

  13. Platform computing

    CERN Multimedia

    2002-01-01

    "Platform Computing releases first grid-enabled workload management solution for IBM eServer Intel and UNIX high performance computing clusters. This Out-of-the-box solution maximizes the performance and capability of applications on IBM HPC clusters" (1/2 page) .

  14. Quantum Computing

    Indian Academy of Sciences (India)

    In the first part of this article, we had looked at how quantum physics can be harnessed to make the building blocks of a quantum computer. In this concluding part, we look at algorithms which can exploit the power of this computational device, and some practical difficulties in building such a device. Quantum Algorithms.

  15. Quantum computing

    OpenAIRE

    Burba, M.; Lapitskaya, T.

    2017-01-01

    This article gives an elementary introduction to quantum computing. It is a draft for a book chapter of the "Handbook of Nature-Inspired and Innovative Computing", Eds. A. Zomaya, G.J. Milburn, J. Dongarra, D. Bader, R. Brent, M. Eshaghian-Wilner, F. Seredynski (Springer, Berlin Heidelberg New York, 2006).

  16. Computational Pathology

    Science.gov (United States)

    Louis, David N.; Feldman, Michael; Carter, Alexis B.; Dighe, Anand S.; Pfeifer, John D.; Bry, Lynn; Almeida, Jonas S.; Saltz, Joel; Braun, Jonathan; Tomaszewski, John E.; Gilbertson, John R.; Sinard, John H.; Gerber, Georg K.; Galli, Stephen J.; Golden, Jeffrey A.; Becich, Michael J.

    2016-01-01

    Context We define the scope and needs within the new discipline of computational pathology, a discipline critical to the future of both the practice of pathology and, more broadly, medical practice in general. Objective To define the scope and needs of computational pathology. Data Sources A meeting was convened in Boston, Massachusetts, in July 2014 prior to the annual Association of Pathology Chairs meeting, and it was attended by a variety of pathologists, including individuals highly invested in pathology informatics as well as chairs of pathology departments. Conclusions The meeting made recommendations to promote computational pathology, including clearly defining the field and articulating its value propositions; asserting that the value propositions for health care systems must include means to incorporate robust computational approaches to implement data-driven methods that aid in guiding individual and population health care; leveraging computational pathology as a center for data interpretation in modern health care systems; stating that realizing the value proposition will require working with institutional administrations, other departments, and pathology colleagues; declaring that a robust pipeline should be fostered that trains and develops future computational pathologists, for those with both pathology and non-pathology backgrounds; and deciding that computational pathology should serve as a hub for data-related research in health care systems. The dissemination of these recommendations to pathology and bioinformatics departments should help facilitate the development of computational pathology. PMID:26098131

  17. Performance of scientific computing platforms with MCNP4B

    International Nuclear Information System (INIS)

    McLaughlin, H.E.; Hendricks, J.S.

    1998-01-01

    Several computing platforms were evaluated with the MCNP4B Monte Carlo radiation transport code. The DEC AlphaStation 500/500 was the fastest to run MCNP4B. Compared to the HP 9000-735, the fastest platform 4 yr ago, the AlphaStation is 335% faster, the HP C180 is 133% faster, the SGI Origin 2000 is 82% faster, the Cray T94/4128 is 1% faster, the IBM RS/6000-590 is 93% as fast, the DEC 3000/600 is 81% as fast, the Sun Sparc20 is 57% as fast, the Cray YMP 8/8128 is 57% as fast, the sun Sparc5 is 33% as fast, and the Sun Sparc2 is 13% as fast. All results presented are reproducible and allow for comparison to computer platforms not included in this study. Timing studies are seen to be very problem dependent. The performance gains resulting from advances in software were also investigated. Various compilers and operating systems were seen to have a modest impact on performance, whereas hardware improvements have resulted in a factor of 4 improvement. MCNP4B also ran approximately as fast as MCNP4A

  18. Homologous labelling of leukocytes with Tc 99m- dimeric ethylcysteinate (DEC): 'in vitro' and 'in vivo' tests; Marcacion leucocitaria homologa con Tc99m-Etilcisteinato dimero (ECD): pruebas 'in vitro' e 'in vivo'

    Energy Technology Data Exchange (ETDEWEB)

    Soroa, Victoria E [Hospital de Clinicas Jose de San Martin, Buenos Aires (Argentina). Centro de Medicina Nuclear; Ozker, K [Medical Coll. of Wisconsin, Milwaukee, WI (United States). Dept. of Radiology

    1999-07-01

    Preliminary tests have been carried out to validate the use of DEC -Tc 99m labelled leukocytes as a more stable substitute for Tc 99m-HMPAO in the diagnosis of infectious and inflammatory diseases. Although in all the patients the infectious focuses have been detected and the results are promissory, further studies with different infections /inflammations are needed to validate the procedure as an alternative routine technique.

  19. Cloud Computing

    DEFF Research Database (Denmark)

    Krogh, Simon

    2013-01-01

    with technological changes, the paradigmatic pendulum has swung between increased centralization on one side and a focus on distributed computing that pushes IT power out to end users on the other. With the introduction of outsourcing and cloud computing, centralization in large data centers is again dominating...... the IT scene. In line with the views presented by Nicolas Carr in 2003 (Carr, 2003), it is a popular assumption that cloud computing will be the next utility (like water, electricity and gas) (Buyya, Yeo, Venugopal, Broberg, & Brandic, 2009). However, this assumption disregards the fact that most IT production......), for instance, in establishing and maintaining trust between the involved parties (Sabherwal, 1999). So far, research in cloud computing has neglected this perspective and focused entirely on aspects relating to technology, economy, security and legal questions. While the core technologies of cloud computing (e...

  20. Computability theory

    CERN Document Server

    Weber, Rebecca

    2012-01-01

    What can we compute--even with unlimited resources? Is everything within reach? Or are computations necessarily drastically limited, not just in practice, but theoretically? These questions are at the heart of computability theory. The goal of this book is to give the reader a firm grounding in the fundamentals of computability theory and an overview of currently active areas of research, such as reverse mathematics and algorithmic randomness. Turing machines and partial recursive functions are explored in detail, and vital tools and concepts including coding, uniformity, and diagonalization are described explicitly. From there the material continues with universal machines, the halting problem, parametrization and the recursion theorem, and thence to computability for sets, enumerability, and Turing reduction and degrees. A few more advanced topics round out the book before the chapter on areas of research. The text is designed to be self-contained, with an entire chapter of preliminary material including re...

  1. An interactive, multitask computer system for heavy-ion physics research with the spin spectrometer: [Progress report, 1982

    International Nuclear Information System (INIS)

    Sarantites, D.G.

    1982-01-01

    The scope of this proposal is to assemble an interactive off-line data analysis system based on a DEC VAX 11/780 computer interfaced with an array processor, which is capable of meeting the needs of modern heavy-ion physics experiments involving data of large dimensionality as created in the Spin Spectrometer at the Holifield Heavy-ion Research Facility, to adapt the existing PDP 11 software for the Spin Spectrometer for this computer system in a form completely compatible with other laboratories with VAX 11 computers, and to develop new general and efficient software for automatic but fully interactive data analysis making use of an attach array processor

  2. Computational Streetscapes

    Directory of Open Access Journals (Sweden)

    Paul M. Torrens

    2016-09-01

    Full Text Available Streetscapes have presented a long-standing interest in many fields. Recently, there has been a resurgence of attention on streetscape issues, catalyzed in large part by computing. Because of computing, there is more understanding, vistas, data, and analysis of and on streetscape phenomena than ever before. This diversity of lenses trained on streetscapes permits us to address long-standing questions, such as how people use information while mobile, how interactions with people and things occur on streets, how we might safeguard crowds, how we can design services to assist pedestrians, and how we could better support special populations as they traverse cities. Amid each of these avenues of inquiry, computing is facilitating new ways of posing these questions, particularly by expanding the scope of what-if exploration that is possible. With assistance from computing, consideration of streetscapes now reaches across scales, from the neurological interactions that form among place cells in the brain up to informatics that afford real-time views of activity over whole urban spaces. For some streetscape phenomena, computing allows us to build realistic but synthetic facsimiles in computation, which can function as artificial laboratories for testing ideas. In this paper, I review the domain science for studying streetscapes from vantages in physics, urban studies, animation and the visual arts, psychology, biology, and behavioral geography. I also review the computational developments shaping streetscape science, with particular emphasis on modeling and simulation as informed by data acquisition and generation, data models, path-planning heuristics, artificial intelligence for navigation and way-finding, timing, synthetic vision, steering routines, kinematics, and geometrical treatment of collision detection and avoidance. I also discuss the implications that the advances in computing streetscapes might have on emerging developments in cyber

  3. COMPUTATIONAL THINKING

    Directory of Open Access Journals (Sweden)

    Evgeniy K. Khenner

    2016-01-01

    Full Text Available Abstract. The aim of the research is to draw attention of the educational community to the phenomenon of computational thinking which actively discussed in the last decade in the foreign scientific and educational literature, to substantiate of its importance, practical utility and the right on affirmation in Russian education.Methods. The research is based on the analysis of foreign studies of the phenomenon of computational thinking and the ways of its formation in the process of education; on comparing the notion of «computational thinking» with related concepts used in the Russian scientific and pedagogical literature.Results. The concept «computational thinking» is analyzed from the point of view of intuitive understanding and scientific and applied aspects. It is shown as computational thinking has evolved in the process of development of computers hardware and software. The practice-oriented interpretation of computational thinking which dominant among educators is described along with some ways of its formation. It is shown that computational thinking is a metasubject result of general education as well as its tool. From the point of view of the author, purposeful development of computational thinking should be one of the tasks of the Russian education.Scientific novelty. The author gives a theoretical justification of the role of computational thinking schemes as metasubject results of learning. The dynamics of the development of this concept is described. This process is connected with the evolution of computer and information technologies as well as increase of number of the tasks for effective solutions of which computational thinking is required. Author substantiated the affirmation that including «computational thinking » in the set of pedagogical concepts which are used in the national education system fills an existing gap.Practical significance. New metasubject result of education associated with

  4. Computer interfacing

    CERN Document Server

    Dixey, Graham

    1994-01-01

    This book explains how computers interact with the world around them and therefore how to make them a useful tool. Topics covered include descriptions of all the components that make up a computer, principles of data exchange, interaction with peripherals, serial communication, input devices, recording methods, computer-controlled motors, and printers.In an informative and straightforward manner, Graham Dixey describes how to turn what might seem an incomprehensible 'black box' PC into a powerful and enjoyable tool that can help you in all areas of your work and leisure. With plenty of handy

  5. Computational physics

    CERN Document Server

    Newman, Mark

    2013-01-01

    A complete introduction to the field of computational physics, with examples and exercises in the Python programming language. Computers play a central role in virtually every major physics discovery today, from astrophysics and particle physics to biophysics and condensed matter. This book explains the fundamentals of computational physics and describes in simple terms the techniques that every physicist should know, such as finite difference methods, numerical quadrature, and the fast Fourier transform. The book offers a complete introduction to the topic at the undergraduate level, and is also suitable for the advanced student or researcher who wants to learn the foundational elements of this important field.

  6. Computational physics

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1987-01-15

    Computers have for many years played a vital role in the acquisition and treatment of experimental data, but they have more recently taken up a much more extended role in physics research. The numerical and algebraic calculations now performed on modern computers make it possible to explore consequences of basic theories in a way which goes beyond the limits of both analytic insight and experimental investigation. This was brought out clearly at the Conference on Perspectives in Computational Physics, held at the International Centre for Theoretical Physics, Trieste, Italy, from 29-31 October.

  7. Cloud Computing

    CERN Document Server

    Baun, Christian; Nimis, Jens; Tai, Stefan

    2011-01-01

    Cloud computing is a buzz-word in today's information technology (IT) that nobody can escape. But what is really behind it? There are many interpretations of this term, but no standardized or even uniform definition. Instead, as a result of the multi-faceted viewpoints and the diverse interests expressed by the various stakeholders, cloud computing is perceived as a rather fuzzy concept. With this book, the authors deliver an overview of cloud computing architecture, services, and applications. Their aim is to bring readers up to date on this technology and thus to provide a common basis for d

  8. Computational Viscoelasticity

    CERN Document Server

    Marques, Severino P C

    2012-01-01

    This text is a guide how to solve problems in which viscoelasticity is present using existing commercial computational codes. The book gives information on codes’ structure and use, data preparation  and output interpretation and verification. The first part of the book introduces the reader to the subject, and to provide the models, equations and notation to be used in the computational applications. The second part shows the most important Computational techniques: Finite elements formulation, Boundary elements formulation, and presents the solutions of Viscoelastic problems with Abaqus.

  9. Optical computing.

    Science.gov (United States)

    Stroke, G. W.

    1972-01-01

    Applications of the optical computer include an approach for increasing the sharpness of images obtained from the most powerful electron microscopes and fingerprint/credit card identification. The information-handling capability of the various optical computing processes is very great. Modern synthetic-aperture radars scan upward of 100,000 resolvable elements per second. Fields which have assumed major importance on the basis of optical computing principles are optical image deblurring, coherent side-looking synthetic-aperture radar, and correlative pattern recognition. Some examples of the most dramatic image deblurring results are shown.

  10. Computational physics

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    Computers have for many years played a vital role in the acquisition and treatment of experimental data, but they have more recently taken up a much more extended role in physics research. The numerical and algebraic calculations now performed on modern computers make it possible to explore consequences of basic theories in a way which goes beyond the limits of both analytic insight and experimental investigation. This was brought out clearly at the Conference on Perspectives in Computational Physics, held at the International Centre for Theoretical Physics, Trieste, Italy, from 29-31 October

  11. Phenomenological Computation?

    DEFF Research Database (Denmark)

    Brier, Søren

    2014-01-01

    Open peer commentary on the article “Info-computational Constructivism and Cognition” by Gordana Dodig-Crnkovic. Upshot: The main problems with info-computationalism are: (1) Its basic concept of natural computing has neither been defined theoretically or implemented practically. (2. It cannot...... encompass human concepts of subjective experience and intersubjective meaningful communication, which prevents it from being genuinely transdisciplinary. (3) Philosophically, it does not sufficiently accept the deep ontological differences between various paradigms such as von Foerster’s second- order...

  12. Integrated Decentralized Training for Health Professions Education at the University of KwaZulu-Natal, South Africa: Protocol for the I-DecT Project

    Science.gov (United States)

    2018-01-01

    Background The Integrated Decentralized Training (i-DecT) project was created to address the current need for health care in South Africa among resource poor climates in rural and periurban settings. The University of KwaZulu-Natal (UKZN) in South Africa has embarked on a program within the School of Health Sciences (SHS) to decentralize the clinical learning platform in order to address this disparity. Framed in a pragmatic stance, this proposal is geared towards informing the roll out of decentralized clinical training (DCT) within the province of KwaZulu-Natal. There currently remains uncertainty as to how the implementation of this program will unfold, especially for the diverse SHS, which includes specialities like audiology, dentistry, occupational therapy, optometry, pharmacy, physiotherapy, speech-language pathology, and sport science. Consequently, there is a need to carefully monitor and manage this DCT in order to ensure that the participating students have a positive learning experience and achieve expected academic outcomes, and that the needs of the communities are addressed adequately. Objective The study aims to explore the factors that will influence the roll-out of the DCT by developing an inclusive and context-specific model that will adhere to the standards set by the SHS for the DCT program at UKZN. Methods Key role players, including but not limited to, the South African Ministry of Health policy makers, clinicians, policy makers at UKZN, clinical educators, academicians, and students of UKZN within the SHS will participate in this project. Once the infrastructural, staffing and pedagogical enablers and challenges are identified, together with a review of existing models of decentralized training, a context-specific model for DCTl will be proposed based on initial pilot data that will be tested within iterative cycles in an Action Learning Action Research (ALAR) process. Results The study was designed to fit within the existing structures, and

  13. Terminologia DeCS e as novas regras ortográficas da língua portuguesa: orientações para uma atualização DeCS terminology and the new rules on orthography of Portuguese language: guidelines for an update

    Directory of Open Access Journals (Sweden)

    Teresa Avalos Pereira

    2012-07-01

    Full Text Available OBJETIVO: Destacar as mudanças ortográficas a serem utilizadas como referencial básico por profissionais, pesquisadores, médicos, professores, alunos e usuários, que estão diretamente vinculados e exercendo atividades nos serviços de saúde em geral, visando à aplicação da ortografia correta na recuperação e produção de seus trabalhos científicos. MÉTODOS: Para a coleta dos dados, foram mostrados alguns exemplos de termos DeCS (Descritores em Ciências da Saúde, analisados conforme a ortografia vigente e comparados com o Vocabulário Ortográfico da Língua Portuguesa (VOLP. RESULTADOS: Foram selecionados e listados exemplos de descritores e/ou termos relacionados às Ciências da Saúde, os quais foram comparados com as respectivas regras do Acordo Ortográfico da Língua Portuguesa e divididos em três itens: acentuação gráfica, o não uso do trema e suas exceções e o uso ou não do hífen. CONCLUSÃO: Este estudo indica algumas diretrizes para as alterações dos descritores de acordo com a Nova Ortografia da Língua Portuguesa, contribuindo para a eficiência na descrição dos conteúdos dos documentos e na sua recuperação.PURPOSE: To indicate orthographic changes to be used as a basic reference for professionals, researchers, doctors, teachers, students and users, which are directly linked and performing activities in health services in general, aimed at implementing the correct orthography in recovery and production of their scientific studies. METHODS: For data collection, were shown some examples of terminology DeCS (Descriptors in Health Science analyzed according to the current spelling and compared with the Orthographic Vocabulary of Portuguese Language (VOLP. RESULTS: It was select and listed examples of key words and/or terms related to Health Sciences, which was compared to the respective rules of the Orthographic Agreement of Portuguese Language, and divided into three items: graphical accentuation, the

  14. Essentials of cloud computing

    CERN Document Server

    Chandrasekaran, K

    2014-01-01

    ForewordPrefaceComputing ParadigmsLearning ObjectivesPreambleHigh-Performance ComputingParallel ComputingDistributed ComputingCluster ComputingGrid ComputingCloud ComputingBiocomputingMobile ComputingQuantum ComputingOptical ComputingNanocomputingNetwork ComputingSummaryReview PointsReview QuestionsFurther ReadingCloud Computing FundamentalsLearning ObjectivesPreambleMotivation for Cloud ComputingThe Need for Cloud ComputingDefining Cloud ComputingNIST Definition of Cloud ComputingCloud Computing Is a ServiceCloud Computing Is a Platform5-4-3 Principles of Cloud computingFive Essential Charact

  15. Personal Computers.

    Science.gov (United States)

    Toong, Hoo-min D.; Gupta, Amar

    1982-01-01

    Describes the hardware, software, applications, and current proliferation of personal computers (microcomputers). Includes discussions of microprocessors, memory, output (including printers), application programs, the microcomputer industry, and major microcomputer manufacturers (Apple, Radio Shack, Commodore, and IBM). (JN)

  16. Computational Literacy

    DEFF Research Database (Denmark)

    Chongtay, Rocio; Robering, Klaus

    2016-01-01

    In recent years, there has been a growing interest in and recognition of the importance of Computational Literacy, a skill generally considered to be necessary for success in the 21st century. While much research has concentrated on requirements, tools, and teaching methodologies for the acquisit......In recent years, there has been a growing interest in and recognition of the importance of Computational Literacy, a skill generally considered to be necessary for success in the 21st century. While much research has concentrated on requirements, tools, and teaching methodologies...... for the acquisition of Computational Literacy at basic educational levels, focus on higher levels of education has been much less prominent. The present paper considers the case of courses for higher education programs within the Humanities. A model is proposed which conceives of Computational Literacy as a layered...

