International Nuclear Information System (INIS)
Satish Rao, B.S.; Upadhya, D.; Adiga, S.K.
2007-01-01
The exposure of humans to ionizing radiations may be advertently by routine diagnostic and therapeutic purposes or inadvertently during natural, occupational and nuclear accident situations. Therefore, in order to overcome the deleterious biological effects of radiation several chemical agents have been studied for their radioprotective potential. The medicinal plants being one of the resources for such clinically important natural agents, used extensively in several drug discovery related research. Here the radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage was analyzed using Chinese hamster fibroblast cells (V79) and human peripheral blood lymphocytes (HPBLs) growing in vitro is reported
Huang, Ya-Yi; Cho, Shu-Ting; Haryono, Mindia; Kuo, Chih-Horng
2017-01-01
Common bermudagrass (Cynodon dactylon (L.) Pers.) belongs to the subfamily Chloridoideae of the Poaceae family, one of the most important plant families ecologically and economically. This grass has a long connection with human culture but its systematics is relatively understudied. In this study, we sequenced and investigated the chloroplast genome of common bermudagrass, which is 134,297 bp in length with two single copy regions (LSC: 79,732 bp; SSC: 12,521 bp) and a pair of inverted repeat (IR) regions (21,022 bp). The annotation contains a total of 128 predicted genes, including 82 protein-coding, 38 tRNA, and 8 rRNA genes. Additionally, our in silico analyses identified 10 sets of repeats longer than 20 bp and predicted the presence of 36 RNA editing sites. Overall, the chloroplast genome of common bermudagrass resembles those from other Poaceae lineages. Compared to most angiosperms, the accD gene and the introns of both clpP and rpoC1 genes are missing. Additionally, the ycf1, ycf2, ycf15, and ycf68 genes are pseudogenized and two genome rearrangements exist. Our phylogenetic analysis based on 47 chloroplast protein-coding genes supported the placement of common bermudagrass within Chloridoideae. Our phylogenetic character mapping based on the parsimony principle further indicated that the loss of the accD gene and clpP introns, the pseudogenization of four ycf genes, and the two rearrangements occurred only once after the most recent common ancestor of the Poaceae diverged from other monocots, which could explain the unusual long branch leading to the Poaceae when phylogeny is inferred based on chloroplast sequences.
Two new stilbene trimers from Cynodon dactylon.
Li, Bi-Jun; Liu, Yao; Gu, Ai-Tong; Zhang, Qing; Chen, Lei; Wang, Shu-Mei; Wang, Feng
2017-11-01
Many naturally occurring oligostilbenes have drawn considerable attention because of their intricate structures and diverse bioactivities. Two new stilbene trimers, cystibenetrimerol A (1) and cystibenetrimerol B (2) were isolated from the dried grass of Cynodon dactylon (L.) Pers. The planar structures and stereo configurations of them were elucidated by spectroscopic and spectrometric methods. The isolation and structures elucidation of two new stilbene trimers suggested the ordinary grass belonging to the family Poaceae may be a rich source of stilbene oligomers.
Effects of Cynodon dactylon on Stress-Induced Infertility in Male Rats
Chidrawar, VR; Chitme, HR; Patel, KN; Patel, NJ; Racharla, VR; Dhoraji, NC; Vadalia, KR
2011-01-01
Cynodon dactylon (Family: Poaceae) is known to be a tackler in Indian mythology and is offered to Lord Ganesha. It is found everywhere, even on waste land, road side, dry places, and spreads vigorously on cultivated ground. This study was carried out with an objective to test if the constituents of this plant are useful in coping stress-induced sexual In this study, we considered immobilization stress to induce male infertility and the effect of C. dactylon in restoration of the dysfunction was evaluated by considering sexual behavioral observations, sexual performance, fructose content of the seminal vesicles, epididymal sperm concentration and histopathological examinations as parameters. Treatment of rats under stress with methanolic extract of C. dactylon has shown a promising effect in overcoming stress-induced sexual dysfunction, sexual performance, fructose content, sperm concentration and its effect on accessory sexual organs and body weight. We conclude that active constituents of C. dactylon present in methanolic extract have a potent aphrodisiac and male fertility activity. PMID:21607051
Antiarthritic activity of Cynodon dactylon (L.) Pers.
Bhangale, Jitendra; Acharya, Sanjeev
2014-03-01
Cynodon dactylon (L.) (Poaceae) is traditionally used herb to treat fevers, skin diseases and rheumatic affections. The ethanolic extract of C. dactylon was found to be safe at all the dose levels (100, 200 and 400 mg/kg, orally) and there was no mortality up to the dose of 5000 mg/kg of extract when administered orally. C. dactylon showed significant antiarthritic activity against Freund's complete adjuvant induced arthritis in rats. Treatment with C. dactylon significantly reduced the mean percentage change in injected and non injected paw, ankle diameter, clinical severity and significantly increased body weight. Results were confirmed using biochemical parameters; there was a significant improvement in the levels of Hb and RBC in C. dactylon treated rats. The increased levels of WBC, ESR, C- reactive protein (CRP) and TNFalpha were significantly suppressed in C. dactylon treated rats. C. dactylon showed protective effect in arthritic joints but it has been supported by an improvement in bone lesions rather than in cartilage lesions. It can be concluded that ethanolic extract of C. dactylon at a dose of 400 mg/kg is effective in improving haematological level, CRP and reducing TNFalpha level. Phytochemical screening showed the presence of alkaloids, flavonoids and glycosides in ethanolic extract. All the above results support the traditional uses of the plant in the treatment of rheumatoid arthritis.
Directory of Open Access Journals (Sweden)
A Garjani
2008-09-01
Full Text Available Background and purpose of the study: Probable antiarrhythmic effects of Cynodon dactylon (L. pers. (family Poaceae against ischemia/reperfusion (I/R-induced arrhythmias were investigated in isolated rat heart. Methods: The hearts were subjected to 30min regional ischemia followed by 30min reperfusion and perfused with hydroalcoholic extract of rhizome of C. dactylon (25, 50, 100 and 200µg/ml. Results: During ischemia, the extract produced marked reduction in the number, duration and incidences of ventricular tachycardia (VT at 25 and 50µg/ml (p<0.001 and p<0.01, respectively. Total number of ischemic ventricular ectopic beats (VEBs were lowered by 25-100µg/ml (p<0.001, p<0.001 and p<0.05, respectively. At the reperfusion phase, C. dactylon (25 and 50µg/ml decreased incidence of VT from 100% (control to 13 and 33% (p<0.001 and p<0.05 respectively. Duration and number of VT and total VF incidence were also reduced at the same concentration (p<0.05 for all. Perfusion of the extract (25-100µg/ml was markedly lowered reversible VF duration from 218±99sec to 0 sec, 0 sec and 10±5sec (p<0.01, p<0.01 and p<0.05 respectively. Moreover, C. dactylon (25 and 50µg/ml decreased number of total VEBs from 349±73 to 35±17 (p<0.001 and 66±26 (p<0.01. In this study, it was also shown that perfusion of the extract produced a marked and concentration-dependent positive inotropic effect. Conclusion: The findings of this study indicate that C. dactylon produce protective effects against I/R-induced arrhythmias in isolated rat hearts probably by increase in the myocardial contractility and as a result by improvement of hemodynamic factors.
Assessment of antidiabetic potential of Cynodon dactylon extract in streptozotocin diabetic rats.
Singh, Santosh Kumar; Kesari, Achyut Narayan; Gupta, Rajesh Kumar; Jaiswal, Dolly; Watal, Geeta
2007-11-01
This study was undertaken to investigate the hypoglycemic and antidiabetic effect of single and repeated oral administration of the aqueous extract of Cynodon dactylon (Family: Poaceae) in normal and streptozotocin induced diabetic rats, respectively. The effect of repeated oral administration of aqueous extract on serum lipid profile in diabetic rats was also examined. A range of doses, viz. 250, 500 and 1000mg/kg bw of aqueous extract of Cynodon dactylon were evaluated and the dose of 500mg/kg was identified as the most effective dose. It lowers blood glucose level around 31% after 4h of administration in normal rats. The same dose of 500mg/kg produced a fall of 23% in blood glucose level within 1h during glucose tolerance test (GTT) of mild diabetic rats. This dose has almost similar effect as that of standard drug tolbutamide (250mg/kg bw). Severely diabetic rats were also treated daily with 500mg/kg bw for 14 days and a significant reduction of 59% was observed in fasting blood glucose level. A reduction in the urine sugar level and increase in body weight of severe diabetic rats were additional corroborating factors for its antidiabetic potential. Total cholesterol (TC), low density lipoprotein (LDL) and triglyceride (TG) levels were decreased by 35, 77 and 29%, respectively, in severely diabetic rats whereas, cardioprotective, high density lipoprotein (HDL) was increased by 18%. These results clearly indicate that aqueous extract of Cynodon dactylon has high antidiabetic potential along with significant hypoglycemic and hypolipidemic effects.
AFLP analysis of Cynodon dactylon (L.) Pers. var. dactylon genetic variation.
Wu, Y Q; Taliaferro, C M; Bai, G H; Anderson, M P
2004-08-01
Cynodon dactylon (L.) Pers. var. dactylon (common bermudagrass) is geographically widely distributed between about lat 45 degrees N and lat 45 degrees S, penetrating to about lat 53 degrees N in Europe. The extensive variation of morphological and adaptive characteristics of the taxon is substantially documented, but information is lacking on DNA molecular variation in geographically disparate forms. Accordingly, this study was conducted to assess molecular genetic variation and genetic relatedness among 28 C. dactylon var. dactylon accessions originating from 11 countries on 4 continents (Africa, Asia, Australia, and Europe). A fluorescence-labeled amplified fragment length polymorphism (AFLP) DNA profiling method was used to detect the genetic diversity and relatedness. On the basis of 443 polymorphic AFLP fragments from 8 primer combinations, the accessions were grouped into clusters and subclusters associating with their geographic origins. Genetic similarity coefficients (SC) for the 28 accessions ranged from 0.53 to 0.98. Accessions originating from Africa, Australia, Asia, and Europe formed major groupings as indicated by cluster and principal coordinate analysis. Accessions from Australia and Asia, though separately clustered, were relatively closely related and most distantly related to accessions of European origin. African accessions formed two distant clusters and had the greatest variation in genetic relatedness relative to accessions from other geographic regions. Sampling the full extent of genetic variation in C. dactylon var. dactylon would require extensive germplasm collection in the major geographic regions of its distributional range.
Sadki, Chrifa; Hacht, Brahim; Souliman, Amrani; Atmani, Fouad
2010-03-24
The aim of the present study is to evaluate the diuretic potential and effect on urinary electrolytes of aqueous Erica multiflora L. (Ericaceae) flowers and Cynodon dactylon L. (Poaceae) rhizomes extracts in rats. Different concentrations of these plants extract (0.125, 0.250, and 0.500 g/kg of body weight) or the reference drug furosemide (0.015 g/kg) were administrated orally to hydrated male Wistar rats and their urine output was measured at several interval of time after a single dose administration. Furthermore, a toxicological effect of both plants was undertaken as well. The results showed that furosemide induced significant diuresis and electrolytes excretion during the first hours. Plant extracts increased significantly urinary output and electrolytes excretion at the dose of 0.250 g/kg for Erica multiflora and 0.500 g/kg for Cynodon dactylon. This diuretic effect seems to be not related to K(+) plant content. Urinary pH remained mostly unchanged during the course of the study for both plant extracts. No lethality was observed among animals when using Erica multiflora even at the dose of 10 g/kg while Cynodon dactylon, instead, caused 50% of rat death (LD50) at 4.5 g/kg. We concluded that both aqueous herb extracts administered, particularly, at the dose of 0.500 g/kg induce significant effect on urinary output of water and electrolytes and justify their use as diuretic remedy in traditional medicine. Copyright (c) 2010 Elsevier Ireland Ltd. All rights reserved.
Atmani, F; Sadki, C; Aziz, M; Mimouni, M; Hacht, B
2009-04-01
Cynodon dactylon (Poaceae family) decoction was used in the treatment of kidney stones. However, no scientific study was undertaken so far to demonstrate the beneficial effect of the plant. Thus, the aim of the current study is to evaluate the effect of Cynodon aqueous extract as a preventive and curative agent in experimentally induced nephrolithiasis in a rat model. Ethylene glycol (EG) was used in the experiment to induce calcium oxalate (CaOx) deposition into kidneys. In preventive protocol, Cynodon decoction was administered in the same day with EG to evaluate the ability of the extract to prevent crystal deposition. However, in curative protocol, rats were first rendered nephrolithiasic and then the extract was administered to assess the ability of the plant to eliminate the pre-existing crystal deposition. In both protocols, urinary biochemical and other variables were measured during the course of the study. Crystalluria and renal histology were examined as well. The results showed that, in both protocols, all measured variables were similar for both the rat groups. Nevertheless, urinary biochemical analysis was apparently unaffected by the extract except oxalate in preventive protocol, and calcium, sodium, and potassium in curative protocol which were significantly highly excreted in treated rats compared to untreated animals. Crystalluria was characterized mostly by the presence of large quantities of CaOx monohydrate and CaOx dihydrate particles in untreated rats. However, crystalluria was mainly dominated by the presence of CaOx dihydrate particles with reduced size. The most apparent beneficial effect of Cynodon extract was seen in kidney tissues where reduced levels of CaOx deposition have been noticed especially in medullary and papillary sections from treated rats. We concluded that C. dactylon extract has beneficial effect in preventing and eliminating CaOx deposition into kidneys. Such findings provide a scientific explanation for its use in the
Mameaux, Sabine; Cockram, James; Thiel, Thomas; Steuernagel, Burkhard; Stein, Nils; Taudien, Stefan; Jack, Peter; Werner, Peter; Gray, John C; Greenland, Andy J; Powell, Wayne
2012-01-01
The genomes of cereals such as wheat (Triticum aestivum) and barley (Hordeum vulgare) are large and therefore problematic for the map-based cloning of agronomicaly important traits. However, comparative approaches within the Poaceae permit transfer of molecular knowledge between species, despite their divergence from a common ancestor sixty million years ago. The finding that null variants of the rice gene cytokinin oxidase/dehydrogenase 2 (OsCKX2) result in large yield increases provides an opportunity to explore whether similar gains could be achieved in other Poaceae members. Here, phylogenetic, molecular and comparative analyses of CKX families in the sequenced grass species rice, brachypodium, sorghum, maize and foxtail millet, as well as members identified from the transcriptomes/genomes of wheat and barley, are presented. Phylogenetic analyses define four Poaceae CKX clades. Comparative analyses showed that CKX phylogenetic groupings can largely be explained by a combination of local gene duplication, and the whole-genome duplication event that predates their speciation. Full-length OsCKX2 homologues in barley (HvCKX2.1, HvCKX2.2) and wheat (TaCKX2.3, TaCKX2.4, TaCKX2.5) are characterized, with comparative analysis at the DNA, protein and genetic/physical map levels suggesting that true CKX2 orthologs have been identified. Furthermore, our analysis shows CKX2 genes in barley and wheat have undergone a Triticeae-specific gene-duplication event. Finally, by identifying ten of the eleven CKX genes predicted to be present in barley by comparative analyses, we show that next-generation sequencing approaches can efficiently determine the gene space of large-genome crops. Together, this work provides the foundation for future functional investigation of CKX family members within the Poaceae. © 2011 National Institute of Agricultural Botany (NIAB). Plant Biotechnology Journal © 2011 Society for Experimental Biology, Association of Applied Biologists and Blackwell
Sumathi, Thangarajan; Shobana, Chandrasekar; Kumari, Balasubramanian Rathina; Nandhini, Devarajulu Nisha
2011-12-01
Cynodon dactylon (Poaceae) is a creeping grass used as a traditional ayurvedic medicine in India. Aluminium-induced neurotoxicity is well known and different salts of aluminium have been reported to accelerate damage to biomolecules like lipids, proteins and nucleic acids. The objective of the present study was to investigate whether the aqueous extract of C. dactylon (AECD) could potentially prevent aluminium-induced neurotoxicity in the cerebral cortex, hippocampus and cerebellum of the rat brain. Male albino rats were administered with AlCl(3) at a dose of 4.2 mg/kg/day i.p. for 4 weeks. Experimental rats were given C. dactylon extract in two different doses of 300 mg and 750 mg/keg/day orally 1 h prior to the AlCl(3) administration for 4 weeks. At the end of the experiments, antioxidant status and activities of ATPases in cerebral cortex, hippocampus and cerebellum of rat brain were measured. Aluminium administration significantly decreased the level of GSH and the activities of SOD, GPx, GST, Na(+)/K(+) ATPase, and Mg(2+) ATPase and increased the level of lipid peroxidation (LPO) in all the brain regions when compared with control rats. Pre-treatment with AECD at a dose of 750 mg/kg b.w increased the antioxidant status and activities of membrane-bound enzymes (Na(+)/K(+) ATPase and Mg(2+) ATPase) and also decreased the level of LPO significantly, when compared with aluminium-induced rats. The results of this study indicated that AECD has potential to protect the various brain regions from aluminium-induced neurotoxicity.
Genome-wide distribution comparative and composition analysis of the SSRs in Poaceae.
Wang, Yi; Yang, Chao; Jin, Qiaojun; Zhou, Dongjie; Wang, Shuangshuang; Yu, Yuanjie; Yang, Long
2015-02-15
The Poaceae family is of great importance to human beings since it comprises the cereal grasses which are the main sources for human food and animal feed. With the rapid growth of genomic data from Poaceae members, comparative genomics becomes a convinent method to study genetics of diffierent species. The SSRs (Simple Sequence Repeats) are widely used markers in the studies of Poaceae for their high abundance and stability. In this study, using the genomic sequences of 9 Poaceae species, we detected 11,993,943 SSR loci and developed 6,799,910 SSR primer pairs. The results show that SSRs are distributed on all the genomic elements in grass. Hexamer is the most frequent motif and AT/TA is the most frequent motif in dimer. The abundance of the SSRs has a positive linear relationship with the recombination rate. SSR sequences in the coding regions involve a higher GC content in the Poaceae than that in the other species. SSRs of 70-80 bp in length showed the highest AT/GC base ratio among all of these loci. The result shows the highest polymorphism rate belongs to the SSRs ranged from 30 bp to 40 bp. Using all the SSR primers of Japonica, nineteen universal primers were selected and located on the genome of the grass family. The information of SSR loci, the SSR primers and the tools of mining and analyzing SSR are provided in the PSSRD (Poaceae SSR Database, http://biodb.sdau.edu.cn/pssrd/). Our study and the PSSRD database provide a foundation for the comparative study in the Poaceae and it will accelerate the study on markers application, gene mapping and molecular breeding.
Rao, Bola Sadashiva Satish; Upadhya, Dinesh; Adiga, Satish Kumar
2008-01-01
The radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (family: Poaceae) against radiation-induced cytogenetic damage was analyzed using Chinese hamster lung fibroblast (V79) cells and human peripheral blood lymphocytes (HPBLs) growing in vitro. Induction of micronuclei was used as an index of cytogenetic damage, evaluated in cytokinesis blocked binucleate cells. The hydroalcoholic Cynodon dactylon extract (CDE) rendered protection against the radiation-induced DNA damage, as evidenced by the significant (p<0.001) reduction in micronucleated binucleate cells (MNBNC%) after various doses of CDE treatment in V79 cells and HPBLs. The optimum dose of CDE (40 and 50 microg/ml in HPBLs and V79 cells, respectively) with the greatest reduction in micronuclei was further used in combination with various doses of gamma radiation (0.5, 1, 2, 3, and 4 Gy) exposed 1 h after CDE treatment. A linear dose-dependent MNBNC% increase in radiation alone group was observed, while 40/50 microg/ml CDE significantly resulted in the reduction of MNBNC%, compared to the respective radiation alone groups. CDE resulted in a dose-dependent increase in free radical scavenging ability against various free radicals, viz., 2, 2-diphenyl-2-picryl-hydrazyl (DPPH); 2, 2-azinobis (3-ethylbenzothiazoline-6-sulfonic acid) (ABTS); superoxide anion (O2*-); hydroxyl radical (OH*) and nitric oxide radical (NO*) generated in vitro. Also, an excellent (70%) inhibition of lipid peroxidation in vitro was observed at a dose of 300 microg/ml CDE, attaining the saturation point at higher doses. The present findings demonstrated the radioprotective effect of CDE, also rendering protection against radiation-induced genomic instability and DNA damage. The observed radioprotective effect may be partly attributed to the free radical scavenging and antilipid peroxidative potential of CDE.
Accumulation and resistance to copper of two biotypes of Cynodon dactylon.
Wang, Youbao; Zhang, Li; Yao, Jing; Huang, Yongjie; Yan, Mi
2009-04-01
The effects of copper accumulation and resistance in two biotypes of Cynodon dactylon were studied. Results showed that at a low concentration of copper (Cynodon dactylon was generally unaffected. As copper concentration increased, negative effects on the growth of Cynodon dactylon became apparent. The critical concentration at which the plant exhibited poisoning symptoms was different for the two biotypes of Cynodon dactylon. At 500 mg/kg copper concentration in soil, the biotype from the polluted area showed significantly higher tolerance of copper than the biotype from the unpolluted area.
IDENTIFIKASI TUMBUHAN SUKU POACEAE SEBAGAI SUPLEMEN MATAKULIAH KEANEKARAGAMAN TUMBUHAN
Directory of Open Access Journals (Sweden)
Desy Yanuarita Wulandari
2017-01-01
Full Text Available Poaceae known as plants used as food ingredients in Indonesian. One area thas has high level diversity of plants Poaceae is Tahura R. Soerjo. Morphological characterization Poaceae in that region are still rare. The Goal for this research are to identify Poaceae tribes, and make photography Poaceae data that can be used as a supplement on Diversity of Plants course. This study included descriptive exploratory study with free cruising method. The species Poaceae has identified are Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflor. Suku Poaceae dikenal sebagai tumbuhan yang dimanfaatkan sebagai bahan pangan masyarakat Indonesia. Salah satu daerah yang memiliki tingkat keanekaragaman tumbuhan Poaceae adalah di Tahura R. Soerjo. Karakterisasi morfologi terkait suku Poaceae di daerah tersebut masih sedikit. Tujuan dalam penelitian ini adalah untuk identifikasi suku Poaceae, membuat data fotografi suku Poaceae sehingga dapat digunakan sebagai suplemen keanekaragaman tumbuhan. Penelitian ini termasuk penelitian deskriptif eksploratif dengan metode jelajah bebas. Sebelas spesies suku Poaceae yang telah teridentifikasi, yaitu Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflora.
Poaceae pollen as the leading aeroallergen worldwide: A review.
García-Mozo, H
2017-12-01
The Poaceae family comprises over 12 000 wind-pollinated species, which release large amounts of pollen into the atmosphere. Poaceae pollen is currently regarded as the leading airborne biological pollutant and the chief cause of pollen allergy worldwide. Sensitization rates vary by country, and those variations are reviewed here. Grass pollen allergens are grouped according to their protein structure and function. In Poaceae, although species belonging to different subfamilies are characterized by distinct allergen subsets, there is a considerable degree of cross-reactivity between many species. Cross-reactivity between grass pollen protein and fresh fruit pan-allergens is associated with the appearance of food allergies. The additional influence of urban pollution may prompt a more severe immunological response. The timing and the intensity of the pollen season are governed by species genetics, but plant phenology is also influenced by climate; as a result, climate changes may affect airborne pollen concentrations. This article reviews the findings of worldwide research which has highlighted the major impact of climate change on plant phenology and also on the prevalence and severity of allergic disease. © 2017 EAACI and John Wiley and Sons A/S. Published by John Wiley and Sons Ltd.
Building supertrees: an empirical assessment using the grass family (Poaceae).
Salamin, Nicolas; Hodkinson, Trevor R; Savolainen, Vincent
2002-02-01
Large and comprehensive phylogenetic trees are desirable for studying macroevolutionary processes and for classification purposes. Such trees can be obtained in two different ways. Either the widest possible range of taxa can be sampled and used in a phylogenetic analysis to produce a "big tree," or preexisting topologies can be used to create a supertree. Although large multigene analyses are often favored, combinable data are not always available, and supertrees offer a suitable solution. The most commonly used method of supertree reconstruction, matrix representation with parsimony (MRP), is presented here. We used a combined data set for the Poaceae to (1) assess the differences between an approach that uses combined data and one that uses different MRP modifications based on the character partitions and (2) investigate the advantages and disadvantages of these modifications. Baum and Ragan and Purvis modifications gave similar results. Incorporating bootstrap support associated with pre-existing topologies improved Baum and Ragan modification and its similarity with a combined analysis. Finally, we used the supertree reconstruction approach on 55 published phylogenies to build one of most comprehensive phylogenetic trees published for the grass family including 403 taxa and discuss its strengths and weaknesses in relation to other published hypotheses.
Huang, Chunqiong; Liu, Guodao; Bai, Changjun; Wang, Wenqiang
2014-10-21
Although Cynodon dactylon (C. dactylon) is widely distributed in China, information on its genetic diversity within the germplasm pool is limited. The objective of this study was to reveal the genetic variation and relationships of 430 C. dactylon accessions collected from 22 Chinese provinces using sequence-related amplified polymorphism (SRAP) markers. Fifteen primer pairs were used to amplify specific C. dactylon genomic sequences. A total of 481 SRAP fragments were generated, with fragment sizes ranging from 260-1800 base pairs (bp). Genetic similarity coefficients (GSC) among the 430 accessions averaged 0.72 and ranged from 0.53-0.96. Cluster analysis conducted by two methods, namely the unweighted pair-group method with arithmetic averages (UPGMA) and principle coordinate analysis (PCoA), separated the accessions into eight distinct groups. Our findings verify that Chinese C. dactylon germplasms have rich genetic diversity, which is an excellent basis for C. dactylon breeding for new cultivars.
Chemotaxonomy as a tool for interpreting the cryptic diversity of Poaceae pollen
Julier, A.C.M.; Jardine, P.E.; Coe, A.L.; Gosling, W.D.; Lomax, B.H.; Fraser, W.T.
2016-01-01
The uniform morphology of different species of Poaceae (grass) pollen means that identification to below family level using light microscopy is extremely challenging. Poor taxonomic resolution reduces recoverable information from the grass pollen record, for example, species diversity and
Burke, Sean V.; Wysocki, William P.; Clark, Lynn G.