  17. Computing Religion

    DEFF Research Database (Denmark)

    Nielbo, Kristoffer Laigaard; Braxton, Donald M.; Upal, Afzal

    2012-01-01

    The computational approach has become an invaluable tool in many fields that are directly relevant to research in religious phenomena. Yet the use of computational tools is almost absent in the study of religion. Given that religion is a cluster of interrelated phenomena and that research...... concerning these phenomena should strive for multilevel analysis, this article argues that the computational approach offers new methodological and theoretical opportunities to the study of religion. We argue that the computational approach offers 1.) an intermediary step between any theoretical construct...... and its targeted empirical space and 2.) a new kind of data which allows the researcher to observe abstract constructs, estimate likely outcomes, and optimize empirical designs. Because sophisticated mulitilevel research is a collaborative project we also seek to introduce to scholars of religion some...

  18. Computational Controversy

    NARCIS (Netherlands)

    Timmermans, Benjamin; Kuhn, Tobias; Beelen, Kaspar; Aroyo, Lora

    2017-01-01

    Climate change, vaccination, abortion, Trump: Many topics are surrounded by fierce controversies. The nature of such heated debates and their elements have been studied extensively in the social science literature. More recently, various computational approaches to controversy analysis have

  19. Grid Computing

    Indian Academy of Sciences (India)

    IAS Admin

    emergence of supercomputers led to the use of computer simula- tion as an .... Scientific and engineering applications (e.g., Tera grid secure gate way). Collaborative ... Encryption, privacy, protection from malicious software. Physical Layer.

  20. Computer tomographs

    International Nuclear Information System (INIS)

    Niedzwiedzki, M.

    1982-01-01

    Physical foundations and the developments in the transmission and emission computer tomography are presented. On the basis of the available literature and private communications a comparison is made of the various transmission tomographs. A new technique of computer emission tomography ECT, unknown in Poland, is described. The evaluation of two methods of ECT, namely those of positron and single photon emission tomography is made. (author)

  1. Computational sustainability

    CERN Document Server

    Kersting, Kristian; Morik, Katharina

    2016-01-01

    The book at hand gives an overview of the state of the art research in Computational Sustainability as well as case studies of different application scenarios. This covers topics such as renewable energy supply, energy storage and e-mobility, efficiency in data centers and networks, sustainable food and water supply, sustainable health, industrial production and quality, etc. The book describes computational methods and possible application scenarios.

  2. Computing farms

    International Nuclear Information System (INIS)

    Yeh, G.P.

    2000-01-01

    High-energy physics, nuclear physics, space sciences, and many other fields have large challenges in computing. In recent years, PCs have achieved performance comparable to the high-end UNIX workstations, at a small fraction of the price. We review the development and broad applications of commodity PCs as the solution to CPU needs, and look forward to the important and exciting future of large-scale PC computing

  3. Computational chemistry

    Science.gov (United States)

    Arnold, J. O.

    1987-01-01

    With the advent of supercomputers, modern computational chemistry algorithms and codes, a powerful tool was created to help fill NASA's continuing need for information on the properties of matter in hostile or unusual environments. Computational resources provided under the National Aerodynamics Simulator (NAS) program were a cornerstone for recent advancements in this field. Properties of gases, materials, and their interactions can be determined from solutions of the governing equations. In the case of gases, for example, radiative transition probabilites per particle, bond-dissociation energies, and rates of simple chemical reactions can be determined computationally as reliably as from experiment. The data are proving to be quite valuable in providing inputs to real-gas flow simulation codes used to compute aerothermodynamic loads on NASA's aeroassist orbital transfer vehicles and a host of problems related to the National Aerospace Plane Program. Although more approximate, similar solutions can be obtained for ensembles of atoms simulating small particles of materials with and without the presence of gases. Computational chemistry has application in studying catalysis, properties of polymers, all of interest to various NASA missions, including those previously mentioned. In addition to discussing these applications of computational chemistry within NASA, the governing equations and the need for supercomputers for their solution is outlined.

  4. Improved materials management through client/server computing

    International Nuclear Information System (INIS)

    Brooks, D.; Neilsen, E.; Reagan, R.; Simmons, D.

    1992-01-01

    This paper reports that materials management and procurement impacts every organization within an electric utility from power generation to customer service. An efficient material management and procurement system can help improve productivity and minimize operating costs. It is no longer sufficient to simply automate materials management using inventory control systems. Smart companies are building centralized data warehouses and use the client/server style of computing to provide real time data access. This paper describes how Alabama Power Company, Southern Company Services and Digital Equipment Corporation transformed two existing applications, a purchase order application within DEC's ALL-IN-1 environment and a materials management application within an IBM CICS environment, into a data warehouse - client/server application. An application server is used to overcome incompatibilities between computing environments and provide easy, real-time access to information residing in multi-vendor environments

  5. Report by the AERES on the unit: Fuel Study Department (DEC) under the supervision of the establishments and bodies: Atomic Energy and Alternative Energies Commission (CEA); Rapport de l'AERES sur l'unite: Departement d'Etudes des Combustibles (DEC) sous tutelle des etablissements et organismes: Commissariat a l'Energie Atomique et aux Energies Alternatives (CEA)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-03-15

    This report is a kind of audit report on a research laboratory, the DEC (Departement d'Etudes des Combustibles, Fuel Study Department) which comprises four departments: a department of analysis and characterization of fuel behaviour (SA3C) which comprises four laboratories, a Plutonium, Uranium and Minor Actinides department (SPUA) which comprises four laboratories, a department for the investigation and simulation of fuel behaviour (four laboratories) and the Leca-Star department (3 laboratories and a project group). The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications on different themes (fundamental research on fuels, fuel design, fabrications, characterizations and property measurements, experimental irradiations, characterization of irradiated fuels and chemical and radio-chemical analysis, modelling and simulation). A more detailed assessment is presented for each theme in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project

  6. Computational creativity

    Directory of Open Access Journals (Sweden)

    López de Mántaras Badia, Ramon

    2013-12-01

    Full Text Available New technologies, and in particular artificial intelligence, are drastically changing the nature of creative processes. Computers are playing very significant roles in creative activities such as music, architecture, fine arts, and science. Indeed, the computer is already a canvas, a brush, a musical instrument, and so on. However, we believe that we must aim at more ambitious relations between computers and creativity. Rather than just seeing the computer as a tool to help human creators, we could see it as a creative entity in its own right. This view has triggered a new subfield of Artificial Intelligence called Computational Creativity. This article addresses the question of the possibility of achieving computational creativity through some examples of computer programs capable of replicating some aspects of creative behavior in the fields of music and science.Las nuevas tecnologías y en particular la Inteligencia Artificial están cambiando de forma importante la naturaleza del proceso creativo. Los ordenadores están jugando un papel muy significativo en actividades artísticas tales como la música, la arquitectura, las bellas artes y la ciencia. Efectivamente, el ordenador ya es el lienzo, el pincel, el instrumento musical, etc. Sin embargo creemos que debemos aspirar a relaciones más ambiciosas entre los ordenadores y la creatividad. En lugar de verlos solamente como herramientas de ayuda a la creación, los ordenadores podrían ser considerados agentes creativos. Este punto de vista ha dado lugar a un nuevo subcampo de la Inteligencia Artificial denominado Creatividad Computacional. En este artículo abordamos la cuestión de la posibilidad de alcanzar dicha creatividad computacional mediante algunos ejemplos de programas de ordenador capaces de replicar algunos aspectos relacionados con el comportamiento creativo en los ámbitos de la música y la ciencia.

  7. Quantum computing

    International Nuclear Information System (INIS)

    Steane, Andrew

    1998-01-01

    The subject of quantum computing brings together ideas from classical information theory, computer science, and quantum physics. This review aims to summarize not just quantum computing, but the whole subject of quantum information theory. Information can be identified as the most general thing which must propagate from a cause to an effect. It therefore has a fundamentally important role in the science of physics. However, the mathematical treatment of information, especially information processing, is quite recent, dating from the mid-20th century. This has meant that the full significance of information as a basic concept in physics is only now being discovered. This is especially true in quantum mechanics. The theory of quantum information and computing puts this significance on a firm footing, and has led to some profound and exciting new insights into the natural world. Among these are the use of quantum states to permit the secure transmission of classical information (quantum cryptography), the use of quantum entanglement to permit reliable transmission of quantum states (teleportation), the possibility of preserving quantum coherence in the presence of irreversible noise processes (quantum error correction), and the use of controlled quantum evolution for efficient computation (quantum computation). The common theme of all these insights is the use of quantum entanglement as a computational resource. It turns out that information theory and quantum mechanics fit together very well. In order to explain their relationship, this review begins with an introduction to classical information theory and computer science, including Shannon's theorem, error correcting codes, Turing machines and computational complexity. The principles of quantum mechanics are then outlined, and the Einstein, Podolsky and Rosen (EPR) experiment described. The EPR-Bell correlations, and quantum entanglement in general, form the essential new ingredient which distinguishes quantum from

  8. Quantum computing

    Energy Technology Data Exchange (ETDEWEB)

    Steane, Andrew [Department of Atomic and Laser Physics, University of Oxford, Clarendon Laboratory, Oxford (United Kingdom)

    1998-02-01

    The subject of quantum computing brings together ideas from classical information theory, computer science, and quantum physics. This review aims to summarize not just quantum computing, but the whole subject of quantum information theory. Information can be identified as the most general thing which must propagate from a cause to an effect. It therefore has a fundamentally important role in the science of physics. However, the mathematical treatment of information, especially information processing, is quite recent, dating from the mid-20th century. This has meant that the full significance of information as a basic concept in physics is only now being discovered. This is especially true in quantum mechanics. The theory of quantum information and computing puts this significance on a firm footing, and has led to some profound and exciting new insights into the natural world. Among these are the use of quantum states to permit the secure transmission of classical information (quantum cryptography), the use of quantum entanglement to permit reliable transmission of quantum states (teleportation), the possibility of preserving quantum coherence in the presence of irreversible noise processes (quantum error correction), and the use of controlled quantum evolution for efficient computation (quantum computation). The common theme of all these insights is the use of quantum entanglement as a computational resource. It turns out that information theory and quantum mechanics fit together very well. In order to explain their relationship, this review begins with an introduction to classical information theory and computer science, including Shannon's theorem, error correcting codes, Turing machines and computational complexity. The principles of quantum mechanics are then outlined, and the Einstein, Podolsky and Rosen (EPR) experiment described. The EPR-Bell correlations, and quantum entanglement in general, form the essential new ingredient which distinguishes quantum from

  9. Multiparty Computations

    DEFF Research Database (Denmark)

    Dziembowski, Stefan

    here and discuss other problems caused by the adaptiveness. All protocols in the thesis are formally specified and the proofs of their security are given. [1]Ronald Cramer, Ivan Damgård, Stefan Dziembowski, Martin Hirt, and Tal Rabin. Efficient multiparty computations with dishonest minority......In this thesis we study a problem of doing Verifiable Secret Sharing (VSS) and Multiparty Computations in a model where private channels between the players and a broadcast channel is available. The adversary is active, adaptive and has an unbounded computing power. The thesis is based on two...... to a polynomial time black-box reduction, the complexity of adaptively secure VSS is the same as that of ordinary secret sharing (SS), where security is only required against a passive, static adversary. Previously, such a connection was only known for linear secret sharing and VSS schemes. We then show...

  10. Scientific computing

    CERN Document Server

    Trangenstein, John A

    2017-01-01

    This is the third of three volumes providing a comprehensive presentation of the fundamentals of scientific computing. This volume discusses topics that depend more on calculus than linear algebra, in order to prepare the reader for solving differential equations. This book and its companions show how to determine the quality of computational results, and how to measure the relative efficiency of competing methods. Readers learn how to determine the maximum attainable accuracy of algorithms, and how to select the best method for computing problems. This book also discusses programming in several languages, including C++, Fortran and MATLAB. There are 90 examples, 200 exercises, 36 algorithms, 40 interactive JavaScript programs, 91 references to software programs and 1 case study. Topics are introduced with goals, literature references and links to public software. There are descriptions of the current algorithms in GSLIB and MATLAB. This book could be used for a second course in numerical methods, for either ...

  11. Computational Psychiatry

    Science.gov (United States)

    Wang, Xiao-Jing; Krystal, John H.

    2014-01-01

    Psychiatric disorders such as autism and schizophrenia arise from abnormalities in brain systems that underlie cognitive, emotional and social functions. The brain is enormously complex and its abundant feedback loops on multiple scales preclude intuitive explication of circuit functions. In close interplay with experiments, theory and computational modeling are essential for understanding how, precisely, neural circuits generate flexible behaviors and their impairments give rise to psychiatric symptoms. This Perspective highlights recent progress in applying computational neuroscience to the study of mental disorders. We outline basic approaches, including identification of core deficits that cut across disease categories, biologically-realistic modeling bridging cellular and synaptic mechanisms with behavior, model-aided diagnosis. The need for new research strategies in psychiatry is urgent. Computational psychiatry potentially provides powerful tools for elucidating pathophysiology that may inform both diagnosis and treatment. To achieve this promise will require investment in cross-disciplinary training and research in this nascent field. PMID:25442941

  12. Computational artifacts

    DEFF Research Database (Denmark)

    Schmidt, Kjeld; Bansler, Jørgen P.

    2016-01-01

    The key concern of CSCW research is that of understanding computing technologies in the social context of their use, that is, as integral features of our practices and our lives, and to think of their design and implementation under that perspective. However, the question of the nature...... of that which is actually integrated in our practices is often discussed in confusing ways, if at all. The article aims to try to clarify the issue and in doing so revisits and reconsiders the notion of ‘computational artifact’....

  13. Computer security

    CERN Document Server

    Gollmann, Dieter

    2011-01-01

    A completely up-to-date resource on computer security Assuming no previous experience in the field of computer security, this must-have book walks you through the many essential aspects of this vast topic, from the newest advances in software and technology to the most recent information on Web applications security. This new edition includes sections on Windows NT, CORBA, and Java and discusses cross-site scripting and JavaScript hacking as well as SQL injection. Serving as a helpful introduction, this self-study guide is a wonderful starting point for examining the variety of competing sec

  14. Cloud Computing

    CERN Document Server

    Antonopoulos, Nick

    2010-01-01

    Cloud computing has recently emerged as a subject of substantial industrial and academic interest, though its meaning and scope is hotly debated. For some researchers, clouds are a natural evolution towards the full commercialisation of grid systems, while others dismiss the term as a mere re-branding of existing pay-per-use technologies. From either perspective, 'cloud' is now the label of choice for accountable pay-per-use access to third party applications and computational resources on a massive scale. Clouds support patterns of less predictable resource use for applications and services a

  15. Computational Logistics

    DEFF Research Database (Denmark)

    Pacino, Dario; Voss, Stefan; Jensen, Rune Møller

    2013-01-01

    This book constitutes the refereed proceedings of the 4th International Conference on Computational Logistics, ICCL 2013, held in Copenhagen, Denmark, in September 2013. The 19 papers presented in this volume were carefully reviewed and selected for inclusion in the book. They are organized in to...... in topical sections named: maritime shipping, road transport, vehicle routing problems, aviation applications, and logistics and supply chain management.......This book constitutes the refereed proceedings of the 4th International Conference on Computational Logistics, ICCL 2013, held in Copenhagen, Denmark, in September 2013. The 19 papers presented in this volume were carefully reviewed and selected for inclusion in the book. They are organized...

  16. Computational Logistics

    DEFF Research Database (Denmark)

    This book constitutes the refereed proceedings of the 4th International Conference on Computational Logistics, ICCL 2013, held in Copenhagen, Denmark, in September 2013. The 19 papers presented in this volume were carefully reviewed and selected for inclusion in the book. They are organized in to...... in topical sections named: maritime shipping, road transport, vehicle routing problems, aviation applications, and logistics and supply chain management.......This book constitutes the refereed proceedings of the 4th International Conference on Computational Logistics, ICCL 2013, held in Copenhagen, Denmark, in September 2013. The 19 papers presented in this volume were carefully reviewed and selected for inclusion in the book. They are organized...

  17. Computational engineering

    CERN Document Server

    2014-01-01

    The book presents state-of-the-art works in computational engineering. Focus is on mathematical modeling, numerical simulation, experimental validation and visualization in engineering sciences. In particular, the following topics are presented: constitutive models and their implementation into finite element codes, numerical models in nonlinear elasto-dynamics including seismic excitations, multiphase models in structural engineering and multiscale models of materials systems, sensitivity and reliability analysis of engineering structures, the application of scientific computing in urban water management and hydraulic engineering, and the application of genetic algorithms for the registration of laser scanner point clouds.

  18. Computer busses

    CERN Document Server

    Buchanan, William

    2000-01-01

    As more and more equipment is interface or'bus' driven, either by the use of controllers or directly from PCs, the question of which bus to use is becoming increasingly important both in industry and in the office. 'Computer Busses' has been designed to help choose the best type of bus for the particular application.There are several books which cover individual busses, but none which provide a complete guide to computer busses. The author provides a basic theory of busses and draws examples and applications from real bus case studies. Busses are analysed using from a top-down approach, helpin

  19. Reconfigurable Computing

    CERN Document Server

    Cardoso, Joao MP

    2011-01-01

    As the complexity of modern embedded systems increases, it becomes less practical to design monolithic processing platforms. As a result, reconfigurable computing is being adopted widely for more flexible design. Reconfigurable Computers offer the spatial parallelism and fine-grained customizability of application-specific circuits with the postfabrication programmability of software. To make the most of this unique combination of performance and flexibility, designers need to be aware of both hardware and software issues. FPGA users must think not only about the gates needed to perform a comp

  20. Riemannian computing in computer vision

    CERN Document Server

    Srivastava, Anuj

    2016-01-01

    This book presents a comprehensive treatise on Riemannian geometric computations and related statistical inferences in several computer vision problems. This edited volume includes chapter contributions from leading figures in the field of computer vision who are applying Riemannian geometric approaches in problems such as face recognition, activity recognition, object detection, biomedical image analysis, and structure-from-motion. Some of the mathematical entities that necessitate a geometric analysis include rotation matrices (e.g. in modeling camera motion), stick figures (e.g. for activity recognition), subspace comparisons (e.g. in face recognition), symmetric positive-definite matrices (e.g. in diffusion tensor imaging), and function-spaces (e.g. in studying shapes of closed contours).   ·         Illustrates Riemannian computing theory on applications in computer vision, machine learning, and robotics ·         Emphasis on algorithmic advances that will allow re-application in other...