2018-01-01
The systematics of grasses has advanced through applications of plastome phylogenomics, although studies have been largely limited to subfamilies or other subgroups of Poaceae. Here we present a plastome phylogenomic analysis of 250 complete plastomes (179 genera) sampled from 44 of the 52 tribes of Poaceae. Plastome sequences were determined from high throughput sequencing libraries and the assemblies represent over 28.7 Mbases of sequence data. Phylogenetic signal was characterized in 14 partitions, including (1) complete plastomes; (2) protein coding regions; (3) noncoding regions; and (4) three loci commonly used in single and multi-gene studies of grasses. Each of the four main partitions was further refined, alternatively including or excluding positively selected codons and also the gaps introduced by the alignment. All 76 protein coding plastome loci were found to be predominantly under purifying selection, but specific codons were found to be under positive selection in 65 loci. The loci that have been widely used in multi-gene phylogenetic studies had among the highest proportions of positively selected codons, suggesting caution in the interpretation of these earlier results. Plastome phylogenomic analyses confirmed the backbone topology for Poaceae with maximum bootstrap support (BP). Among the 14 analyses, 82 clades out of 309 resolved were maximally supported in all trees. Analyses of newly sequenced plastomes were in agreement with current classifications. Five of seven partitions in which alignment gaps were removed retrieved Panicoideae as sister to the remaining PACMAD subfamilies. Alternative topologies were recovered in trees from partitions that included alignment gaps. This suggests that ambiguities in aligning these uncertain regions might introduce a false signal. Resolution of these and other critical branch points in the phylogeny of Poaceae will help to better understand the selective forces that drove the radiation of the BOP and PACMAD
Khajavi Rad, Abolfazl; Hadjzadeh, Mousa-Al-Reza; Rajaei, Ziba; Mohammadian, Nema; Valiollahi, Saleh; Sonei, Mehdi
2011-01-01
To assess the beneficial effect of different fractions of Cynodon dactylon (C. dactylon) on ethylene glycol-induced kidney calculi in rats. Male Wistar rats were randomly divided into control, ethylene glycol, curative, and preventive groups. The control group received tap drinking water for 35 days. Ethylene glycol, curative, and preventive groups received 1% ethylene glycol for induction of calcium oxalate (CaOx) calculus formation. Preventive and curative subjects also received different fractions of C. dactylon extract in drinking water at 12.8 mg/kg, since day 0 and day 14, respectively. After 35 days, the kidneys were removed and examined for histopathological findings and counting the CaOx deposits in 50 microscopic fields. In curative protocol, treatment of rats with C. dactylon N-butanol fraction and N-butanol phase remnant significantly reduced the number of the kidney CaOx deposits compared to ethylene glycol group. In preventive protocol, treatment of rats with C. dactylon ethyl acetate fraction significantly decreased the number of CaOx deposits compared to ethylene glycol group. Fractions of C. dactylon showed a beneficial effect on preventing and eliminating CaOx deposition in the rat kidney. These results provide a scientific rational for preventive and treatment roles of C. dactylon in human kidney stone disease.
López-Matas, M A; Moya, R; Cardona, V; Valero, A; Gaig, P; Malet, A; Viñas, M; García-Moral, A; Labrador, M; Alcoceba, E; Ibero, M; Carnés, J
The homologous group of sweet grasses belongs to the Pooideae subfamily, but grass pollen species from other subfamilies can also cause allergy, such as Cynodon dactylon (Chloridoideae) and Phragmites communis (Arundinoideae). C dactylon and P communis have not been included in the sweet grasses homologous group because of their low cross-reactivity with other grasses. The aims of this study were to investigate the profile of sensitization to C dactylon and P communis in patients sensitized to grasses and to analyze cross-reactivity between these 2 species and temperate grasses. Patients were skin prick tested with a grass mixture (GM). Specific IgE to GM, C dactylon, P communis, Cyn d 1, and Phl p 1 was measured by ImmunoCAP. A pool of sera was used for the immunoblot assays. Cross-reactivity was studied by ELISA and immunoblot inhibition. Thirty patients had sIgE to GM. Twenty-four (80%) had positive results for C dactylon, 27 (90%) for P communis, 22 (73.3%) for nCyn d 1, and 92.9% for rPhl p 1. Bands were detected in the 3 extracts by immunoblot. Inhibition of GM was not observed with C dactylon or P communis by immunoblot or ELISA inhibition. When C dactylon or P communis were used in the solid phase, GM produced almost complete inhibition. Eighty percent of patients sensitized to grasses were also sensitized to C dactylon and 90% were sensitized to P communis. Sensitization to these species seems to be induced by allergens different to those in sweet grasses.
Pashaie, Belal; Hobbenaghi, Rahim; Malekinejad, Hassan
2017-01-01
Cynodon dactylon (Bermuda grass) is a perennial plant traditionally used as an herbal medicine in many countries. In the present study, anti-atherosclerotic property of ethanolic extract of C. dactylon was investigated in the experimentally induced hypercholesterolemia in rats. In this study, 36 male Wistar rats were selected and allocated into six groups (n = 6). The control group received a normal diet, sham group received a high cholesterol diet (HCD; 1.50% cholesterol and 24.00% fat) and other groups received a HCD and ethanolic extract of C. dactylon at low (100 mg kg -1 ), moderate (200 mg kg -1 ) and maximum (400 mg kg -1 ) doses via gavages. The last group received atorvastatin (10 mg kg -1 ) through gavage with a HCD. The study period for all groups was six months. At the end of this period, parameters including total cholesterol (TC), triglyceride (TG), low-density lipoprotein cholesterol (LDL-C) and high-density lipoprotein cholesterol (HDL-C) were assessed in the blood samples. Additionally, histopathological and immunohistochemical examinations on coronary and aorta arteries sections were performed. The results showed an increase in vessels wall thickness and proliferation of smooth muscle cells in the HCD group, while these pathological changes were not seen in C. dactylon -treated groups. Treatment of HCD animals with C. dactylon positively changed lipid profile by lowering of TC, TG and LDL-C. The results indicate that C. dactylon prevents from early atherosclerotic changes in the vessels wall.
Late Cretaceous origin of the rice tribe provides evidence for early diversification in Poaceae.
Prasad, V; Strömberg, C A E; Leaché, A D; Samant, B; Patnaik, R; Tang, L; Mohabey, D M; Ge, S; Sahni, A
2011-09-20
Rice and its relatives are a focal point in agricultural and evolutionary science, but a paucity of fossils has obscured their deep-time history. Previously described cuticles with silica bodies (phytoliths) from the Late Cretaceous period (67-65 Ma) of India indicate that, by the latest Cretaceous, the grass family (Poaceae) consisted of members of the modern subclades PACMAD (Panicoideae-Aristidoideae-Chloridoideae-Micrairoideae-Arundinoideae-Danthonioideae) and BEP (Bambusoideae-Ehrhartoideae-Pooideae), including a taxon with proposed affinities to Ehrhartoideae. Here we describe additional fossils and show that, based on phylogenetic analyses that combine molecular genetic data and epidermal and phytolith features across Poaceae, these can be assigned to the rice tribe, Oryzeae, of grass subfamily Ehrhartoideae. The new Oryzeae fossils suggest substantial diversification within Ehrhartoideae by the Late Cretaceous, pushing back the time of origin of Poaceae as a whole. These results, therefore, necessitate a re-evaluation of current models for grass evolution and palaeobiogeography.
Role of glycemic elements of Cynodon dactylon and Musa paradisiaca in diabetes management.
Rai, Prashant Kumar; Jaiswal, Dolly; Rai, Nilesh K; Pandhija, Shiwani; Rai, A K; Watal, Geeta
2009-09-01
The study defined the scientific evaluation of glycemic elements of extracts of Cynodon dactylon and Musa paradisiaca. A dose of 500 mg/kg body weight (bw) of C. dactylon produced maximum falls of 23.2% and 22.8% in blood glucose levels of normoglycemic rats during studies of fasting blood glucose and glucose tolerance, respectively, whereas the same dose of M. paradisiaca produced a rise of 34.9% and 18.4%. In diabetic rats during glucose tolerance tests, a fall of 27.8% and a rise of 17.5% were observed with the same dose of C. dactylon and M. paradisiaca, respectively. Laser-induced breakdown spectroscopy used for detection of glycemic elements present in both the extracts indicated that C. dactylon was rich in magnesium (Mg), whereas M. paradisiaca was rich in potassium (K) and sodium (Na), comparatively, suggesting thereby the defined roles of these elements in diabetes management.
INVENTARISASI HIJAUAN PAKAN KUDA PACUAN DI NUSA TENGGARA BARAT
Directory of Open Access Journals (Sweden)
Sudirman Sudirman
2014-12-01
Full Text Available Pacuan kuda dilaksanakan setiap tahun di Provinsi Nusa Tenggara Barat yang diikuti oleh tidak kurang dari 700 ekor kuda pacuan dalam lima kelas lomba. Kegiatan ini umumnya berlangsung selama 1-2 minggu di Pulau Sumbawa dan senantiasa menjadi agenda hiburan rakyat serangkaian dengan acara perayaan hari-hari besar nasional maupun regional dan/atau lokal. Selama kurun waktu tersebut, semua kuda yang akan dilombakan diberikan pakan berupa hijauan dari jenis tumbuhan tertentu dan/atau spesifik. Tujuan penelitian ini adalah (1 menginventarisisr jenis-jenis tumbuhan yang dijadikan hijauan pakan kuda pacuan selama lomba berlangsung, dan (2 mengkaji komposisi nutrisi jenis hijauan pakan dimaksud. Metode yang digunakan untuk mengumpulkan data pada penelitian ini adalah metode observasi dan wawancara. Semua kuda pacuan yang berasal dari beberapa kabupaten di provinsi Nusa Tenggara Barat yangmengikuti lomba pacuan kuda di kabupaten Sumbawa tahun 2012 diamati pemberian pakannya, kemudian dilakukan identifikasi dan analisis komposisi nutrisi jenis hijauan yang diberikan. Untuk mengetahui jenis pakan yang diberikan, dilakukan pengamatan langsung dan wawancara dengan peternak kuda pacuan. Hasil penelitian menunjukkan bahwa tercatat 9 jenis tumbuhan (2 famili, 8 marga yang diberikan pada kuda pacuan selama lomba berlangsung, yaitu Alysicarpus vaginalis (Fabaceae, Desmodium dichotomum (Fabaceae, Cynodon dactylon (Poaceae, Cynodon sp. (Poaceae, Dactyloctenium aegyptium (Poaceae, Brachiaria sp. (Poaceae, Eleusine indica (Poaceae, Eulalia fimbriata (Poaceae dan Leersia hexandra (Poaceae. Hijauan pakan diberikan pada kuda pacuan dalam bentuk pakan tunggal maupun kombinasi diantara jenis-jenis tumbuhan tersebut dengan komposisi nutrisi yang berbeda.
Anti-chikungunya activity of luteolin and apigenin rich fraction from Cynodon dactylon
Institute of Scientific and Technical Information of China (English)
Krishnan Saravana Murali; Srinivasan Sivasubramanian; Savariar Vincent; Shanmugaraj Bala Murugan; Bupesh Giridaran; Sundaram Dinesh; Palani Gunasekaran; Kaveri Krishnasamy; Ramalingam Sathishkumar
2015-01-01
Objective:To obtain luteolin and apigenin rich fraction from the ethanolic extract ofCynodon dactylon (L.) (C. dactylon) Pers and evaluate the fraction’s cytotoxicity and anti-Chikungunya potential using Vero cells.Methods:The ethanolic extract ofC. dactylon was subjected to silica gel column chromatography to obtain anti-chikungunya virus (CHIKV) fraction. Reverse phase-HPLC and GC-MS studies were carried out to identify the major phytochemicals in the fraction using phytochemical standards. Cytotoxicity and the potential of the fraction against CHIKV were evaluatedin vitrousing Vero cells. Reduction in viral replication was assessed by reverse transcriptase-polymerase chain reaction (RT-PCR) after treating the viral infected Vero cells with the fraction.Results:Reverse Phase-HPLC and GC-MS studies confirmed the presence of flavonoids, luteolin and apigenin as major phytochemicals in the anti-CHIKV ethanolic fraction ofC. dactylon. The fraction was found to exhibit potent viral inhibitory activity (about 98%) at the concentration of 50 µg/mL as observed by reduction in cytopathic effect, and the cytotoxic concentration of the fraction was found to be 250 µg/mL. RT-PCR analyses indicated that the reduction in viral mRNA synthesis in fraction treated infected cells was much higher than the viral infected control cells.Conclusions:Luteolin and apigenin rich ethanolic fraction fromC. dactylon can be utilized as a potential therapeutic agent against CHIKV infection as the fraction does not show cytotoxicity while inhibiting the virus.
Phyto-bioconversion of hard coal in the Cynodon dactylon/coal rhizosphere.
Igbinigie, Eric E; Mutambanengwe, Cecil C Z; Rose, Peter D
2010-03-01
Fundamental processes involved in the microbial degradation of coal and its derivatives have been well documented. A mutualistic interaction between plant roots and certain microorganisms to aid growth of plants such as Cynodon dactylon (Bermuda grass) on hard coal dumps has recently been suggested. In the present study coal bioconversion activity of nonmycorrhizal fungi was investigated in the C. dactylon/coal rhizosphere. Fungal growth on 2% Duff-agar, gutation formation on nitric acid treated coal and submerged culture activity in nitrogen-rich and -deficient broth formed part of the screening and selection of the fungi. The selected fungal isolates were confirmed to be found in pristine C. dactylon/coal rhizosphere. To simulate bioconversion, a fungal aliquot of this rhizosphere was used as inoculum for a Perfusate fixed bed bioreactor, packed with coal. The results demonstrate an enhanced coal bioconversion facilitated by low molecular weight organics and the bioconversion of coal may be initiated by an introduction of nitrogen moieties to the coal substrate. These findings suggest a phyto-bioconversion of hard coal involving plant and microbes occurring in the rhizosphere to promote the growth of C. dactylon. An understanding of this relationship can serve as a benchmark for coal dumps rehabilitation as well as for the industrial scale bioprocessing of hard coal.
[Genetic diversity of wild Cynodon dactylon germplasm detected by SRAP markers].
Yi, Yang-Jie; Zhang, Xin-Quan; Huang, Lin-Kai; Ling, Yao; Ma, Xiao; Liu, Wei
2008-01-01
Sequence-related amplified polymorphism (SRAP) molecular markers were used to detect the genetic diversity of 32 wild accessions of Cynodon dactylon collected from Sichuan, Chongqing, Guizhou and Tibet, China. The following results were obtained. (1) Fourteen primer pairs produced 132 polymorphic bands, averaged 9.4 bands per primer pair. The percentage of polymorphic bands in average was 79.8%. The Nei's genetic similarity coefficient of the tested accessions ranged from 0.591 to 0.957, and the average Nei's coefficient was 0.759. These results suggested that there was rich genetic diversity among the wild resources of Cynodon dactylon tested. (2) Thirty two wild accessions were clustered into four groups. Moreover, the accessions from the same origin frequently clustered into one group. The findings implied that a correlation among the wild resources, geographical and ecological environment. (3) Genetic differentiation between and within six eco-geographical groups of C. dactylon was estimated by Shannon's diversity index, which showed that 65.56% genetic variance existed within group, and 34.44% genetic variance was among groups. (4) Based on Nei's unbiased measures of genetic identity, UPGMA cluster analysis measures of six eco-geographical groups of Cynodon dactylon, indicated that there was a correlation between genetic differentiation and eco-geographical habits among the groups.
Kidney stone formation and antioxidant effects of Cynodon dactylon decoction in male Wistar rats.
Golshan, Alireza; Hayatdavoudi, Parichehr; Hadjzadeh, Mousa Al-Reza; Khajavi Rad, Abolfazl; Mohamadian Roshan, Nema; Abbasnezhad, Abbasali; Mousavi, Seyed Mojtaba; Pakdel, Roghayeh; Zarei, Batool; Aghaee, Azita
2017-01-01
The antioxidant capacity impairs in kidney and urinary bladder of animals with stone disease. Herbal medicine can improve the antioxidant condition of renal tissue. Cynodon dactylon ( C. dactylon ) is a medicinal plant with antioxidative and diuretic properties and different preparations of this plant have shown promising effects in stone disease. Assessment of the whole plant decoction to prevent kidney stone disease as well as its antioxidant effects was the aim of this paper. Fifty male Wistar rats were randomly divided into 5 experimental groups (n=10). One group was left without treatment and four groups received ethylene glycol (1% v/v) in drinking water for 6 weeks. Three doses of Cynodon dactylon aqueous decoction (12.5, 50 and 200 mg/kg BW) were added to the drinking water of groups 3-5. Finally, water intake, 24-hour urine volume, MDA, total thiol concentration and FRAP value were measured in the serum and kidney tissues. The CaOx depositions were evaluated by hematoxylin and eosin staining. Compared to the ethylene glycol-treated group, 200 mg/kg C. dactylon , lowered stone incidents, decreased urine volume, increased FRAP/g Cr (43%) and thiol content (p<0.05) with no significant alteration of water intake, MDA decreased significantly compared to C. dactylon 12.5 (p<0.01). Kidney weight increased and body weight decreased in ethylene glycol-treated group compared to the control group (p<0.05). A minimum dose of 200 mg/kg C. dactylon reduced stone formation and simultaneously increased total antioxidant power of serum and preserved MDA content and water.
Anti-chikungunya activity of luteolin and apigenin rich fraction from Cynodon dactylon.
Murali, Krishnan Saravana; Sivasubramanian, Srinivasan; Vincent, Savariar; Murugan, Shanmugaraj Bala; Giridaran, Bupesh; Dinesh, Sundaram; Gunasekaran, Palani; Krishnasamy, Kaveri; Sathishkumar, Ramalingam
2015-05-01
To obtain luteolin and apigenin rich fraction from the ethanolic extract of Cynodon dactylon (L.) (C. dactylon) Pers and evaluate the fraction's cytotoxicity and anti-Chikungunya potential using Vero cells. The ethanolic extract of C. dactylon was subjected to silica gel column chromatography to obtain anti-chikungunya virus (CHIKV) fraction. Reverse phase-HPLC and GC-MS studies were carried out to identify the major phytochemicals in the fraction using phytochemical standards. Cytotoxicity and the potential of the fraction against CHIKV were evaluated in vitro using Vero cells. Reduction in viral replication was assessed by reverse transcriptase-polymerase chain reaction (RT-PCR) after treating the viral infected Vero cells with the fraction. Reverse Phase-HPLC and GC-MS studies confirmed the presence of flavonoids, luteolin and apigenin as major phytochemicals in the anti-CHIKV ethanolic fraction of C. dactylon. The fraction was found to exhibit potent viral inhibitory activity (about 98%) at the concentration of 50 µg/mL as observed by reduction in cytopathic effect, and the cytotoxic concentration of the fraction was found to be 250 µg/mL. RT-PCR analyses indicated that the reduction in viral mRNA synthesis in fraction treated infected cells was much higher than the viral infected control cells. Luteolin and apigenin rich ethanolic fraction from C. dactylon can be utilized as a potential therapeutic agent against CHIKV infection as the fraction does not show cytotoxicity while inhibiting the virus. Copyright © 2015 Hainan Medical College. Production and hosting by Elsevier B.V. All rights reserved.
Sindhu, G; Ratheesh, M; Shyni, G L; Helen, A
2009-01-01
Cynodon dactylon is one of the 10 auspicious herbs that constitute the group Dasapushpam in Ayurveda. Traditionally Cynodon dactylon L. is used against many chronic inflammatory diseases in India. The present study was carried out to evaluate the protective effect of Cynodon dactylon against rats with adjuvant- induced arthritis. Arthritis was induced by intradermal injection of complete Freund's adjuvant into the right hind paw produce inflammation of the joint. A significant increase in the levels of inflammatory mediators, myeloperoxidase, nitrite, C-reactive protein, ceruloplasmin was observed. This was associated with oxidative stress with a marked reduction in the activity of catalase, superoxide dismutase, glutathione peroxidase and the levels of glutathione, vitamins C and E and an increase in the lipid peroxidation as indicated by the higher levels of thiobarbituric acid reactive substances. Cynodon dactylon (20mg/kg/b.wt) was orally administered to arthritic rats after adjuvant injection produced a significant attenuation in the inflammatory response, oxidative stress and ameliorated the arthritic changes to near normal conditions. Hence, the results of this study clearly indicate that Cynodon dactylon extract has a promising protective role against arthritis.
C. Selva Kumar
2011-01-01
Hypercholesteremia is one of the risk factors for coronary artery disease. The present study highlights the efficacy of Ayurvedic herbal formulation Cynodon dactylon (Bermuda grass) on histopathological study and DNA fragmentation analysis in experimentally induced hypercholesteremic rats. Four groups of rats were employed namely control, hypercholesterolemia rats (4% Cholesterol+1% cholic acid), Cynodon dactylon treatment in hypercholesteremic rats and Cynodon dactylon alone treated rats. Re...
Isolation and in silico evaluation of antidiabetic molecules of Cynodon dactylon (L.).
Annapurna, Hasthi V; Apoorva, Babu; Ravichandran, Natesan; Arun, Kallur Purushothaman; Brindha, Pemaiah; Swaminathan, Sethuraman; Vijayalakshmi, Mahadevan; Nagarajan, Arumugam
2013-02-01
Cynodon dactylon is a potential source of metabolites such as flavanoids, alkaloids, glycosides and β-sitosterol and has been traditionally employed to treat urinary tract and other microbial infections and dysentery. The present work attempts to evaluate the activity of C. dactylon extracts for glycemic control. Aqueous extracts of C. dactylon analyzed by HPLC-ESI MS have identified the presence of apigenin, luteolin, 6-C-pentosyl-8-C-hexosyl apigenin and 6-C-hexosyl-8-C-pentosyl luteolin. Evaluation of hypoglycemic activity through an extensive in silico docking approach with PPARγ (Peroxisome Proliferator-Activated Receptor), GLUT-4 (glucose transporter-4) and SGLT2 (sodium glucose co-transporter-2) revealed that luteolin, apigenin, 6-C-pentosyl-8-C-hexosyl apigenin, 6-C-hexosyl-8-C-pentosyl luteolin interact with SGLT2. Interactions of these molecules with Gln 295 and Asp 294 residues of SGLT2 have been shown to compare well with that of the phase III drug, dapagliflozin. These residues have been proven to be responsible for sugar sensing and transport. This work establishes C. dactylon extract as a potential SGLT2 inhibitor for diabetic neuropathy thus enabling a possibility of this plant extract as a new alternative to existing diabetic approaches. Copyright © 2012 Elsevier Inc. All rights reserved.
[Transformation of Cu forms in Cynodon dactylon rhizosphere soil of copper tailings yard].
Wang, You-bao; Huang, Yong-jie; Zhen, Quan; Yan, Mi; Yang, Hong-fei; Liu, Deng-yi
2007-06-01
The study on the Cu forms in Cynodon dactylon rhizosphere soil of copper tailings yard in Tongling City, Anhui Province showed that among the test Cu forms, the amount of residual form occupied the majority, while that of exchangeable form was relatively low. Compared with non-rhizosphere soil, rhizosphere soil had a higher organic matter content but a lower pH. With the growth of C. dactylon, the contents of organically combined and exchangeable Cu in rhizosphere soil increased by 7.89% and 5%, respectively, while those of carbonate-combined and Fe-Mn oxides-combined Cu decreased. The growth of C. dactylon accelerated the transformation of Cu forms in rhizosphere soil, and decreased the rhizosphere soil Cu content through its absorption.
Evaluation of Cynodon dactylon for wound healing activity.
Biswas, Tuhin Kanti; Pandit, Srikanta; Chakrabarti, Shrabana; Banerjee, Saheli; Poyra, Nandini; Seal, Tapan
2017-02-02
Research in the field of wound healing is very recent. The concept of wound healing is changing from day to day. Ayurveda is the richest source of plant drugs for management of wounds and Cynodon dactylon L. is one such. The plant is used as hemostatic and wound healing agent from ethnopharmacological point of view. Aim of the present study is scientific validation of the plant for wound healing activity in detail. Aqueous extract of the plant was prepared and phytochemical constituents were detected by HPLC analysis. Acute and dermatological toxicity study of the extract was performed. Pharmacological testing of 15% ointment (w/w) of the extract with respect to placebo control and standard comparator framycetin were done on full thickness punch wound in Wister rats and effects were evaluated based on parameters like wound contraction size (mm 2 ), tensile strength (g); tissue DNA, RNA, protein, hydroxyproline and histological examination. The ointment was applied on selected clinical cases of chronic and complicated wounds and efficacy was evaluated on basis of scoring on granulation, epithelialization, vascularity as well as routine hematological investigations. Significant results (pCynodon dactylon explores its potential wound healing activity in animal model and subsequent feasibility in human subjects. Phenolic acids and flavonoids present in c. dactylon supports its wound healing property for its anti-oxidative activity that are responsible for collagenesis. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
CYNODON DACTYLON (L.) PERS., AND ITS IMPLICATIONS
African Journals Online (AJOL)
Key words/phrases: Cynodon dactylon, salinity, salt glands, salt secretion ... associated with salt glands, sensitivity of secretion to temperature and metabolic inhibitors (Thomson. .... G, salt gland; Magnification = X400; scale bar = 50 n. Fig. 4. .... relative humidity causes a rapid transpiration rate in excess of absorption from ...