  1. Statistical Computing

    Indian Academy of Sciences (India)

    inference and finite population sampling. Sudhakar Kunte. Elements of statistical computing are discussed in this series. ... which captain gets an option to decide whether to field first or bat first ... may of course not be fair, in the sense that the team which wins ... describe two methods of drawing a random number between 0.

  2. Computational biology

    DEFF Research Database (Denmark)

    Hartmann, Lars Røeboe; Jones, Neil; Simonsen, Jakob Grue

    2011-01-01

    Computation via biological devices has been the subject of close scrutiny since von Neumann’s early work some 60 years ago. In spite of the many relevant works in this field, the notion of programming biological devices seems to be, at best, ill-defined. While many devices are claimed or proved t...

  3. Computing News

    CERN Multimedia

    McCubbin, N

    2001-01-01

    We are still five years from the first LHC data, so we have plenty of time to get the computing into shape, don't we? Well, yes and no: there is time, but there's an awful lot to do! The recently-completed CERN Review of LHC Computing gives the flavour of the LHC computing challenge. The hardware scale for each of the LHC experiments is millions of 'SpecInt95' (SI95) units of cpu power and tens of PetaBytes of data storage. PCs today are about 20-30SI95, and expected to be about 100 SI95 by 2005, so it's a lot of PCs. This hardware will be distributed across several 'Regional Centres' of various sizes, connected by high-speed networks. How to realise this in an orderly and timely fashion is now being discussed in earnest by CERN, Funding Agencies, and the LHC experiments. Mixed in with this is, of course, the GRID concept...but that's a topic for another day! Of course hardware, networks and the GRID constitute just one part of the computing. Most of the ATLAS effort is spent on software development. What we ...

  4. Quantum Computation

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 9. Quantum Computation - Particle and Wave Aspects of Algorithms. Apoorva Patel. General Article Volume 16 Issue 9 September 2011 pp 821-835. Fulltext. Click here to view fulltext PDF. Permanent link:

  5. Cloud computing.

    Science.gov (United States)

    Wink, Diane M

    2012-01-01

    In this bimonthly series, the author examines how nurse educators can use Internet and Web-based technologies such as search, communication, and collaborative writing tools; social networking and social bookmarking sites; virtual worlds; and Web-based teaching and learning programs. This article describes how cloud computing can be used in nursing education.

  6. Computer Recreations.

    Science.gov (United States)

    Dewdney, A. K.

    1988-01-01

    Describes the creation of the computer program "BOUNCE," designed to simulate a weighted piston coming into equilibrium with a cloud of bouncing balls. The model follows the ideal gas law. Utilizes the critical event technique to create the model. Discusses another program, "BOOM," which simulates a chain reaction. (CW)

  7. [Grid computing

    CERN Multimedia

    Wolinsky, H

    2003-01-01

    "Turn on a water spigot, and it's like tapping a bottomless barrel of water. Ditto for electricity: Flip the switch, and the supply is endless. But computing is another matter. Even with the Internet revolution enabling us to connect in new ways, we are still limited to self-contained systems running locally stored software, limited by corporate, institutional and geographic boundaries" (1 page).

  8. Computational Finance

    DEFF Research Database (Denmark)

    Rasmussen, Lykke

    One of the major challenges in todays post-crisis finance environment is calculating the sensitivities of complex products for hedging and risk management. Historically, these derivatives have been determined using bump-and-revalue, but due to the increasing magnitude of these computations does...

  9. Optical Computing

    Indian Academy of Sciences (India)

    Optical computing technology is, in general, developing in two directions. One approach is ... current support in many places, with private companies as well as governments in several countries encouraging such research work. For example, much ... which enables more information to be carried and data to be processed.

  10. Computed tomography of laryngeal carcinoma correlated with histopathological findings

    Energy Technology Data Exchange (ETDEWEB)

    Cai, Yi-Long

    1988-09-01

    Since the development of conservation laryngeal surgery and the advent of computed tomography (CT) scanners, a precise preoperative evaluation of the extent of laryngeal cancer has been of prime importance. Eight patients with known carcinoma of the larynx were examined with CT of the larynx prior to surgery, and whole-mount serial sections of the extirpated larynx were compared with the corresponding level of CT sections to evaluate the reliability of CT during my study abroad in Japan from Dec. 1985 through Dec. 1986. 1. The results indicated that CT scanning accurately delineates the anatomic location and pathologic extent of the tumor three-dimensionally in all cases examined. There is also good demonstration of the anterior commissure and preepiglottic, paraglottic and subglottic spaces which are sometimes poorly seen by laryngoscopy or by any other means. 2. Determination of invasion of the laryngeal cartilage by tumor proved to be very difficult to diagnose with CT. 3. The CT images obtained while the patient is breathing quietly, coupled with additional sections at the level of the vocal cord during slight valsalva maneuver afford good visualization of laryngeal tumors. 4. It should be emphasized that a thorough pathologic examination of extirpated specimens with serial sections is essential for laryngeal surgeons, because it is impossible to determine the patient's prognosis without microscopic demonstration of the degree of invasion.

  11. Computing and Network - Overview

    International Nuclear Information System (INIS)

    Jakubowski, Z.

    1999-01-01

    Full text: The responsibility of the Network Group covers: - providing central services like WWW, DNS (Domain Name Server), mail, etc.; - maintenance and support of the Local Area Networks,; - operation of the Wide Area Networks (LAN); - the support of the central UNIX servers and desktop workstations; - VAX/VMS cluster operation and support. The two-processor HP-UNIX K-200 and 6-processor SGI Challenge XL servers were delivering stable services to our users. Both servers were upgraded during the past year. SGI Challenge received additional 256 MB of memory. It was necessary in order to get all benefits of true 64-bit architecture of the SGI IRIX 6.2. The upgrade of our HP K-200 server were problematic so we decided to buy a new powerful machine and join the old and new machine via the fast network. Besides these main servers we have more than 30 workstations from IBM, DEC, HP, SGI and SUN. We observed a real race in PC technology in the past year. Intel processors deliver currently a performance that is comparable with HP or SUN workstations at very low costs. These CPU power is especially visible under Linux that is free Unix-like operating system. The clusters of cheap PC computers should be seriously considered in planning the computing power for the future experiments. The CPU power was further decentralized-smaller but powerful computers cover growing computing demands of our work-groups creating a small ''local computing centers''. The stable network and the concept of central services plays the essential role in this scenario. Unfortunately the network performance for the international communications is persistently unacceptable. We believe that attempts to join the European Quantum project is the only way to achieve the reasonable international network performance. In these plan polish scientific community will gain 34 Mbps international link. The growing costs of the ''real meetings'' give us no alternative to ''virtual meetings'' via the network in the

  12. Estudio comparativo de los Códecs de voz para comunicaciones de Voip utilizando teléfonos inteligentes - caso de estudio Universidad Católica de Cuenca sede Azogues

    OpenAIRE

    Ortega Ortega, Martín Educardo

    2015-01-01

    Este trabajo de investigación presenta un estudio comparativo de los códecs de voz para comunicaciones de VoIP en la Universidad Católica de Cuenca Sede Azogues, mediante la aplicación de diferentes escenarios reales de pruebas utilizando teléfonos móviles celulares inteligentes con cuentas SIP registradas en aplicaciones softphones y configuradas con la dirección IP interna del servidor de VoIP cuando la conexión sea a través de la red WLAN interna del campus universitario,...

  13. Avaliação in vitro da microinfiltração em cavidades classe II de molares decíduos, restaurados com resina composta auto e fotopolimerizável

    OpenAIRE

    CAVALCANTI Alessandro Leite; CHELOTTI Adolpho

    1999-01-01

    Estudou-se a microinfiltração marginal presente na interface da parede gengival de cavidades classe II em molares decíduos, restaurados com resina composta (auto e fotopolimerizável), através da penetração de uma solução corante. Os preparos cavitários apresentavam a parede gengival em esmalte e foram restaurados segundo 4 diferentes técnicas: 1) resina composta fotopolimerizável; 2) resina composta autopolimerizável; 3) resina composta auto e fotopolimerizável; e 4) ionômero de vidro/resina ...

  14. Printing in heterogeneous computer environment at DESY

    International Nuclear Information System (INIS)

    Jakubowski, Z.

    1996-01-01

    The number of registered hosts DESY reaches 3500 while the number of print queues approaches 150. The spectrum of used computing environment is very wide: from MAC's and PC's, through SUN, DEC and SGI machines to the IBM mainframe. In 1994 we used 18 tons of paper. We present a solution for providing print services in such an environment for more than 3500 registered users. The availability of the print service is a serious issue. Using centralized printing has a lot of advantages for software administration but creates single point of failure. We solved this problem partially without using expensive software and hardware. The talk provides information about the DESY central central print spooler concept. None of the systems available on the market provides ready to use reliable solution for all platforms used for DESY. We discuss concepts for installation, administration and monitoring large number of printers. We found a solution for printing both on central computing facilities likewise for support of stand-alone workstations. (author)

  15. Computable Frames in Computable Banach Spaces

    Directory of Open Access Journals (Sweden)

    S.K. Kaushik

    2016-06-01

    Full Text Available We develop some parts of the frame theory in Banach spaces from the point of view of Computable Analysis. We define computable M-basis and use it to construct a computable Banach space of scalar valued sequences. Computable Xd frames and computable Banach frames are also defined and computable versions of sufficient conditions for their existence are obtained.

  16. Algebraic computing

    International Nuclear Information System (INIS)

    MacCallum, M.A.H.

    1990-01-01

    The implementation of a new computer algebra system is time consuming: designers of general purpose algebra systems usually say it takes about 50 man-years to create a mature and fully functional system. Hence the range of available systems and their capabilities changes little between one general relativity meeting and the next, despite which there have been significant changes in the period since the last report. The introductory remarks aim to give a brief survey of capabilities of the principal available systems and highlight one or two trends. The reference to the most recent full survey of computer algebra in relativity and brief descriptions of the Maple, REDUCE and SHEEP and other applications are given. (author)

  17. Computational Controversy

    OpenAIRE

    Timmermans, Benjamin; Kuhn, Tobias; Beelen, Kaspar; Aroyo, Lora

    2017-01-01

    Climate change, vaccination, abortion, Trump: Many topics are surrounded by fierce controversies. The nature of such heated debates and their elements have been studied extensively in the social science literature. More recently, various computational approaches to controversy analysis have appeared, using new data sources such as Wikipedia, which help us now better understand these phenomena. However, compared to what social sciences have discovered about such debates, the existing computati...

  18. Computed tomography

    International Nuclear Information System (INIS)

    Andre, M.; Resnick, D.

    1988-01-01

    Computed tomography (CT) has matured into a reliable and prominent tool for study of the muscoloskeletal system. When it was introduced in 1973, it was unique in many ways and posed a challenge to interpretation. It is in these unique features, however, that its advantages lie in comparison with conventional techniques. These advantages will be described in a spectrum of important applications in orthopedics and rheumatology

  19. Computed radiography

    International Nuclear Information System (INIS)

    Pupchek, G.

    2004-01-01

    Computed radiography (CR) is an image acquisition process that is used to create digital, 2-dimensional radiographs. CR employs a photostimulable phosphor-based imaging plate, replacing the standard x-ray film and intensifying screen combination. Conventional radiographic exposure equipment is used with no modification required to the existing system. CR can transform an analog x-ray department into a digital one and eliminates the need for chemicals, water, darkrooms and film processor headaches. (author)

  20. Computational universes

    International Nuclear Information System (INIS)

    Svozil, Karl

    2005-01-01

    Suspicions that the world might be some sort of a machine or algorithm existing 'in the mind' of some symbolic number cruncher have lingered from antiquity. Although popular at times, the most radical forms of this idea never reached mainstream. Modern developments in physics and computer science have lent support to the thesis, but empirical evidence is needed before it can begin to replace our contemporary world view

  1. GLOBECOM '88 - IEEE Global Telecommunications Conference and Exhibition, Hollywood, FL, Nov. 28-Dec. 1, 1988, Conference Record. Volumes 1, 2, & 3

    Science.gov (United States)

    Various papers on communications for the information age are presented. Among the general topics considered are: telematic services and terminals, satellite communications, telecommunications mangaement network, control of integrated broadband networks, advances in digital radio systems, the intelligent network, broadband networks and services deployment, future switch architectures, performance analysis of computer networks, advances in spread spectrum, optical high-speed LANs, and broadband switching and networks. Also addressed are: multiple access protocols, video coding techniques, modulation and coding, photonic switching, SONET terminals and applications, standards for video coding, digital switching, progress in MANs, mobile and portable radio, software design for improved maintainability, multipath propagation and advanced countermeasure, data communication, network control and management, fiber in the loop, network algorithm and protocols, and advances in computer communications.

  2. Knowledge Based Systems: A Critical Survey of Major Concepts, Issues, and Techniques. M.S. Thesis Final Report, 1 Jul. 1985 - 31 Dec. 1987

    Science.gov (United States)

    Dominick, Wayne D. (Editor); Kavi, Srinu

    1984-01-01

    This Working Paper Series entry presents a detailed survey of knowledge based systems. After being in a relatively dormant state for many years, only recently is Artificial Intelligence (AI) - that branch of computer science that attempts to have machines emulate intelligent behavior - accomplishing practical results. Most of these results can be attributed to the design and use of Knowledge-Based Systems, KBSs (or ecpert systems) - problem solving computer programs that can reach a level of performance comparable to that of a human expert in some specialized problem domain. These systems can act as a consultant for various requirements like medical diagnosis, military threat analysis, project risk assessment, etc. These systems possess knowledge to enable them to make intelligent desisions. They are, however, not meant to replace the human specialists in any particular domain. A critical survey of recent work in interactive KBSs is reported. A case study (MYCIN) of a KBS, a list of existing KBSs, and an introduction to the Japanese Fifth Generation Computer Project are provided as appendices. Finally, an extensive set of KBS-related references is provided at the end of the report.

  3. Dentição decídua: estudo da prevalência dos espaços interproximais em crianças brasileiras Deciduous dentition: prevalence study of interdental spaces in brazilian children

    Directory of Open Access Journals (Sweden)

    Vera Mendes SOVIERO

    1999-04-01

    Full Text Available No intuito de conhecer mais sobre as características da dentição decídua, apresentadas pelas crianças brasileiras, realizou-se um estudo de prevalência do qual participaram 400 crianças, com dentição decídua completa e idade variando de 2 a 6 anos, na cidade de Petrópolis - RJ. O arco tipo I foi o mais prevalente tanto no arco superior (93,2% como no inferior (90,5%, sendo que o superior tipo II foi mais comum no sexo feminino (p For the purpose of ascertaining more information about the characteristics of deciduous dentition presented by the Brazilian children, a prevalence study was performed. Four hundred children with complete deciduous dentitions and age ranging from 2 to 6 years, were examined in Petrópolis - RJ - Brazil. The type I arch was the most prevalent in the upper arch (93.2% and in the lower arch (90.5%. The type II upper arch was more common in the females (p < 0.01. The primate spaces were the most frequent spaces found in both arches. The association between the presence of interdental spaces and age was statistically significant (p < 0.05, suggesting that there is a tendency for the spaces to close with age.

  4. A versatile computer based system for data acquisition manipulation and presentation

    International Nuclear Information System (INIS)

    Bardsley, D.J.

    1985-12-01

    A data acquisition system based on the Microdata M 1600L data logger and a Digital Equipment Corporation (DEC) VT103 computer system has been set up for use in a wide range of research and development projects in the field of fission detectors and associated technology. The philosophy underlying the system and its important features are described. Operating instructions for the logger are given, and its application to experimental measurements is considered. Observations on whole system performance, and recommendations for improvements are made. (U.K.)

  5. Analysis of plutonium gamma-ray spectra by small portable computers

    International Nuclear Information System (INIS)

    Ruhter, W.; Gunnink, R.; Camp, D.; DeCarolis, M.

    1985-01-01

    A sophisticated program for isotopic analysis of plutonium gamma-ray spectra using small computers has been developed. It is implemented on a DEC LSI-11/2 configured in a portable unit without a mass storage device for use by IAEA inspectors in the field. Only the positions of the 148-keV 241 Pu and 208-keV 237 U peaks are needed as input. Analysis is completed in 90 seconds by fitting isotopic component response functions to peak multiplets. 9 refs., 2 figs., 1 tab

  6. Configuración e Implementación de una Infraestructura cloud computing privada

    OpenAIRE

    Segarra Cabedo, Pedro

    2014-01-01

    Treball final de Grau en Enginyeria Informàtica. Codi: EI1054. Curs acadèmic 2013-2014 Cloud computing (computación en la nube) es un paradigma de computación que permite ofrecer recursos de computación a través de la red. Estos recursos se ofrecen bajo demanda y pueden ser suministrados con una mínima interacción y gestión por parte del proveedor del servicio. La computación en la nube posee algunas características esenciales, destacando la elasticidad, es dec...

  7. Customizable computing

    CERN Document Server

    Chen, Yu-Ting; Gill, Michael; Reinman, Glenn; Xiao, Bingjun

    2015-01-01

    Since the end of Dennard scaling in the early 2000s, improving the energy efficiency of computation has been the main concern of the research community and industry. The large energy efficiency gap between general-purpose processors and application-specific integrated circuits (ASICs) motivates the exploration of customizable architectures, where one can adapt the architecture to the workload. In this Synthesis lecture, we present an overview and introduction of the recent developments on energy-efficient customizable architectures, including customizable cores and accelerators, on-chip memory

  8. 7th International Conference on Embedded and Multimedia Computing (EMC-12)

    CERN Document Server

    Jeong, Young-Sik; Park, Sang; Chen, Hsing-Chung; Embedded and Multimedia Computing Technology and Service

    2012-01-01

    The 7th International Conference on Embedded and Multimedia Computing (EMC-12), will be held in Gwangju, Korea on September 6 - 8, 2012. EMC-12 will be the most comprehensive conference focused on the various aspects of advances in Embedded and Multimedia (EM) Computing. EMC-12 will provide an opportunity for academic and industry professionals to discuss the latest issues and progress in the area of EM. In addition, the conference will publish high quality papers which are closely related to the various theories and practical applications in EM. Furthermore, we expect that the conference and its publications will be a trigger for further related research and technology improvements in this important subject. The EMC-12 is the next event, in a series of highly successful International Conference on Embedded and Multimedia Computing, previously held as EMC 2011 (China, Aug. 2011), EMC 2010 (Philippines, Aug. 2010), EM-Com 2009 (Korea, Dec. 2009), UMC-08 (Australia, Oct. 2008), ESO-08(China, Dec. 2008), UMS-08 ...

  9. Computed tomography

    International Nuclear Information System (INIS)

    Wells, P.; Davis, J.; Morgan, M.

    1994-01-01

    X-ray or gamma-ray transmission computed tomography (CT) is a powerful non-destructive evaluation (NDE) technique that produces two-dimensional cross-sectional images of an object without the need to physically section it. CT is also known by the acronym CAT, for computerised axial tomography. This review article presents a brief historical perspective on CT, its current status and the underlying physics. The mathematical fundamentals of computed tomography are developed for the simplest transmission CT modality. A description of CT scanner instrumentation is provided with an emphasis on radiation sources and systems. Examples of CT images are shown indicating the range of materials that can be scanned and the spatial and contrast resolutions that may be achieved. Attention is also given to the occurrence, interpretation and minimisation of various image artefacts that may arise. A final brief section is devoted to the principles and potential of a range of more recently developed tomographic modalities including diffraction CT, positron emission CT and seismic tomography. 57 refs., 2 tabs., 14 figs

  10. Computing Services and Assured Computing

    Science.gov (United States)

    2006-05-01

    fighters’ ability to execute the mission.” Computing Services 4 We run IT Systems that: provide medical care pay the warfighters manage maintenance...users • 1,400 applications • 18 facilities • 180 software vendors • 18,000+ copies of executive software products • Virtually every type of mainframe and... chocs electriques, de branchez les deux cordons d’al imentation avant de faire le depannage P R IM A R Y SD A S B 1 2 PowerHub 7000 RST U L 00- 00

  11. Computational neuroscience

    CERN Document Server

    Blackwell, Kim L

    2014-01-01

    Progress in Molecular Biology and Translational Science provides a forum for discussion of new discoveries, approaches, and ideas in molecular biology. It contains contributions from leaders in their fields and abundant references. This volume brings together different aspects of, and approaches to, molecular and multi-scale modeling, with applications to a diverse range of neurological diseases. Mathematical and computational modeling offers a powerful approach for examining the interaction between molecular pathways and ionic channels in producing neuron electrical activity. It is well accepted that non-linear interactions among diverse ionic channels can produce unexpected neuron behavior and hinder a deep understanding of how ion channel mutations bring about abnormal behavior and disease. Interactions with the diverse signaling pathways activated by G protein coupled receptors or calcium influx adds an additional level of complexity. Modeling is an approach to integrate myriad data sources into a cohesiv...

  12. Social Computing

    CERN Multimedia

    CERN. Geneva

    2011-01-01

    The past decade has witnessed a momentous transformation in the way people interact with each other. Content is now co-produced, shared, classified, and rated by millions of people, while attention has become the ephemeral and valuable resource that everyone seeks to acquire. This talk will describe how social attention determines the production and consumption of content within both the scientific community and social media, how its dynamics can be used to predict the future and the role that social media plays in setting the public agenda. About the speaker Bernardo Huberman is a Senior HP Fellow and Director of the Social Computing Lab at Hewlett Packard Laboratories. He received his Ph.D. in Physics from the University of Pennsylvania, and is currently a Consulting Professor in the Department of Applied Physics at Stanford University. He originally worked in condensed matter physics, ranging from superionic conductors to two-dimensional superfluids, and made contributions to the theory of critical p...

  13. computer networks

    Directory of Open Access Journals (Sweden)

    N. U. Ahmed

    2002-01-01

    Full Text Available In this paper, we construct a new dynamic model for the Token Bucket (TB algorithm used in computer networks and use systems approach for its analysis. This model is then augmented by adding a dynamic model for a multiplexor at an access node where the TB exercises a policing function. In the model, traffic policing, multiplexing and network utilization are formally defined. Based on the model, we study such issues as (quality of service QoS, traffic sizing and network dimensioning. Also we propose an algorithm using feedback control to improve QoS and network utilization. Applying MPEG video traces as the input traffic to the model, we verify the usefulness and effectiveness of our model.

  14. Computer Tree

    Directory of Open Access Journals (Sweden)

    Onur AĞAOĞLU

    2014-12-01

    Full Text Available It is crucial that gifted and talented students should be supported by different educational methods for their interests and skills. The science and arts centres (gifted centres provide the Supportive Education Program for these students with an interdisciplinary perspective. In line with the program, an ICT lesson entitled “Computer Tree” serves for identifying learner readiness levels, and defining the basic conceptual framework. A language teacher also contributes to the process, since it caters for the creative function of the basic linguistic skills. The teaching technique is applied for 9-11 aged student level. The lesson introduces an evaluation process including basic information, skills, and interests of the target group. Furthermore, it includes an observation process by way of peer assessment. The lesson is considered to be a good sample of planning for any subject, for the unpredicted convergence of visual and technical abilities with linguistic abilities.

  15. Computed tomography

    International Nuclear Information System (INIS)

    Boyd, D.P.

    1989-01-01

    This paper reports on computed tomographic (CT) scanning which has improved computer-assisted imaging modalities for radiologic diagnosis. The advantage of this modality is its ability to image thin cross-sectional planes of the body, thus uncovering density information in three dimensions without tissue superposition problems. Because this enables vastly superior imaging of soft tissues in the brain and body, CT scanning was immediately successful and continues to grow in importance as improvements are made in speed, resolution, and cost efficiency. CT scanners are used for general purposes, and the more advanced machines are generally preferred in large hospitals, where volume and variety of usage justifies the cost. For imaging in the abdomen, a scanner with a rapid speed is preferred because peristalsis, involuntary motion of the diaphram, and even cardiac motion are present and can significantly degrade image quality. When contrast media is used in imaging to demonstrate scanner, immediate review of images, and multiformat hardcopy production. A second console is reserved for the radiologist to read images and perform the several types of image analysis that are available. Since CT images contain quantitative information in terms of density values and contours of organs, quantitation of volumes, areas, and masses is possible. This is accomplished with region-of- interest methods, which involve the electronic outlining of the selected region of the television display monitor with a trackball-controlled cursor. In addition, various image- processing options, such as edge enhancement (for viewing fine details of edges) or smoothing filters (for enhancing the detectability of low-contrast lesions) are useful tools

  16. Cloud Computing: The Future of Computing

    OpenAIRE

    Aggarwal, Kanika

    2013-01-01

    Cloud computing has recently emerged as a new paradigm for hosting and delivering services over the Internet. Cloud computing is attractive to business owners as it eliminates the requirement for users to plan ahead for provisioning, and allows enterprises to start from the small and increase resources only when there is a rise in service demand. The basic principles of cloud computing is to make the computing be assigned in a great number of distributed computers, rather then local computer ...

  17. Creep-fatigue interaction at high temperature; Proceedings of the Symposium, 112th ASME Winter Annual Meeting, Atlanta, GA, Dec. 1-6, 1991

    Science.gov (United States)

    Haritos, George K.; Ochoa, O. O.

    Various papers on creep-fatigue interaction at high temperature are presented. Individual topics addressed include: analysis of elevated temperature fatigue crack growth mechanisms in Alloy 718, physically based microcrack propagation laws for creep-fatigue-environment interaction, in situ SEM observation of short fatigue crack growth in Waspaloy at 700 C under cyclic and dwell conditions, evolution of creep-fatigue life prediction models, TMF design considerations in turbine airfoils of advanced turbine engines. Also discussed are: high temperature fatigue life prediction computer code based on the total strain version of strainrange partitioning, atomic theory of thermodynamics of internal variables, geometrically nonlinear analysis of interlaminar stresses in unsymmetrically laminated plates subjected to uniform thermal loading, experimental investigation of creep crack tip deformation using moire interferometry. (For individual items see A93-31336 to A93-31344)

  18. Heat transfer in gas turbine engines and three-dimensional flows; Proceedings of the Symposium, ASME Winter Annual Meeting, Chicago, IL, Nov. 27-Dec. 2, 1988

    Science.gov (United States)

    Elovic, E. (Editor); O'Brien, J. E. (Editor); Pepper, D. W. (Editor)

    1988-01-01

    The present conference on heat transfer characteristics of gas turbines and three-dimensional flows discusses velocity-temperature fluctuation correlations at the flow stagnation flow of a circular cylinder in turbulent flow, heat transfer across turbulent boundary layers with pressure gradients, the effect of jet grid turbulence on boundary layer heat transfer, and heat transfer characteristics predictions for discrete-hole film cooling. Also discussed are local heat transfer in internally cooled turbine airfoil leading edges, secondary flows in vane cascades and curved ducts, three-dimensional numerical modeling in gas turbine coal combustor design, numerical and experimental results for tube-fin heat exchanger airflow and heating characteristics, and the computation of external hypersonic three-dimensional flow field and heat transfer characteristics.

  19. A Programming Environment Evaluation Methodology for Object-Oriented Systems. Ph.D Thesis Final Report, 1 Jul. 1985 - 31 Dec. 1987

    Science.gov (United States)

    Dominick, Wayne D. (Editor); Moreau, Dennis R.

    1987-01-01

    The object-oriented design strategy as both a problem decomposition and system development paradigm has made impressive inroads into the various areas of the computing sciences. Substantial development productivity improvements have been demonstrated in areas ranging from artificial intelligence to user interface design. However, there has been very little progress in the formal characterization of these productivity improvements and in the identification of the underlying cognitive mechanisms. The development and validation of models and metrics of this sort require large amounts of systematically-gathered structural and productivity data. There has, however, been a notable lack of systematically-gathered information on these development environments. A large part of this problem is attributable to the lack of a systematic programming environment evaluation methodology that is appropriate to the evaluation of object-oriented systems.

  20. Influência da variação dos decúbitos laterais na deposição pulmonar de aerossol Influence of change in lateral decubitus on pulmonary aerosol deposition

    Directory of Open Access Journals (Sweden)

    Luciana Alcoforado

    2011-08-01

    Full Text Available CONTEXTUALIZAÇÃO: O decúbito lateral apresenta as maiores mudanças em relação à ventilação pulmonar regional e é utilizado na rotina da fisioterapia respiratória. OBJETIVOS: Avaliar a influência do decúbito lateral na deposição pulmonar de radioaerossol durante a inalação em indivíduos jovens e relacionar os efeitos desse decúbito na rotina terapêutica. MÉTODOS: Em estudo randomizado em duas fases, foram incluídos oito homens voluntários saudáveis, com média de idade de 23,6±2,5 anos. Na primeira fase, inalou-se aerossol durante nove minutos no decúbito lateral sorteado e, após intervalo de cinco a sete dias, realizou-se a segunda fase. Para a cintilografia, inalou-se uma dose média de ácido dietilnotriaminopentacético marcado com tecnécio (DTPA - TC99m, com uma atividade radioativa em média de 25 milicuries (mCi. Ao final da inalação, as imagens foram adquiridas em câmaras de cintilação e analisadas por meio da divisão longitudinal e transversal dos pulmões em regiões de interesse (ROI. Para análise estatística, utilizou-se o teste t de Student pareado, considerando significativo pBACKGROUND: The lateral decubitus position leads to the greatest changes in regional pulmonary ventilation and is used in respiratory physical therapy routines. OBJECTIVES: To evaluate the influence of the lateral decubitus position on the pulmonary deposition of inhaled radioaerosol particles in young people and report the effects of the decubitus position on routine therapy. METHODS: Eight healthy male volunteers, mean age 23.6±2.5 years, were included in a randomized study in two phases. In the first phase, aerosol was inhaled for nine minutes in a randomly-selected lateral decubitus position and after an interval of 5 to 7 days, the second phase was conducted. Pulmonary scintigraphy was carried out by inhalation of 25 mCi of 99mTc-DTPA. Following inhalation, images were acquired with scintillation cameras and regions of

  1. Synthesis and Evaluation of in Vitro Biological Activity of 4-Substituted Arylpiperazine Derivatives of 1,7,8,9-Tetrachloro-10,10-dimethoxy-4-azatricyclo[5.2.1.02,6]dec-8-ene-3,5-dione

    Directory of Open Access Journals (Sweden)

    David Collu

    2009-12-01

    Full Text Available A series of twenty arylpiperazine derivatives of 1,7,8,9-tetrachloro-10,10-dimethoxy-4-azatricyclo[5.2.1.02,6]dec-8-ene-3,5-dione have been prepared. These derivatives were tested in vitro with the aim of identifying novel lead compounds active against emergent and re-emergent human and cattle infectious diseases (AIDS, hepatitis B and C, tuberculosis, bovine viral diarrhea. In particular, these compounds were evaluated in vitro against representatives of different virus classes, such as a HIV-1 (Retrovirus, a HBV (Hepadnavirus and the single-stranded RNA+ viruses Yellow fever virus (YFV and Bovine viral diarrhea virus (BVDV, both belonging to the Flaviridae. Compounds 2c, 2g and 3d showed a modest activity against CVB-2. The molecular structures of the starting imide 1 and one of propyl-piperazine derivatives, 3b, have been determined by an X-ray crystallography study.

  2. Avaliação in vitro da microinfiltração em cavidades classe II de molares decíduos, restaurados com resina composta auto e fotopolimerizável

    Directory of Open Access Journals (Sweden)

    CAVALCANTI Alessandro Leite

    1999-01-01

    Full Text Available Estudou-se a microinfiltração marginal presente na interface da parede gengival de cavidades classe II em molares decíduos, restaurados com resina composta (auto e fotopolimerizável, através da penetração de uma solução corante. Os preparos cavitários apresentavam a parede gengival em esmalte e foram restaurados segundo 4 diferentes técnicas: 1 resina composta fotopolimerizável; 2 resina composta autopolimerizável; 3 resina composta auto e fotopolimerizável; e 4 ionômero de vidro/resina composta. Após a análise estatística dos resultados, concluiu-se que todos os grupos apresentaram microinfiltração em graus variados; todavia, os grupos 2, 3 e 4 apresentaram os menores graus de infiltração.

  3. Computer Refurbishment

    International Nuclear Information System (INIS)

    Ichiyen, Norman; Chan, Dominic; Thompson, Paul

    2004-01-01

    The major activity for the 18-month refurbishment outage at the Point Lepreau Generating Station is the replacement of all 380 fuel channel and calandria tube assemblies and the lower portion of connecting feeder pipes. New Brunswick Power would also take advantage of this outage to conduct a number of repairs, replacements, inspections and upgrades (such as rewinding or replacing the generator, replacement of shutdown system trip computers, replacement of certain valves and expansion joints, inspection of systems not normally accessible, etc.). This would allow for an additional 25 to 30 years. Among the systems to be replaced are the PDC's for both shutdown systems. Assessments have been completed for both the SDS1 and SDS2 PDC's, and it has been decided to replace the SDS2 PDCs with the same hardware and software approach that has been used successfully for the Wolsong 2, 3, and 4 and the Qinshan 1 and 2 SDS2 PDCs. For SDS1, it has been decided to use the same software development methodology that was used successfully for the Wolsong and Qinshan called the I A and to use a new hardware platform in order to ensure successful operation for the 25-30 year station operating life. The selected supplier is Triconex, which uses a triple modular redundant architecture that will enhance the robustness/fault tolerance of the design with respect to equipment failures

  4. A stand alone computer system to aid the development of mirror fusion test facility RF heating systems

    International Nuclear Information System (INIS)

    Thomas, R.A.

    1983-01-01

    The Mirror Fusion Test Facility (MFTF-B) control system architecture requires the Supervisory Control and Diagnostic System (SCDS) to communicate with a LSI-11 Local Control Computer (LCC) that in turn communicates via a fiber optic link to CAMAC based control hardware located near the machine. In many cases, the control hardware is very complex and requires a sizable development effort prior to being integrated into the overall MFTF-B system. One such effort was the development of the Electron Cyclotron Resonance Heating (ECRH) system. It became clear that a stand alone computer system was needed to simulate the functions of SCDS. This paper describes the hardware and software necessary to implement the SCDS Simulation Computer (SSC). It consists of a Digital Equipment Corporation (DEC) LSI-11 computer and a Winchester/Floppy disk operating under the DEC RT-11 operating system. All application software for MFTF-B is programmed in PASCAL, which allowed us to adapt procedures originally written for SCDS to the SSC. This nearly identical software interface means that software written during the equipment development will be useful to the SCDS programmers in the integration phase

  5. Computed Tomography (CT) -- Sinuses

    Medline Plus

    Full Text Available ... Physician Resources Professions Site Index A-Z Computed Tomography (CT) - Sinuses Computed tomography (CT) of the sinuses ... CT of the Sinuses? What is CT (Computed Tomography) of the Sinuses? Computed tomography, more commonly known ...

  6. Illustrated computer tomography

    International Nuclear Information System (INIS)

    Takahashi, S.

    1983-01-01

    This book provides the following information: basic aspects of computed tomography; atlas of computed tomography of the normal adult; clinical application of computed tomography; and radiotherapy planning and computed tomography

  7. Analog and hybrid computing

    CERN Document Server

    Hyndman, D E

    2013-01-01

    Analog and Hybrid Computing focuses on the operations of analog and hybrid computers. The book first outlines the history of computing devices that influenced the creation of analog and digital computers. The types of problems to be solved on computers, computing systems, and digital computers are discussed. The text looks at the theory and operation of electronic analog computers, including linear and non-linear computing units and use of analog computers as operational amplifiers. The monograph examines the preparation of problems to be deciphered on computers. Flow diagrams, methods of ampl

  8. Cloud Computing Fundamentals

    Science.gov (United States)

    Furht, Borko

    In the introductory chapter we define the concept of cloud computing and cloud services, and we introduce layers and types of cloud computing. We discuss the differences between cloud computing and cloud services. New technologies that enabled cloud computing are presented next. We also discuss cloud computing features, standards, and security issues. We introduce the key cloud computing platforms, their vendors, and their offerings. We discuss cloud computing challenges and the future of cloud computing.

  9. Unconventional Quantum Computing Devices

    OpenAIRE

    Lloyd, Seth

    2000-01-01

    This paper investigates a variety of unconventional quantum computation devices, including fermionic quantum computers and computers that exploit nonlinear quantum mechanics. It is shown that unconventional quantum computing devices can in principle compute some quantities more rapidly than `conventional' quantum computers.

  10. Computing handbook computer science and software engineering

    CERN Document Server

    Gonzalez, Teofilo; Tucker, Allen

    2014-01-01

    Overview of Computer Science Structure and Organization of Computing Peter J. DenningComputational Thinking Valerie BarrAlgorithms and Complexity Data Structures Mark WeissBasic Techniques for Design and Analysis of Algorithms Edward ReingoldGraph and Network Algorithms Samir Khuller and Balaji RaghavachariComputational Geometry Marc van KreveldComplexity Theory Eric Allender, Michael Loui, and Kenneth ReganFormal Models and Computability Tao Jiang, Ming Li, and Bala

  11. Computational system for activity calculation of radiopharmaceuticals

    African Journals Online (AJOL)

    STORAGESEVER

    2008-12-29

    Dec 29, 2008 ... 2National Nuclear Energy Commission, Brazil. Accepted 24 October ... radiopharmaceuticals in use around the world with ... ment with a very important aspects: no profits ends. The tool ... The software interface is showed in ...

  12. Computational fluid dynamics in greenhouses: A review

    African Journals Online (AJOL)

    use

    2011-12-05

    Dec 5, 2011 ... reduce environmental impact while enhancing crop qua- lity and yields .... within a mild climate, appropriate design and control of ventilation are required .... crucial parameter in the pattern of internal greenhouse temperatures ...