Khonghiran, Oapkun; Kunanoppadol, Suchaya; Potha, Teerapong; Chuammitri, Phongsakorn
2014-01-01
The in vitro virustatic and virucidal tests of the crude extract of Cynodon dactylon against infection with porcine reproductive and respiratory syndrome virus (PRRSV), a cause of major devastating pig disease, were described. Crude extract of C. dactylon was prepared for cytotoxicity on tissue-culture cells that were used to measure virustatic and virucidal activities against PRRSV. Crude extract of C. dactylon at 0.78 mg/mL showed no cytotoxicity on the cell line, and at that concentration significantly inhibited replication of PRRSV as early as 24 hours post infection (hpi). C. dactylon also inactivated PRRSV as determined by immunoperoxidase monolayer assay (IPMA) compared to the control experiments. In summary, the present study may be among the earliest studies to describe virustatic and virucidal activities of C. dactylon crude extract against PRRSV in vitro. Extracts of C. dactylon may be useful for PRRSV control and prevention on pig farms. PMID:24744959
Albert-Baskar, Arul; Ignacimuthu, Savarimuthu
2010-07-01
The present study was aimed at evaluating the chemopreventive property of Cynodon dactylon. The antioxidant, antiproliferative and apoptotic potentials of the plant were investigated by 1,1-diphenyl-2-picrylhydrazyl (DPPH) assay, nitric oxide radical scavenging activity (NO(-)) and MTT assay on four cancer cell lines (COLO 320 DM, MCH-7, AGS, A549) and a normal cell line (VERO). In vivo chemopreventive property of the plant extract was studied in DMH-induced colon carcinogenesis. The methanolic extract of C. dactylon was found to be antiproliferative and antioxidative at lower concentrations and induced apoptotic cell death in COLO 320 DM cells. Treatment with methanolic extract of C. dactylon increased the levels of antioxidant enzymes and reduced the number of dysplastic crypts in DMH-induced colon of albino rats. The present investigation revealed the anticancer potential of methanolic extract of C. dactylon in COLO 320 DM cells and experimentally induced colon carcinogenesis in rats.
Guo, Yuanwen; Wu, Yanqi; Anderson, Jeff A; Moss, Justin Q; Zhu, Lan
2015-01-01
Common bermudagrass [C. dactylon (L.) Pers. var. dactylon] is economically and environmentally the most important member among Cynodon species because of its extensive use for turf, forage and soil erosion control in the world. However, information regarding the inheritance within the taxon is limited. Accordingly, the objective of this study was to determine qualitative inheritance mode in common bermudagrass. Two tetraploid (2n = 4x = 36), first-generation selfed (S1) populations, 228 progenies of 'Zebra' and 273 from A12359, were analyzed for segregation with 21 and 12 simple sequence repeat (SSR) markers, respectively. It is concluded that the inheritance mode of tetraploid bermudagrass was complete or near complete disomic. It is evident that the two bermudagrass parents had an allotetraploid genome with two distinct subgenomes since 33 SSR primer pairs amplified 34 loci, each having two alleles. Severe transmission ratio distortions occurred in the Zebra population while less so in the A12359 population. The findings of disomic inheritance and segregation ratio distortion in common bermudagrass is significant in subsequent linkage map construction, quantitative trait locus mapping and marker-assisted selection in the species.
Wang, Ruyi; He, Pinjing; Shao, Liming; Zhang, Bin; Li, Guojian
2005-05-01
With pot experiment, this paper studied the membrane lipid peroxidation and the variations of antioxidation system in Cynodon dactylon under recirculated landfill leachate irrigation. The results showed that when irrigated with low dilution ratio ( 25%), there existed an obvious negative fect on Cynodon dactylon, i.e., the chlorophyll a/b ratio decreased, while cell membrane permeability and MDA and H2O2 contents increased, which meant that the membrane lipid peroxidation was accelerated. The contents antioxidants AsA, GSH and Car also showed the similar trend, i.e., they increased with increasing leachate dilution ratio when irrigated with low dilution ratio leachate, but decreased under medium or high dilution ratio leachate irrigation. Among three test anti-oxidative enzymes, SOD and POD activities showed a similar change test antioxidants, and POD activity was more sensitive, while CAT activity was on the contrary. The contents test antioxidants and the activities of SOD and POD were negatively and significantly correlated to MDA content, indicating that they might play an important role in preventing Cynodon dactylon from cell membrane lipid peroxdation.
Ethanolic extracts of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus were tested for toxicity to 3rd instar Anopheles stephensi, Culex quinquefasciatus, and Aedes aegypti. Median lethal concentrations (LC50) were, respectively, 0.44%, 0.51%, 0.59% and 0.68%. Cynodon dactylon...
Muthukrishnan, Saradha Devi; Kaliyaperumal, Ashokkumar; Subramaniyan, Annapoorani
2015-01-01
Cynodon dactylon (L.) is a potent medicinal plant in the traditional and current Indian medicinal systems. The objective of this research was to find out the levels of flavonoids, carotenoids and chlorophyll b in C. dactylon leaves by high-performance liquid chromatography (HPLC) equipped with a diode array detector. HPLC analysis revealed that total carotenoid and total flavonoid concentration were 62 mg/100 g and 249.1 μg/g, respectively. The mean chlorophyll b was 85.1 mg/100 g in C. dactylon. Among the flavonoids, quercetin (164.7 μg/g) was the major flavonoid followed by kaempferol (48.2 μg/g), rutin (18.4 μg/g), catechin (12.1 μg/g) and myricetin (5.7 μg/g). Of the carotenoids, β-carotene (35.2 mg/100 g) was predominant followed by lutein (17.0 mg/100 g), violaxanthin (5.8 mg/100 g) and zeaxanthin (4.2 mg/100 g). Chlorophyll b concentration was 85.1 mg/100 g in C. dactylon. The results of this investigation should be useful information for further pharmacological studies.
Establishing Cynodon dactylon on mining tailings and mining ...
African Journals Online (AJOL)
Mining for copper and cobalt generates extensive mounds of removed topsoil and subsoil, and tailings with toxic levels of copper and cobalt. The threat of soil erosion in a high rainfall regime can be countered with rapid establishment of a sod-forming grass, such as Cynodon dactylon, that covers and binds the soil.
Li, Xi; Wang, Ling; Li, Yiqiao; Sun, Lingxia; Cai, Shizhen; Huang, Zhuo
2014-01-01
Sulfur dioxide (SO2), a major air pollutant in developing countries, is highly toxic to plants. To achieve better air quality and landscape, planting appropriate grass species in severe SO2 polluted areas is very critical. Cynodon dactylon, a widely used warm season turfgrass species, has good SO2-tolerant ability. In this study, we selected 9 out of 38 C. dactylon accessions from Southwest China as representatives of high, intermediate SO2-tolerant and SO2-sensitive accessions to comparatively analyze their physiological differences in leaves under SO2 untreated and treated conditions. Our results revealed that SO2-tolerant C. dactylon accessions showed higher soluble sugar, proline, and chlorophyll a contents under both SO2 treated and untreated conditions; higher chlorophyll b and carotenoid under SO2 treated condition; lower reactive oxygen species (ROS) level, oxidative damages, and superoxide dismutase (SOD) activities under SO2 treated condition; and higher peroxidase (POD) activities under SO2 untreated condition. Further results indicated that SO2-tolerant C. dactylon accessions had higher sulfur contents under both SO2 treated and untreated conditions, consistent with higher SO activities under both SO2 treated and untreated conditions, and higher SiR activities under SO2 treated condition. Taken together, our results indicated that SO2 tolerance of C. dactylon might be largely related to soluble sugar, proline and chlorophyll a contents, and SO enzyme activity.
Karyotype asymmetry in Cynodon Rich. (Poaceae) accessions.
Chiavegatto, R B; Paula, C M P; Souza Sobrinho, F; Benites, F R G; Techio, V H
2016-12-02
Cynodon is a genus of plants with forage potential that has attracted the interest of breeders. These species have high morphological variability in a large number of varieties and cytotypes, hampering identification. This study aimed to determine the karyotype asymmetry index among accessions of Cynodon to discriminate between them. Karyotype symmetry was based on three estimates, which were compared. The basic number for the genus is x = 9. The results of the chromosome count and DNA quantification, respectively, were as follows: two diploid accessions (2n = 2x = 18 and 1.08 ± 0.094 to 1.17 ± 0.036 pg DNA and ± standard deviation), one triploid accession (2n = 3x = 27 and 1.63 ± 0.017 pg DNA), four tetraploid accessions (2n = 4x = 36 and 1.88 ± 0.069 to 2.10 ± 0.07 pg DNA), and one pentaploid accession (2n = 5x = 45 and 2.55 ± 0.098 pg DNA). C. incompletus var. hirsutus had the longest total length of the haploid lot (29.05 µm), with chromosomes that ranged from 1.7 to 6.2 µm in length. On the basis of the karyotype asymmetry indices, the accessions were divided into two groups: 1) C. dactylon var. dactylon, C. transvaalensis, C. dactylon var. polevansii, three accessions of Cynodon sp, and C. nlemfuensis; and 2) C. incompletus var. hirsutus. This is the first description of tetraploidy in C. transvaalensis. The karyotypic data facilitated a determination of the degree of proximity between the accessions.
Evidence-based Critical Evaluation of Glycemic Potential of Cynodon dactylon
Singh, Santosh Kumar; Rai, Prashant Kumar; Jaiswal, Dolly
2008-01-01
The present study is an extension of our previous work carried out on Cynodon dactylon. This study deals with the critical evaluation of glycemic potential of ethanolic extract of defatted C. dactylon. The doses of 250, 500 and 750 mg kg−1 bw of the extract were administered orally to normal as well as Streptozotocin-induced diabetic rats to study its glycemic potential. The effect of repeated oral administration of the same doses of ethanolic extract was also studied on serum lipid profile of severely diabetic (SD) rats. The dose of 500 mg kg−1 bw was identified as the most effective dose as it lowered the blood glucose levels of normal by 42.12% and of diabetic by 43.42% during fasting blood glucose (FBG) and glucose tolerance test respectively. The SD rats were also treated daily with this identified dose of 500 mg kg−1 bw for 2 weeks and a significant reduction of 56.34% was observed in FBG level. Total cholesterol, low density lipoprotein and triglyceride levels were also decreased by 32.94, 64.06 and 48.46% respectively in SD rats whereas, cardioprotective high density lipoprotein increased by 16.45%. The reduced urine sugar level and increased body weight are additional advantages. These evidences clearly indicate that the ethanolic extract of defatted C. dactylon has high antidiabetic potential along with good hypolipidemic profile. PMID:18955211
Directory of Open Access Journals (Sweden)
Adriana Tiemi Nakamura
2009-03-01
Full Text Available O presente estudo objetivou verificar a existência de um padrão do desenvolvimento pós-seminal em Poaceae. Para tanto, foram estudadas as seguintes espécies: Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae. Procurou-se também comparar as estruturas da plântula de Poaceae com as demais monocotiledôneas. As espécies estudadas são plantas perenes, rizomatosas, cespitosas e apresentam cariopses de tamanhos diferentes. Apresentam sementes albuminosas; embrião lateral, diferenciado, com raiz endógena (adventícia; cotilédone dividido em hiperfilo (escutelo, bainha reduzida e hipofilo (coleóptilo; coleorriza (raiz primária reduzida e mesocótilo (eixo localizado entre o escutelo e coleóptilo. A presença de epiblasto (folha embrionária foi observada em Olyra humilis, Chloris elata e Eragrostis solida. O desenvolvimento pós-seminal é semelhante nas espécies estudadas e forma um padrão em Poaceae. Primeiramente, observa-se a emissão da coleorriza, que cresce no sentido geotrópico positivo, seguida do coleóptilo e plúmula que crescem em sentido contrário, a partir do desenvolvimento do mesocótilo. As primeiras folhas são semelhantes às folhas definitivas (metafilos das espécies, exceto em Olyra humilis, que são modificadas em catafilos e podem ser interpretadas como caráter basal em Bambusoideae. Raiz primária reduzida (coleorriza e hipofilo modificado em coleóptilo são considerados caracteres derivados em Poaceae, quando comparados com as demais monocotiledôneas.This work has aimed to verify the existence of a pattern of the post-seminal development in Poaceae. Thus, Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae have been studied. Besides, it was compared the structures of
Directory of Open Access Journals (Sweden)
Leandro do Prado Ribeiro
2016-07-01
Full Text Available Bermudagrass (Cynodon dactylon cv. Jiggs is an important food source for dairy cattle in the semi-intensive milk production systems most often used in southern Brazil. Although many insect pests are associated with feed grasses, we report here the first occurrence of the fly Atherigona (Atherigona reversura Villeneuve, 1936 (Diptera: Muscidae feeding on bermudagrass in Brazil. This potential pest was observed in April 2015 in three localities (Abelardo Luz, Palmitos, and Videira in western Santa Catarina, in southern Brazil. The infested plants had senescent and necrotic terminal leaves that reduced plant growth. New growth had to sprout new tillers from basal nodes, which resulted in a reduced plant growth rate. We also provide a morphological identification key (with figures for A. (Atherigona reversura and A. (Acritochaeta orientalis Schiner, 1868. A molecular identification based on COI is also provided to better differentiate species. Keywords: COI gene, Insect pest, Pastures, Plant–insect interaction
Rai, D K; Sharma, R K; Rai, P K; Watal, G; Sharma, B
2011-02-12
The present study was designed to investigate the ameliorating effect of aqueous extract of C. dactylon on carbofuran induced oxidative stress (OS) and alterations in the activity of acetylcholinesterase (AChE) in the brain of rats. Vitamin C was used as a positive control. Wistar rats were administered with single sub-acute oral dose (1.6 mgkg-1 b.wt.) of carbofuran for 24 h. The OS parameters such as lipid peroxidation (LPO) and the activities of antioxidant enzymes including super oxide dismutase (SOD), catalase (CAT) and glutathione-S-transferase (GST), and that of AChE were studied in brain. Carbofuran treatment significantly increased the activities of SOD and CAT by 75 and 60%, respectively. It also induced the level of LPO by 113%. In contrast, the activities of GST and AChE were recorded to be diminished by 25 and 33%, respectively. Pretreatment of the rats with aqueous extract of C. dactylon (oral; 500mgkg-1) restored SOD activity completely but CAT activity only partially (7%). Carbofuran induced LPO was moderated by 95% in the brain of C. dactylon treated rats. The observed changes in OS parameters in C. dactylon treated group were comparable to that observed in vitamin C (200 mg-kg-1 b. wt.) treated group. Surprisingly, C. dactylon treatment significantly recovered the activity of AChE to a similar level as observed in the brain of control group. In contrast vitamin C treatment did not cause significant change in the activity of AChE in carbofuran treated group. There were no noticeable changes in the aforementioned study parameters in the brain of rats receiving C. dactylon and vitamin C, only. The results suggest that the study is extremely important in the context of development of new anticholinestesterase and antioxidant antidotes against carbofuran from C. dactylon.
Zhou, Ruilian; Dov, Paternak; Zhao, Halin
2002-08-01
Responses of six varieties (Suwannee, Coast cross, Tifton44, Tifton68, Tifton78 and Tifton85) of Cynodon dactylon to irrigation-water salinity were investigated in field by means of a double line source experimental design. The digestibility of the grass by goat was analyzed using the rumen gastric justice digestion method. The results showed that the six varieties grew well, and had a high yield of fresh grass when eletro-conductivity (Eci) Cynodon dactylon were not effected by saltwater irrigation.
Kannan, Rajaretinam Rajesh; Vincent, Samuel Gnana Prakash
2012-03-01
The aim of the present study was to screen cardioactive herbs from Western Ghats of India. The heart beat rate (HBR) and blood flow during systole and diastole were tested in zebrafish embryos. We found that Cynodon dactylon (C. dactylon) induced increases in the HBR in zebrafish embryos with a HBR of (3.968±0.344) beats/s, which was significantly higher than that caused by betamethosone [(3.770±0.344) beats/s]. The EC50 value of C. dactylon was 3.738 µg/mL. The methanolic extract of Sida acuta (S. acuta) led to decreases in the HBR in zebrafish embryos [(1.877±0.079) beats/s], which was greater than that caused by nebivolol (positive control). The EC50 value of Sida acuta was 1.195 µg/mL. The untreated embryos had a HBR of (2.685±0.160) beats/s at 3 d post fertilization (dpf). The velocities of blood flow during the cardiac cycle were (2,291.667±72.169) µm/s for the control, (4,250±125.000) µm/s for C. dactylon and (1,083.333±72.169) µm/s for S. acuta. The LC50 values were 32.6 µg/mL for C. dactylon and 20.9 µg/mL for S. acuta. In addition, the extracts exhibited no chemical genetic effects in the drug dosage range tested. In conclusion, we developed an assay that can measure changes in cardiac function in response to herbal small molecules and determine the cardiogenic effects by microvideography.
Hussain, Fatma; Ahmed, Nisar; Ghorbani, Abdolbaset
2018-01-01
In pursuit of developing fast and accurate species-level molecular identification methods, we tested six DNA barcodes, namely ITS2, matK, rbcLa, ITS2+matK, ITS2+rbcLa, matK+rbcLa and ITS2+matK+rbcLa, for their capacity to identify frequently consumed but geographically isolated medicinal species of Fabaceae and Poaceae indigenous to the desert of Cholistan. Data were analysed by BLASTn sequence similarity, pairwise sequence divergence in TAXONDNA, and phylogenetic (neighbour-joining and maximum-likelihood trees) methods. Comparison of six barcode regions showed that ITS2 has the highest number of variable sites (209/360) for tested Fabaceae and (106/365) Poaceae species, the highest species-level identification (40%) in BLASTn procedure, distinct DNA barcoding gap, 100% correct species identification in BM and BCM functions of TAXONDNA, and clear cladding pattern with high nodal support in phylogenetic trees in both families. ITS2+matK+rbcLa followed ITS2 in its species-level identification capacity. The study was concluded with advocating the DNA barcoding as an effective tool for species identification and ITS2 as the best barcode region in identifying medicinal species of Fabaceae and Poaceae. Current research has practical implementation potential in the fields of pharmaco-vigilance, trade of medicinal plants and biodiversity conservation. PMID:29576968
Cynodon dactylon (L.) Pers. (common bermudagrass) is a troublesome perennial grass common in the southeastern U. S. and extremely difficult to control in organic crop production systems. Research trials in a site heavily infested with C. dactylon were conducted from 2008 to 2010 to evaluate systems...
Evaluation of the immunomodulatory and DNA protective activities of the shoots of Cynodon dactylon.
Mangathayaru, K; Umadevi, M; Reddy, C Umamaheswara
2009-05-04
Fresh juice of Cyanodon dactylon known as 'durva' grass is employed in India as a rejuvenator and for wound healing. To validate the traditional use of the herb through evaluation of DNA protective activity in vitro and immunomodulatory activity in vivo. Fresh juice of the grass was prepared as indicated for use in traditional medicine and standardized for solid content. Its total phenol content was estimated by Folin-Ciocalteau method. Freshly prepared juice was investigated for its effect on doxorubicin-induced DNA damage in vitro. Its immunomodulatory activity was tested on balb/c mice by the humoral antibody response which was determined by haemagglutination antibody titer and spleen cell assay. Fresh juice of Cyanodon dactylon of 1.46% (w/w) solid content had a phenolic content of 47+/-0.33 mg/kg GAE. At doses equivalent to 50, 100 and 200mg total solids/kg body weight the juice protected human DNA against doxorubicin-induced DNA damage as demonstrated in DNA spectral studies, where the ratio of absorbance of DNA at 260 and 280 nm in samples pretreated with the juice was 1.66, 1.53 and 1.63 respectively, while it was 1.37 for DNA treated with doxorubicin only. This indicates nucleic acid purity in the Cynodon dactylon treated samples. Oral administration of the juice at 250 and 500 mg/kg in balb/c mice increased humoral antibody response upon antigen challenge, as evidenced by a dose-dependent, statistically significant increase in antibody titer in the haemagglutination antibody assay and plaque forming cell assay. The present report demonstrated the DNA protective activity and immunomodulatory property of the fresh juice of Cynodon dactylon validating the traditional use of the herb as a 'rasayana' in ayurvedic system of medicine.
A study on the protective effect of Cynodon dactylon leaves extract in diabetic rats.
Karthik, D; Ravikumar, S
2011-04-01
To investigate the antidiabetic, antioxidant and hypolipidemic efficacy of Cynodon dactylon in diabetic rats. The experimental rats were randomly divided into three groups: Group I: control; Group II: Alloxan diabetic, untreated; and Group III: Alloxan diabetic treated with ethanolic extract of C. dactylon leaves (450 mg/kg·bw). Experimental diabetes was induced by alloxan in a single dose of 150 mg/kg·bw. A Significant diminution of fasting blood sugar level was observed and also significant increase in HDL and decrease (P<0.05) in cholesterol, triglyceride, LDL and VLDL were observed after 15 days of treatment. The investigation also revealed, the activities of AST, ALT, ALP, AP, LDH, and CPK (P<0.05) were decreased in the extract-supplemented group. The significant decrease in protein content and SOD, CAT, GPx, and GSH (P<0.05) activity and increase in LPO in plasma were found to be ameliorated after treatment. Our result supports the fact that administration of extract of C. dactylon leave is able to reduce hyperglycemia and hyperlipidemia risk and also reduced the oxidative stress in diabetic rats. Copyright © 2011 The Editorial Board of Biomedical and Environmental Sciences. Published by Elsevier B.V. All rights reserved.
Kowsalya, R; Kaliaperumal, Jagatheesh; Vaishnavi, M; Namasivayam, Elangovan
2015-01-01
Hepatocellular carcinoma is one of the most common cancers and a lethal disease. In view of the limited treatment and a grave prognosis of liver cancer, preventive control has been emphasized. The methanolic extract of roots of Cynodon dactylon was screened for its hepato-protective activity in diethyl nitrosamine (DEN) induced liver cancer in Swiss albino mice. The plant extract at a dose of 50 mg/kg was administered orally once a week, up to 30 days after DEN administration. The animals were sacrificed; blood sample and liver tissue were collected and used for enzyme assay such as, asparatate amino transferase (AST), alanine aminotransferase (ALT), catalase (CAT), glutathione peroxidase (GPx) and glutathione-S-transferase (GST). The liver marker enzymes AST and ALT produced significant results in the protective action. The antioxidant enzyme assay results concerning the improved activity of GPx, GST and CAT. These results concluded that enhanced levels of antioxidant enzyme and reduced amount of serum amino transaminase, which are suggested to be the major mechanisms of C. dactylon root extract in protecting the mice from hepatocarcinoma induced by DEN. These biochemical observations were supplemented by histopathological examination of liver sections. The methanolic extract of C. dactylon possesses significant anticancer properties.
Directory of Open Access Journals (Sweden)
R Kowsalya
2015-01-01
Full Text Available Background: Hepatocellular carcinoma is one of the most common cancers and a lethal disease. In view of the limited treatment and a grave prognosis of liver cancer, preventive control has been emphasized. Materials and Methods: The methanolic extract of roots of Cynodon dactylon was screened for its hepato-protective activity in diethyl nitrosamine (DEN induced liver cancer in Swiss albino mice. The plant extract at a dose of 50 mg/kg was administered orally once a week, up to 30 days after DEN administration. The animals were sacrificed; blood sample and liver tissue were collected and used for enzyme assay such as, asparatate amino transferase (AST, alanine aminotransferase (ALT, catalase (CAT, glutathione peroxidase (GPx and glutathione-S-transferase (GST. The liver marker enzymes AST and ALT produced signifi cant results in the protective action. Results: The antioxidant enzyme assay results concerning the improved activity of GPx, GST and CAT. These results concluded that enhanced levels of antioxidant enzyme and reduced amount of serum amino transaminase, which are suggested to be the major mechanisms of C. dactylon root extract in protecting the mice from hepatocarcinoma induced by DEN. These biochemical observations were supplemented by histopathological examination of liver sections. Conclusion: The methanolic extract of C. dactylon possesses signifi cant anticancer properties
Poaceae vs. Abiotic Stress: Focus on Drought and Salt Stress, Recent Insights and Perspectives
Directory of Open Access Journals (Sweden)
Simone Landi
2017-07-01
Full Text Available Poaceae represent the most important group of crops susceptible to abiotic stress. This large family of monocotyledonous plants, commonly known as grasses, counts several important cultivated species, namely wheat (Triticum aestivum, rice (Oryza sativa, maize (Zea mays, and barley (Hordeum vulgare. These crops, notably, show different behaviors under abiotic stress conditions: wheat and rice are considered sensitive, showing serious yield reduction upon water scarcity and soil salinity, while barley presents a natural drought and salt tolerance. During the green revolution (1940–1960, cereal breeding was very successful in developing high-yield crops varieties; however, these cultivars were maximized for highest yield under optimal conditions, and did not present suitable traits for tolerance under unfavorable conditions. The improvement of crop abiotic stress tolerance requires a deep knowledge of the phenomena underlying tolerance, to devise novel approaches and decipher the key components of agricultural production systems. Approaches to improve food production combining both enhanced water use efficiency (WUE and acceptable yields are critical to create a sustainable agriculture in the future. This paper analyzes the latest results on abiotic stress tolerance in Poaceae. In particular, the focus will be directed toward various aspects of water deprivation and salinity response efficiency in Poaceae. Aspects related to cell wall metabolism will be covered, given the importance of the plant cell wall in sensing environmental constraints and in mediating a response; the role of silicon (Si, an important element for monocots' normal growth and development, will also be discussed, since it activates a broad-spectrum response to different exogenous stresses. Perspectives valorizing studies on landraces conclude the survey, as they help identify key traits for breeding purposes.
Evaluation of CNS activities of aerial parts of Cynodon dactylon Pers. in mice.
Pal, Dilipkumar
2008-01-01
The dried extracts of aerial parts of Cynodon dactylon Pers. (Graminae) were evaluated for CNS activities in mice. The ethanol extract of aerial parts of C. dactylon (EECD) was found to cause significant depression in general behavioral profiles in mice. EECD significantly potentiated the sleeping time in mice induced by standard hypnotics viz. pentobarbitone sodium, diazepam, and meprobamate in a dose dependant manner. EECD showed significant analgesic properties as evidenced by the significant reduction in the number of writhes and stretches induced in mice by 1.2% acetic acid solution. It also potentiated analgesia induced by morphine and pethidine in mice. EECD inhibited the onset and the incidence of convulsion in a dose dependent manner against pentylenetetrazole (PTZ)-induced convulsion. The present study indicates that EECD has significant CNS depressant activities.
Révision du genre Digitaria Haller (Poaceae) au Sénégal ...
African Journals Online (AJOL)
Le genre Digitaria Haller (Poaceae) constitue l'un des genres les plus diversifiés des Poaceae du Sénégal avec 19 espèces. Bien qu'il y ait une monographie mondiale du genre, la détermination des espèces reste difficile et repose essentiellement sur les caractères de l'appareil reproducteur. Ce travail, qui est une ...
What is Cynodon radiatus Roth ex R. & S. (Poaceae)?
Nowack, R.