  13. Application of computers in a radiological survey program

    International Nuclear Information System (INIS)

    Berven, B.A.; Blair, M.S.; Doane, R.W.; Little, C.A.; Perdue, P.T.

    1984-01-01

    Computers have become increasingly important in data analysis and data management as well as assisting in report preparation in the Oak Ridge National Laboratory (ORNL) Radiological Survey Activities (RASA) Program. The primary function of the RASA program is to collect, analyze, report, and manage data collected to characterize the radiological condition of potentially contaminated sites identified in the Department of Energy's (DOE) remedial action programs. Three different computer systems are routinely utilized in ORNL/RASA operations. Two of these systems are employed in specific functions. A Nuclear Data (ND) 682 is used to perform isotopic analysis of gamma spectroscopic data generated by high-purity germanium detectors for air, water and soil samples. The ND682 employs a 16,000-channel analyzer that is routinely used with four germanium spectrometers. Word processing and data management are accomplished using the INtext system implemented on a DEC PDP-11 computer. A group of personal computers are used to perform a diverse number of functions. These computer systems are Commodore Business Machines (CBM) Model 8032 with a dual floppy disk storage medium and line printers (with optional X-Y plotters). The CBM's are utilized for: (1) data analysis -- raw data from radiation detection instrumentation are stored and manipulated with customized computer programs; (2) data reduction -- raw data are converted into report-ready tables using customized programs; (3) data management -- radionuclide data on each air, water and soil sample are stored on diskettes along with location of archived samples; and (4) program management -- site surveys and report status are tracked by computer files as well as program budget information to provide contemporary information of program status

  14. Specialized computer architectures for computational aerodynamics

    Science.gov (United States)

    Stevenson, D. K.

    1978-01-01

    In recent years, computational fluid dynamics has made significant progress in modelling aerodynamic phenomena. Currently, one of the major barriers to future development lies in the compute-intensive nature of the numerical formulations and the relative high cost of performing these computations on commercially available general purpose computers, a cost high with respect to dollar expenditure and/or elapsed time. Today's computing technology will support a program designed to create specialized computing facilities to be dedicated to the important problems of computational aerodynamics. One of the still unresolved questions is the organization of the computing components in such a facility. The characteristics of fluid dynamic problems which will have significant impact on the choice of computer architecture for a specialized facility are reviewed.

  15. Applied Parallel Computing Industrial Computation and Optimization

    DEFF Research Database (Denmark)

    Madsen, Kaj; NA NA NA Olesen, Dorte

    Proceedings and the Third International Workshop on Applied Parallel Computing in Industrial Problems and Optimization (PARA96)......Proceedings and the Third International Workshop on Applied Parallel Computing in Industrial Problems and Optimization (PARA96)...

  16. Further computer appreciation

    CERN Document Server

    Fry, T F

    2014-01-01

    Further Computer Appreciation is a comprehensive cover of the principles and aspects in computer appreciation. The book starts by describing the development of computers from the first to the third computer generations, to the development of processors and storage systems, up to the present position of computers and future trends. The text tackles the basic elements, concepts and functions of digital computers, computer arithmetic, input media and devices, and computer output. The basic central processor functions, data storage and the organization of data by classification of computer files,

  17. BONFIRE: benchmarking computers and computer networks

    OpenAIRE

    Bouckaert, Stefan; Vanhie-Van Gerwen, Jono; Moerman, Ingrid; Phillips, Stephen; Wilander, Jerker

    2011-01-01

    The benchmarking concept is not new in the field of computing or computer networking. With “benchmarking tools”, one usually refers to a program or set of programs, used to evaluate the performance of a solution under certain reference conditions, relative to the performance of another solution. Since the 1970s, benchmarking techniques have been used to measure the performance of computers and computer networks. Benchmarking of applications and virtual machines in an Infrastructure-as-a-Servi...

  18. Democratizing Computer Science

    Science.gov (United States)

    Margolis, Jane; Goode, Joanna; Ryoo, Jean J.

    2015-01-01

    Computer science programs are too often identified with a narrow stratum of the student population, often white or Asian boys who have access to computers at home. But because computers play such a huge role in our world today, all students can benefit from the study of computer science and the opportunity to build skills related to computing. The…

  19. Computing at Stanford.

    Science.gov (United States)

    Feigenbaum, Edward A.; Nielsen, Norman R.

    1969-01-01

    This article provides a current status report on the computing and computer science activities at Stanford University, focusing on the Computer Science Department, the Stanford Computation Center, the recently established regional computing network, and the Institute for Mathematical Studies in the Social Sciences. Also considered are such topics…

  20. Soft computing in computer and information science

    CERN Document Server

    Fray, Imed; Pejaś, Jerzy

    2015-01-01

    This book presents a carefully selected and reviewed collection of papers presented during the 19th Advanced Computer Systems conference ACS-2014. The Advanced Computer Systems conference concentrated from its beginning on methods and algorithms of artificial intelligence. Further future brought new areas of interest concerning technical informatics related to soft computing and some more technological aspects of computer science such as multimedia and computer graphics, software engineering, web systems, information security and safety or project management. These topics are represented in the present book under the categories Artificial Intelligence, Design of Information and Multimedia Systems, Information Technology Security and Software Technologies.

  1. Computational Intelligence, Cyber Security and Computational Models

    CERN Document Server

    Anitha, R; Lekshmi, R; Kumar, M; Bonato, Anthony; Graña, Manuel

    2014-01-01

    This book contains cutting-edge research material presented by researchers, engineers, developers, and practitioners from academia and industry at the International Conference on Computational Intelligence, Cyber Security and Computational Models (ICC3) organized by PSG College of Technology, Coimbatore, India during December 19–21, 2013. The materials in the book include theory and applications for design, analysis, and modeling of computational intelligence and security. The book will be useful material for students, researchers, professionals, and academicians. It will help in understanding current research trends and findings and future scope of research in computational intelligence, cyber security, and computational models.

  2. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... When the image slices are reassembled by computer software, the result is a very detailed multidimensional view ... Safety Images related to Computed Tomography (CT) - Head Videos related to Computed Tomography (CT) - Head Sponsored by ...

  3. Computers: Instruments of Change.

    Science.gov (United States)

    Barkume, Megan

    1993-01-01

    Discusses the impact of computers in the home, the school, and the workplace. Looks at changes in computer use by occupations and by industry. Provides information on new job titles in computer occupations. (JOW)

  4. DNA computing models

    CERN Document Server

    Ignatova, Zoya; Zimmermann, Karl-Heinz

    2008-01-01

    In this excellent text, the reader is given a comprehensive introduction to the field of DNA computing. The book emphasizes computational methods to tackle central problems of DNA computing, such as controlling living cells, building patterns, and generating nanomachines.

  5. Distributed multiscale computing

    NARCIS (Netherlands)

    Borgdorff, J.

    2014-01-01

    Multiscale models combine knowledge, data, and hypotheses from different scales. Simulating a multiscale model often requires extensive computation. This thesis evaluates distributing these computations, an approach termed distributed multiscale computing (DMC). First, the process of multiscale

  6. Computational Modeling | Bioenergy | NREL

    Science.gov (United States)

    cell walls and are the source of biofuels and biomaterials. Our modeling investigates their properties . Quantum Mechanical Models NREL studies chemical and electronic properties and processes to reduce barriers Computational Modeling Computational Modeling NREL uses computational modeling to increase the

  7. Computer Viruses: An Overview.

    Science.gov (United States)

    Marmion, Dan

    1990-01-01

    Discusses the early history and current proliferation of computer viruses that occur on Macintosh and DOS personal computers, mentions virus detection programs, and offers suggestions for how libraries can protect themselves and their users from damage by computer viruses. (LRW)

  8. Computer Virus and Trends

    OpenAIRE

    Tutut Handayani; Soenarto Usna,Drs.MMSI

    2004-01-01

    Since its appearance the first time in the mid-1980s, computer virus has invited various controversies that still lasts to this day. Along with the development of computer systems technology, viruses komputerpun find new ways to spread itself through a variety of existing communications media. This paper discusses about some things related to computer viruses, namely: the definition and history of computer viruses; the basics of computer viruses; state of computer viruses at this time; and ...

  9. Plasticity: modeling & computation

    National Research Council Canada - National Science Library

    Borja, Ronaldo Israel

    2013-01-01

    .... "Plasticity Modeling & Computation" is a textbook written specifically for students who want to learn the theoretical, mathematical, and computational aspects of inelastic deformation in solids...

  10. Cloud Computing Quality

    Directory of Open Access Journals (Sweden)

    Anamaria Şiclovan

    2013-02-01

    Full Text Available Cloud computing was and it will be a new way of providing Internet services and computers. This calculation approach is based on many existing services, such as the Internet, grid computing, Web services. Cloud computing as a system aims to provide on demand services more acceptable as price and infrastructure. It is exactly the transition from computer to a service offered to the consumers as a product delivered online. This paper is meant to describe the quality of cloud computing services, analyzing the advantages and characteristics offered by it. It is a theoretical paper.Keywords: Cloud computing, QoS, quality of cloud computing

  11. Computer hardware fault administration

    Science.gov (United States)

    Archer, Charles J.; Megerian, Mark G.; Ratterman, Joseph D.; Smith, Brian E.

    2010-09-14

    Computer hardware fault administration carried out in a parallel computer, where the parallel computer includes a plurality of compute nodes. The compute nodes are coupled for data communications by at least two independent data communications networks, where each data communications network includes data communications links connected to the compute nodes. Typical embodiments carry out hardware fault administration by identifying a location of a defective link in the first data communications network of the parallel computer and routing communications data around the defective link through the second data communications network of the parallel computer.

  12. Computer jargon explained

    CERN Document Server

    Enticknap, Nicholas

    2014-01-01

    Computer Jargon Explained is a feature in Computer Weekly publications that discusses 68 of the most commonly used technical computing terms. The book explains what the terms mean and why the terms are important to computer professionals. The text also discusses how the terms relate to the trends and developments that are driving the information technology industry. Computer jargon irritates non-computer people and in turn causes problems for computer people. The technology and the industry are changing so rapidly; it is very hard even for professionals to keep updated. Computer people do not

  13. Computers and data processing

    CERN Document Server

    Deitel, Harvey M

    1985-01-01

    Computers and Data Processing provides information pertinent to the advances in the computer field. This book covers a variety of topics, including the computer hardware, computer programs or software, and computer applications systems.Organized into five parts encompassing 19 chapters, this book begins with an overview of some of the fundamental computing concepts. This text then explores the evolution of modern computing systems from the earliest mechanical calculating devices to microchips. Other chapters consider how computers present their results and explain the storage and retrieval of

  14. Computers in nuclear medicine

    International Nuclear Information System (INIS)

    Giannone, Carlos A.

    1999-01-01

    This chapter determines: capture and observation of images in computers; hardware and software used, personal computers, networks and workstations. The use of special filters determine the quality image

  15. Advances in unconventional computing

    CERN Document Server

    2017-01-01

    The unconventional computing is a niche for interdisciplinary science, cross-bred of computer science, physics, mathematics, chemistry, electronic engineering, biology, material science and nanotechnology. The aims of this book are to uncover and exploit principles and mechanisms of information processing in and functional properties of physical, chemical and living systems to develop efficient algorithms, design optimal architectures and manufacture working prototypes of future and emergent computing devices. This first volume presents theoretical foundations of the future and emergent computing paradigms and architectures. The topics covered are computability, (non-)universality and complexity of computation; physics of computation, analog and quantum computing; reversible and asynchronous devices; cellular automata and other mathematical machines; P-systems and cellular computing; infinity and spatial computation; chemical and reservoir computing. The book is the encyclopedia, the first ever complete autho...

  16. Computability and unsolvability

    CERN Document Server

    Davis, Martin

    1985-01-01

    ""A clearly written, well-presented survey of an intriguing subject."" - Scientific American. Classic text considers general theory of computability, computable functions, operations on computable functions, Turing machines self-applied, unsolvable decision problems, applications of general theory, mathematical logic, Kleene hierarchy, computable functionals, classification of unsolvable decision problems and more.

  17. Mathematics for computer graphics

    CERN Document Server

    Vince, John

    2006-01-01

    Helps you understand the mathematical ideas used in computer animation, virtual reality, CAD, and other areas of computer graphics. This work also helps you to rediscover the mathematical techniques required to solve problems and design computer programs for computer graphic applications

  18. Computations and interaction

    NARCIS (Netherlands)

    Baeten, J.C.M.; Luttik, S.P.; Tilburg, van P.J.A.; Natarajan, R.; Ojo, A.

    2011-01-01

    We enhance the notion of a computation of the classical theory of computing with the notion of interaction. In this way, we enhance a Turing machine as a model of computation to a Reactive Turing Machine that is an abstract model of a computer as it is used nowadays, always interacting with the user

  19. Symbiotic Cognitive Computing

    OpenAIRE

    Farrell, Robert G.; Lenchner, Jonathan; Kephjart, Jeffrey O.; Webb, Alan M.; Muller, MIchael J.; Erikson, Thomas D.; Melville, David O.; Bellamy, Rachel K.E.; Gruen, Daniel M.; Connell, Jonathan H.; Soroker, Danny; Aaron, Andy; Trewin, Shari M.; Ashoori, Maryam; Ellis, Jason B.

    2016-01-01

    IBM Research is engaged in a research program in symbiotic cognitive computing to investigate how to embed cognitive computing in physical spaces. This article proposes 5 key principles of symbiotic cognitive computing.  We describe how these principles are applied in a particular symbiotic cognitive computing environment and in an illustrative application.  

  20. Computer scientist looks at reliability computations

    International Nuclear Information System (INIS)

    Rosenthal, A.

    1975-01-01

    Results from the theory of computational complexity are applied to reliability computations on fault trees and networks. A well known class of problems which almost certainly have no fast solution algorithms is presented. It is shown that even approximately computing the reliability of many systems is difficult enough to be in this class. In the face of this result, which indicates that for general systems the computation time will be exponential in the size of the system, decomposition techniques which can greatly reduce the effective size of a wide variety of realistic systems are explored

  1. Roadmap to greener computing

    CERN Document Server

    Nguemaleu, Raoul-Abelin Choumin

    2014-01-01

    A concise and accessible introduction to green computing and green IT, this book addresses how computer science and the computer infrastructure affect the environment and presents the main challenges in making computing more environmentally friendly. The authors review the methodologies, designs, frameworks, and software development tools that can be used in computer science to reduce energy consumption and still compute efficiently. They also focus on Computer Aided Design (CAD) and describe what design engineers and CAD software applications can do to support new streamlined business directi

  2. Brief: Managing computing technology

    International Nuclear Information System (INIS)

    Startzman, R.A.

    1994-01-01

    While computing is applied widely in the production segment of the petroleum industry, its effective application is the primary goal of computing management. Computing technology has changed significantly since the 1950's, when computers first began to influence petroleum technology. The ability to accomplish traditional tasks faster and more economically probably is the most important effect that computing has had on the industry. While speed and lower cost are important, are they enough? Can computing change the basic functions of the industry? When new computing technology is introduced improperly, it can clash with traditional petroleum technology. This paper examines the role of management in merging these technologies

  3. Computer mathematics for programmers

    CERN Document Server

    Abney, Darrell H; Sibrel, Donald W

    1985-01-01

    Computer Mathematics for Programmers presents the Mathematics that is essential to the computer programmer.The book is comprised of 10 chapters. The first chapter introduces several computer number systems. Chapter 2 shows how to perform arithmetic operations using the number systems introduced in Chapter 1. The third chapter covers the way numbers are stored in computers, how the computer performs arithmetic on real numbers and integers, and how round-off errors are generated in computer programs. Chapter 4 details the use of algorithms and flowcharting as problem-solving tools for computer p

  4. Parallel computing works

    Energy Technology Data Exchange (ETDEWEB)

    1991-10-23

    An account of the Caltech Concurrent Computation Program (C{sup 3}P), a five year project that focused on answering the question: Can parallel computers be used to do large-scale scientific computations '' As the title indicates, the question is answered in the affirmative, by implementing numerous scientific applications on real parallel computers and doing computations that produced new scientific results. In the process of doing so, C{sup 3}P helped design and build several new computers, designed and implemented basic system software, developed algorithms for frequently used mathematical computations on massively parallel machines, devised performance models and measured the performance of many computers, and created a high performance computing facility based exclusively on parallel computers. While the initial focus of C{sup 3}P was the hypercube architecture developed by C. Seitz, many of the methods developed and lessons learned have been applied successfully on other massively parallel architectures.

  5. Volume 13, Issue 2 July - Dec 2014

    African Journals Online (AJOL)

    legal and institutional frameworks, and interactions/relationships between ... models as well as trend, spectral and wavelet analyses. ... natural variability in the climate system, whereby ... Japan Agency for Marine-Earth Science and ... custodian of all meteorological data in the ...... no influence of host size or depth on the.

  6. Monthly results of measurements: Dec 1996

    International Nuclear Information System (INIS)

    1996-01-01

    This report of the OPRI (Office of Protection against Ionizing Radiations) exposes the principal results concerning the routine monitoring of environmental radioactivity in France: atmospheric dusts, rainwater, surface water, underground water, sewage water, drinking water, food chain (milk, vegetables, fishes), sea water around nuclear sites and other sites. The activities of various radioisotopes are presented in tables

  7. Monthly results of measurements: Dec 1999

    International Nuclear Information System (INIS)

    1999-01-01

    This report of the OPRI (Office of Protection against Ionizing Radiations) exposes the principal results concerning the routine monitoring of environmental radioactivity in France: atmospheric dusts, rainwater, surface water, underground water, sewage water, drinking water, food chain (milk, vegetables, fishes), sea water around nuclear sites and other sites. The activities of various radioisotopes are presented in tables. (N.C.)

  8. Monthly results of measurements: Dec 2000

    International Nuclear Information System (INIS)

    2000-01-01

    This report of the OPRI (Office of Protection against Ionizing Radiations) exposes the principal results concerning the routine monitoring of environmental radioactivity in France: atmospheric dusts, rainwater, surface water, underground water, sewage water, drinking water, food chain (milk, vegetables, fishes), sea water around nuclear sites and other sites. The activities of various radioisotopes are presented in tables

  9. NJS July - Dec 2010.cdr (cynt...

    African Journals Online (AJOL)

    NAM

    University of Nigeria Teaching. Hospital ... attract adequate medical manpower in most developing countries. As a result, ... In this study, we examined the factors influencing choice of future career by .... intellectual stimulation and future patient.

  10. Resonance Cover Dec 09. TP.cdr

    Indian Academy of Sciences (India)

    Admin

    Email:renrav@math.iisc.ernet.in. Errata. Resonance, Vol 14, No. 11, November 2009. The Solar Physics Observatory at Kodaikanal and John Evershed (pp. 1032–1039):. Due to an inadvertence on the part of the author, the article did not carry the credits to go with the photographs. The photographs appearing in the article ...