1992-01-01
Roemer and Schultes (1817) described Cynodon radiatus, basing themselves on a manuscript by A.W. Roth, copying Roth's brief diagnosis and comment. It was compared to Cynodon dactylon, differing by its larger habit, the number and direction of the spikes, and the glabrous blades and sheaths. This was
Fauteux, François; Strömvik, Martina V
2009-01-01
Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP) gene promoters from three plant families, namely Brassicaceae (mustards), Fabaceae (legumes) and Poaceae (grasses) using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L.) Heynh.), soybean (Glycine max (L.) Merr.) and rice (Oryza sativa L.) respectively. We have identified three conserved motifs (two RY-like and one ACGT-like) in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination of conserved motifs
Directory of Open Access Journals (Sweden)
Fauteux François
2009-10-01
Full Text Available Abstract Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP gene promoters from three plant families, namely Brassicaceae (mustards, Fabaceae (legumes and Poaceae (grasses using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L. Heynh., soybean (Glycine max (L. Merr. and rice (Oryza sativa L. respectively. We have identified three conserved motifs (two RY-like and one ACGT-like in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination
Evolutionary modes of emergence of short interspersed nuclear element (SINE) families in grasses.
Kögler, Anja; Schmidt, Thomas; Wenke, Torsten
2017-11-01
Short interspersed nuclear elements (SINEs) are non-autonomous transposable elements which are propagated by retrotransposition and constitute an inherent part of the genome of most eukaryotic species. Knowledge of heterogeneous and highly abundant SINEs is crucial for de novo (or improvement of) annotation of whole genome sequences. We scanned Poaceae genome sequences of six important cereals (Oryza sativa, Triticum aestivum, Hordeum vulgare, Panicum virgatum, Sorghum bicolor, Zea mays) and Brachypodium distachyon to examine the diversity and evolution of SINE populations. We comparatively analyzed the structural features, distribution, evolutionary relation and abundance of 32 SINE families and subfamilies within grasses, comprising 11 052 individual copies. The investigation of activity profiles within the Poaceae provides insights into their species-specific diversification and amplification. We found that Poaceae SINEs (PoaS) fall into two length categories: simple SINEs of up to 180 bp and dimeric SINEs larger than 240 bp. Detailed analysis at the nucleotide level revealed that multimerization of related and unrelated SINE copies is an important evolutionary mechanism of SINE formation. We conclude that PoaS families diversify by massive reshuffling between SINE families, likely caused by insertion of truncated copies, and provide a model for this evolutionary scenario. Twenty-eight of 32 PoaS families and subfamilies show significant conservation, in particular either in the 5' or 3' regions, across Poaceae species and share large sequence stretches with one or more other PoaS families. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.
Zwerts, J A; Prins, H H T; Bomhoff, D; Verhagen, I; Swart, J M; de Boer, W F
2015-01-01
South African savanna grasslands are often characterised by indigestible tufted grass species whereas lawn grasses are far more desirable in terms of herbivore sustenance. We aimed to investigate the role of nutrients and/or the disturbance (grazing, trampling) by herbivores on the formation of grazing lawns. We conducted a series of common garden experiments to test the effect of nutrients on interspecific competition between a typical lawn-forming grass species (Cynodon dactylon) and a species that is frequently found outside grazing lawns (Hyparrhenia hirta), and tested for the effect of herbivore disturbance in the form of trampling and clipping. We also performed a vegetation and herbivore survey to apply experimentally derived insights to field observations. Our results showed that interspecific competition was not affected by soil nutrient concentrations. C. dactylon did show much more resilience to disturbance than H. hirta, presumably due to the regenerative capacity of its rhizomes. Results from the field survey were in line with these findings, describing a correlation between herbivore pressure and C. dactylon abundance. We conclude that herbivore disturbance, and not soil nutrients, provide C. dactylon with a competitive advantage over H. hirta, due to vegetative regeneration from its rhizomes. This provides evidence for the importance of concentrated, high herbivore densities for the creation and maintenance of grazing lawns.
Arjunan, Nareshkumar; Murugan, Kadarkarai; Madhiyazhagan, Pari; Kovendan, Kalimuthu; Prasannakumar, Kanagarajan; Thangamani, Sundaram; Barnard, Donald R
2012-04-01
Ethanolic extracts of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus were tested for their toxicity effect on the third-instar larvae of Anopheles stephensi, Culex quinquefasciatus and Aedes aegypti. The leaves of C. dactylon, A. vera, H. indicus and C. amboinicus were collected from natural habitats (forests) in Western Ghats, Tamil Nadu, India. A total of 250 g of fresh, mature leaves were rinsed with distilled water and dried in shade. The dried leaves were put in Soxhlet apparatus and extract prepared using 100% ethanol for 72 h at 30-40°C. Dried residues were obtained from 100 g of extract evaporated to dryness in rotary vacuum evaporator. Larvicidal properties of ethanolic leaf extracts showed that the extracts are effective as mosquito control agents. The larval mortality was observed after 24 h exposure. No mortality was observed in the control. The median lethal concentration (LC(50)) values observed for the larvicidal activities are 0.44%, 0.51%, 0.59% and 0.68% for extracts of C. dactylon, A. vera, H. indicus and C. amboinicus, respectively. The observed mortality were statistically significant at P < 0.05 level. C. dactylon showed the highest mortality rate against the three species of mosquito larvae in laboratory and field. The selected plants were shown to exhibit water purification properties. Water quality parameters such as turbidity, pH and water clarity were analyzed in the water samples (pre-treatment and post-treatment of plant extracts) taken from the different breeding sites of mosquitoes. Water colour, turbidity and pH were reduced significantly after treatment with C. dactylon (13 HU, 31.5 mg/l and 6.9), H. indicus (13.8 HU, 33 mg/l and 7.1), A. vera (16 HU, 33.8 mg/l and 7.4) and C. amboinicus (21 HU, 35 mg/l and 7.5) extracts. The study proved that the extracts of C. dactylon, A. vera, H. indicus and C. amboinicus have both mosquitocidal and water sedimentation properties.
Antidiabetic activity of aqueous extract and non polysaccharide fraction of Cynodon dactylon Pers.
Jarald, E E; Joshi, S B; Jain, D C
2008-09-01
Petroleum ether (60 degrees-80 degrees C), chloroform, acetone, ethanol, aqueous and crude hot water extracts of the whole plant of C. dactylon and the two fractions of aqueous extract were tested for antihyperglycaemic activity in glucose overloaded hyperglycemic rats and in alloxan induced diabetic model at two-dose levels, 200 and 400 mg/kg (po) respectively. The aqueous extract of C. dactylon and the non polysaccharide fraction of aqueous extract were found to exhibit significant antihyperglycaemic activity and only the non polysaccharide fraction was found to produce hypoglycemia in fasted normal rats. Treatment of diabetic rats with aqueous extract and non polysaccharide fraction of the plant decreased the elevated biochemical parameters, glucose, urea, creatinine, serum cholesterol, serum triglyceride, high density lipoprotein, low density lipoprotein, haemoglobin and glycosylated haemoglobin significantly. Comparatively, the non polysaccharide fraction of aqueous extract was found to be more effective than the aqueous extract.
Garjani, Alireza; Afrooziyan, Arash; Nazemiyeh, Hossein; Najafi, Moslem; Kharazmkia, Ali; Maleki-Dizaji, Nasrin
2009-08-05
The rhizomes of Cynodon dactylon are used for the treatment of heart failure in folk medicine. In the present study, we investigated the effects of hydroalcoholic extract of C. dactylon rhizomes on cardiac contractility in normal hearts and on cardiac functions in right-heart failure in rats. Right-heart failure was induced by intraperitoneal injection of monocrotaline (50 mg/kg). Two weeks later, the animals were treated orally with different doses of the extract for fifteen days. At the end of the experiments cardiac functions and markers of myocardial hypertrophy were measured. The treated rats showed very less signs of fatigue, peripheral cyanosis and dyspnea. The survival rate was high in the extract treated groups (90%). Administration of C. dactylon in monocrotaline-injected rats led to profound improvement in cardiac functions as demonstrated by decreased right ventricular end diastolic pressure (RVEDP) and elevated mean arterial pressure. RVdP/dtmax, and RVdP/dt/P as indices of myocardial contractility were also markedly (p < 0.001; using one way ANOVA) increased by the extract. The extract reduced heart and lung congestion by decreasing tissue wet/dry and wet/body weight ratios (p < 0.01). In the isolated rat hearts, the extract produced a remarkable (P < 0.001) positive inotropic effect concomitant with a parallel decrease in LVEDP. The results of this study indicated that C. dactylon exerted a strong protective effect on right heart failure, in part by positive inotropic action and improving cardiac functions.
Kaleeswaran, B; Ilavenil, S; Ravikumar, S
2011-12-01
Indian major carp (Catla catla) was subjected to study the immunostimulatory effects when the grass Cynodon dactylon(L) ethanolic extract administrated as feed supplement. C. catla was fed with 0% (Control), 0.05% (group I), 0.5% (group II) and 5% (group III) extract provided for 60 days. Blood samples were collected at every 10 days of interval up to 60 days for analyzing the non-specific humoral (lysozyme activity, antiprotease activity and haemolytic complement) and cellular (production of reactive oxygen and nitrogen species, myeloperoxidase activity) immune response study. The results indicate that C. dactylon ethanolic extract administered as feed supplement significantly (P < 0.05) enhanced most of the non-specific immune parameters tested. Among the experimental diet groups, significantly increased response of non-specific immunity was seen in group III (5%). Disease resistant analysis against Aeromonas hydrophila was performed in control group and plant extract treated fish for 7, 14, 21 and 28 days. Relative percent survival rate (RPS) was observed in treated samples, which is directly proportional to concentration of the extract. Additionally, electron microscopic studies and gelatin zymography for Matrix Metalo Proteinase (MMPs) were examined in spleen at 7th and 28th days of feeding. Administration of C. dactylon mixed diet delayed the lymphocyte destruction with positive ultrastructural changes. An induced stress (A. hydrophila infection) was observed by using MMPs expression, which was reduced in the experimental diet groups than the control. All these experimental results prove that C. dactylon ethanolic extract enhances the immunity of Catla fish. Copyright © 2011 Elsevier Ltd. All rights reserved.
Zhang, Bing; Xiao, Xiaolin; Zong, Junqin; Chen, Jingbo; Li, Jianjian; Guo, Hailin; Liu, Jianxiu
2017-12-01
Bermudagrass (Cynodon dactylon L.) is a prominent warm-season turf and forage grass species with multiple applications. In most C. dactylon cultivars and accessions, erect-growing stems (shoot) and prostrate-growing stems (stolon) often coexist. These two types of stems are both formed through tillering but grow in two directions with different tiller angles. Elucidating the mechanism of tiller angle regulation in bermudagrass could provide important clues to breed cultivars with different plant architectural features for diverse usage. In this study, we compared the stem internode transcriptome of two bermudagrass wild accessions with extremely different tiller angles and stem growth directions. A total of 2088 and 12,141 unigenes were preferentially expressed in prostrate-growing wild accession C792 and erect-growing wild accession C793, respectively. Kyoto Encyclopedia of Genes and Genomes (KEGG) Orthology-based Annotation System (KOBAS) analyses further indicated that light- and gravity-responsive genes were enriched in accession C792, whereas lignin synthesis-related genes were enriched in accession C793, which well explains the difference in lignification of vascular bundles and mechanical tissues in the two accessions. These results not only expand our understanding of the genetic control of tiller angle and stem growth direction in bermudagrass but also provide insight for future molecular breeding of C. dactylon and other turfgrass species with different plant architectures. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Functional dissection of drought-responsive gene expression patterns in Cynodon dactylon L.
Kim, Changsoo; Lemke, Cornelia; Paterson, Andrew H
2009-05-01
Water deficit is one of the main abiotic factors that affect plant productivity in subtropical regions. To identify genes induced during the water stress response in Bermudagrass (Cynodon dactylon), cDNA macroarrays were used. The macroarray analysis identified 189 drought-responsive candidate genes from C. dactylon, of which 120 were up-regulated and 69 were down-regulated. The candidate genes were classified into seven groups by cluster analysis of expression levels across two intensities and three durations of imposed stress. Annotation using BLASTX suggested that up-regulated genes may be involved in proline biosynthesis, signal transduction pathways, protein repair systems, and removal of toxins, while down-regulated genes were mostly related to basic plant metabolism such as photosynthesis and glycolysis. The functional classification of gene ontology (GO) was consistent with the BLASTX results, also suggesting some crosstalk between abiotic and biotic stress. Comparative analysis of cis-regulatory elements from the candidate genes implicated specific elements in drought response in Bermudagrass. Although only a subset of genes was studied, Bermudagrass shared many drought-responsive genes and cis-regulatory elements with other botanical models, supporting a strategy of cross-taxon application of drought-responsive genes, regulatory cues, and physiological-genetic information.
Duffort, O; Calabozo, B; González, R; Carpizo, J A; Barber, D; Polo, F
2004-12-01
Pollen of Bermuda grass (Cynodon dactylon) is an important cause of pollinosis in many areas of the world. Most patients show sensitivity to the major allergen Cyn d 1, a glycoprotein composed of a number of isoforms with a molecular mass of 31-32 kDa. The aim of this work was to develop a monoclonal antibody (mAb)-based ELISA to quantify Cyn d 1, and to assess the correlation of the allergen content with the biological activity of C. dactylon pollen extracts. After fusion of myeloma cells with spleen cells from a BALB/c mouse immunized with C. dactylon pollen extract, Cyn d 1-specific mAbs secreting hybridomas were selected, and the antibodies characterized. One of them (4.4.1) was used as the capture antibody in an ELISA method for Cyn d 1 quantitation. An anti-Cyn d 1 rabbit serum was used as the second antibody. Cyn d 1 was purified by immunoaffinity chromatography with mAb 4.4.1, characterized, and used as the standard in the assay. The identity, purity and isoallergen composition of affinity-purified Cyn d 1 was confirmed by N-terminal amino acid sequencing, SDS-PAGE, Western blot and 2D electrophoresis. The Cyn d 1 ELISA is highly specific and sensitive, with a detection limit of 0.24 ng/ml and a linear range of 1.1-9.2 ng/ml. An excellent correlation was found when the content of Cyn d 1, measured in 16 different extracts, was compared with the allergenic activity of the same extracts determined by RAST inhibition. The results prove the usefulness of the Cyn d 1 ELISA for the standardization of C. dactylon-allergen products on the basis of major allergen content. 2004 S. Karger AG, Basel.
Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J
2016-08-29
In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings.
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011. Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and ...
The effects of cynodon dactylon on the immune response of NMRI-MICE after challenge with REV1
Directory of Open Access Journals (Sweden)
Behrooz Ilkhanizadeh
2016-10-01
Full Text Available Cynodon dactylon is used in Iranian traditional medicine as a healing agent for reducing the complications of diabetes mellitus. We proposed that Cynodon dactylon may perform its effects through moderating humoral and cellular immune responses. We aimed to determine the possible effects of hydroalcholic extract of Cynodon dactylonon humoral and cellular immune responses following the Rev1 challenge in the mouse model. 20 NMRI male mice were randomly grouped in two equal groups and immunized with Rev1[0.1 ml Rev1+0.9 PBS[. Mice in the treatment group orally received 400 mg/kg hydroalcoholic extract of Cynodon dactylon every day from the beginning of the study for 2 weeks. Blood samples were obtained from the animals 5 days after the last injection. Moreover, 48 hr before bleeding time, Rev1[0.1 ml Rev1+0.9 PBS[was injected into the left hind foot pad of mice. The levels of anti-Rev1 antibody and the specific cellular immune responses were measured by microhemagglutination test and footpad thickness, respectively. Moreover, susceptibility of macrophages respiratory burst and proliferation of immune cells were measured in order withNitroblue tetrazolium[NBT] and Microculture Tetrazolium Assay [MTT]. The concentrations of IL-1, TNFα, Il-6, and IL-10 in the serum were determined using commercially available ELISA kits. We found a significant increase in anti-Rev1 antibody levels and simultaneously a significant decrease in the level of cellular immunity[DTH] in the treatment group compared to the control group. Lymphocyte proliferation index in splenocytes was significantly increased in the treatment group. However, the level of respiratory burst in phagocytic population of splenocytes dramatically decreased in the treatment group compared to the control. A significant decrease in IL-6, TNF-α , IL-1 and increaseIl-10 serum levels were also seen in the treatment group. Cynodon dactylon extract could have an anti-inflammatory effect through
International Nuclear Information System (INIS)
Shu, W.S.; Ye, Z.H.; Lan, C.Y.; Zhang, Z.Q.; Wong, M.H.
2002-01-01
Metal-tolerant populations of the plants Paspalum distichum and Cunodon dactylon were identified. - Both Fankou and Lechang lead/zinc (Pb/Zn) mine tailings located at Guangdong Province contained high levels of total and DTPA-extractable Pb, Zn and Cu. Paspalum distichum and Cynodon dactylon were dominant species colonized naturally on the tailings. Lead, zinc and copper accumulation and tolerance of different populations of the two grasses growing on the tailings were investigated. Tillers of these populations including those from an uncontaminated area were subjected to the following concentrations: 5, 10, 20, 30 and 40 mg l -1 Pb, 2.5, 5, 10, 20 and 30 mg l -1 Zn, or 0.25, 0.50, 1 and 2 mg l -1 Cu for 14 days, respectively, then tolerance index (TI) and EC 50 (the concentrations of metals in solutions which reduce 50% of normal root growth) were calculated. The results indicated that both Lechang and Fankou populations of the two grasses showed a greater tolerance to the three metals than those growing on the uncontaminated area, which suggested that co-tolerant ecotypes have evolved in the two grasses. P. distichum collected from Fankou tailings had the highest tolerance to Cu while Lechang population the highest tolerance to Pb and Zn among the tested populations, and tolerance levels in P. distichum were related to metal concentrations in the plants. P. distichum had a better growth performance than C. dactylon when both of them were grown on the tailings sites. Tolerant populations of these species would serve as potential candidates for re-vegetation of wastelands contaminated with Pb, Zn and Cu
Energy Technology Data Exchange (ETDEWEB)
Shu, W.S.; Ye, Z.H.; Lan, C.Y.; Zhang, Z.Q.; Wong, M.H
2002-12-01
Metal-tolerant populations of the plants Paspalum distichum and Cunodon dactylon were identified. - Both Fankou and Lechang lead/zinc (Pb/Zn) mine tailings located at Guangdong Province contained high levels of total and DTPA-extractable Pb, Zn and Cu. Paspalum distichum and Cynodon dactylon were dominant species colonized naturally on the tailings. Lead, zinc and copper accumulation and tolerance of different populations of the two grasses growing on the tailings were investigated. Tillers of these populations including those from an uncontaminated area were subjected to the following concentrations: 5, 10, 20, 30 and 40 mg l{sup -1} Pb, 2.5, 5, 10, 20 and 30 mg l{sup -1} Zn, or 0.25, 0.50, 1 and 2 mg l{sup -1} Cu for 14 days, respectively, then tolerance index (TI) and EC{sub 50} (the concentrations of metals in solutions which reduce 50% of normal root growth) were calculated. The results indicated that both Lechang and Fankou populations of the two grasses showed a greater tolerance to the three metals than those growing on the uncontaminated area, which suggested that co-tolerant ecotypes have evolved in the two grasses. P. distichum collected from Fankou tailings had the highest tolerance to Cu while Lechang population the highest tolerance to Pb and Zn among the tested populations, and tolerance levels in P. distichum were related to metal concentrations in the plants. P. distichum had a better growth performance than C. dactylon when both of them were grown on the tailings sites. Tolerant populations of these species would serve as potential candidates for re-vegetation of wastelands contaminated with Pb, Zn and Cu.
Wong, M H; Lau, W M
1985-04-01
An ecological survey was conducted on the roadside vegetation at three different sites: Tai Po, a commercial and residential area (average annual daily traffic (AADT) = 23730; and Shek O and Wu Kai Sha, recreational areas (AADT = 1590 and 20, respectively). Cynodon dactylon and Eleusine indica were the two most dominant species recorded. The Tai Po site had higher Pb contents in both soil and plant, followed by Shek O, and then Wu Kai Sha. Tillers of C. dactylon and E. indica from the three sites were subjected to a series concentrations of Pb(NO3)2. By comparing their indexes of tolerance and values of 14-day EC50 (effective concentration reducing the normal root growth by 50%), roadside populations of the two grasses collected from Tai Po and Shek O, especially the former one, were more tolerant to elevated levels of Pb compared with those collected from Wu Kai Sha.
Khanal, Sameer; Kim, Changsoo; Auckland, Susan A; Rainville, Lisa K; Adhikari, Jeevan; Schwartz, Brian M; Paterson, Andrew H
2017-04-01
We report SSR-enriched genetic maps of bermudagrass that: (1) reveal partial residual polysomic inheritance in the tetraploid species, and (2) provide insights into the evolution of chloridoid genomes. This study describes genetic linkage maps of two bermudagrass species, Cynodon dactylon (T89) and Cynodon transvaalensis (T574), that integrate heterologous microsatellite markers from sugarcane into frameworks built with single-dose restriction fragments (SDRFs). A maximum likelihood approach was used to construct two separate parental maps from a population of 110 F 1 progeny of a cross between the two parents. The T89 map is based on 291 loci on 34 cosegregating groups (CGs), with an average marker spacing of 12.5 cM. The T574 map is based on 125 loci on 14 CGs, with an average marker spacing of 10.7 cM. Six T89 and one T574 CG(s) deviated from disomic inheritance. Furthermore, marker segregation data and linkage phase analysis revealed partial residual polysomic inheritance in T89, suggesting that common bermudagrass is undergoing diploidization following whole genome duplication (WGD). Twenty-six T89 CGs were coalesced into 9 homo(eo)logous linkage groups (LGs), while 12 T574 CGs were assembled into 9 LGs, both putatively representing the basic chromosome complement (x = 9) of the species. Eight T89 and two T574 CGs remain unassigned. The marker composition of bermudagrass ancestral chromosomes was inferred by aligning T89 and T574 homologs, and used in comparisons to sorghum and rice genome sequences based on 108 and 91 significant blast hits, respectively. Two nested chromosome fusions (NCFs) shared by two other chloridoids (i.e., zoysiagrass and finger millet) and at least three independent translocation events were evident during chromosome number reduction from 14 in the polyploid common ancestor of Poaceae to 9 in Cynodon.
Cynodon dactylon (L) Pers (Poaceae) root extract induces apoptotic ...
African Journals Online (AJOL)
has also been used for the treatment of weak vision, urinary tract infection, .... with an alternating 12 h dark/light cycle in ... detected by Western blot analysis as described previously .... the cyclin signaling pathways, induced apoptotic cell death ...
Embryo sac development in some representatives of the tribe Cynodonteae (Poaceae
Directory of Open Access Journals (Sweden)
A. Strydom
1994-10-01
Full Text Available Chloris virgata Sw., Cynodon dactylon (L. Pers., Harpochloa falx (L. f. Kuntze, and Tragus berteronianus Schult. have a Polygonum type of embryo sac development. Unreduced embryo sacs were found in Eustachys paspaloides (Vahl Lanza & Mattei, Harpochloa falx, and Rendlia altera (Rendle Chiov. Both facultative and obligate apomixis were observed. The Hieracium type of embryo sac development was observed in the aposporic specimens.
Embryo sac development in some representatives of the tribe Cynodonteae (Poaceae)
A. Strydom; J. J. Spies
1994-01-01
Chloris virgata Sw., Cynodon dactylon (L.) Pers., Harpochloa falx (L. f.) Kuntze, and Tragus berteronianus Schult. have a Polygonum type of embryo sac development. Unreduced embryo sacs were found in Eustachys paspaloides (Vahl) Lanza & Mattei, Harpochloa falx, and Rendlia altera (Rendle) Chiov. Both facultative and obligate apomixis were observed. The Hieracium type of embryo sac development was observed in the aposporic specimens.
CATÁLOGO DE LA FAMILIA POACEAE EN COLOMBIA
Directory of Open Access Journals (Sweden)
Diego Giraldo-Cañas
2011-01-01
Full Text Available Se presenta un inventario de las especies de Poaceae de Colombia junto con un análisis de la diversidad específica de esta familia según las regiones naturales colombianas, los gradientes de altitud y de precipitaciones, y la distribución sistemática. Se realizaron 96 expediciones de campo a las diez grandes regiones naturales de Colombia (Amazonia, Andes, Caribe, Chocó Biogeográfico, Guayana, islas caribeñas, Orinoquia, Sierra Nevada de Santa Marta, valle del río Cauca y valle del río Magdalena con un muestreo total de alrededor de 5800 ejemplares. Además, se consultaron colecciones de los herbarios CAUP, COAH, COL, CUVC, CHOCO, HFAB, HUA, HUQ, JAUM, MEDEL, MEXU, MO, NY, PSO, RSA, SI, UDBC, UIS, US, VALLE y VEN, y se realizó una investigación bibliográfica exhaustiva. Las Poaceae están representadas en Colombia por 840 especies y 173 géneros. Se reconocieron 74 especies y un género (Agrostopoa endémicos. Por otra parte, se documentaron 83 especies introducidas-naturalizadas y 50 introducidas-cultivadas. Los géneros más ricos en especies son Paspalum (89 especies, Panicum (42, Festuca (36, Eragrostis (29, Calamagrostis (25, Chusquea (25, Digitaria (24, Axonopus (21, Setaria (20, Cenchrus (18, Poa (17, Muhlenbergia (16, Andropogon (15, Aristida (15, Agrostis (14, Lasiacis (12, Urochloa (12, Pariana (11, Sporobolus (11, Arthrostylidium (10, Cortaderia (10, Nassella (10, Neurolepis (10 y Schizachyrium (10. Durante el desarrollo de esta investigación, se descubrieron 10 nuevos registros para la flora colombiana. La regiones Andina, Orinocense, Caribe y Guayanesa son las más ricas en especies, con 583, 233, 186 y 179 especies, respectivamente. La Región Andina presenta el mayor número de especies endémicas (57 especies. Los gradientes altitudinales más diversos corresponden a los de las tierras bajas (por debajo de 1200 m s.m.. Al igual que en otras áreas tropicales, en Colombia las subfamilias de Poaceae muestran una
Directory of Open Access Journals (Sweden)
Anna Maria Mercuri
2016-12-01
Full Text Available Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change.
Mercuri, Anna Maria; Torri, Paola; Fornaciari, Rita; Florenzano, Assunta
2016-01-01
Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region) that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change. PMID:27929423
DOSES DE LODO DE ESGOTO SOBRE O DESENVOLVIMENTO DA GRAMA BERMUDA (Cynodon dactylon)
NOBILE, Fabio Olivieri de; NUNES, Hugo Dias; NEVES, Jéssica Caroline
2014-01-01
Population growth occurred rapidly, resulting in cities with poor infrastructure on the sanitation sector. So, there was the introduction of sanitary treatment, causing difficulty in choosing alternatives for the proper disposal of sewage sludge, rich in essential nutrients for the plants. The experiment was conducted to determine the best dose of sewage sludge to Grass Cynodon dactylon. It was conducted in greenhouse in the University Center of Educational Foundation of Barretos-SP. The expe...
Nature of ergastic substances in some Poaceae seeds | Idu | African ...
African Journals Online (AJOL)
Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and protein and were devoid of tannins and inulin. Only 12 seed samples indicated the presence of alkaloids. The Positively ...
Hong, Ming; Guo, Quan-Shu; Nie, Bi-Hong; Kang, Yi; Pei, Shun-Xiang; Jin, Jiang-Qun; Wang, Xiang-Fu
2011-11-01
This paper studied the population density, morphological characteristics, and biomass and its allocation of Cynodon dactylon at different altitudinal sections of the hydro-fluctuation belt in Three Gorges Reservoir area, based on located observations. At the three altitudinal sections, the population density of C. dactylon was in the order of shallow water section (165-170 m elevation) > non-flooded section (above 172 m elevation) > deep water section (145-150 m elevation), the root diameter and root length were in the order of deep water section > shallow water section > non-flooded section, the total biomass, root biomass, stem biomass, leaf biomass, and stem biomass allocation ratio were in the order of the shallow water section > non-flooded section > deep water section, and the root biomass allocation ratio, leaf biomass allocation ratio, and underground biomass/aboveground biomass were in the order of deep water section > shallow water section > non-flooded section. The unique adaption strategies of C. dactylon to the flooding-drying habitat change in the shallow water section were the accelerated elongation growth and the increased stem biomass allocation, those in the deep water section were the increased node number of primary and secondary branches, increased number of the branches, and increased leaf biomass allocation, whereas the common strategies in the shallow and deep water sections were the accelerated root growth and the increased tillering and underground biomass allocation for preparing nutrition and energy for the rapid growth in terrestrial environment.
Responses of meristematic callus cells of two Cynodon dactylon genotypes to aluminium.
Ramgareeb, Sumita; Cooke, John A; Watt, M Paula
2004-11-01
Responses to Al3+ of embryogenic callus cells of an Al-sensitive (Al-S) and Al-resistant (Al-R) Cynodon dactylon genotype were evaluated with regard to Al3+ toxicity and resistance. A chemical equilibrium speciation model (MINTEQA2) was used to ensure the availability of the Al3+ ion in culture media, which was supplied as 0.08-2.3 mM Al3+ for 2-8 weeks. Increasing Al3+ concentration and exposure time had a greater negative impact on the Al-S than on the Al-R genotype, in terms of callus growth rate and frequency of non-embryogenic cells. Exposure to 0.8 mM Al3+ for 2 weeks resulted in an 88% reduction in the Al-S meristematic cell number, whereas that of the Al-R genotype remained unaffected. In addition, the Al-S cells accumulated three times more Al in the nucleus than did the Al-R cells, suggesting that Al interfered with mitosis. The Al-R cells appeared to exclude Al3+ from its cells through an increase in extracellular pH (4.34 in Al-R and 4.08 in Al-S) and by the immobilisation of Al in the cell wall (33% more in Al-R). The results showed that by studying the cellular responses to Al3+ it is possible to discriminate between the Al-S and Al-R C. dactylon genotypes.
Anticancer activity of Cynodon dactylon and Oxalis corniculata on Hep2 cell line.
Salahuddin, H; Mansoor, Q; Batool, R; Farooqi, A A; Mahmood, T; Ismail, M
2016-04-30
Bioactive chemicals isolated from plants have attracted considerable attention over the years and overwhelmingly increasing laboratory findings are emphasizing on tumor suppressing properties of these natural agents in genetically and chemically induced animal carcinogenesis models. We studied in vitro anticancer activity of organic extracts of Cynodon dactylon and Oxalis corniculata on Hep2 cell line and it was compared with normal human corneal epithelial cells (HCEC) by using MTT assay. Real Time PCR was conducted for p53 and PTEN genes in treated cancer cell line. DNA fragmentation assay was also carried out to note DNA damaging effects of the extracts. The minimally effective concentration of ethanolic extract of Cynodon dactylon and methanolic extract of Oxalis corniculata that was nontoxic to HCEC but toxic to Hep2 was recorded (IC50) at a concentration of 0.042mg/ml (49.48 % cell death) and 0.048mg/ml (47.93% cell death) respectively, which was comparable to the positive control. Our results indicated dose dependent increase in cell death. P53 and PTEN did not show significant increase in treated cell line. Moreover, DNA damaging effects were also not detected in treated cancer cell line. Anticancer activity of these plants on the cancer cell line showed the presence of anticancer components which should be characterized to be used as anticancer therapy.
Agronomic behaviour of some Cynodon dactylon ecotypes for turfgrass use in the Mediterranean climate
Directory of Open Access Journals (Sweden)
Roberto Viggiani
2015-02-01
Full Text Available In Italy, the expansion of turfgrasses is limited by the lack of suitable species for cultivation in the Mediterranean climate. With this view, Mi.Te.A.Med. (Turfgrass improvement in the Mediterranean climate research project was developed with the main purpose to find out and agronomically characterise native turfgrass species of Southern and Central Italy and to compare them with some commercial cultivars. During the first step of the research, 11 sites from 6 regions of Southern and Central Italy were identified. In these sites 24 ecotypes of Cynodon dactylon L. (Pers. were collected and their habitus, phenology plus some biometric parameters have been determined. During the two years of research both botanic and agronomic characterisation of the collected C. dactylon ecotypes and their comparison with 3 commercial cultivars (Panama, Transcontinental and Yukon was carried out. In the first year the colour loss interval was assessed. In the second year, colour index was measured by an electronic colorimeter, weekly growth rate was measured by a turfmeter, turf quality and ground cover percentage were assessed by visual estimate. Some native accessions showed behaviour similar to commercial cultivars while an ecotype from the Abruzzo region showed better results compared to the commercial cultivars for several quality indices.
Soraya, Hamid; Moloudizargari, Milad; Aghajanshakeri, Shahin; Javaherypour, Soheil; Mokarizadeh, Aram; Hamedeyazdan, Sanaz; Esmaeli Gouvarchin Ghaleh, Hadi; Mikaili, Peyman; Garjani, Alireza
2015-01-29
Cynodon dactylon, a valuable medicinal plant, is widely used in Iranian folk medicine for the treatment of various cardiovascular diseases such as heart failure and atherosclerosis. Moreover, its anti-diabetic, anti-cancer and anti-microbial properties have been also reported. Concerning the critical role of angiogenesis in the incidence and progression of tumors and also its protective role in cardiovascular diseases, we investigated the effects of the aqueous extract prepared from the rhizomes of C. dactylon on vascular endothelial growth factor (VEGF) expressions in Human Umbilical Vein Endothelial Cells (HUVECs) and also on angiogenesis in carrageenan induced air-pouch model in rats. In the air-pouch model, carrageenan was injected into an air-pouch on the back of the rats and following an IV injection of carmine red dye on day 6, granulation tissue was processed for the assessment of the dye content. Furthermore, in an in vitro study, angiogenic property of the extract was assessed through its effect on VEGF expression in HUVECs. Oral administration of 400 mg/kg/day of the extract significantly increased angiogenesis (p<0.05) and markedly decreased neutrophil (p<0.05) and total leukocyte infiltration (p<0.001) into the granulation tissues. Moreover, the extract increased the expression of total VEGF in HUVECs at a concentration of (100 μl/ml). The present study showed that the aqueous extract of C. dactylon promotes angiogenesis probably through stimulating VEGF expression.
Directory of Open Access Journals (Sweden)
Dunn Sade N
2008-06-01
Full Text Available Abstract Background Quantitative Real Time RT-PCR (q2(RTPCR is a maturing technique which gives researchers the ability to quantify and compare very small amounts of nucleic acids. Primer design and optimization is an essential yet time consuming aspect of using q2(RTPCR. In this paper we describe the design and empirical optimization of primers to amplify and quantify plastid RNAs from Zea mays that are robust enough to use with other closely related species. Results Primers were designed and successfully optimized for 57 of the 104 reported genes in the maize plastome plus two nuclear genes. All 59 primer pairs produced single amplicons after end-point reverse transcriptase polymerase chain reactions (RT-PCR as visualized on agarose gels and subsequently verified by q2(RTPCR. Primer pairs were divided into several categories based on the optimization requirements or the uniqueness of the target gene. An in silico test suggested the majority of the primer sets should work with other members of the Poaceae family. An in vitro test of the primer set on two unsequenced species (Panicum virgatum and Miscanthus sinensis supported this assumption by successfully producing single amplicons for each primer pair. Conclusion Due to the highly conserved chloroplast genome in plant families it is possible to utilize primer pairs designed against one genomic sequence to detect the presence and abundance of plastid genes or transcripts from genomes that have yet to be sequenced. Analysis of steady state transcription of vital system genes is a necessary requirement to comprehensively elucidate gene expression in any organism. The primer pairs reported in this paper were designed for q2(RTPCR of maize chloroplast genes but should be useful for other members of the Poaceae family. Both in silico and in vitro data are presented to support this assumption.
An experiment was conducted at the University of Kentucky Spindletop Farm in Lexington, Kentucky between October and November, 2009 to evaluate the effect of different percentages of alfalfa (Medicago sativa) as mixtures in switchgrass (Panicum virgatus) and bermudagrass (Cynodon dactylon) silages. ...
[Growth analysis on modules of Cynodon dactylon clones in Yili River Valley Plain of Xinjiang].
Zhao, Yu; Janar; Li, Hai-Yan; Liu, Ying; Yang, Yun-Fei
2009-04-01
By the method of randomly digging up whole ramet tuft while maintaining natural integrity, large samples of Cynodon dactylon clones were collected from a grape orchard abandoned for 2 years without any management in the Yili River Valley Plain of Xinjiang, aimed to quantitatively analyze the growth patterns of their modules. The results showed that the average ramet number of test 30 clones reached 272.6 +/- 186. 6, among which, vegetative ramets occupied 82.3%, being 4.3 times higher than reproductive ones. The total biomass of the clones was 45.4 +/- 40.0 g, in which, rhizomes accounted for 54.4%, while the vegetative ramets, stolons, and reproductive ramets occupied 21.0%, 14.8%, and 9.4% of the total, respectively. The accumulative length of rhizomes and stolons reached 5.1 + 4.7 m and 3.3 +/- 3.4 m, while the bud number on stolons and rhizomes was 291.5 +/- 246.8 and 78.8 +/- 87.4, respectively. The bud number on stolons and rhizomes was positively correlated to the quantitative characters of vegetative ramets, reproductive ramets, stolons, and rhizomes (P < 0.01), indicating that in Yili River Valley Plain, C. dactylon clone could achieve and maintain its continuous renovation via rhizome buds.
O gênero Chloris (Poaceae) em Pernambuco, Brasil
Maciel, Jefferson Rodrigues; Silva, Wegliane Campelo da; Costa-e-Silva, Maria Bernadete
2013-01-01
Com o objetivo de colaborar com o conhecimento da riqueza de Poaceae em Pernambuco, foi estudado o gênero Chloris Sw. As coletas foram realizadas no estado, bem como dados foram coligidos de levantamento em herbários da região. Foram registradas sete espécies de Chloris em Pernambuco: C. barbata Sw., C. elata Desv., C. exilis Renv., C. gayana Kunth, C. orthonoton Döll, C. pycnothrix Trin. e C. virgata Sw. O gênero apresenta distribuição ampla em todas as zonas fitogeográficas do estado. Chlor...
Fluoride sorption using Cynodon dactylon based activated carbon
Directory of Open Access Journals (Sweden)
Alagumuthu G.
2011-01-01
Full Text Available This study deals the application of Cynodon dactylon based thermally activated carbon for fluoride toxicity. The batch adsorption techniques was followed at neutral pH as the functions of contact time, adsorbent dose, adsorbate concentration, temperature and the effect of co-anions. The data indicate that the prepared adsorbent surface sites are heterogeneous in nature and that fits into a heterogeneous site-binding model. The present system followed the Redlich-Peterson isotherm as well as Langmuir adsorption isotherm model. Lagergren pseudo-first-order, pseudo-second-order, intra particle diffusion and Elovich kinetics were modeled to describe the adsorption rate of fluoride and determined as this scheme followed pseudo-second-order kinetics. The calculated enthalpy change, ΔH°, and entropy change, ΔS°, for the adsorption process are +8.725 kJ/mol and +0.033 J/mol K respectively and shows endothermic experience. Instrumental analysis of XRD, FTIR and SEM gives the idea about the fluoride binding ability of adsorbent.
Wesseling, Anne-Maria; Demetrowitsch, Tobias J.; Schwarz, Karin; Ober, Dietrich
2017-01-01
Pyrrolizidine alkaloids (PAs) are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae). Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae). In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid. PMID:29250094
Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae
Directory of Open Access Journals (Sweden)
Anne-Maria Wesseling
2017-11-01
Full Text Available Pyrrolizidine alkaloids (PAs are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae. Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae. In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid.
García de León, David; García-Mozo, Herminia; Galán, Carmen; Alcázar, Purificación; Lima, Mauricio; González-Andújar, José L
2015-10-15
Pollen allergies are the most common form of respiratory allergic disease in Europe. Most studies have emphasized the role of environmental processes, as the drivers of airborne pollen fluctuations, implicitly considering pollen production as a random walk. This work shows that internal self-regulating processes of the plants (negative feedback) should be included in pollen dynamic systems in order to give a better explanation of the observed pollen temporal patterns. This article proposes a novel methodological approach based on dynamic systems to investigate the interaction between feedback structure of plant populations and climate in shaping long-term airborne Poaceae pollen fluctuations and to quantify the effects of climate change on future airborne pollen concentrations. Long-term historical airborne Poaceae pollen data (30 years) from Cordoba city (Southern Spain) were analyzed. A set of models, combining feedback structure, temperature and actual evapotranspiration effects on airborne Poaceae pollen were built and compared, using a model selection approach. Our results highlight the importance of first-order negative feedback and mean annual maximum temperature in driving airborne Poaceae pollen dynamics. The best model was used to predict the effects of climate change under two standardized scenarios representing contrasting temporal patterns of economic development and CO2 emissions. Our results predict an increase in pollen levels in southern Spain by 2070 ranging from 28.5% to 44.3%. The findings from this study provide a greater understanding of airborne pollen dynamics and how climate change might impact the future evolution of airborne Poaceae pollen concentrations and thus the future evolution of related pollen allergies. Copyright © 2015 Elsevier B.V. All rights reserved.
Roy, Swarnendu; Chakraborty, Usha
2018-01-01
Comparative analyses of the responses to NaCl in Cynodon dactylon and a sensitive crop species like rice could effectively unravel the salt tolerance mechanism in the former. C. dactylon, a wild perennial chloridoid grass having a wide range of ecological distribution is generally adaptable to varying degrees of salinity stress. The role of salt exclusion mechanism present exclusively in the wild grass was one of the major factors contributing to its tolerance. Salt exclusion was found to be induced at 4 days when the plants were treated with a minimum conc. of 200 mM NaCl. The structural peculiarities of the salt exuding glands were elucidated by the SEM and TEM studies, which clearly revealed the presence of a bicellular salt gland actively functioning under NaCl stress to remove the excess amount of Na + ion from the mesophyll tissues. Moreover, the intracellular effect of NaCl on the photosynthetic apparatus was found to be lower in C. dactylon in comparison to rice; at the same time, the vacuolization process increased in the former. Accumulation of osmolytes like proline and glycine betaine also increased significantly in C. dactylon with a concurrent check on the H 2 O 2 levels, electrolyte leakage and membrane lipid peroxidation. This accounted for the proper functioning of the Na + ion transporters in the salt glands and also in the vacuoles for the exudation and loading of excess salts, respectively, to maintain the osmotic balance of the protoplasm. In real-time PCR analyses, CdSOS1 expression was found to increase by 2.5- and 5-fold, respectively, and CdNHX expression increased by 1.5- and 2-fold, respectively, in plants subjected to 100 and 200 mM NaCl treatment for 72 h. Thus, the comparative analyses of the expression pattern of the plasma membrane and tonoplast Na + ion transporters, SOS1 and NHX in both the plants revealed the significant role of these two ion transporters in conferring salinity tolerance in Cynodon.
Roy, Soumen; Pawar, Sandip; Chowdhary, Abhay
2016-01-01
To evaluate in vitro cytotoxicity and antioxidant activity of Datura metel L. and Cynodon dactylon L. extracts. The extraction of plants parts (datura seed and fruit pulp) and areal parts of durva was carried out using soxhlet and cold extraction method using solvents namely methanol and distilled water. The total phenolic content (TPC) and total flavonoid content (TFC) was determined by established methods. The in vitro cytotoxicity assay was performed in vero cell line by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay method. In vitro antioxidant activity of the extract was performed by 2, 2-diphenyl-1-picrylhydrazyl radical scavenging method. We found that the highest amount of TPC and TFC in methanolic extracts of seed (268.6 μg of gallic acid equivalence/mg of dry plant material) and fruit pulp (8.84 μg of quercetin equivalence/mg dry plant material) of D. metel, respectively prepared by Soxhlet method. The methanolic extract of C. dactylon prepared using soxhlation has shown potent free radical scavenging activity with 50% inhibitory concentration (IC50) value of 100 μg/ml. The IC50 of a methanolic cold extract of datura fruit was found to be 3 mg/ml against vero cell line. We observed that plant parts of C. dactylon and D. metel have a high antioxidant activity. Further research is needed to explore the therapeutic potential of these plant extracts. In the present study we observed a positive correlation was between the phenolic and flavanoid content of the Datura metel and cynodon doctylon (durva) extracts with the free radical scavenging activities. Both were found to have a high antioxidant activity. Abbreviations used: BHA: Butylated hydroxyanisole, BHT: Butylated hydroxytoluene, CC50: 50% cell cytotoxic concentration, CNS: Central nervous system, DPPH: 2, 2-diphenyl-1-picrylhydrazyl, IC50: 50% inhibitory concentration, MTT: 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide), TFC: Total flavonoid content, TPC: Total
Cogongrass, Imperata cylindrica (L.) Palisot de Beauvois (Cyperales: Poaceae), is a noxious invasive weed in the southeastern USA. Surveys for potential biological control agents of cogongrass were conducted in Asia and East Africa from 2013 to 2016. Several insect herbivores were found that may hav...
Complete plastid genome sequence of goosegrass (Eleusine indica) and comparison with other Poaceae.
Zhang, Hui; Hall, Nathan; McElroy, J Scott; Lowe, Elijah K; Goertzen, Leslie R
2017-02-05
Eleusine indica, also known as goosegrass, is a serious weed in at least 42 countries. In this paper we report the complete plastid genome sequence of goosegrass obtained by de novo assembly of paired-end and mate-paired reads generated by Illumina sequencing of total genomic DNA. The goosegrass plastome is a circular molecule of 135,151bp in length, consisting of two single-copy regions separated by a pair of inverted repeats (IRs) of 20,919 bases. The large (LSC) and the small (SSC) single-copy regions span 80,667 bases and 12,646 bases, respectively. The plastome of goosegrass has 38.19% GC content and includes 108 unique genes, of which 76 are protein-coding, 28 are transfer RNA, and 4 are ribosomal RNA. The goosegrass plastome sequence was compared to eight other species of Poaceae. Although generally conserved with respect to Poaceae, this genomic resource will be useful for evolutionary studies within this weed species and the genus Eleusine. Copyright © 2016. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Stancik Daniel
2001-07-01
Full Text Available The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.
Forma de crecimiento en Leptochloa Chloridiformis (Poaceae
Directory of Open Access Journals (Sweden)
Mariel G. Perreta
2000-01-01
Full Text Available Perreta, M. G., Tivano, J. C. & Vegetti, A. C. 2000. Forma de crecimiento en Leptochloachloridiformis (Poaceae. Darwiniana 38(3-4: 219-226.El objetivo de este trabajo fue analizar la forma de crecimiento de Leptochloa chloridiformis (Hack.Parodi. En esta especie perenne la ramificación ocurre principalmente a través de yemas axilarespresentes en la zona de innovación. Este sistema de ramificación genera una planta cespitosa, en la cual lasconexiones entre unidades estructurales son rizomas cortos. Dependiendo de su posición estas conexio-nes muestran diferentes tendencias en relación a la desarticulación estructural. En algunas plantas seobservó ramificación en la zona de entrenudos largos posiblemente debido a cambios ambientalesrelacionados con las distintas estaciones
Use of hybrid ultradwarf bermudagrasses (UDBG; Cynodon dactylon (L.) Pers. x C. transvaalensis Burtt-Davy) on golf course putting greens is increasing in the southern United States. However, off-type grasses within many putting surfaces have been observed. To explore the genetic variation among UD...
International Nuclear Information System (INIS)
Arfeen, R. Z.; Saleem, A.; Mirza, S. N.; Tayyab, H. M.; Akmal, M.; Afzal, O.
2015-01-01
Pakistan riparian zone mostly belongs to Sindh and Punjab provinces and prone to climatic problems and anthropogenic activities. The research was conduct to estimate and compare the structure and composition of riverine floral diversity in low riparian zone of River Indus. The data was collected from Keti Shah forest and Taunsa wildlife sanctuary. Total 14259 plants/individuals were recorded, which belong to 54 plant species with 18 different families. In Taunsa pre-monsoon survey, total 30 plant species were found with 4476 plants from 16 different families. In Taunsa post-monsoon survey total 3348 individuals were recorded from 20 plant species and 9 families. Similarly, in Keti Shah forest, total 3975 individual were recorded from 22 species and 11 families during the pre-monsoon season and 2460 plants were recorded in post-monsoon season, belonging to 16 species and 10 families. These species mostly belong to Fabaceae, Poaceae, Cyperaceae and Asclepiadaceae. Different phytosociological parameters indicate Tamarix dioca, Cynodon dactylon, Desmostachya bipinnata, Imperata cylindrica, Fimbristylis hispidula, Acacia nilotica, Phragmites karka, Tamarix sp. and Saccharum bengalense as dominant species. The biodiversity in upstream and downstream areas were rich in pre-monsoon season in comparison to post-monsoon season in surveyed areas. This study is useful for management of the area in the future as conservation strategies can be made through considering the adaptive tree species in future plantation and endangered species can be conserved. (author)
Energy Technology Data Exchange (ETDEWEB)
Campos, Alessandro T. [UNIOESTE, Marechal Candido Rondon, PR (Brazil). Centro de Ciencias Agrarias]. E-mail: atcampos3@yahoo.com.br; Saglietti, Jose R.C.; Bueno, Osmar C. [UNESP, Botucatu, SP (Brazil). Facudade de Ciencias Agronomicas; Campos, Aloisio T. [EMBRAPA - Gado de leite, Juiz de Fora, MG (Brazil)
2005-05-15
The aim of this work was to characterize the energy consumption related to the introduction, development, hay processing and storage of Cynodon dactylon (L.) Pers allied to the analysis of the energetic efficiency. The data used in this project were collected from EMBRAPA Gado de Leite, localized in Coronel Pacheco, Minas Gerais, Brazil. The data were obtained from a seven year period of an intensive system of milk production. Energetic coefficients were used to generate the survey and several matrix components obtained from pertinent literature. The direct energy, related to the inputs, showed more efficient participation on the energetic matrix than the indirect energy and the percentages were 94.64 and 5.31, respectively. Farm tractor was the main indirect energy consumer, which is responsible for turning on all the equipment, followed by the irrigation system. The energetic efficiency presented by the whole system was 4.2, being considered positive and demonstrating that the agriculture ecosystem is sustainable. Most of the direct energy employed in this system was oil derived on fuel form. There was, however, a great consume of another oil derived energy such as fertilizer, but mainly on the nitrogen form (28.89% of the total employed energy). (author)
Jananie, R. K.; Priya, V.; Vijayalakshmi, K.
2012-01-01
Objectives: To study the ability of the secondary metabolites of Cynodon dactylon to serve as an antagonist to angiotensin II type 1 receptor (AT1); activation of this receptor plays a vital role in diabetic retinopathy (DR). Materials and Methods: In silico methods are mainly harnessed to reduce time, cost and risk associated with drug discovery. Twenty-four compounds were identified as the secondary metabolites of hydroalcoholic extract of C. dactylon using the GCMS technique. These were considered as the ligands or inhibitors that would serve as an antagonist to the AT1. The ACD/Chemsketch tool was used to generate 3D structures of the ligands. A molecular file format converter tool was used to convert the generated data to the PDB format (Protein Data Bank) and was used for docking studies. The AT1 structure was retrieved from the Swissprot data base and PDB and visualized using the Rasmol tool. Domain analysis was carried from the Pfam data base; following this, the active site of the target protein was identified using a Q-site finder tool. The ability of the ligands to bind with the active site of AT1 was studied using the Autodocking tool. The docking results were analyzed using the WebLab viewer tool. Results: Sixteen ligands showed effective binding with the target protein; diazoprogesteron, didodecyl phthalate, and 9,12-octadecadienoyl chloride (z,z) may be considered as compounds that could be used to bind with the active site sequence of AT1. Conclusions: The present study shows that the metabolites of C. dactylon could serve as a natural antagonist to AT1 that could be used to treat diabetic retinopathy. PMID:22368412
Lin, Heng-Sheng; Chiang, Chih-Yun; Chang, Song-Bin; Kuoh, Chang-Sheng
2011-01-01
Foxtail millet is one of the world's oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR) markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21%) and CAT (46.15%). The average number of alleles (N(a)), the average heterozygosities observed (H(o)) and expected (H(e)) are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.
Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae) para la Flora Argentina
Ana María Cialdella
2010-01-01
Durante la revisión de los géneros de Stipeae (Poaceae) para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P...