  11. Backbone upgrades and DEC equipment replacement

    Science.gov (United States)

    Vancamp, Warren

    1991-01-01

    The NASA Science Internet (NSI) dual protocol backbone is outlined. It includes DECnet link upgrades to match TCP/IP link performance. It also includes the integration of backbone resources and central management. The phase 1 transition process is outlined.

  12. Dec 2011 NJS for Prof Anyanwu

    African Journals Online (AJOL)

    was obtained, biodata, medical history as well as full physical examination findings documented. The serum PSA level was measured at this enrolment. This was followed by titration phase of 2 weeks, when IPSS and bother score were assessed and baseline uroflowmetry performed. Branded. Doxazosin (Cadura) 1mg was ...

  13. Tendances Carbone n. 9 Dec. 2006

    International Nuclear Information System (INIS)

    2006-01-01

    This newsletter presents, first, the two-price signals now sent by the European Union emissions trading scheme which corresponds to a disconnection between first phase (2005-2007) and second phase (2008-2012) prices and refers to different dynamics. Then, it makes a synthesis of the European CO 2 market over the last 13 months: traded volumes, spot prices, climate indexes (temperature, precipitations), economic activity indicators (industrial production index, business leaders' confidence index, changes in energy prices, CO 2 quotas allocated to European Union countries, and detailed indicators of CO 2 market, climate, economic activity and energy prices. (J.S.)

  14. NJS July Dec 2009.cdr correct...

    African Journals Online (AJOL)

    NAM

    respectively as having invasive cancer, fibroadenoma, and fibrocystic changes. Our study shows that breast lump was the most common presenting complaint with most patients not presenting early. Fewer lumps are discovered by breast self examination. The finding that breast cancer was slightly more common than.

  15. General Staff Meeting, 17 Dec 2002

    CERN Multimedia

    CERN. Geneva. Audiovisual Unit

    2002-01-01

    I would like to invite all members of the CERN Personnel to a meeting, to give a report on the outcome of the December Council Meetings. Closed-circuit transmission of the meeting will be available in the SL Auditorium (Prévessin), the IT Auditorium (bldg. 31), the LHC Auditorium (bldg. 30) and the PS Auditorium (bldg. 6).

  16. NJS July - Dec 2010.cdr (cynt...

    African Journals Online (AJOL)

    NAM

    have a major injury to the Cervical Spine. This case highlights the problems of identification of such injuries in the unconscious. An unconscious young adult was admitted from the accident and emergency into the intensive care unit with a clinical impression of traumatic head injury. Neck collar was applied and the airway ...

  17. NJS July - Dec 2010.cdr (cynt...

    African Journals Online (AJOL)

    NAM

    onset, painless, visual loss following the use of sildenafil citrate 100mg twice weekly, prescribed for his ... vascular and visceral smooth muscle effects the use of sildenafil has ... Laboratory investigations revealed normal fasting blood glucose ...

  18. Dec 2011 NJS for Prof Anyanwu

    African Journals Online (AJOL)

    This informed a search for the presence of asymptomatic penile plaques in middle aged men presenting at our urologic outpatient clinic. Peyronie's disease is a disease of middle aged men 40-. 59 years though it has been reported in men from 18 to. 4. 80 years old . Our patients were aged 50, 60 and 67 years respectively.

  19. Dec 2011 NJS for Prof Anyanwu

    African Journals Online (AJOL)

    marks and tattoos and skin blemishes and abdominoplasties(tummy tuck),.are routinely carried out in plastic surgery centres in Nigeria today. ... Cultural beliefs and societal acceptance of cosmetic .... Orthopaedic clinics of North America,.

  20. Dec 2011 NJS for Prof Anyanwu

    African Journals Online (AJOL)

    Ed; Appleton and Lange, Stanford Connecticut. 1996: 537-555. 2. Aderele WI. Pleural Effusion, Pneumothorax and. Bronchiectasis. In Azubuike JC, Nkanginieme. KEO Eds. Pediatrics and Child Health in a. Tropical Region. Owerri. African Educational. Services, 1999, p. 246-53. 3. Anyanwu CH. Empyema. In: Badoe EA,.

  1. NJS July Dec 2009.cdr correct...

    African Journals Online (AJOL)

    NAM

    Teaching Hospital, Nnewi,. Nigeria. Drchinemelum@yahoo.com. 1,2,4,5,6. 3. Abstract ... Submandibular stones close to the helium of the ... Sialography has conventionally been the gold ... sialondoscopy, including wire-basket extraction and.

  2. The digital computer

    CERN Document Server

    Parton, K C

    2014-01-01

    The Digital Computer focuses on the principles, methodologies, and applications of the digital computer. The publication takes a look at the basic concepts involved in using a digital computer, simple autocode examples, and examples of working advanced design programs. Discussions focus on transformer design synthesis program, machine design analysis program, solution of standard quadratic equations, harmonic analysis, elementary wage calculation, and scientific calculations. The manuscript then examines commercial and automatic programming, how computers work, and the components of a computer

  3. Cloud computing for radiologists

    OpenAIRE

    Amit T Kharat; Amjad Safvi; S S Thind; Amarjit Singh

    2012-01-01

    Cloud computing is a concept wherein a computer grid is created using the Internet with the sole purpose of utilizing shared resources such as computer software, hardware, on a pay-per-use model. Using Cloud computing, radiology users can efficiently manage multimodality imaging units by using the latest software and hardware without paying huge upfront costs. Cloud computing systems usually work on public, private, hybrid, or community models. Using the various components of a Cloud, such as...

  4. Toward Cloud Computing Evolution

    OpenAIRE

    Susanto, Heru; Almunawar, Mohammad Nabil; Kang, Chen Chin

    2012-01-01

    -Information Technology (IT) shaped the success of organizations, giving them a solid foundation that increases both their level of efficiency as well as productivity. The computing industry is witnessing a paradigm shift in the way computing is performed worldwide. There is a growing awareness among consumers and enterprises to access their IT resources extensively through a "utility" model known as "cloud computing." Cloud computing was initially rooted in distributed grid-based computing. ...

  5. Algorithmically specialized parallel computers

    CERN Document Server

    Snyder, Lawrence; Gannon, Dennis B

    1985-01-01

    Algorithmically Specialized Parallel Computers focuses on the concept and characteristics of an algorithmically specialized computer.This book discusses the algorithmically specialized computers, algorithmic specialization using VLSI, and innovative architectures. The architectures and algorithms for digital signal, speech, and image processing and specialized architectures for numerical computations are also elaborated. Other topics include the model for analyzing generalized inter-processor, pipelined architecture for search tree maintenance, and specialized computer organization for raster

  6. Synthetic Computation: Chaos Computing, Logical Stochastic Resonance, and Adaptive Computing

    Science.gov (United States)

    Kia, Behnam; Murali, K.; Jahed Motlagh, Mohammad-Reza; Sinha, Sudeshna; Ditto, William L.

    Nonlinearity and chaos can illustrate numerous behaviors and patterns, and one can select different patterns from this rich library of patterns. In this paper we focus on synthetic computing, a field that engineers and synthesizes nonlinear systems to obtain computation. We explain the importance of nonlinearity, and describe how nonlinear systems can be engineered to perform computation. More specifically, we provide an overview of chaos computing, a field that manually programs chaotic systems to build different types of digital functions. Also we briefly describe logical stochastic resonance (LSR), and then extend the approach of LSR to realize combinational digital logic systems via suitable concatenation of existing logical stochastic resonance blocks. Finally we demonstrate how a chaotic system can be engineered and mated with different machine learning techniques, such as artificial neural networks, random searching, and genetic algorithm, to design different autonomous systems that can adapt and respond to environmental conditions.

  7. Future Computer Requirements for Computational Aerodynamics

    Science.gov (United States)

    1978-01-01

    Recent advances in computational aerodynamics are discussed as well as motivations for and potential benefits of a National Aerodynamic Simulation Facility having the capability to solve fluid dynamic equations at speeds two to three orders of magnitude faster than presently possible with general computers. Two contracted efforts to define processor architectures for such a facility are summarized.

  8. Computers and Computation. Readings from Scientific American.

    Science.gov (United States)

    Fenichel, Robert R.; Weizenbaum, Joseph

    A collection of articles from "Scientific American" magazine has been put together at this time because the current period in computer science is one of consolidation rather than innovation. A few years ago, computer science was moving so swiftly that even the professional journals were more archival than informative; but today it is…

  9. Know Your Personal Computer Introduction to Computers

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 1. Know Your Personal Computer Introduction to Computers. Siddhartha Kumar Ghoshal. Series Article Volume 1 Issue 1 January 1996 pp 48-55. Fulltext. Click here to view fulltext PDF. Permanent link:

  10. Heterotic computing: exploiting hybrid computational devices.

    Science.gov (United States)

    Kendon, Viv; Sebald, Angelika; Stepney, Susan

    2015-07-28

    Current computational theory deals almost exclusively with single models: classical, neural, analogue, quantum, etc. In practice, researchers use ad hoc combinations, realizing only recently that they can be fundamentally more powerful than the individual parts. A Theo Murphy meeting brought together theorists and practitioners of various types of computing, to engage in combining the individual strengths to produce powerful new heterotic devices. 'Heterotic computing' is defined as a combination of two or more computational systems such that they provide an advantage over either substrate used separately. This post-meeting collection of articles provides a wide-ranging survey of the state of the art in diverse computational paradigms, together with reflections on their future combination into powerful and practical applications. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  11. Cloud Computing for radiologists.

    Science.gov (United States)

    Kharat, Amit T; Safvi, Amjad; Thind, Ss; Singh, Amarjit

    2012-07-01

    Cloud computing is a concept wherein a computer grid is created using the Internet with the sole purpose of utilizing shared resources such as computer software, hardware, on a pay-per-use model. Using Cloud computing, radiology users can efficiently manage multimodality imaging units by using the latest software and hardware without paying huge upfront costs. Cloud computing systems usually work on public, private, hybrid, or community models. Using the various components of a Cloud, such as applications, client, infrastructure, storage, services, and processing power, Cloud computing can help imaging units rapidly scale and descale operations and avoid huge spending on maintenance of costly applications and storage. Cloud computing allows flexibility in imaging. It sets free radiology from the confines of a hospital and creates a virtual mobile office. The downsides to Cloud computing involve security and privacy issues which need to be addressed to ensure the success of Cloud computing in the future.

  12. Cloud Computing for radiologists

    International Nuclear Information System (INIS)

    Kharat, Amit T; Safvi, Amjad; Thind, SS; Singh, Amarjit

    2012-01-01

    Cloud computing is a concept wherein a computer grid is created using the Internet with the sole purpose of utilizing shared resources such as computer software, hardware, on a pay-per-use model. Using Cloud computing, radiology users can efficiently manage multimodality imaging units by using the latest software and hardware without paying huge upfront costs. Cloud computing systems usually work on public, private, hybrid, or community models. Using the various components of a Cloud, such as applications, client, infrastructure, storage, services, and processing power, Cloud computing can help imaging units rapidly scale and descale operations and avoid huge spending on maintenance of costly applications and storage. Cloud computing allows flexibility in imaging. It sets free radiology from the confines of a hospital and creates a virtual mobile office. The downsides to Cloud computing involve security and privacy issues which need to be addressed to ensure the success of Cloud computing in the future

  13. Cloud computing for radiologists

    Directory of Open Access Journals (Sweden)

    Amit T Kharat

    2012-01-01

    Full Text Available Cloud computing is a concept wherein a computer grid is created using the Internet with the sole purpose of utilizing shared resources such as computer software, hardware, on a pay-per-use model. Using Cloud computing, radiology users can efficiently manage multimodality imaging units by using the latest software and hardware without paying huge upfront costs. Cloud computing systems usually work on public, private, hybrid, or community models. Using the various components of a Cloud, such as applications, client, infrastructure, storage, services, and processing power, Cloud computing can help imaging units rapidly scale and descale operations and avoid huge spending on maintenance of costly applications and storage. Cloud computing allows flexibility in imaging. It sets free radiology from the confines of a hospital and creates a virtual mobile office. The downsides to Cloud computing involve security and privacy issues which need to be addressed to ensure the success of Cloud computing in the future.

  14. Masticatory performance and bite force in children with primary dentition Performance mastigatória e força de mordida em crianças na dentição decídua

    Directory of Open Access Journals (Sweden)

    Maria Beatriz Duarte Gavião

    2007-06-01

    Full Text Available The aim of this study was to evaluate the relationship between masticatory performance and maximum bite force in the primary dentition. The sample comprised 15 children of both genders, aged 3 to 5.5 years, with good systemic and oral health, presence of all primary teeth without large caries, no structural anomalies, without severe malocclusion, and no history of orthodontic treatment. They chewed one standardized silicone tablet for 20 strokes and the median areas of the chewed particles were measured by an optical digital system. Enhanced performance was measured by a decrease in the chewed particle areas and an increase in the amount of chewed particles. The bite force was determined using a transmitter pressurized tube connected to an analog/digital electronic circuit. Weight, height and body mass index (kg/m² were determined. The data were analyzed by descriptive statistics and Pearson or Spearman's correlations, after assessment of the normality of the distribution by Shapiro-Wilks' W-test. There was no correlation between bite force and particle area and amount (p > 0.05, neither were the body variables correlated with the masticatory variables (p > 0.05. It was concluded that the bite force was not a primary determinant of masticatory performance, and both variables were not dependent on body variables in the studied sample.O objetivo deste estudo foi avaliar a correlação entre performance mastigatória e força de mordida máxima na dentição decídua. A amostra consistiu de 15 crianças de 3 a 5,5 anos de idade, de ambos os gêneros, apresentando boa saúde bucal e sistêmica, com a presença de todos os dentes decíduos, sem cáries extensas, sem anomalias estruturais, sem maloclusão severa e ausência de tratamento ortodôntico. Um tablete de silicone foi mastigado durante 20 ciclos e as áreas medianas das partículas foram mensuradas por um sistema óptico digital. A performance mastigatória foi considerada melhor quanto

  15. Estudo cefalométrico das características ântero-posteriores em jovens com dentadura decídua Cephalometric study of the antero-posterior characteristics in children with primary dentition

    Directory of Open Access Journals (Sweden)

    Marcelo Flávio Rocha Mendlovitz

    2006-10-01

    Full Text Available OBJETIVO: esse estudo propôs-se a avaliar as características cefalométricas ântero-posteriores em jovens com dentadura decídua. METODOLOGIA: foi avaliada uma amostra de 42 jovens do gênero masculino, divididos em dois grupos, um com 22 indíviduos aos 4 anos de idade (G1 e outro com 20 indíviduos aos 5 anos de idade (G2, no intuito de se obter valores cefalométricos e informações sobre o crescimento craniofacial. Selecionou-se apenas os que apresentavam tanto oclusão normal na dentadura decídua como perfis faciais harmoniosos. Foram avaliadas as medidas cefalométricas angulares SNA, SNB, ANB, SN.GoGn, 1.1, FMA, FMIA e IMPA e as lineares Nperp-A, Co-A, Co-Gn, diferença maxilo-mandibular, S-N, ENA-ENP, trespasse horizontal e a altura do ramo mandibular. Os dados obtidos foram analisados por meio do teste t de Student, com significância estatística de 5%, para detectar diferenças entre os grupos. RESULTADOS E CONCLUSÕES: observou-se somente diferenças para as medidas relativas ao IMPA e ao ângulo inter-incisivos. Os jovens do G2 apresentaram os incisivos mais verticalizados em relação à sua base óssea que o G1. Todas as medidas lineares do G2 encontraram-se maiores que as do G1, mas somente as medidas relativas a Co-A, Co-Gn e diferença maxilo-mandibular apresentaram diferenças estatisticamente significantes.AIM: the aim of this study was to evaluate the antero-posterior cephalometric characteristics in children until primary dentition. METHODS: a group of 42 males, who had normal primary dentition, divided in two groups, one of four year-old boys (n=22 and the other of boys with five years old (n=20, were evaluated to determine cephalometric norms. Simultaneously, groups were evaluated to obtain information about the facial growth on those age. The measurements were taken on lateral cephalograms. Only those who had normal primary dentition and balanced profiles were selected. The cephalometric measurements were SNA, SNB

  16. False positive reaction due to endogenous biotin activity in glandular epithelium of decidua Reação falso positiva em epitélio glandular da decídua devido a atividade endógena de biotina

    Directory of Open Access Journals (Sweden)

    Liliana Cruz Spano

    2005-06-01

    observada no núcleo de células do epitélio glandular da decídua tanto no controle positivo quanto no negativo em tecidos de primeiro e segundo trimestre gestacional. Esta reação não foi inibida com solução bloqueadora da atividade endógena de fosfatase alcalina e persistiu mesmo com a omissão das sondas. O uso de controles negativos permitiu revelar atividade endógena de biotina nuclear em epitélio glandular da decídua, responsável por reações falso positivas em sistemas de detecção estreptavidina-biotina (StrepABC. Os resultados obtidos neste estudo fortemente recomendam que a detecção de ADN por hibridização in situ em endométrio gestacional seja feita com outro sistema de detecção que não o StrepABC.

  17. Levantamento florístico de uma mata decídua em Uberlândia, Minas Gerais, Brasil Floriste survey of an area of deciduous forest in Uberlândia, Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Luciene Alves Rodrigues

    1997-12-01

    Full Text Available Esse trabalho consistiu de levantamento florístico em mata mesófila decídua situada em solo raso de origem basáltica em Uberlândia, Minas Gerais. Foram feitas visitas quinzenais à mata, no período de fevereiro/93 a junho/95, para coletas de exemplares botânicos férteis. O material coletado foi incorporado ao Herbário da Universidade Federal de Uberlândia (HUFU. Foram identificadas 105 espécies de árvores, arbustos, lianas e herbáceas, distribuídas em 88 gêneros e 43 famílias. As espécies mais freqüentes na mata foram: Anadenanthera colubrina, Bauhinia sp., Croton sp., Myracrodruon urundeuva e Sweetiafruticosa. Euphorbiaceae (10, Rubiaceae (8, Mimosaceae (6, Myrtaceae (6, Caesalpinaceae (5 e Fabaceae (5 foram as famílias com maior número de espécies identificadas.A floristic survey was carried out in a deciduous forest on a shallow basaltic soil, in Uberlândia, Minas Gerais. Visits were performed fortnightly from February/93 to June/95. The sampled material was lodged at the Herbarium of the Universidade Federal de Uberlândia (HUFU. A list is provided with 105 species of trees, shrubs, scandent shrubs, lianas and herbs, belonging to 88 genera and 43 botanic families. The most frequent species were: Anadenanthera colubrina, Bauhinia sp., Croton sp., Myracrodruon urundeuva and Sweetia fruticosa. Euphorbiaceae (10, Rubiaceae (8, Mimosaceae (6, Myrtaceae (6, Caesalpinaceae (5 e Fabaceae (5 were the families with the largest numbers of identified species.

  18. Review of quantum computation

    International Nuclear Information System (INIS)

    Lloyd, S.