Patel, Maulik R; Bhalodia, Yagnik S; Pathak, Nimish L; Patel, Maulik S; Suthar, Kunal; Patel, Nilesh; Golwala, Dharmesh K; Jivani, Nurudin P
2013-12-12
In the traditional medicine, Cynodon dactylon (Linn.) is used in asthma, but scientific studies to provide evidence for medicinal uses are sparse. Thus this study was undertaken to provide evidence for medicinal use in asthma as a bronchodilator, and to identify active ingredient(s). In vivo, acetylcholine (Ach)-induced bronchospasm was conducted in guinea pig while isolated rat tracheal strip was suspended in organ bath to measure the concentration response curve using multichannel data acquisition system. The chloroform extract of Cynodon dactylon (CECD) protected against Ach-induced bronchospasm in guinea pigs, similar to atropine. In the in vitro studies, CECD relaxed carbachol (CCh) and high K+-induced contraction of rat tracheal strip, similar to atropine and verapamil respectively, suggesting antimuscarinic and calcium channel blocking (CCB) activities, which were confirmed by right ward shifting of CCh and Ca(+2) concentration response curve (CRC). The phosphodiestrase (PDE) inhibitory activity was confirmed by potentiation of isoprenaline-induced inhibitory response, similar to papaverine. Densitometry analyses led to the identification of scopoletin as an active ingredient. Effectively, it significantly inhibited high K+, and Ca(+2) induced contractile response, similar to verapamil. The phosphodiestrase (PDE) inhibitory activity was confirmed by direct evidence of potentiation of isoprenaline-induced inhibitory response, similar to papaverine. These results suggest that the bronchodilator activity of CECD is partly due to presence of scopoletin, and mediated possibly through CCB and PDE inhibition.
Novy, Ari; Flory, S Luke; Honig, Joshua A; Bonos, Stacy; Hartman, Jean Marie
2012-02-01
Microsatellite markers were developed for the invasive plant Microstegium vimineum (Poaceae) to assess its population structure and to facilitate tracking of invasion expansion. Using 454 sequencing, 11 polymorphic and six monomorphic microsatellite primer sets were developed for M. vimineum. The primer sets were tested on individuals sampled from six populations in the United States and China. The polymorphic primers amplified di-, tri-, and tetranucleotide repeats with three to 10 alleles per locus. These markers will be useful for a variety of applications including tracking of invasion dynamics and population genetics studies.
Comportamiento de céspedes de Cynodon dactylon (L.) Pers. en Paraná, Entre Ríos, Argentina
Laurencena, María I; Carponi, María S; Reinoso, Patricia D; Butus, Marina; Scorciapino, Claudia; Galli, Martín; Pérez, Guillermo
2009-01-01
En zonas subtropicales o templadas cálidas las gramíneas estivales constituyen la base del césped pero presentan dormancia durante el invierno. Por ello es importante el conocimiento de céspedes con períodos de emergencia a implantación y vegetativo inactivo cortos, de textura fina, buen color, buen comportamiento sanitario y respuesta a fertilización. El objetivo de este trabajo fue evaluar el comportamiento en el Departamento Paraná (Entre Ríos, Argentina) de céspedes de Cynodon dactylon (b...
Directory of Open Access Journals (Sweden)
Chih-Yun Chiang
2011-11-01
Full Text Available Foxtail millet is one of the world’s oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21% and CAT (46.15%. The average number of alleles (Na, the average heterozygosities observed (Ho and expected (He are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.
Morphology and anatomy of the diaspores and seedling of Paspalum (Poaceae, Poales
Directory of Open Access Journals (Sweden)
MAYRA T. EICHEMBERG
2013-09-01
Full Text Available ABSTRACT The knowledge regarding of the diaspore and post-seminal development of Paspalum L. is important for grassland biodiversity conservation, based on their representativeness and genetic improvement of forage. The morphology of the diaspore and the post-seminal development of Paspalum dilatatum Poir. (rhizomatous, P. mandiocanum Trin. var. subaequiglume Barreto (stoloniferous, P. pumilum Nees. (decumbent caespitose and P. urvillei Steud. (erect caespitose was described to distinguish species with different growth forms and to survey the characters useful for taxonomy. P. dilatatum differs by presenting oval diaspores larger than the others, with five prominent nerves and trichomes; P. urvillei presents diaspores with one central nerve that is more developed than the two lateral nerves and trichomes; P. mandiocanum var. subaequiglume presents diaspores with trichomes only in the margin; and P. pumilum differs by presenting glabrous diaspores. The caryopsis involves the seed that presents the differentiated embryo and disposed laterally, an elliptical hilum in all of the studied species and a rostellum in P. dilatatum and P. mandiocanum var. subaequiglume. The post-seminal development is similar in the four species and begins with germination that is marked by the emergence of the coleorhiza, followed by the coleoptile. These characteristics are common to other Poaceae previously studied, indicating a pattern to the family and do not distinguish the growth forms.
Kaur, H; Kumari, S; Gupta, R C
2013-01-01
The present paper deals with cytological studies on the population basis of 21 species belonging to 9 genera of tribe Paniceae of family Poaceae from cytologically unexplored area of Western Himalayas i.e. district Kangra of Himachal Pradesh for the assessment of genetic diversity of grass flora. On world-wide basis, the chromosome counts have been made for the first time for three species such as Brachiaria remota (n = 16), Digitaria granularis (n = 36) and Isachne albens (n = 5). Similarly, on India basis, altogether new records are made for two species such as Echinochloa cruspavonis (n = 27) and Paspalum distichum (2n = 50). A comparison of the different euploid cytotypes studied at present for Digitaria adscendens, D. setigera and Oplismenus compositus revealed significant variations in their morphology, depicting increase in some of the characters of polyploid cytotypes. The course of meiosis has been observed to be normal in all the studied populations with high pollen fertility except for two species such as Paspalum dilatatum and P. distichum marked with abnormal meiosis and reduced pollen fertility.
Directory of Open Access Journals (Sweden)
Doria Maria Saiter Gomes
2009-06-01
Full Text Available This study presents data on leaf micromorphology of 13 species of Merostachys Spreng. (Poaceae: Bambusoideae, a neotropical genus with numerous endemic species. Greatest species richness is found in Central and Southern Brazil, with 41 of the 46 species described. Species were collected in the field at the localities: Itatiaia National Park and Tijuca National Park, Rio de Janeiro State; Fontes do Ipiranga State Park, São Paulo state; Santa Teresa, Espírito Santo State and Rio Doce State Park, Minas Gerais State. Dried plant material came from the herbarium at the São Paulo Botany Institute. The presence of prickles, silica bodies and macro hairs may be especially useful in delimiting species.São apresentados dados relativos à micromorfologia foliar de 13 espécies de Merostachys Spreng. (Poaceae:Bambusoideae, um gênero neotropical, com numerosas espécies endêmicas, que tem sua maior diversidade nas regiões central e sul do Brasil, onde ocorrem 41 das 46 espécies descritas. O material coletado foi obtido nas seguintes localidades: Parque Nacional do Itatiaia e Parque Nacional da Tijuca (RJ; Parque Estadual das Fontes do Ipiranga (SP; Propriedade dos Irmãos Martinelli, Vargem Alta, Santa Teresa (ES e Parque Estadual do Rio Doce (MG. As espécies herborizadas são provenientes do herbário do Instituto de Botânica de São Paulo (SP. Atenção especial é dada à presença de cerdas, corpúsculos silicosos e macropêlos, características que podem ser úteis na delimitação das espécies.
Directory of Open Access Journals (Sweden)
A.P.S. Souza Filho
2010-01-01
agricultural systems. This study aimed to determine the existence of response patterns of the weeds Mimosa pudica and Senna obtusifolia to species of the family Poaceae, through interaction between species and fractions, and arrangement of the effects. Bioassays of seed germination and radicle and hypocotyl elongation were developed under controlled conditions. Hydro-alcoholic extracts at 1.0% of the leaf, root and seed fractions of four species of Poaceae were tested. Differences in intensity of the effects for species and fractions were verified. The activity pattern observed for Paspalum maritimum was the presence of more intense inhibitions. Among Brachiaria species, the most intense inhibitions were produced by B. brizantha. There was an intense effective response for specificity between species and fractions for germination and radicle elongation, especially for Mimosa pudica. Only the P. maritimum extracts showed specificity and were effective in relation to seed germination and radicle elongation of the species Senna obtusifolia. Lleaf fraction was more effective for inhibition, especially for the species P. maritimum. Comparatively, the species Mimosa pudica was more responsive to the effects of the extracts, especially in relation to radicle and hypocotyl development. The intensity of the allelopathic activities varied as follows: radicle elongation > seed germination > hypocotyl elongation. The arrangement of the results for indicators of inhibition showed a pattern discrimination for the receiving species, suggesting specificity of the extracts.
Physiological integration enhanced the tolerance of Cynodon dactylon to flooding.
Li, Z J; Fan, D Y; Chen, F Q; Yuan, Q Y; Chow, W S; Xie, Z Q
2015-03-01
Many flooding-tolerant species are clonal plants; however, the effects of physiological integration on plant responses to flooding have received limited attention. We hypothesise that flooding can trigger changes in metabolism of carbohydrates and ROS (reactive oxygen species) in clonal plants, and that physiological integration can ameliorate the adverse effects of stress, subsequently restoring the growth of flooded ramets. In the present study, we conducted a factorial experiment combining flooding to apical ramets and stolon severing (preventing physiological integration) between apical and basal ramets of Cynodon dactylon, which is a stoloniferous perennial grass with considerable flooding tolerance. Flooding-induced responses including decreased root biomass, accumulation of soluble sugar and starch, as well as increased activity of superoxide dismutase (SOD) and ascorbate peroxidase (APX) in apical ramets. Physiological integration relieved growth inhibition, carbohydrate accumulation and induction of antioxidant enzyme activity in stressed ramets, as expected, without any observable cost in unstressed ramets. We speculate that relief of flooding stress in clonal plants may rely on oxidising power and electron acceptors transferred between ramets through physiological integration. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.
Directory of Open Access Journals (Sweden)
S. Elahi
2016-04-01
Full Text Available To study weed species diversity and community structure in pistachio (Pistacia vera L. orchards in 33 orchards of 12 villages an investigation was conducted in Bardaskan County, Khorasan Razavi Province, Iran during 2008-2009. Weed population sampling was conducted in a w shape method using 1m² quadrate. The results showed that the weeds of pistachio orchards were belonging to 15 families and 44 species. dicotyledons (31 species were more than monocotyledons (13 species. Such as in this community, weed species of C3, C4, annual and perennial were 26, 18, 28 and 13, respectively. The majority of weed species were belonging to the plant families of chenopodiceae (9 species and poaceae (12 species amongst dicotyledons and monocotyledons, respectively. the most important species of monocotyledon annual weeds were including Echinochloa crus-gali, Digitaria sanguinlis, Setaria viridis and perennial weeds were including Cyperus routundus, Cynodon dactylon and convolvulus arvensis. Weed species were grouped in seven clusters for density average, frequency and uniformity (similarity 75 percent whereas in eight clusters for relative density average, relative frequency and relative uniformity (similarity 75 percent. Amplitude changes of Shannon-winter diversity index were between 2.3 and 0.16 and of Simpson dominant index were between 0.97 and 0.17. The difference among indices of biodiversity and dominant clusters were relative to scale and type of management practices.
Ma, Y M; Li, Y; Liu, J Y; Song, Y C; Tan, R X
2004-07-01
A new benzophenone, named rhizoctonic acid (1), together with three known compounds monomethylsulochrin (2), ergosterol (3) and 3beta,5alpha,6beta-trihydroxyergosta-7,22-diene (4) were isolated through bioassay-guided fractionations from the culture of Rhizoctonia sp. (Cy064), an endophytic fungus in the leaf of Cynodon dactylon. The structure of the new acid 1 was elucidated to be 5-hydroxy-2-(2-hydroxy-6-methoxy-4-methylbenzoyl)-3-methoxybenzoic acid by a combination of spectral analyses. Furthermore, the structure of monomethylsulochrin 2 was confirmed by 13C-NMR analysis. All four metabolites were subjected to a more detailed in vitro assessment of their antibacterial action against five clinically isolated and one reference (ATCC 43504) Helicobacter pylori strains.
Zhang, G; Lu, S; Chen, T A; Funk, C R; Meyer, W A
2003-06-01
A transformation system for triploid bermudagrass ( Cynodon dactylon x C. transvaalensis cv. TifEagle) was established with a biolistic bombardment delivery system. Embryogenic callus was induced from stolons and maintained on Murashige and Skoog's medium supplemented with 30 microM dicamba, 20 microM benzylaminopurine, and 100 mg/l myo-inositol. Using the hygromycin phosphotransferase ( hpt) gene as the selectable marker gene, we obtained 75 transgenic lines from 18 petri dishes bombarded. Integration of the hpt gene into genomic DNA and transcription of hpt was confirmed by Southern and Northern blot analyses, respectively. Through suspension culture screening, we obtained homogeneously transformed plants showing stable transcription of the hpt gene.
Yao, Peng-Cheng; Gao, Hai-Yan; Wei, Ya-Nan; Zhang, Jian-Hang; Chen, Xiao-Yong; Li, Hong-Qing
2017-01-01
Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.
Preston, Jill C.; Kellogg, Elizabeth A.
2006-01-01
Gene duplication is an important mechanism for the generation of evolutionary novelty. Paralogous genes that are not silenced may evolve new functions (neofunctionalization) that will alter the developmental outcome of preexisting genetic pathways, partition ancestral functions (subfunctionalization) into divergent developmental modules, or function redundantly. Functional divergence can occur by changes in the spatio-temporal patterns of gene expression and/or by changes in the activities of their protein products. We reconstructed the evolutionary history of two paralogous monocot MADS-box transcription factors, FUL1 and FUL2, and determined the evolution of sequence and gene expression in grass AP1/FUL-like genes. Monocot AP1/FUL-like genes duplicated at the base of Poaceae and codon substitutions occurred under relaxed selection mostly along the branch leading to FUL2. Following the duplication, FUL1 was apparently lost from early diverging taxa, a pattern consistent with major changes in grass floral morphology. Overlapping gene expression patterns in leaves and spikelets indicate that FUL1 and FUL2 probably share some redundant functions, but that FUL2 may have become temporally restricted under partial subfunctionalization to particular stages of floret development. These data have allowed us to reconstruct the history of AP1/FUL-like genes in Poaceae and to hypothesize a role for this gene duplication in the evolution of the grass spikelet. PMID:16816429
Interspecific hybrid bermudagrass (Cynodon dactylon (L.) Pers. x C. transvaalensis Burtt-Davy) is one of the most widely used grasses on golf courses, with cultivars derived from ‘Tifgreen’ or ‘Tifdwarf’ particularly used for putting greens in the southern agronomic region. Many bermudagrass cultiv...
Commelinid Monocotyledon Lignins Are Acylated by p-Coumarate1[OPEN
Free, Heather C.A.; Smith, Bronwen G.
2018-01-01
Commelinid monocotyledons are a monophyletic clade differentiated from other monocotyledons by the presence of cell wall-bound ferulate and p-coumarate. The Poaceae, or grass family, is a member of this group, and most of the p-coumarate in the cell walls of this family acylates lignin. Here, we isolated and examined lignified cell wall preparations from 10 species of commelinid monocotyledons from nine families other than Poaceae, including species from all four commelinid monocotyledon orders (Poales, Zingiberales, Commelinales, and Arecales). We showed that, as in the Poaceae, lignin-linked p-coumarate occurs exclusively on the hydroxyl group on the γ-carbon of lignin unit side chains, mostly on syringyl units. Although the mechanism of acylation has not been studied directly in these species, it is likely to be similar to that in the Poaceae and involve BAHD acyl-coenzyme A:monolignol transferases. PMID:29724771
Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae para la Flora Argentina
Directory of Open Access Journals (Sweden)
Ana María Cialdella
2010-01-01
Full Text Available Durante la revisión de los géneros de Stipeae (Poaceae para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P. mapuche, P. marqueziana y P. zulmae. Se incluye también una clave para identificar los géneros de Stipeae en la Argentina.
Phalaris canariensis L. (Poaceae: A new alien plant record for Kashmir Himalaya, India
Directory of Open Access Journals (Sweden)
Shugufta Rasheed
2016-03-01
Full Text Available The correct taxonomic identification assumes first and foremost priority in the scientific documentation of biodiversity. The Kashmir Himalaya, located in the north-western side of the Himalayan biodiversity hotspot, is well-known for its diverse flora which merits immediate scientific documentation. In this context, the present study reports Phalaris canariensis L. (Poaceae as a new alien plant record to the flora of Kashmir Himalaya, India. In this paper, a detailed description, photographs, and comparison of diagnostic characters with allied species are provided to scientifically validate this alien plant record for this Himalayan region.
Two experiments were conducted at the University of Kentucky Spindletop Farm in Lexington, Kentucky between October and November, 2009 to evaluate the effect of different percentages of alfalfa (Medicago sativa) as mixtures in switchgrass (Panicum virgatus) and bermudagrass (Cynodon dactylon) silage...
HABER, Ricardus M.; SEMAAN, Myrna T.
2007-01-01
Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae) are described as new records for the flora of Lebanon. Specimens of C. nutans collected from roadsides and rocks in a middle mountain forest confirm the occurrence of the species on the western slopes of the Mount Lebanon Range. Additionally, specimens of E. indica were collected from wasteland and roadsides in the coastal town of Kaslik. The species were observed to thrive abundantly in similar habitat...
Cross-species amplification of 105 Lolium perenne SSR loci in 23 species within the Poaceae
DEFF Research Database (Denmark)
Jensen, Louise Bach; Holm, Preben Bach; Lübberstedt, Thomas
2007-01-01
Amplification of 105 Lolium perenne SSR markers was studied in 23 grass species representing seven tribes from three subfamilies of Poaceae. Twelve of the SSR markers are published for the first time. Between 2% and 96% of the SSR markers could be amplified within a given species. A subset of eight...... SSR markers was evaluated for polymorphism across nine of the 23 grass species. Four to seven of the markers were polymorphic within each species, with an average detection of 2.4 alleles per species....
La familia Poaceae del distrito de Arahuay (Canta, Lima, Perú
Directory of Open Access Journals (Sweden)
Paúl Gonzáles
2011-08-01
Full Text Available Se reportan para el distrito de Arahuay (Canta, Lima, Perú (zona baja y media un total de 49 especies de la familia Poaceae agrupadas en 28 géneros, 14 tribus y 4 subfamilias. El género Poa es el más diverso con cinco especies, seguido por Eragrostis y Nassella con cuatro especies cada una. Las especies Calamagrostis spiciformis Hack. ex Stuck., Chloris halophila Parodi, Lamprothyrsus peruvianus Hitchc., Festuca glyceriantha Pilg., Lolium multiflorum Lam. y Poa supina Schrad. son nuevos reportes para el departamento de Lima. Se presentan claves dicotómicas para la determinación de los géneros y para las especies en los casos pertinentes. Para cada especie se incluye datos sobre su hábitat, distribución y el material estudiado.
Phylogenomics and taxonomy of Lecomtelleae (Poaceae), an isolated panicoid lineage from Madagascar.
Besnard, Guillaume; Christin, Pascal-Antoine; Malé, Pierre-Jean G; Coissac, Eric; Ralimanana, Hélène; Vorontsova, Maria S
2013-10-01
An accurate characterization of biodiversity requires analyses of DNA sequences in addition to classical morphological descriptions. New methods based on high-throughput sequencing may allow investigation of specimens with a large set of genetic markers to infer their evolutionary history. In the grass family, the phylogenetic position of the monotypic genus Lecomtella, a rare bamboo-like endemic from Madagascar, has never been appropriately evaluated. Until now its taxonomic treatment has remained controversial, indicating the need for re-evaluation based on a combination of molecular and morphological data. The phylogenetic position of Lecomtella in Poaceae was evaluated based on sequences from the nuclear and plastid genomes generated by next-generation sequencing (NGS). In addition, a detailed morphological description of L. madagascariensis was produced, and its distribution and habit were investigated in order to assess its conservation status. The complete plastid sequence, a ribosomal DNA unit and fragments of low-copy nuclear genes (phyB and ppc) were obtained. All phylogenetic analyses place Lecomtella as an isolated member of the core panicoids, which last shared a common ancestor with other species >20 million years ago. Although Lecomtella exhibits morphological characters typical of Panicoideae, an unusual combination of traits supports its treatment as a separate group. The study showed that NGS can be used to generate abundant phylogenetic information rapidly, opening new avenues for grass phylogenetics. These data clearly showed that Lecomtella forms an isolated lineage, which, in combination with its morphological peculiarities, justifies its treatment as a separate tribe: Lecomtelleae. New descriptions of the tribe, genus and species are presented with a typification, a distribution map and an IUCN conservation assessment.
Ruminal production of methane ''in vitro'' with Coast Cross No. 1 bermuda grass (Cynodon dactylon)
Energy Technology Data Exchange (ETDEWEB)
Geerken, C M; Funes, F; Gonzalez, R
1980-11-01
1. Samples of Coast Cross No. 1 bermuda grass (Cynodon dactylon) of 3, 6, 9, 12 and 15 days of cut, irrigated and fertilized at a rate of 400 kg N/ha/year, were used to determine their bromatological composition, digestibility and methane production ''in vitro''. 2. Crude protein concentration of the pasture fell sharply from 20 to 4% and crude fibre increased from 26 to 34% as the pasture grew older. DM digestibility decreased from 58 to 44% from the 6th to the 15th week of cut. Methane production ''in vitro'' was significantly lower (P is less than 0,01), at 3 and 6 weeks, than that obtained at older ages. The differences were more marked when calculated per unit of digested DM. 3. These results could be of interest in the search of a better utilization of dietary energy for grazing animals. (Refs. 16).
Butler, Afrachanna D; Wynter, Michelle; Medina, Victor F; Bednar, Anthony J
2016-06-01
Yuma Proving Grounds (YPG) in western Arizona is a testing range where Depleted uranium (DU) penetrators have been historically fired. A portion of the fired DU penetrators are being managed under controlled conditions by leaving them in place. The widespread use of DU in armor-penetrating weapons has raised environmental and human health concerns. The present study is focused on the onsite management approach and on the potential interactions with plants local to YPG. A 30 day study was conducted to assess the toxicity of DU corrosion products (e.g., schoepite and meta-schoepite) in two grass species that are native to YPG, Bermuda (Cynodon dactylon) and Purple Threeawn (Aristida purpurea). In addition, the ability for plants to uptake DU was studied. The results of this study show a much lower threshold for biomass toxicity and higher plant concentrations, particularly in the roots than shoots, compared to previous studies.
Directory of Open Access Journals (Sweden)
L.D. Tuffi Santos
2004-09-01
(Setaria anceps cv. Kazungula pasture which had been established in the previous rainy season, with forage being affected by the slow growth of the plants. For the phyto-sociological study, the inventory square method was applied through a square of 1,0 m², randomly placed 19 times in area 1 and 41 times in area 2. The species found were identified and recorded. In the Angola-grass pasture, 27 species were identified, distributed in 11 families; in the Setaria grass pasture, 34 species were identified, distributed in 13 families. The most representative families in number of species were: Poaceae (11; Asteraceae (6; Papilionoideae (5; Malvaceae and Euphorbiaceae (4. The most frequent species were: Cynodon dactylon, Sida rhombifolia, Cyperus esculentus, Mimosa pudica, Senna occidentalis, Setaria anceps cv. Kazungula and Paspalum urvillei. In general, both areas were infested with weeds, including toxic, spinescent and rather unpalatable plants, reducing the animal support capacity of the pastures and preventing adequate utilization of the areas by the cattle.
Anther and pollen development in some species of Poaceae (Poales
Directory of Open Access Journals (Sweden)
AT. Nakamura
Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.
Lepidopteran larvae were discovered boring in the basal stems of Imperata cylindrica (L.) Beauv. (Poaceae) in Itoshima city, Fukuoka Prefecture, Kyushu, Japan. Adults reared from these larvae were identified as Acrapex azumai Sugi (Lepidoptera: Noctuidae). Sequencing of the CO1 (cytochrome oxidase 1...
Braun, Uwe; Crous, Pedro W; Nakashima, Chiharu
2014-12-01
Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosperms were treated. This second part deals with cercosporoid fungi on monocots (Liliopsida; Equisetopsida, Magnoliidae, Lilianae), which covers species occurring on host plants belonging to families arranged in alphabetical order from Acoraceae to Xyridaceae, excluding Poaceae (cereals and grasses) which requires a separate treatment. The species are described and illustrated in alphabetical order under the particular cercosporoid genera, supplemented by keys to the species concerned. A detailed introduction, a survey of currently recognised cercosporoid genera, a key to the genera concerned, and a discussion of taxonomically relevant characters were published in the first part of this series. Neopseudocercospora, an additional recently introduced cercosporoid genus, is briefly discussed. The following taxonomic novelties are introduced: Cercospora alpiniigena sp. nov., C. neomaricae sp. nov., Corynespora palmicola comb. nov., Exosporium miyakei comb. nov., E. petersii comb. nov., Neopseudocercospora zambiensis comb. nov., Passalora caladiicola comb. nov., P. streptopi comb. nov., P. togashiana comb. nov., P. tranzschelii var. chinensis var. nov., Pseudocercospora beaucarneae comb. nov., P. constrictoflexuosa comb. et stat. nov., P. curcumicola sp. nov., P. dispori comb. nov., P. smilacicola sp. nov., P. urariigena nom. nov., Zasmidium agavicola comb. nov., Z. cercestidis-afzelii comb. nov., Z. citri-griseum comb. nov., Z. cyrtopodii comb. nov., Z. gahnae comb. nov., Z. indicum
Directory of Open Access Journals (Sweden)
Peng-Cheng Yao
Full Text Available Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P < 0.01. These results suggest that increasing the sample size in specialist habitats can improve measurements of intraspecific genetic diversity, and will have a positive effect on the application of the DNA barcodes in widely distributed species. The results of random sampling showed that when sample size reached 11 for Chloris virgata, Chenopodium glaucum, and Dysphania ambrosioides, 13 for Setaria viridis, and 15 for Eleusine indica, Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.
Hu, Longxing; Li, Huiying; Chen, Liang; Lou, Yanhong; Amombo, Erick; Fu, Jinmin
2015-08-04
Soil salinity is one of the most significant abiotic stresses affecting plant shoots and roots growth. The adjustment of root architecture to spatio-temporal heterogeneity in salinity is particularly critical for plant growth and survival. Bermudagrass (Cynodon dactylon) is a widely used turf and forage perennial grass with a high degree of salinity tolerance. Salinity appears to stimulate the growth of roots and decrease their mortality in tolerant bermudagrass. To estimate a broad spectrum of genes related to root elongation affected by salt stress and the molecular mechanisms that control the positive response of root architecture to salinity, we analyzed the transcriptome of bermudagrass root tips in response to salinity. RNA-sequencing was performed in root tips of two bermudagrass genotypes contrasting in salt tolerance. A total of 237,850,130 high quality clean reads were generated and 250,359 transcripts were assembled with an average length of 1115 bp. Totally, 103,324 unigenes obtained with 53,765 unigenes (52 %) successfully annotated in databases. Bioinformatics analysis indicated that major transcription factor (TF) families linked to stress responses and growth regulation (MYB, bHLH, WRKY) were differentially expressed in root tips of bermudagrass under salinity. In addition, genes related to cell wall loosening and stiffening (xyloglucan endotransglucosylase/hydrolases, peroxidases) were identified. RNA-seq analysis identified candidate genes encoding TFs involved in the regulation of lignin synthesis, reactive oxygen species (ROS) homeostasis controlled by peroxidases, and the regulation of phytohormone signaling that promote cell wall loosening and therefore root growth under salinity.
Hidalgo, Nicolás Pérez; Martínez-Torres, David; Collantes-Alegre, Jorge Mariano; Muller, William Villalobos; Nafría, Juan M. Nieto
2012-01-01
Abstract The new species Rhopalosiphum chusqueae Pérez Hidalgo & Villalobos Muller, is described from apterous viviparous females caught on Chusquea tomentosa in Cerro de la Muerte (Costa Rica). The identity of the species is supported both by the morphological features and by a molecular phylogenetic analysis based on a fragment of the mitochondrial DNA containing the 5’ region of the cytochrome c oxidase 1 (COI) and on the nuclear gene coding for the Elongation factor-1 alpha (EF1α). The taxonomic position of the new species is discussed. An identification key to the Aphidinae species living on plants of Bambusoideae (Poaceae) is presented. PMID:22328859
Li, L; Qu, R
2004-01-01
Common bermudagrass, Cynodon dactylon, is a widely used warm-season turf and forage species in the temperate and tropical regions of the world. Improvement of bermudagrass via biotechnology depends on improved tissue culture responses, especially in plant regeneration, and a successful scheme to introduce useful transgenes. When the concentration of 6-benzylaminopurine was adjusted in the culture medium, yellowish, compact calluses were observed from young inflorescence tissue culture of var. J1224. Nine long-term, highly regenerable callus lines (including a suspension-cultured line) were subsequently established, of which six were used for biolistic transformation. Five independent transgenic events, with four producing green plants, were obtained following hygromycin B selection from one callus line. Three transgenic events displayed resistance to the herbicide glufosinate, and one of these showed beta-glucuronidase activity since the co-transformation vector used in the experiments contained both the gusA and bar genes.
Contrasting Changes Caused by Drought and Submergence Stresses in Bermudagrass (Cynodon dactylon)
Ye, Tiantian; Shi, Haitao; Wang, Yanping; Chan, Zhulong
2015-01-01
In this study, we investigated the mechanisms by which bermudagrass withstands the drought and submergence stresses through physiological, proteomic and metabolomic approaches. The results showed that significant physiological changes were observed after drought treatment, while only slight changes after submergence treatment, including compatible solute contents, ROS levels and antioxidant enzyme activities. Proteomics results showed that 81 proteins regulated by drought or submergence treatment were identified by MALDI-TOF-MS. Among them, 76 proteins were modulated by drought stress with 46 increased abundance and 30 decreased abundance. Forty-five showed abundance changes after submergence treatment with 10 increased and 35 decreased. Pathway enrichment analysis revealed that pathways of amino acid metabolism and mitochondrial electron transport/ATP synthesis were only enriched by drought treatment, while other pathways including photosynthesis, biodegradation of xenobiotics, oxidative pentose phosphate, glycolysis and redox were commonly over-represented after both drought and submergence treatments. Metabolomic analysis indicated that most of the metabolites were up-regulated by drought stress, while 34 of 40 metabolites contents exhibited down-regulation or no significant changes when exposed to submergence stress, including sugars and sugar alcohols. These data indicated that drought stress extensively promoted photosynthesis and redox metabolisms while submergence stress caused declined metabolisms and dormancy in Cynodon dactylon. Taken together, the quiescence strategy with retarded growth might allow bermudagrass to be adaptive to long-term submerged environment, while activation of photosynthesis and redox, and accumulation of compatible solutes and molecular chaperones increased bermudagrass tolerance to drought stress. PMID:26617615
Shi, Haitao; Wang, Yanping; Cheng, Zhangmin; Ye, Tiantian; Chan, Zhulong
2012-01-01
Bermudagrass (Cynodon dactylon) is a widely used warm-season turfgrass and one of the most drought tolerant species. Dissecting the natural variation in drought tolerance and physiological responses will bring us powerful basis and novel insight for plant breeding. In the present study, we evaluated the natural variation of drought tolerance among nine bermudagrass varieties by measuring physiological responses after drought stress treatment through withholding water. Three groups differing in drought tolerance were identified, including two tolerant, five moderately tolerant and two susceptible varieties. Under drought stress condition, drought sensitive variety (Yukon) showed relative higher water loss, more severe cell membrane damage (EL), and more accumulation of hydrogen peroxide (H₂O₂) and malondialdehyde (MDA), while drought tolerant variety (Tifgreen) exhibited significantly higher antioxidant enzymes activities. Further results indicated that drought induced cell injury in different varieties (Yukon, SR9554 and Tifgreen) exhibited liner correlation with leaf water content (LWC), H₂O₂ content, MDA content and antioxidant enzyme activities. Additionally, Tifgreen plants had significantly higher levels of osmolytes (proline level and soluble sugars) when compared with Yukon and SR9554 under drought stress condition. Taken together, our results indicated that natural variation of drought stress tolerance in bermudagrass varieties might be largely related to the induced changes of water status, osmolyte accumulation and antioxidant defense system.
Diop, Serigne Mbacké; Guèye, Momar Talla; Ndiaye, Ibrahima; Diop, Michel Bakar; Ndiaye, El Hadji Barka; Thiam, Abdoulaye; Fauconnier, Marie-Laure; Lognay, Georges
2017-01-01
This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried out by GC/FID and GC/MS. Oils from Dakar were dominated by geranial which represented 46.0-43.9%, neral 31.8-31.0%, myrcene 10.8-11.7% and geraniol 2.7-4.2% in the fresh and d...
Directory of Open Access Journals (Sweden)
AT. Nakamura
2010-05-01
Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.O desenvolvimento da antera e do grão de pólen de Olyra humilis Nees, Sucrea monophylla Soderstr. (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees and Chloris elata Desv. (Chloridoideae foi estudado visando caracterizar embriologicamente essas espécies de subfamílias consideradas basal, intermediária e derivada, respectivamente. As espécies são similares entre si e entre as demais Poaceae. Apresentam os seguintes caracteres: anteras tetrasporangiadas; desenvolvimento da parede da antera do tipo monocotiledôneo, endotécio com espessamento de parede anelar, tapete secretor; microsporogênese sucessiva; tétrades isobilaterais; grãos de
Comportamiento de céspedes de Cynodon dactylon (L. Pers. en Paraná, Entre Ríos, Argentina
Directory of Open Access Journals (Sweden)
María I. Laurencena
2009-01-01
Full Text Available En zonas subtropicales o templadas cálidas las gramíneas estivales constituyen la base del césped pero presentan dormancia durante el invierno. Por ello es importante el conocimiento de céspedes con períodos de emergencia a implantación y vegetativo inactivo cortos, de textura fina, buen color, buen comportamiento sanitario y respuesta a fertilización. El objetivo de este trabajo fue evaluar el comportamiento en el Departamento Paraná (Entre Ríos, Argentina de céspedes de Cynodon dactylon (bermuda comercializados para uso ornamental y deportivo. Se evaluaron cobertura, textura, color, dormancia, rebrote y respuesta a fertilización en un ensayo en dos tratamientos: con y sin drenaje, con cuatro repeticiones. El diseño experimental fue de parcelas apareadas y las mediciones se realizaron desde marzo de 2005 a noviembre de 2006. No hubo diferencias entre las bermudas evaluadas y todas presentaron alta cobertura, textura fina, color verde medio, dormancia con bajas temperaturas y buena respuesta a la fertilización.
In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species
Directory of Open Access Journals (Sweden)
Ertuğrul Filiz
2013-01-01
Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.
Sahu, Nidhi; Soni, Deepika; Chandrashekhar, B; Sarangi, Bijaya Ketan; Satpute, Devanand; Pandey, Ram Avatar
2013-07-01
Many methods of synthesizing silver nanoparticles (Ag-NPs) by reducing Ag⁺ ions using aqueous/organic extracts of various plants have been reported in the past, but the methods are rather slow. In this investigation, silver nanoparticles were quickly synthesized from aqueous silver nitrate through a simple method using leaf extract of a plant--Cynodon dactylon which served as reducing agent, while sunlight acted as a catalyst. The formation of Ag-NPs was indicated by gradual change in colour and pH and confirmed by ultraviolet--visible spectroscopy. The Ag-NPs showed a surface plasmon resonance at 451 nm. Based on the decrease in pH, a possible mechanism of the synthesis of Ag-NPs involving hydroxyl (OH⁻) ions of polyphenols of the leaf extract is postulated. Ag-NPs having (111) and (200) crystal lattices were confirmed by X-ray diffraction. Scanning electron microscopy revealed the spherical nature of the Ag-NPs, while transmission electron microscopy showed that the nanoparticles were polydispersed with a size range of 8-10 nm. The synthesized Ag-NPs also demonstrated their antibacterial activity against Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus and Salmonella typhimurium.
Cheng, Zhangmin; Ye, Tiantian; Chan, Zhulong
2012-01-01
Bermudagrass (Cynodon dactylon) is a widely used warm-season turfgrass and one of the most drought tolerant species. Dissecting the natural variation in drought tolerance and physiological responses will bring us powerful basis and novel insight for plant breeding. In the present study, we evaluated the natural variation of drought tolerance among nine bermudagrass varieties by measuring physiological responses after drought stress treatment through withholding water. Three groups differing in drought tolerance were identified, including two tolerant, five moderately tolerant and two susceptible varieties. Under drought stress condition, drought sensitive variety (Yukon) showed relative higher water loss, more severe cell membrane damage (EL), and more accumulation of hydrogen peroxide (H2O2) and malondialdehyde (MDA), while drought tolerant variety (Tifgreen) exhibited significantly higher antioxidant enzymes activities. Further results indicated that drought induced cell injury in different varieties (Yukon, SR9554 and Tifgreen) exhibited liner correlation with leaf water content (LWC), H2O2 content, MDA content and antioxidant enzyme activities. Additionally, Tifgreen plants had significantly higher levels of osmolytes (proline level and soluble sugars) when compared with Yukon and SR9554 under drought stress condition. Taken together, our results indicated that natural variation of drought stress tolerance in bermudagrass varieties might be largely related to the induced changes of water status, osmolyte accumulation and antioxidant defense system. PMID:23285294
Directory of Open Access Journals (Sweden)
Alain Raimundo Rodríguez-Orozco
2007-09-01
Full Text Available Las enfermedades alérgicas son una de las principales causas de atención médica en la infancia y su impacto se acentúa más en las familias de bajos ingresos. En un estudio descriptivo analítico se caracterizó el perfil de consulta del niño alérgico proveniente de familias mexicanas de bajos recursos económicos. Las enfermedades alérgicas predominaron en el sexo masculino y la edad escolar; el 71 % de los enfermos provenía de localidades urbanas. El asma fue el diagnóstico más frecuente (64 %, seguido de la rinitis alérgica (30 %, dermatitis atópica (6 % y urticaria (3 %. Las reactividades encontradas con más frecuencia en la prueba cutánea fueron Dermatofagoides farinae (77 %, Dermatofagoides pteronyssinus (60 %, Phleum pratense (20 %, gato (17 %, perro (14 % y Cynodon dactylon (11 %. El alto grado de disfunción familiar y la poca adhesión a tratamientos prolongados posibilitan la perpetuidad de los síntomas y el pronóstico incierto en este grupo de niños.Allergic diseases are one of the main causes for seeing the doctor in childhood and their impact is more acute in low income families. An analytical descriptive study characterized the profile of medical consultation of the allergic child from Mexican low income families. Allergic diseases prevailed in males and at school age, and 71 % of the sick children lived in urban settings. Asthma was the most frequent diagnosis (64 % followed by allergic rhinitis (30%, atopic dermatitis (6 % and urticaria (3 %. The most commom reactivity rates in the cutaneous test were Dermatofagoides farinae (77 %, Dermatofagoides pteronyssinus (60 %, Phleum pratense (20 %, cat (17 %, dog (14 % and Cynodon dactylon (11 %. The high level of family dysfunction and low adhesion to long therapies make it possible the persistence of symptoms and the uncertain prognosis in this group of children.
Directory of Open Access Journals (Sweden)
Bárbara Toncic Neves
2011-12-01
Full Text Available O presente trabalho consiste no levantamento dos táxons da tribo Andropogoneae (Panicoideae - Poaceae ocorrentes na Ilha de Santa Catarina, Florianópolis, Brasil. A partir da revisão de materiais de herbários e coletas a campo foi confirmada a ocorrência de 10 gêneros e 20 espécies, 17 nativas e duas subespontâneas: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 e Sorghum Moench (1. Os gêneros Bothriochloa e Rhytachne são registrados pela primeira vez para a Ilha de Santa Catarina. São apresentadas chaves de identificação para gêneros e espécies, ilustrações, informações sobre distribuição geográfica, habitat, período de floração e comentários para cada táxon.The present work is a survey of the taxa in the tribe Andropogoneae (Panicoideae - Poaceae that occur on the Island of Santa Catarina, Florianópolis, Brazil. Based on a review of herbarium specimens and fieldwork, 20 species were recorded in the following 10 genera: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 and Sorghum Moench (1. Seventeen of the species are native, and two species are subspontaneous. Bothriochloa and Rhytachne are recorded here, for the first time, for the Island of Santa Catarina. This work provides key to the genera and species, as well as illustrations, information about geographic distribution, habitat, phenology, and comments about each taxon presented in the study.
Multilocus Sequence Analysis of Cercospora spp. from Different Host Plant Families
Directory of Open Access Journals (Sweden)
Floreta Fiska Yuliarni
2014-06-01
Full Text Available Identification of the genus Cercospora is still complicated due to the host preferences often being used as the main criteria to propose a new name. We determined the relationship between host plants and multilocus sequence variations (ITS rDNA including 5.8S rDNA, elongation factor 1-α, and calmodulin in Cercospora spp. to investigate the host specificity. We used 53 strains of Cercospora spp. infecting 12 plant families for phylogenetic analysis. The sequences of 23 strains of Cercospora spp. infecting the plant families of Asteraceae, Cucurbitaceae, and Solanaceae were determined in this study. The sequences of 30 strains of Cercospora spp. infecting the plant families of Fabaceae, Amaranthaceae, Apiaceae, Plumbaginaceae, Malvaceae, Cistaceae, Plantaginaceae, Lamiaceae, and Poaceae were obtained from GenBank. The molecular phylogenetic analysis revealed that the majority of Cercospora species lack host specificity, and only C. zinniicola, C. zeina, C. zeae-maydis, C. cocciniae, and C. mikaniicola were found to be host-specific. Closely related species of Cercospora could not be distinguished using molecular analyses of ITS, EF, and CAL gene regions. The topology of the phylogenetic tree based on the CAL gene showed a better topology and Cercospora species separation than the trees developed based on the ITS rDNA region or the EF gene.
International Nuclear Information System (INIS)
Hameed, M.; Ashraf, M.; Naz, N.; Al-qurainy, F.
2010-01-01
A naturally adapted salt tolerant population of Cynodon dactylon (L.) Pers., from highly saline soils of Uchhali Lake, the Salt Range, Pakistan was evaluated for root and stem anatomical modifications. A population from the normal (non-saline) soils of the Faisalabad region was also collected for comparison. Both populations were subjected to salt stress hydroponically. The salt treatments used were: control (0 mM salt), 50, 100, 150 and 200 mM NaCl in 0.5 strength Hoagland's nutrient solution. The Salt Range population showed specific root and stem anatomical adaptations for its better survival under harsh saline environments. Increased exodermis and sclerenchyma, endodermis, cortex and pith parenchyma in roots were critical for checking water loss and enhancing water storage capability. In stem, increased stem area (succulence), increased epidermis and sclerenchyma thicknesses (preventing water loss), increased cortex thickness (increasing water storage), and increased number and area of vascular tissue (increased water conduction) seemed to be crucial for its better survival under harsh saline environments. (author)
Shi, Haitao; Ye, Tiantian; Chan, Zhulong
2014-09-01
Drought (water-deficit) stress is a serious environmental problem in plant growth and cultivation. As one of widely cultivated warm-season turfgrass, bermudagrass (Cynodon dactylon (L). Pers.) exhibits drastic natural variation in the drought stress resistance in leaves and stems of different varieties. In this study, proteomic analysis was performed to identify drought-responsive proteins in both leaves and stems of two bermudagrass varieties contrasting in drought stress resistance, including drought sensitive variety (Yukon) and drought tolerant variety (Tifgreen). Through comparative proteomic analysis, 39 proteins with significantly changed abundance were identified, including 3 commonly increased and 2 decreased proteins by drought stress in leaves and stems of Yukon and Tifgreen varieties, 2 differentially regulated proteins in leaves and stems of two varieties after drought treatment, 23 proteins increased by drought stress in Yukon variety and constitutively expressed in Tifgreen variety, and other 3 differentially expressed proteins under control and drought stress conditions. Among them, proteins involved in photosynthesis (PS), glycolysis, N-metabolism, tricarboxylicacid (TCA) and redox pathways were largely enriched, which might be contributed to the natural variation of drought resistance between Yukon and Tifgreen varieties. These studies provide new insights to understand the molecular mechanism underlying bermudagrass response to drought stress. Copyright © 2014 Elsevier Masson SAS. All rights reserved.
A synteny-based draft genome sequence of the forage grass Lolium perenne
DEFF Research Database (Denmark)
Byrne, Stephen; Nagy, Istvan; Pfeifer, Matthias
2015-01-01
-family of the grass family (Poaceae). Transcriptome data was used to identify 28 455 gene models, and we utilized macro-co-linearity between perennial ryegrass and barley, and synteny within the grass family, to establish a synteny-based linear gene order. The gametophytic self-incompatibility mechanism enables...
Parthasarathy, Meera; Pemaiah, Brindha; Natesan, Ravichandran; Padmavathy, Saralla R; Pachiappan, Jayaraman
2015-02-01
Salt glands are specialized organelles present in the leaf tissues of halophytes, which impart salt-tolerance capability to the plant species. These glands are usually identified only by their morphology using conventional staining procedures coupled with optical microscopy. In this work, we have employed scanning electrochemical microscopy to identify the salt glands not only by their morphology but also by their salt excretion behavior. Bermuda grass (Cynodon dactylon L.) species was chosen for the study as they are known to be salt-tolerant and contain salt glands on leaf surfaces. Scanning electrochemical microscopy performed in sodium chloride medium in the presence and absence of potassium ferrocyanide as redox mediator, reveals the identity of salt glands. More insight into the ion expulsion behavior of these glands was obtained by mapping lateral and vertical variations in ion concentrations using surface impedance measurements which indicated five times higher resistance over the salt glands compared to the surrounding tissues and bulk solution. The protocol could be used to understand the developmental processes in plants grown in different soil/water conditions in order to improve salt tolerance of food crops by genetic engineering and hence improve their agricultural productivity.
Akbari, M; Salehi, H; Niazi, A
2018-04-01
The main goals of the present study were to screen Iranian common bermudagrasses to find cold-tolerant accessions and evaluate their genetic and morphological variabilities. In this study, 49 accessions were collected from 18 provinces of Iran. One foreign cultivar of common bermudagrass was used as control. Morphological variation was evaluated based on 14 morphological traits to give information about taxonomic position of Iranian common bermudagrass. Data from morphological traits were evaluated to categorize all accessions as either cold sensitive or tolerant using hierarchical clustering with Ward's method in SPSS software. Inter-Simple Sequence Repeat (ISSR) primers were employed to evaluate genetic variability of accessions. The results of our taxonomic investigation support the existence of two varieties of Cynodon dactylon in Iran: var. dactylon (hairless plant) and var. villosous (plant with hairs at leaf underside and/or upper side surfaces or exterior surfaces of sheath). All 15 primers amplified and gave clear and highly reproducible DNA fragments. In total, 152 fragments were produced, of which 144 (94.73%) being polymorphic. The polymorphic information content (PIC) values ranged from 0.700 to 0.928. The average PIC value obtained with 15 ISSR primers was 0.800, which shows that all primers were informative. Probability identity (PI) and discriminating power between all primers ranged from 0.029 to 0.185 and 0.815 to 0.971, respectively. Genetic data were converted into a binary data matrix. NTSYS software was used for data analysis. Clustering was done by the unweighted pair-group method with arithmetic averages and principle coordinate analysis, separated the accessions into six main clusters. According to both morphological and genetic diversity investigations of accessions, they can be clustered into three groups: cold sensitive, cold semi-tolerant, and cold tolerant. The most cold-tolerant accessions were: Taft, Malayear, Gorgan, Safashahr
Évaluation de la diversité floristique en herbacées des savanes de ...
African Journals Online (AJOL)
Thus, 37 species, 33 kinds and 10 families were identified in the savannah of Hyparrhenia diplandra (Hack.) Stapf and 27 species, 22 kinds and 8 families in the savannah of Loudetia simplex (Nees) CE Hubbard. Overall, the richest families in species were Poaceae, Fabaceae and the Cyperaceae. The Shannon diversity ...
Ji, L L; Song, Y C; Tan, R X
2004-01-01
The cultures of an endophytic fungus Calcarisporium sp. were screened for inhibitors on the growth of feed-associated moulds and on the aflatoxin biosynthesis to find a safe and effective feed preservative. Eight test fungi were isolated from the spoiled poultry feed. The endophytic fungus Calcarisporium sp. was separated from the Chinese coastal grass Cynodon dactylon. The antifungal action concerning the endophytic culture extract (ECE) was performed with propionic acid (PPA) as the corresponding reference. The ECE had a similar antifungal efficacy to PPA in a concentration-dependent manner. The susceptibility order of the ECE to the test fungi was found to be Fusarium sp. > Aspergillus spp. > Penicillium spp. Furthermore, the application of the ECE in pelleted-layer duck feed as a preservative was carried out at a humidity of 10, 15 and 20%. It has been discerned that mould growth and aflatoxin biosynthesis could be co-inhibited almost completely by ECE at concentrations higher than 1.0% (w/w). The LD50 of the ECE on mice was shown to be higher than 28 g kg-1. The ECE can be selected as an inhibitor to preserve poultry feed on inhibiting the growth of mould and aflatoxin biosynthesis during feed storage. The ECE may be an effective and biosafe antifungal ingredient for poultry feed and holds a potential market prospect in feed industry.
Wu, Song-Lin; Chen, Bao-Dong; Sun, Yu-Qing; Ren, Bai-Hui; Zhang, Xin; Wang, You-Shan
2014-09-01
In a greenhouse pot experiment, dandelion (Taraxacum platypecidum Diels.) and bermudagrass (Cynodon dactylon[Linn.] Pers.), inoculated with and without arbuscular mycorrhizal fungus (AMF) Rhizophagus irregularis, were grown in chromium (Cr)-amended soils (0 mg/kg, 5 mg/kg, 10 mg/kg, and 20 mg/kg Cr[VI]) to test whether arbuscular mycorrhizal (AM) symbiosis can improve Cr tolerance in different plant species. The experimental results indicated that the dry weights of both plant species were dramatically increased by AM symbiosis. Mycorrhizal colonization increased plant P concentrations and decreased Cr concentrations and Cr translocation from roots to shoots for dandelion; in contrast, mycorrhizal colonization decreased plant Cr concentrations without improvement of P nutrition in bermudagrass. Chromium speciation analysis revealed that AM symbiosis potentially altered Cr species and bioavailability in the rhizosphere. The study confirmed the protective effects of AMF on host plants under Cr contaminations. © 2014 SETAC.
Marcos Antonio Teixeira
2014-01-01
O objetivo deste trabalho foi avaliar o desempenho animal da raÃa Purunà e de pastagens de Tifton 85 (Cynodon spp) e Coastcross (Cynodon dactylon) com e sem irrigaÃÃo sendo o experimento realizado no municÃpio de Santa Tereza do Oeste/PR. Inicialmente, avaliou-se a produÃÃo de matÃria seca (MS) e composiÃÃo bromatolÃgica das pastagens de capim tifton 85 e coastcross sem irrigaÃÃo e com irrigaÃÃo. O delineamento experimental foi em blocos casualizados, em esquema fatorial com parcelas subd...
Computational identification of putative cytochrome P450 genes in ...
African Journals Online (AJOL)
Chattha
Economically, legumes represent the second most important family of crop plants after Poacea (grass family), accounting for ... further characterization of P450 genes with both known and unknown functions. MATERIALS AND METHODS ..... Cytochrome P450. In: Somerville CR, Meyerowitz EM (eds) .The Arabidopsis book,.
Lifescience Database Archive (English)
Full Text Available PD:C01530], Benzoxazinones, Polysaccharide, Protein Coix lacryma-jobi [TAX:714458] Same as: D06798 Poaceae (grass family) Coicis semen Major component: Coixenolide [CPD:C17566] ...