    1992-01-01

    Digital computers are machines that can be programmed to perform logical and arithmetical operations. Contemporary digital computers are ''universal,'' in the sense that a program that runs on one computer can, if properly compiled, run on any other computer that has access to enough memory space and time. Any one universal computer can simulate the operation of any other; and the set of tasks that any such machine can perform is common to all universal machines. Since Bennett's discovery that computation can be carried out in a non-dissipative fashion, a number of Hamiltonian quantum-mechanical systems have been proposed whose time-evolutions over discrete intervals are equivalent to those of specific universal computers. The first quantum-mechanical treatment of computers was given by Benioff, who exhibited a Hamiltonian system with a basis whose members corresponded to the logical states of a Turing machine. In order to make the Hamiltonian local, in the sense that its structure depended only on the part of the computation being performed at that time, Benioff found it necessary to make the Hamiltonian time-dependent. Feynman discovered a way to make the computational Hamiltonian both local and time-independent by incorporating the direction of computation in the initial condition. In Feynman's quantum computer, the program is a carefully prepared wave packet that propagates through different computational states. Deutsch presented a quantum computer that exploits the possibility of existing in a superposition of computational states to perform tasks that a classical computer cannot, such as generating purely random numbers, and carrying out superpositions of computations as a method of parallel processing. In this paper, we show that such computers, by virtue of their common function, possess a common form for their quantum dynamics

  19. Computers for imagemaking

    CERN Document Server

    Clark, D

    1981-01-01

    Computers for Image-Making tells the computer non-expert all he needs to know about Computer Animation. In the hands of expert computer engineers, computer picture-drawing systems have, since the earliest days of computing, produced interesting and useful images. As a result of major technological developments since then, it no longer requires the expert's skill to draw pictures; anyone can do it, provided they know how to use the appropriate machinery. This collection of specially commissioned articles reflects the diversity of user applications in this expanding field

  20. Computer Lexis and Terminology

    Directory of Open Access Journals (Sweden)

    Gintautas Grigas

    2011-04-01

    Full Text Available Computer becomes a widely used tool in everyday work and at home. Every computer user sees texts on its screen containing a lot of words naming new concepts. Those words come from the terminology used by specialists. The common vocabury between computer terminology and lexis of everyday language comes into existence. The article deals with the part of computer terminology which goes to everyday usage and the influence of ordinary language to computer terminology. The relation between English and Lithuanian computer terminology, the construction and pronouncing of acronyms are discussed as well.

  1. Computations in plasma physics

    International Nuclear Information System (INIS)

    Cohen, B.I.; Killeen, J.

    1984-01-01

    A review of computer application in plasma physics is presented. Computer contribution to the investigation of magnetic and inertial confinement of a plasma and charged particle beam propagation is described. Typical utilization of computer for simulation and control of laboratory and cosmic experiments with a plasma and for data accumulation in these experiments is considered. Basic computational methods applied in plasma physics are discussed. Future trends of computer utilization in plasma reseaches are considered in terms of an increasing role of microprocessors and high-speed data plotters and the necessity of more powerful computer application

  2. Quantum computer science

    CERN Document Server

    Lanzagorta, Marco

    2009-01-01

    In this text we present a technical overview of the emerging field of quantum computation along with new research results by the authors. What distinguishes our presentation from that of others is our focus on the relationship between quantum computation and computer science. Specifically, our emphasis is on the computational model of quantum computing rather than on the engineering issues associated with its physical implementation. We adopt this approach for the same reason that a book on computer programming doesn't cover the theory and physical realization of semiconductors. Another distin

  3. Explorations in quantum computing

    CERN Document Server

    Williams, Colin P

    2011-01-01

    By the year 2020, the basic memory components of a computer will be the size of individual atoms. At such scales, the current theory of computation will become invalid. ""Quantum computing"" is reinventing the foundations of computer science and information theory in a way that is consistent with quantum physics - the most accurate model of reality currently known. Remarkably, this theory predicts that quantum computers can perform certain tasks breathtakingly faster than classical computers -- and, better yet, can accomplish mind-boggling feats such as teleporting information, breaking suppos

  4. Physics vs. computer science

    International Nuclear Information System (INIS)

    Pike, R.

    1982-01-01

    With computers becoming more frequently used in theoretical and experimental physics, physicists can no longer afford to be ignorant of the basic techniques and results of computer science. Computing principles belong in a physicist's tool box, along with experimental methods and applied mathematics, and the easiest way to educate physicists in computing is to provide, as part of the undergraduate curriculum, a computing course designed specifically for physicists. As well, the working physicist should interact with computer scientists, giving them challenging problems in return for their expertise. (orig.)

  5. Polymorphous computing fabric

    Science.gov (United States)

    Wolinski, Christophe Czeslaw [Los Alamos, NM; Gokhale, Maya B [Los Alamos, NM; McCabe, Kevin Peter [Los Alamos, NM

    2011-01-18

    Fabric-based computing systems and methods are disclosed. A fabric-based computing system can include a polymorphous computing fabric that can be customized on a per application basis and a host processor in communication with said polymorphous computing fabric. The polymorphous computing fabric includes a cellular architecture that can be highly parameterized to enable a customized synthesis of fabric instances for a variety of enhanced application performances thereof. A global memory concept can also be included that provides the host processor random access to all variables and instructions associated with the polymorphous computing fabric.

  6. Computer ray tracing speeds.

    Science.gov (United States)

    Robb, P; Pawlowski, B

    1990-05-01

    The results of measuring the ray trace speed and compilation speed of thirty-nine computers in fifty-seven configurations, ranging from personal computers to super computers, are described. A correlation of ray trace speed has been made with the LINPACK benchmark which allows the ray trace speed to be estimated using LINPACK performance data. The results indicate that the latest generation of workstations, using CPUs based on RISC (Reduced Instruction Set Computer) technology, are as fast or faster than mainframe computers in compute-bound situations.

  7. Computing networks from cluster to cloud computing

    CERN Document Server

    Vicat-Blanc, Pascale; Guillier, Romaric; Soudan, Sebastien

    2013-01-01

    "Computing Networks" explores the core of the new distributed computing infrastructures we are using today:  the networking systems of clusters, grids and clouds. It helps network designers and distributed-application developers and users to better understand the technologies, specificities, constraints and benefits of these different infrastructures' communication systems. Cloud Computing will give the possibility for millions of users to process data anytime, anywhere, while being eco-friendly. In order to deliver this emerging traffic in a timely, cost-efficient, energy-efficient, and

  8. Computing Nash equilibria through computational intelligence methods

    Science.gov (United States)

    Pavlidis, N. G.; Parsopoulos, K. E.; Vrahatis, M. N.

    2005-03-01

    Nash equilibrium constitutes a central solution concept in game theory. The task of detecting the Nash equilibria of a finite strategic game remains a challenging problem up-to-date. This paper investigates the effectiveness of three computational intelligence techniques, namely, covariance matrix adaptation evolution strategies, particle swarm optimization, as well as, differential evolution, to compute Nash equilibria of finite strategic games, as global minima of a real-valued, nonnegative function. An issue of particular interest is to detect more than one Nash equilibria of a game. The performance of the considered computational intelligence methods on this problem is investigated using multistart and deflection.

  9. Reversible computing fundamentals, quantum computing, and applications

    CERN Document Server

    De Vos, Alexis

    2010-01-01

    Written by one of the few top internationally recognized experts in the field, this book concentrates on those topics that will remain fundamental, such as low power computing, reversible programming languages, and applications in thermodynamics. It describes reversible computing from various points of view: Boolean algebra, group theory, logic circuits, low-power electronics, communication, software, quantum computing. It is this multidisciplinary approach that makes it unique.Backed by numerous examples, this is useful for all levels of the scientific and academic community, from undergr

  10. Computing in high energy physics

    Energy Technology Data Exchange (ETDEWEB)

    Watase, Yoshiyuki

    1991-09-15

    The increasingly important role played by computing and computers in high energy physics is displayed in the 'Computing in High Energy Physics' series of conferences, bringing together experts in different aspects of computing - physicists, computer scientists, and vendors.

  11. Searching with Quantum Computers

    OpenAIRE

    Grover, Lov K.

    2000-01-01

    This article introduces quantum computation by analogy with probabilistic computation. A basic description of the quantum search algorithm is given by representing the algorithm as a C program in a novel way.

  12. Book Review: Computational Topology

    DEFF Research Database (Denmark)

    Raussen, Martin

    2011-01-01

    Computational Topology by Herbert Edelsbrunner and John L. Harer. American Matheamtical Society, 2010 - ISBN 978-0-8218-4925-5......Computational Topology by Herbert Edelsbrunner and John L. Harer. American Matheamtical Society, 2010 - ISBN 978-0-8218-4925-5...

  13. Essential numerical computer methods

    CERN Document Server

    Johnson, Michael L

    2010-01-01

    The use of computers and computational methods has become ubiquitous in biological and biomedical research. During the last 2 decades most basic algorithms have not changed, but what has is the huge increase in computer speed and ease of use, along with the corresponding orders of magnitude decrease in cost. A general perception exists that the only applications of computers and computer methods in biological and biomedical research are either basic statistical analysis or the searching of DNA sequence data bases. While these are important applications they only scratch the surface of the current and potential applications of computers and computer methods in biomedical research. The various chapters within this volume include a wide variety of applications that extend far beyond this limited perception. As part of the Reliable Lab Solutions series, Essential Numerical Computer Methods brings together chapters from volumes 210, 240, 321, 383, 384, 454, and 467 of Methods in Enzymology. These chapters provide ...

  14. Know Your Personal Computer

    Indian Academy of Sciences (India)

    computer with IBM PC .... read by a human and not translated by a compiler are called .... by different stages of education becomes a computer scientist. ... ancestors knew and carried out the semantic actions without question or comment.

  15. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... images. These images can be viewed on a computer monitor, printed on film or transferred to a ... other in a ring, called a gantry. The computer workstation that processes the imaging information is located ...

  16. SSCL computer planning

    International Nuclear Information System (INIS)

    Price, L.E.

    1990-01-01

    The SSC Laboratory is in the process of planning the acquisition of a substantial computing system to support the design of detectors. Advice has been sought from users and computer experts in several stages. This paper discuss this process

  17. Computed Tomography (CT) -- Sinuses

    Medline Plus

    Full Text Available ... images. These images can be viewed on a computer monitor, printed on film or transferred to a ... other in a ring, called a gantry. The computer workstation that processes the imaging information is located ...

  18. Computational Science Facility (CSF)

    Data.gov (United States)

    Federal Laboratory Consortium — PNNL Institutional Computing (PIC) is focused on meeting DOE's mission needs and is part of PNNL's overarching research computing strategy. PIC supports large-scale...

  19. Quantum Computer Science

    Science.gov (United States)

    Mermin, N. David

    2007-08-01

    Preface; 1. Cbits and Qbits; 2. General features and some simple examples; 3. Breaking RSA encryption with a quantum computer; 4. Searching with a quantum computer; 5. Quantum error correction; 6. Protocols that use just a few Qbits; Appendices; Index.

  20. Computer Vision Syndrome.

    Science.gov (United States)

    Randolph, Susan A

    2017-07-01

    With the increased use of electronic devices with visual displays, computer vision syndrome is becoming a major public health issue. Improving the visual status of workers using computers results in greater productivity in the workplace and improved visual comfort.

  1. Computed Tomography (CT) -- Sinuses

    Medline Plus

    Full Text Available ... are the limitations of CT of the Sinuses? What is CT (Computed Tomography) of the Sinuses? Computed ... nasal cavity by small openings. top of page What are some common uses of the procedure? CT ...

  2. Computer Technology Directory.

    Science.gov (United States)

    Exceptional Parent, 1990

    1990-01-01

    This directory lists approximately 300 commercial vendors that offer computer hardware, software, and communication aids for children with disabilities. The company listings indicate computer compatibility and specific disabilities served by their products. (JDD)

  3. My Computer Is Learning.

    Science.gov (United States)

    Good, Ron

    1986-01-01

    Describes instructional uses of computer programs found in David Heiserman's book "Projects in Machine Intelligence for Your Home Computer." The programs feature "creatures" of various colors that move around within a rectangular white border. (JN)

  4. What is Computed Tomography?

    Science.gov (United States)

    ... Imaging Medical X-ray Imaging What is Computed Tomography? Share Tweet Linkedin Pin it More sharing options ... Chest X ray Image back to top Computed Tomography (CT) Although also based on the variable absorption ...

  5. Joint Computing Facility

    Data.gov (United States)

    Federal Laboratory Consortium — Raised Floor Computer Space for High Performance ComputingThe ERDC Information Technology Laboratory (ITL) provides a robust system of IT facilities to develop and...

  6. Computing for Belle

    CERN Multimedia

    CERN. Geneva

    2004-01-01

    2s-1, 10 times as much as we obtain now. This presentation describes Belle's efficient computing operations, struggles to manage large amount of raw and physics data, and plans for Belle computing for Super KEKB/Belle.

  7. Computational Continuum Mechanics

    CERN Document Server

    Shabana, Ahmed A

    2011-01-01

    This text presents the theory of continuum mechanics using computational methods. Ideal for students and researchers, the second edition features a new chapter on computational geometry and finite element analysis.

  8. Applications of computer algebra

    CERN Document Server

    1985-01-01

    Today, certain computer software systems exist which surpass the computational ability of researchers when their mathematical techniques are applied to many areas of science and engineering. These computer systems can perform a large portion of the calculations seen in mathematical analysis. Despite this massive power, thousands of people use these systems as a routine resource for everyday calculations. These software programs are commonly called "Computer Algebra" systems. They have names such as MACSYMA, MAPLE, muMATH, REDUCE and SMP. They are receiving credit as a computational aid with in­ creasing regularity in articles in the scientific and engineering literature. When most people think about computers and scientific research these days, they imagine a machine grinding away, processing numbers arithmetically. It is not generally realized that, for a number of years, computers have been performing non-numeric computations. This means, for example, that one inputs an equa­ tion and obtains a closed for...

  9. ICASE Computer Science Program

    Science.gov (United States)

    1985-01-01

    The Institute for Computer Applications in Science and Engineering computer science program is discussed in outline form. Information is given on such topics as problem decomposition, algorithm development, programming languages, and parallel architectures.

  10. Computed Tomography (CT) -- Sinuses

    Medline Plus

    Full Text Available ... ring, called a gantry. The computer workstation that processes the imaging information is located in a separate ... follows a spiral path. A special computer program processes this large volume of data to create two- ...

  11. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... ring, called a gantry. The computer workstation that processes the imaging information is located in a separate ... follows a spiral path. A special computer program processes this large volume of data to create two- ...

  12. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... Stroke Brain Tumors Computer Tomography (CT) Safety During Pregnancy Head and Neck Cancer X-ray, Interventional Radiology and Nuclear Medicine Radiation Safety Images related to Computed Tomography (CT) - ...

  13. Intimacy and Computer Communication.

    Science.gov (United States)

    Robson, Dave; Robson, Maggie

    1998-01-01

    Addresses the relationship between intimacy and communication that is based on computer technology. Discusses definitions of intimacy and the nature of intimate conversations that use computers as a communications medium. Explores implications for counseling. (MKA)

  14. Computed Tomography (CT) -- Sinuses

    Medline Plus

    Full Text Available ... other in a ring, called a gantry. The computer workstation that processes the imaging information is located ... ray beam follows a spiral path. A special computer program processes this large volume of data to ...

  15. Cognitive Computing for Security.

    Energy Technology Data Exchange (ETDEWEB)

    Debenedictis, Erik [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Rothganger, Fredrick [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Aimone, James Bradley [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Marinella, Matthew [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Evans, Brian Robert [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Warrender, Christina E. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mickel, Patrick [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-12-01

    Final report for Cognitive Computing for Security LDRD 165613. It reports on the development of hybrid of general purpose/ne uromorphic computer architecture, with an emphasis on potential implementation with memristors.

  16. STARS: An Integrated, Multidisciplinary, Finite-Element, Structural, Fluids, Aeroelastic, and Aeroservoelastic Analysis Computer Program

    Science.gov (United States)

    Gupta, K. K.

    1997-01-01

    A multidisciplinary, finite element-based, highly graphics-oriented, linear and nonlinear analysis capability that includes such disciplines as structures, heat transfer, linear aerodynamics, computational fluid dynamics, and controls engineering has been achieved by integrating several new modules in the original STARS (STructural Analysis RoutineS) computer program. Each individual analysis module is general-purpose in nature and is effectively integrated to yield aeroelastic and aeroservoelastic solutions of complex engineering problems. Examples of advanced NASA Dryden Flight Research Center projects analyzed by the code in recent years include the X-29A, F-18 High Alpha Research Vehicle/Thrust Vectoring Control System, B-52/Pegasus Generic Hypersonics, National AeroSpace Plane (NASP), SR-71/Hypersonic Launch Vehicle, and High Speed Civil Transport (HSCT) projects. Extensive graphics capabilities exist for convenient model development and postprocessing of analysis results. The program is written in modular form in standard FORTRAN language to run on a variety of computers, such as the IBM RISC/6000, SGI, DEC, Cray, and personal computer; associated graphics codes use OpenGL and IBM/graPHIGS language for color depiction. This program is available from COSMIC, the NASA agency for distribution of computer programs.

  17. Computation: A New Open Access Journal of Computational Chemistry, Computational Biology and Computational Engineering

    OpenAIRE

    Karlheinz Schwarz; Rainer Breitling; Christian Allen

    2013-01-01

    Computation (ISSN 2079-3197; http://www.mdpi.com/journal/computation) is an international scientific open access journal focusing on fundamental work in the field of computational science and engineering. Computational science has become essential in many research areas by contributing to solving complex problems in fundamental science all the way to engineering. The very broad range of application domains suggests structuring this journal into three sections, which are briefly characterized ...

  18. Nanoelectronics: Metrology and Computation

    International Nuclear Information System (INIS)

    Lundstrom, Mark; Clark, Jason V.; Klimeck, Gerhard; Raman, Arvind

    2007-01-01

    Research in nanoelectronics poses new challenges for metrology, but advances in theory, simulation and computing and networking technology provide new opportunities to couple simulation and metrology. This paper begins with a brief overview of current work in computational nanoelectronics. Three examples of how computation can assist metrology will then be discussed. The paper concludes with a discussion of how cyberinfrastructure can help connect computing and metrology using the nanoHUB (www.nanoHUB.org) as a specific example

  19. Foundations of Neuromorphic Computing

    Science.gov (United States)

    2013-05-01

    paradigms: few sensors/complex computations and many sensors/simple computation. Challenges with Nano-enabled Neuromorphic Chips A wide variety of...FOUNDATIONS OF NEUROMORPHIC COMPUTING MAY 2013 FINAL TECHNICAL REPORT APPROVED FOR PUBLIC RELEASE; DISTRIBUTION...2009 – SEP 2012 4. TITLE AND SUBTITLE FOUNDATIONS OF NEUROMORPHIC COMPUTING 5a. CONTRACT NUMBER IN-HOUSE 5b. GRANT NUMBER N/A 5c. PROGRAM

  20. Approximation and Computation

    CERN Document Server

    Gautschi, Walter; Rassias, Themistocles M

    2011-01-01

    Approximation theory and numerical analysis are central to the creation of accurate computer simulations and mathematical models. Research in these areas can influence the computational techniques used in a variety of mathematical and computational sciences. This collection of contributed chapters, dedicated to renowned mathematician Gradimir V. Milovanovia, represent the recent work of experts in the fields of approximation theory and numerical analysis. These invited contributions describe new trends in these important areas of research including theoretic developments, new computational alg

  1. Computed tomography for radiographers

    International Nuclear Information System (INIS)

    Brooker, M.

    1986-01-01

    Computed tomography is regarded by many as a complicated union of sophisticated x-ray equipment and computer technology. This book overcomes these complexities. The rigid technicalities of the machinery and the clinical aspects of computed tomography are discussed including the preparation of patients, both physically and mentally, for scanning. Furthermore, the author also explains how to set up and run a computed tomography department, including advice on how the room should be designed

  2. Quantum computing and probability.

    Science.gov (United States)

    Ferry, David K

    2009-11-25

    Over the past two decades, quantum computing has become a popular and promising approach to trying to solve computationally difficult problems. Missing in many descriptions of quantum computing is just how probability enters into the process. Here, we discuss some simple examples of how uncertainty and probability enter, and how this and the ideas of quantum computing challenge our interpretations of quantum mechanics. It is found that this uncertainty can lead to intrinsic decoherence, and this raises challenges for error correction.

  3. Quantum computing and probability

    International Nuclear Information System (INIS)

    Ferry, David K

    2009-01-01

    Over the past two decades, quantum computing has become a popular and promising approach to trying to solve computationally difficult problems. Missing in many descriptions of quantum computing is just how probability enters into the process. Here, we discuss some simple examples of how uncertainty and probability enter, and how this and the ideas of quantum computing challenge our interpretations of quantum mechanics. It is found that this uncertainty can lead to intrinsic decoherence, and this raises challenges for error correction. (viewpoint)

  4. Quantum mechanics and computation

    International Nuclear Information System (INIS)

    Cirac Sasturain, J. I.

    2000-01-01

    We review how some of the basic principles of Quantum Mechanics can be used in the field of computation. In particular, we explain why a quantum computer can perform certain tasks in a much more efficient way than the computers we have available nowadays. We give the requirements for a quantum system to be able to implement a quantum computer and illustrate these requirements in some particular physical situations. (Author) 16 refs

  5. COMPUTATIONAL SCIENCE CENTER

    Energy Technology Data Exchange (ETDEWEB)

    DAVENPORT,J.

    2004-11-01

    The Brookhaven Computational Science Center brings together researchers in biology, chemistry, physics, and medicine with applied mathematicians and computer scientists to exploit the remarkable opportunities for scientific discovery which have been enabled by modern computers. These opportunities are especially great in computational biology and nanoscience, but extend throughout science and technology and include for example, nuclear and high energy physics, astrophysics, materials and chemical science, sustainable energy, environment, and homeland security.

  6. COMPUTER GAMES AND EDUCATION

    OpenAIRE

    Sukhov, Anton

    2018-01-01

    This paper devoted to the research of educational resources and possibilities of modern computer games. The “internal” educational aspects of computer games include educational mechanism (a separate or integrated “tutorial”) and representation of a real or even fantastic educational process within virtual worlds. The “external” dimension represents educational opportunities of computer games for personal and professional development in different genres of computer games (various transport, so...

  7. Man and computer

    International Nuclear Information System (INIS)

    Fischbach, K.F.

    1981-01-01

    The discussion of cultural and sociological consequences of computer evolution is hindered by human prejudice. For example the sentence 'a computer is at best as intelligent as its programmer' veils actual developments. Theoretical limits of computer intelligence are the limits of intelligence in general. Modern computer systems replace not only human labour, but also human decision making and thereby human responsibility. The historical situation is unique. Human head-work is being automated and man is loosing function. (orig.) [de

  8. Computational physics an introduction

    CERN Document Server

    Vesely, Franz J

    1994-01-01

    Author Franz J. Vesely offers students an introductory text on computational physics, providing them with the important basic numerical/computational techniques. His unique text sets itself apart from others by focusing on specific problems of computational physics. The author also provides a selection of modern fields of research. Students will benefit from the appendixes which offer a short description of some properties of computing and machines and outline the technique of 'Fast Fourier Transformation.'

  9. Computing environment logbook

    Science.gov (United States)

    Osbourn, Gordon C; Bouchard, Ann M

    2012-09-18

    A computing environment logbook logs events occurring within a computing environment. The events are displayed as a history of past events within the logbook of the computing environment. The logbook provides search functionality to search through the history of past events to find one or more selected past events, and further, enables an undo of the one or more selected past events.

  10. The Computer Revolution.

    Science.gov (United States)

    Berkeley, Edmund C.

    "The Computer Revolution", a part of the "Second Industrial Revolution", is examined with reference to the social consequences of computers. The subject is introduced in an opening section which discusses the revolution in the handling of information and the history, powers, uses, and working s of computers. A second section examines in detail the…

  11. Advances in physiological computing

    CERN Document Server

    Fairclough, Stephen H

    2014-01-01

    This edited collection will provide an overview of the field of physiological computing, i.e. the use of physiological signals as input for computer control. It will cover a breadth of current research, from brain-computer interfaces to telemedicine.

  12. Physics of quantum computation

    International Nuclear Information System (INIS)

    Belokurov, V.V.; Khrustalev, O.A.; Sadovnichij, V.A.; Timofeevskaya, O.D.

    2003-01-01

    In the paper, the modern status of the theory of quantum computation is considered. The fundamental principles of quantum computers and their basic notions such as quantum processors and computational basis states of the quantum Turing machine as well as the quantum Fourier transform are discussed. Some possible experimental realizations on the basis of NMR methods are given

  13. Quantum walk computation

    International Nuclear Information System (INIS)

    Kendon, Viv

    2014-01-01

    Quantum versions of random walks have diverse applications that are motivating experimental implementations as well as theoretical studies. Recent results showing quantum walks are “universal for quantum computation” relate to algorithms, to be run on quantum computers. We consider whether an experimental implementation of a quantum walk could provide useful computation before we have a universal quantum computer

  14. The Challenge of Computers.

    Science.gov (United States)

    Leger, Guy

    Computers may change teachers' lifestyles, teaching styles, and perhaps even their personal values. A brief survey of the history of computers demonstrates the incredible pace at which computer technology is moving ahead. The cost and size of microchips will continue to decline dramatically over the next 20 years, while the capability and variety…

  15. Visitor's Computer Guidelines | CTIO

    Science.gov (United States)

    Visitor's Computer Guidelines Network Connection Request Instruments Instruments by Telescope IR Instruments Guidelines Library Facilities Outreach NOAO-S EPO Program team Art of Darkness Image Gallery EPO/CADIAS ‹› You are here CTIO Home » Astronomers » Visitor's Computer Guidelines Visitor's Computer

  16. Medical Computational Thinking

    DEFF Research Database (Denmark)

    Musaeus, Peter; Tatar, Deborah Gail; Rosen, Michael A.

    2017-01-01

    Computational thinking (CT) in medicine means deliberating when to pursue computer-mediated solutions to medical problems and evaluating when such solutions are worth pursuing in order to assist in medical decision making. Teaching computational thinking (CT) at medical school should be aligned...

  17. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... Physician Resources Professions Site Index A-Z Computed Tomography (CT) - Head Computed tomography (CT) of the head uses special x-ray ... What is CT Scanning of the Head? Computed tomography, more commonly known as a CT or CAT ...

  18. Emission computed tomography

    International Nuclear Information System (INIS)

    Ott, R.J.

    1986-01-01

    Emission Computed Tomography is a technique used for producing single or multiple cross-sectional images of the distribution of radionuclide labelled agents in vivo. The techniques of Single Photon Emission Computed Tomography (SPECT) and Positron Emission Tomography (PET) are described with particular regard to the function of the detectors used to produce images and the computer techniques used to build up images. (UK)

  19. Computed Tomography (CT) -- Sinuses

    Medline Plus

    Full Text Available ... Physician Resources Professions Site Index A-Z Computed Tomography (CT) - Sinuses Computed tomography (CT) of the sinuses uses special x-ray equipment ... story here Images × Image Gallery Patient undergoing computed tomography (CT) scan. View full size with caption Pediatric Content ...

  20. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... Physician Resources Professions Site Index A-Z Computed Tomography (CT) - Head Computed tomography (CT) of the head uses special x-ray equipment ... story here Images × Image Gallery Patient undergoing computed tomography (CT) scan. View full size with caption Pediatric Content ...

  1. Beyond the Computer Literacy.

    Science.gov (United States)

    Streibel, Michael J.; Garhart, Casey

    1985-01-01

    Describes the approach taken in an education computing course for pre- and in-service teachers. Outlines the basic operational, analytical, and evaluation skills that are emphasized in the course, suggesting that these skills go beyond the attainment of computer literacy and can assist in the effective use of computers. (ML)

  2. Computer algebra applications

    International Nuclear Information System (INIS)

    Calmet, J.

    1982-01-01

    A survey of applications based either on fundamental algorithms in computer algebra or on the use of a computer algebra system is presented. Recent work in biology, chemistry, physics, mathematics and computer science is discussed. In particular, applications in high energy physics (quantum electrodynamics), celestial mechanics and general relativity are reviewed. (Auth.)

  3. Computer-assisted instruction

    NARCIS (Netherlands)

    Voogt, J.; Fisser, P.; Wright, J.D.

    2015-01-01

    Since the early days of computer technology in education in the 1960s, it was claimed that computers can assist instructional practice and hence improve student learning. Since then computer technology has developed, and its potential for education has increased. In this article, we first discuss

  4. Designing with computational intelligence

    CERN Document Server

    Lopes, Heitor; Mourelle, Luiza

    2017-01-01

    This book discusses a number of real-world applications of computational intelligence approaches. Using various examples, it demonstrates that computational intelligence has become a consolidated methodology for automatically creating new competitive solutions to complex real-world problems. It also presents a concise and efficient synthesis of different systems using computationally intelligent techniques.

  5. A new computing principle

    International Nuclear Information System (INIS)

    Fatmi, H.A.; Resconi, G.

    1988-01-01

    In 1954 while reviewing the theory of communication and cybernetics the late Professor Dennis Gabor presented a new mathematical principle for the design of advanced computers. During our work on these computers it was found that the Gabor formulation can be further advanced to include more recent developments in Lie algebras and geometric probability, giving rise to a new computing principle

  6. Computers and Information Flow.

    Science.gov (United States)

    Patrick, R. L.

    This paper is designed to fill the need for an easily understood introduction to the computing and data processing field for the layman who has, or can expect to have, some contact with it. Information provided includes the unique terminology and jargon of the field, the various types of computers and the scope of computational capabilities, and…

  7. Computer naratology: narrative templates in computer games

    OpenAIRE

    Praks, Vítězslav

    2009-01-01

    Relations and actions between literature and computer games were examined. Study contains theoretical analysis of game as an aesthetic artefact. To play a game means to leave practical world for sake of a fictional world. Artistic communication has more similarities with game communication than with normal, practical communication. Game study can help us understand basic concepts of art communication (game rules - poetic rules, game world - fiction, function in game - meaning in art). Compute...

  8. Neural Computation and the Computational Theory of Cognition

    Science.gov (United States)

    Piccinini, Gualtiero; Bahar, Sonya

    2013-01-01

    We begin by distinguishing computationalism from a number of other theses that are sometimes conflated with it. We also distinguish between several important kinds of computation: computation in a generic sense, digital computation, and analog computation. Then, we defend a weak version of computationalism--neural processes are computations in the…

  9. Quantum computing and spintronics

    International Nuclear Information System (INIS)

    Kantser, V.

    2007-01-01

    Tentative to build a computer, which can operate according to the quantum laws, has leaded to concept of quantum computing algorithms and hardware. In this review we highlight recent developments which point the way to quantum computing on the basis solid state nanostructures after some general considerations concerning quantum information science and introducing a set of basic requirements for any quantum computer proposal. One of the major direction of research on the way to quantum computing is to exploit the spin (in addition to the orbital) degree of freedom of the electron, giving birth to the field of spintronics. We address some semiconductor approach based on spin orbit coupling in semiconductor nanostructures. (authors)

  10. Theory of computation

    CERN Document Server

    Tourlakis, George

    2012-01-01

    Learn the skills and acquire the intuition to assess the theoretical limitations of computer programming Offering an accessible approach to the topic, Theory of Computation focuses on the metatheory of computing and the theoretical boundaries between what various computational models can do and not do—from the most general model, the URM (Unbounded Register Machines), to the finite automaton. A wealth of programming-like examples and easy-to-follow explanations build the general theory gradually, which guides readers through the modeling and mathematical analysis of computational pheno

  11. Computer Security Handbook

    CERN Document Server

    Bosworth, Seymour; Whyne, Eric

    2012-01-01

    The classic and authoritative reference in the field of computer security, now completely updated and revised With the continued presence of large-scale computers; the proliferation of desktop, laptop, and handheld computers; and the vast international networks that interconnect them, the nature and extent of threats to computer security have grown enormously. Now in its fifth edition, Computer Security Handbook continues to provide authoritative guidance to identify and to eliminate these threats where possible, as well as to lessen any losses attributable to them. With seventy-seven chapter

  12. Secure cloud computing

    CERN Document Server

    Jajodia, Sushil; Samarati, Pierangela; Singhal, Anoop; Swarup, Vipin; Wang, Cliff

    2014-01-01

    This book presents a range of cloud computing security challenges and promising solution paths. The first two chapters focus on practical considerations of cloud computing. In Chapter 1, Chandramouli, Iorga, and Chokani describe the evolution of cloud computing and the current state of practice, followed by the challenges of cryptographic key management in the cloud. In Chapter 2, Chen and Sion present a dollar cost model of cloud computing and explore the economic viability of cloud computing with and without security mechanisms involving cryptographic mechanisms. The next two chapters addres

  13. Scalable optical quantum computer

    Energy Technology Data Exchange (ETDEWEB)

    Manykin, E A; Mel' nichenko, E V [Institute for Superconductivity and Solid-State Physics, Russian Research Centre ' Kurchatov Institute' , Moscow (Russian Federation)

    2014-12-31

    A way of designing a scalable optical quantum computer based on the photon echo effect is proposed. Individual rare earth ions Pr{sup 3+}, regularly located in the lattice of the orthosilicate (Y{sub 2}SiO{sub 5}) crystal, are suggested to be used as optical qubits. Operations with qubits are performed using coherent and incoherent laser pulses. The operation protocol includes both the method of measurement-based quantum computations and the technique of optical computations. Modern hybrid photon echo protocols, which provide a sufficient quantum efficiency when reading recorded states, are considered as most promising for quantum computations and communications. (quantum computer)

  14. Computing meaning v.4

    CERN Document Server

    Bunt, Harry; Pulman, Stephen

    2013-01-01

    This book is a collection of papers by leading researchers in computational semantics. It presents a state-of-the-art overview of recent and current research in computational semantics, including descriptions of new methods for constructing and improving resources for semantic computation, such as WordNet, VerbNet, and semantically annotated corpora. It also presents new statistical methods in semantic computation, such as the application of distributional semantics in the compositional calculation of sentence meanings. Computing the meaning of sentences, texts, and spoken or texted dialogue i

  15. Scalable optical quantum computer

    International Nuclear Information System (INIS)

    Manykin, E A; Mel'nichenko, E V

    2014-01-01

    A way of designing a scalable optical quantum computer based on the photon echo effect is proposed. Individual rare earth ions Pr 3+ , regularly located in the lattice of the orthosilicate (Y 2 SiO 5 ) crystal, are suggested to be used as optical qubits. Operations with qubits are performed using coherent and incoherent laser pulses. The operation protocol includes both the method of measurement-based quantum computations and the technique of optical computations. Modern hybrid photon echo protocols, which provide a sufficient quantum efficiency when reading recorded states, are considered as most promising for quantum computations and communications. (quantum computer)

  16. COMPUTATIONAL SCIENCE CENTER

    Energy Technology Data Exchange (ETDEWEB)

    DAVENPORT, J.

    2005-11-01

    The Brookhaven Computational Science Center brings together researchers in biology, chemistry, physics, and medicine with applied mathematicians and computer scientists to exploit the remarkable opportunities for scientific discovery which have been enabled by modern computers. These opportunities are especially great in computational biology and nanoscience, but extend throughout science and technology and include, for example, nuclear and high energy physics, astrophysics, materials and chemical science, sustainable energy, environment, and homeland security. To achieve our goals we have established a close alliance with applied mathematicians and computer scientists at Stony Brook and Columbia Universities.

  17. Computer algebra and operators

    Science.gov (United States)

    Fateman, Richard; Grossman, Robert

    1989-01-01

    The symbolic computation of operator expansions is discussed. Some of the capabilities that prove useful when performing computer algebra computations involving operators are considered. These capabilities may be broadly divided into three areas: the algebraic manipulation of expressions from the algebra generated by operators; the algebraic manipulation of the actions of the operators upon other mathematical objects; and the development of appropriate normal forms and simplification algorithms for operators and their actions. Brief descriptions are given of the computer algebra computations that arise when working with various operators and their actions.

  18. Cloud Computing Bible

    CERN Document Server

    Sosinsky, Barrie

    2010-01-01

    The complete reference guide to the hot technology of cloud computingIts potential for lowering IT costs makes cloud computing a major force for both IT vendors and users; it is expected to gain momentum rapidly with the launch of Office Web Apps later this year. Because cloud computing involves various technologies, protocols, platforms, and infrastructure elements, this comprehensive reference is just what you need if you'll be using or implementing cloud computing.Cloud computing offers significant cost savings by eliminating upfront expenses for hardware and software; its growing popularit

  19. Design of Computer Experiments

    DEFF Research Database (Denmark)

    Dehlendorff, Christian

    The main topic of this thesis is design and analysis of computer and simulation experiments and is dealt with in six papers and a summary report. Simulation and computer models have in recent years received increasingly more attention due to their increasing complexity and usability. Software...... packages make the development of rather complicated computer models using predefined building blocks possible. This implies that the range of phenomenas that are analyzed by means of a computer model has expanded significantly. As the complexity grows so does the need for efficient experimental designs...... and analysis methods, since the complex computer models often are expensive to use in terms of computer time. The choice of performance parameter is an important part of the analysis of computer and simulation models and Paper A introduces a new statistic for waiting times in health care units. The statistic...

  20. Computer in radiology

    International Nuclear Information System (INIS)

    Kuesters, H.

    1985-01-01

    With this publication, the author presents the requirements that a user specific software should fulfill to reach an effective practice rationalisation through computer usage and the hardware configuration necessary as basic equipment. This should make it more difficult in the future for sales representatives to sell radiologists unusable computer systems. Furthermore, questions shall be answered that were asked by computer interested radiologists during the system presentation. On the one hand there still exists a prejudice against programmes of standard texts and on the other side undefined fears, that handling a computer is to difficult and that one has to learn a computer language first to be able to work with computers. Finally, it i pointed out, the real competitive advantages can be obtained through computer usage. (orig.) [de