Shi, Haitao; Ye, Tiantian; Zhong, Bao; Liu, Xun; Chan, Zhulong
2014-11-01
As an important second messenger, calcium is involved in plant cold stress response, including chilling (Cynodon dactylon (L.) Pers.). Physiological analyses showed that CaCl2 treatment alleviated the reactive oxygen species (ROS) burst and cell damage triggered by chilling stress, via activating antioxidant enzymes, non-enzymatic glutathione antioxidant pool, while EGTA treatment had the opposite effects. Additionally, comparative proteomic analysis identified 51 differentially expressed proteins that were enriched in redox, tricarboxylicacid cycle, glycolysis, photosynthesis, oxidative pentose phosphate pathway, and amino acid metabolisms. Consistently, 42 metabolites including amino acids, organic acids, sugars, and sugar alcohols were regulated by CaCl2 treatment under control and cold stress conditions, further confirming the common modulation of CaCl2 treatment in carbon metabolites and amino acid metabolism. Taken together, this study reported first evidence of the essential and protective roles of endogenous and exogenous calcium in bermudagrass response to cold stress, partially via activation of the antioxidants and modulation of several differentially expressed proteins and metabolic homeostasis in the process of cold acclimation. © 2014 Institute of Botany, Chinese Academy of Sciences.
Uhlig, Silvio; Botha, Christo J; Vrålstad, Trude; Rolén, Elin; Miles, Christopher O
2009-12-09
Tremorgenic syndromes in mammals are commonly associated with indole-diterpenoid alkaloids of fungal origin. Cattle are sometimes affected by tremors (also called "staggers") when they graze on toxic grass pastures, and Bermuda grass ( Cynodon dactylon , kweek) has been known to be associated with tremors for several decades. This study reports the identification of paspalitrems and paspaline-like indole-diterpenes in the seedheads of Claviceps cynodontis -infected Bermuda grass collected from a pasture that had caused a staggers syndrome in cattle in South Africa and thereby links the condition to specific mycotoxins. The highest concentration (about 150 mg/kg) was found for paspalitrem B. Ergonovine and ergine (lysergic acid amide), together with their C-8 epimers, were found to co-occur with the indole-diterpenes at concentrations of about 10 microg/kg. The indole-diterpene profile of the extract from the ergotized Bermuda grass was similar to that of Claviceps paspali sclerotia. However, the C. paspali sclerotia contained in addition agroclavine and elymoclavine. This is the first study linking tremors associated with grazing of Bermuda grass to specific tremorgenic indole-diterpenoid mycotoxins.
Attigala, Lakshmi; De Silva, Nuwan I; Clark, Lynn G
2016-04-01
Programs that are user-friendly and freely available for developing Web-based interactive keys are scarce and most of the well-structured applications are relatively expensive. WEBiKEY was developed to enable researchers to easily develop their own Web-based interactive keys with fewer resources. A Web-based multiaccess identification tool (WEBiKEY) was developed that uses freely available Microsoft ASP.NET technologies and an SQL Server database for Windows-based hosting environments. WEBiKEY was tested for its usability with a sample data set, the temperate woody bamboo genus Kuruna (Poaceae). WEBiKEY is freely available to the public and can be used to develop Web-based interactive keys for any group of species. The interactive key we developed for Kuruna using WEBiKEY enables users to visually inspect characteristics of Kuruna and identify an unknown specimen as one of seven possible species in the genus.
Lifescience Database Archive (English)
Full Text Available ucris; Adlay ... Coix lacryma-jobi [TAX:714458] ... Same as: E00845 ... Poaceae (grass family) Adlay fruit and bract; Standards for non-pharmacopoeial crude drugs ... PubChem: 163312269 ...
African Journals Online (AJOL)
Timothy Ademakinwa
Faculty of Science, Senate Building and New Hall respectively. A total of 3,495 palynomorphs belonging to about 22 families were recovered in all. The Poaceae family dominates representing 13.67 % of the total palynomorph count, followed by Cyperaceae (12.72 %) Euphorbiaceae (5.34 %) Mimosaceae (8.89 %), Fern.
Wang, Qiuxia; Liu, Huitao; Gao, Ainong; Yang, Xinming; Liu, Weihua; Li, Xiuquan; Li, Lihui
2012-01-01
Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae) are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng) J.L.Yang et al. (2n = 6x = 42, StStPPYY), collected from different environments, were studied using genome in situ hybridization (GISH). We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15%) and Y (22.22%), in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05). The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01). Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.
Directory of Open Access Journals (Sweden)
Qiuxia Wang
Full Text Available Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng J.L.Yang et al. (2n = 6x = 42, StStPPYY, collected from different environments, were studied using genome in situ hybridization (GISH. We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15% and Y (22.22%, in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05. The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01. Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.
Anatomía ecológica de algunas especies del género Paspalum (Poaceae, Panicoideae, Paniceae
Directory of Open Access Journals (Sweden)
Sandra S. Aliscioni
2000-01-01
Full Text Available Aliscioni, S. S. 2000. Anatomía ecológica de algunas especies del género Paspalum(Poaceae, Panicoideae, Paniceae. Darwiniana 38(3-4: 187-207.El género Paspalum L. presenta un elevado número de especies, con una amplia variabilidadmorfológica y una extensa distribución geográfica. Sus especies crecen en hábitats sumamente diversos,desde ambientes muy húmedos o acuáticos, a lugares secos de suelos arcillosos o arenosos, muchas vecessalinos. Dada la diversidad de ambientes en los que puede hallarse Paspalum, se estudiaron lascaracterísticas anatómico-foliares presentes en el género con la finalidad de interpretar diferentesestrategias adaptativas en distintas especies. Se presenta una descripción general de la anatomía foliar delgénero y se discuten ciertos caracteres anatómicos, interpretando su posible relación con las condicionesdel hábitat
Wen, Feng; Zhu, Hong; Li, Peng; Jiang, Min; Mao, Wenqing; Ong, Chermaine; Chu, Zhaoqing
2014-06-01
Members of plant WRKY gene family are ancient transcription factors that function in plant growth and development and respond to biotic and abiotic stresses. In our present study, we have investigated WRKY family genes in Brachypodium distachyon, a new model plant of family Poaceae. We identified a total of 86 WRKY genes from B. distachyon and explored their chromosomal distribution and evolution, domain alignment, promoter cis-elements, and expression profiles. Combining the analysis of phylogenetic tree of BdWRKY genes and the result of expression profiling, results showed that most of clustered gene pairs had higher similarities in the WRKY domain, suggesting that they might be functionally redundant. Neighbour-joining analysis of 301 WRKY domains from Oryza sativa, Arabidopsis thaliana, and B. distachyon suggested that BdWRKY domains are evolutionarily more closely related to O. sativa WRKY domains than those of A. thaliana. Moreover, tissue-specific expression profile of BdWRKY genes and their responses to phytohormones and several biotic or abiotic stresses were analysed by quantitative real-time PCR. The results showed that the expression of BdWRKY genes was rapidly regulated by stresses and phytohormones, and there was a strong correlation between promoter cis-elements and the phytohormones-induced BdWRKY gene expression. © The Author 2014. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.
Directory of Open Access Journals (Sweden)
Marcia Regina Coelho
2000-05-01
Full Text Available O experimento foi realizado no Câmpus do Arenito - UEM, em Cidade Gaúcha, no período de outubro de 1997 a março de 1998, com o objetivo de avaliar na pastagem de coastcross -1 (Cynodon dactylon (L. Pers, em quatro níveis de resíduo de matéria seca (RMS: 1.978, 2.130, 2.545 e 3.857 kg de MS/ha, com lotação contínua e carga animal variável, as densidades e participação dos componentes botânicos. O delineamento experimental utilizado foi inteiramente casualizado, com duas repetições. As avaliações da densidade de forragem, participação dos componentes botânicos e a relação folha/colmo foram estudados nos estratos inferiores (0 - 10 cm e superiores (10 - 20 cm da pastagem, em função dos níveis RMS. A densidade da pastagem (g de MS/m3 nos estratos inferior e superior teve uma relação positiva com os níveis de RMS e negativa em relação ao tempo (dias do experimento. A percentagem de material morto (MM foi superior no estrato inferior em relação à percentagem de colmos verdes (CV e de folhas verdes (FV. No estrato superior o MM e CV tiveram a maior participação, porém FV, aumentou à medida que se elevaram os níveis de RMS.This experiment was carried out in Arenito Research Center-UEM, in Cidade Gaúcha-PR, from October/1997 to March /1998, to evaluate in coastcross-1 (Cynodon dactylon (L. Pers grazing, in four levels of dry matter residue (DMR: 1,978; 2,130; 2,545; 3,857 kg of DM/ha, with a continuous allotment system and variable number of allotments, the densities and participation of botanical component. A completely randomized design with two replications was used. Forage density, participation of botanical components and leaf/stem ratio were evaluated in inferior strata (0-10 cm and superior ones (10-20 cm of the pasture, according to the levels of DMR. The pasture density (g of DM/m3 in superior and inferior strata had a positive relation with the DMR levels and negative when associated to the period (days
Directory of Open Access Journals (Sweden)
Luiz Januário Magalhães Aroeira
2000-05-01
Full Text Available O experimento teve como objetivo estimar o consumo total de MS de vacas das raças gir e girolanda, em pastagem de capim coastcross [Cynodon dactylon (L. Pers cv. coastcross]. Foram utilizadas oito vacas gir e oito girolanda com 30 a 90 dias de lactação. Foi utilizada uma área de cinco hectares (ha, dividida em 10 piquetes de um hectare, e a pastagem manejada em pastejo rotacionado, com três dias de ocupação e 27 dias de descanso e taxa de lotação de 1,6 animais/ha no final da seca e 3,2 animais/ha nas demais épocas experimentais. Para a estimativa do consumo, foi utilizado o marcador cromo mordente. O delineamento experimental foi o de blocos casualizados com dois tratamentos (gir e girolanda, oito repetições e quatro blocos (épocas. O consumo total médio foi de 7,68kg de MS/animal/dia para a raça girolanda e 5,71kg de MS/animal/dia para a raça gir, correspondentes a 1,58% e 1,38% do peso vivo, respectivamente. Os consumos médios de capim coastcross estimados foram de 2,70kg e 4,68kg de MS/animal/dia para a raça gir e girolanda, correspondendo a 0,66 e 1,16% de PV, respectivamente.The objective of this experiment was to estimate the total dry matter intake of gir and girolanda breed cows kept in coastcross pasture [Cynodon dactylon (L. Pers cv. coastcross]. Eight gir and eight girolanda cows were used, all between 30 and 90 days of lactation period. The pasture (five ha was divided in 10 paddocks, grazed for three days with 27 days of resting period with stocking rate of 1.6 cows/ha at the end of the dry season and 3.2 cows/ha in the other experimental periods. Chromic mordant marker was used to estimate dry matter intake. The experimental design was a randomized complete block with two treatments (gir and girolanda, eight replications and four blocks (seasons. The total mean dry matter intake for girolanda cows was of 7.68 kg DM/cow/day and 5.71 kg DM/cow/day for gir cows, corresponding to 1.58% and 1.38% live weight
Airborne study of grass allergen (Lol p 1) in different-sized particles.
De Linares, C; Díaz de la Guardia, C; Nieto Lugilde, D; Alba, F
2010-01-01
The Poaceae family is considered one of the main causes of pollen allergy in industrialized countries. The aim of this study is to establish the dynamics of the Poaceae allergens and determine their distribution in the different-sized particles in the atmosphere. The air of Granada (southern Spain) was sampled during the pollination period of Poaceae using a cascade impactor and a Hirst-type volumetric collector simultaneously. The sampled airborne allergens were analyzed by indirect ELISA and field emission scanning electron microscopy. Airborne pollen was evaluated with the Spanish Aerobiological Network methodology. Poaceae pollen and allergenic activity have parallel dynamics during the period of maximum pollination, which is reflected in the positive correlations between the 2 variables. In addition, the highest Lol p 1 concentrations were recorded in particle sizes lower than 3.3 mum (stage 4-F). The Spearman correlation test showed that airborne allergens are not dependent on meteorological factors, such as humidity, wind direction or sunshine, however, Lol p 1 allergen correlated positively with Poaceae pollen. The results of the present study confirm that the Lol p 1 allergen is detected more frequently with pollutants than with coarse particles with similar dynamics and a positive correlation between airborne pollen and aeroallergens. Moreover, Lol p 1 is released in stable weather conditions without large changes in humidity or temperature. Copyright 2009 S. Karger AG, Basel.
Grass survey of the Itremo Massif records endemic central highland ...
African Journals Online (AJOL)
Grasses are members of the plant family Poaceae, and are primar- ily known for their ... Madagascar Conservation & Development is the journal of. Indian Ocean .... cording to the classification by Kellogg (2015). With 64 ..... Flowering plants.
Lu, Shaoyun; Chen, Chuanhao; Wang, Zhongcheng; Guo, Zhenfei; Li, Haihang
2009-03-01
Eight somaclonal variants with enhanced drought tolerance were isolated from regenerated plants of triploid bermudagrass (Cynodon dactylon x Cynodon transvaalensis cv., TifEagle). Three of them (10-17, 89-02, 117-08) with strong drought tolerance were selected for investigations of physiological responses to drought stress. Compared to the parent control, TifEagle, the somaclonal variants had higher relative water contents and relative growth, and lower ion leakages in the greenhouse tests, while no difference in evapotranspirational water losses and soil water contents was observed between the variants and TifEagle. The variants also had less leaf firing in the field tests under drought stress. Superoxide dismutase (SOD), catalase (CAT) and ascorbate peroxidase (APX) activities decreased gradually in responses to drought stress in all plants and exhibited negative correlations with ion leakage, indicating that the declined activities of these antioxidant enzymes were associated with drought injury in the triploid bermudagrass. However, CAT activities were significantly higher in all three variants than in TifEagle during drought stress. Two variants, 10-17 and 89-02, also had significantly higher APX activities than TifEagle before and during the first 4 days of drought treatments. These two lines also showed higher SOD activities after prolonged drought stress. Proline, total soluble sugars and sucrose were accumulated under drought stress in all plants and exhibited positive correlations with ion leakage. More proline and sugars were accumulated in TifEagle than in the variants. The results indicated that higher activities of the antioxidant enzymes in the variants during drought stress are associated with their increased drought tolerance.
Directory of Open Access Journals (Sweden)
Pavlović Ivan
2017-01-01
Full Text Available The plants of genus Cymbopogon are well known for their use in traditional medicine and for their high content of essential oils that are widely used as flavoring agents, fragrances, cosmetics, and pharmaceuticals. Essential oils isolated from the dried stems and inflorescence of cultivated Cymbopogon schoenanthus (L. Spreng. (Poaceae collected from Khartoum state (Sudan in two periods were studied. The results of chemical analysis of C. schoenanthus revealed that this plant is rich in essential oil which is a valuable source of the commercially important monoterpene, piperitone (47.7-71.5%. Other abundant constituents of the oils were intermedeol (6.1-17.3%, δ-2-carene (4.5-10.0% and elemol (2.7-9.0%. The essential oil from the inflorescence was tested for spasmolytic activity using three different experimental models: against spontaneous contractions, contractions induced with acetylcholine and contractions induced with potassium chloride. The oil exhibited strong, significant and dose-dependent spasmolytic activity, indicating the possibility for further investigations of this essential oil for its medicinal purposes or application in food industry. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no.173021 and Grant no. III41018
Directory of Open Access Journals (Sweden)
Álvaro Ojeda
2012-12-01
Full Text Available Objetivo. Evaluar el efecto de una fuente no proteica de liberación controlada de nitrógeno (NnpLC sobre algunos parámetros de la fermentación ruminal y degradabilidad in situ de Cynodon dactylon. Materiales y métodos. 4 vacas fistuladas al rumen alimentadas con una dieta base de heno de Cynodon dactylon (4.8% proteína cruda y 78.4% fibra detergente neutra, 1 kg de melaza de caña y 55 g de mezcla mineral (tratamiento Control, y tratamientos experimentales con adición a la dieta base de 150 g urea (Urea, sustitución de Urea por NnpLC a razón de 50% del aporte de nitrógeno (Urea/ NnpLC y 183 g NnpLC (NnpLC. En un Cuadrado Latino 4x4 y períodos de 17 días, se registró consumo del día 7 al 14. El día 15 fueron tomadas muestras seriadas de contenido ruminal para evaluar pH, nitrógeno amoniacal (N-NH3 y ácidos grasos volátiles. La degradabilidad de la materia orgánica (DMO48 y fibra detergente neutro (DFND48 a las 48 h fueron medidas con bolsas de nylon. Resultados. No hubo diferencias (p>0.05 en consumo de materia seca (8.2±0.35 kgMS/animal/día, pH (6.1±0.21, DMO48 (52.2±6.2% y DFND48 (30.1±2.8%; aunque hubo diferencias (p<0.01 en valores medios de N-NH3 (19.1, 166.7, 181.6 y 281.8 mg/L; respectivamente. NnpLC incrementó (p<0.05 el ácido propiónico (27.3%, redujo el T1/2 (13.2% y optimizó la relación P:E (22.0± 0.76. Conclusiones. El uso de una fuente NnpLC generó un perfil de ácidos grasos volátiles con patrón gluconeogénico, optimizó la concentración de N-NH3 y mejoró la relación P:E, por lo que debe considerarse una alternativa para manipular el medio ambiente ruminal de vacunos alimentados con recursos fibrosos.
Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae
Directory of Open Access Journals (Sweden)
Hugo F Gutiérrez
2012-06-01
Full Text Available Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve lectotipificaciones: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P. pringlei Leeke, P. tristachyum (Kunth Spreng. subsp. boliviense Chase, y se propone un nombre nuevo para Gymnotrix crinita Kunth.Nomenclatural novelties in Cenchrus s.l. (Poaceae: Panicoideae: Paniceae. Recent phylogenetic studies with morphological and molecular data provided evidence on the monophyly of the genera Cenchrus, Pennisetum and Odontelytrum. Therefore, these studies propose the unification and transfer of species of Pennisetum and Odontelytrum to the genus Cenchrus, which has priority. Nomenclatural problems were detected when conducting a preliminary taxonomic revision of the genus Cenchrus s.l. from America (Gutiérrez, in preparation. To resolve these inconveniences, nine lectotypifications: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P
Directory of Open Access Journals (Sweden)
Eduardo Chaves
2012-10-01
Full Text Available Flowering species of the herbaceous and shrubby layer were sampled in a gallery forest at Portal da Chapada, Alto Paraíso de Goiás-GO in the Chapada dos Veadeiros during 12 months growing within 4.5 meters on either side of a raised pathway 2.4 Km long. The collections were included to University of Brasilia Herbarium (UB. A total of 138 species (103 genera and 40 families were recorded; the most species-rich families were Asteraceae (22, Poaceae (14, Rubiaceae (12, Fabaceae (11 and Melastomataceae (7. The richest family in number of genera was Asteraceae (19, followed by Poaceae (8, Fabaceae (8 and Rubiaceae (7. The results showed a meaningful increase in the Chapada dos Veadeiros flora, especially considering the herbaceous-shrubby layer of the gallery forests (223.6%. Despite the richness of the flora, the number of endemics species in the Goiás State was only 1.5%.
Phytoliths as Emerging Taxonomic Tools for Identification of Plants: An Overview
Directory of Open Access Journals (Sweden)
Sheikh Abdul Shakoor
2014-01-01
Full Text Available In the recent advancements in identification of plant species, phytoliths have found an immense role in the identification of plants at different levels of taxonomic hierarchy. Many plant groups are known to accumulate silica in solid form in and between the cells and tissues and hence create the structures commonly known as phytoliths. These phytoliths create replicas of the structures where they are deposited. The shapes of phytolith replicas, their size dimensions (morphometric parameters, surface features (ornamentation, distribution, and orientation pattern in epidermal layers of vegetative and reproductive structures as well as their frequency are highly important for characterization of species. Monocotyledonous families particularly the family Poaceae (Gramineae are known to produce diverse phytolith types that can serve as diagnostic markers for characterization of different taxa at different levels of taxonomic hierarchy. The present paper highlights the importance of phytoliths in taxonomic analysis of plants particularly in the family Poaceae.
Population genetic structure analysis in endangered Hordeum ...
African Journals Online (AJOL)
Administrator
2011-09-07
Sep 7, 2011 ... populations are grown by few local farmers in low-input farming systems. Based on 117 random ... Triticeae of the Poaceae (Graminae) family found throughout the ... populations and phylogeography is made easy by the.
Original Paper Weeds control through tree-crop associations in a ...
African Journals Online (AJOL)
these trees, two crops were grown: a shade tolerant crop (Colocasia esculenta, taro) ... The most represented weeds family in the open field was Poaceae while under both tree species, the ...... provided guide, corrections and supervision to.
Reasor, Eric H; Brosnan, James T; Trigiano, Robert N; Elsner, J Earl; Henry, Gerald M; Schwartz, Brian M
2016-10-01
Some interspecific hybrid bermudagrass cultivars used on golf course putting greens are genetically unstable, which has caused phenotypically different off-type grasses to occur in production nurseries and putting surfaces. Management practices to reduce the occurrence of off-type grasses in putting green surfaces and the effect they can have on putting quality and performance need to be researched until genetically stable cultivars are developed. Golf course putting green surfaces in subtropical and tropical climates are typically planted with an interspecific hybrid bermudagrass (Cynodon dactylon (L.) Pers. × C. transvaalensis Burtt-Davy), because of the superior putting quality and performance of these cultivars. 'Tifgreen' was one of the first interspecific hybrids developed for putting green use in lieu of common bermudagrass. However, off-type grasses began appearing in established Tifgreen stands soon after commercial release. Off-type grasses are those with different morphology and performance when compared to the surrounding, desirable cultivar. Off-types have the potential to decrease surface uniformity, which negatively affects putting surface quality. However, several unique off-types from Tifgreen have been selected as commercial cultivars, the first being 'Tifdwarf'; then 'Floradwarf', 'MS-Supreme', 'Pee Dee-102', and 'TL-2', identified later. The cultivars 'Champion Dwarf', 'P-18', 'RJT', and 'Emerald Dwarf' were subsequently selected as off-types in Tifdwarf. The naturally occurring off-types and cultivars that have been identified within the Tifgreen family have widely differing phenotypes; however, they are reported to be genetically similar, supporting the hypothesis that their occurrence is a result of somatic mutations. Genetic instability in currently available commercial cultivars is likely to lead to the continued presence of off-types in production nurseries and putting greens. Additional research is needed to understand the nature of
Directory of Open Access Journals (Sweden)
Ramadoss Karthikeyan
2015-01-01
Full Text Available P-coumaric acid is a nonflavonoid phenolic acid and is a major constituent of the species Cynodon dactylon Linn. (Pers.. In this study isolation of P-coumaric acid was achieved by preparative TLC and the compound thus isolated was characterised by UV, mass, and H1 NMR spectral analysis. An isocratic RP-HPLC method was developed for the estimation of P-coumaric acid from methanolic extracts of durva grass. The chromatographic separations were achieved by RP-C18 column (250 mm × 4.6 mm, 5 μ, Shimadzu LC-20AT Prominence liquid chromatograph, and a mobile phase composed of water : methanol : glacial acetic acid (65 : 34 : 1 v/v. The flow rate was 1.0 mL/min and the analyses of column effluents were performed using UV-visible detector at 310 nm. Retention time of P-coumaric acid was found to be 6.617 min. This method has obeyed linearity over the concentration range of 2–10 μg/mL and the regression coefficient obtained from linearity plot for P-coumaric acid was found to be 0.999. RP-HPLC method was validated in pursuance of ICH guidelines.
Karthikeyan, Ramadoss; Devadasu, Chapala; Srinivasa Babu, Puttagunta
2015-01-01
P-coumaric acid is a nonflavonoid phenolic acid and is a major constituent of the species Cynodon dactylon Linn. (Pers.). In this study isolation of P-coumaric acid was achieved by preparative TLC and the compound thus isolated was characterised by UV, mass, and H1 NMR spectral analysis. An isocratic RP-HPLC method was developed for the estimation of P-coumaric acid from methanolic extracts of durva grass. The chromatographic separations were achieved by RP-C18 column (250 mm × 4.6 mm, 5 μ), Shimadzu LC-20AT Prominence liquid chromatograph, and a mobile phase composed of water : methanol : glacial acetic acid (65 : 34 : 1 v/v). The flow rate was 1.0 mL/min and the analyses of column effluents were performed using UV-visible detector at 310 nm. Retention time of P-coumaric acid was found to be 6.617 min. This method has obeyed linearity over the concentration range of 2–10 μg/mL and the regression coefficient obtained from linearity plot for P-coumaric acid was found to be 0.999. RP-HPLC method was validated in pursuance of ICH guidelines. PMID:25788944
Jose Jesus Sanchez-Escalante; Manuel Espericueta-Betancourt; Reyna Amanda Castillo-Gamez
2005-01-01
Presently, the flora of the Sierra de Mazatán contains 357 species of vascular plants distributed in 248 genera and 80 families. The families with the most species are Asteraceae (48), Fabaceae (45), Poaceae (28), Euphorbiaceae (18), and Acanthaceae, Cactaceae, Scrophulariaceae, and Solanaceae (11 each). The results show that the flora of the Sierra de Mazat...
Floristic and phytosociological analysis of palm swamps in the central part of the Brazilian savanna
Directory of Open Access Journals (Sweden)
Isa Lucia de Morais Resende
2013-03-01
Full Text Available We analyzed the floristics and phytosociology of three palm swamps in the municipality of Bela Vista de Goiás, located in the state of Goiás, Brazil, in the central part of the Brazilian savanna (Cerrado. The floristic surveys were conducted monthly from May 2008 to April 2009, and 310 species were recorded (seven bryophytes, 15 ferns and 288 angiosperms. Bryophytes belonged to five genera and five families; ferns belonged to nine genera and nine families; and angiosperms belonged to 134 genera and 45 families. The angiosperm families with the highest species richness were Poaceae, Cyperaceae, Asteraceae, Eriocaulaceae, Xyridaceae, Lentibulariaceae, Melastomataceae, Rubiaceae and Fabaceae. The palm swamps were divided into three zones of increasing humidity: edge, middle and core. The number of species was higher in the middle than at the edge and the core. The families with the highest cover values were Cyperaceae, Melastomataceae, Arecaceae and Poaceae. Although the palm swamps had been disturbed to varying degrees, those disturbances did not affect the flora in the middle or the core. Floristic similarity was high between these two zones within a given palm swamp and low between the edges of different palm swamps.
The effect of technogenic emissions on the heavy metals accumulation by herbaceous plants.
Chaplygin, Victor; Minkina, Tatiana; Mandzhieva, Saglara; Burachevskaya, Marina; Sushkova, Svetlana; Poluektov, Evgeniy; Antonenko, Elena; Kumacheva, Valentina
2018-02-07
The effect of technogenic emissions on the input of Pb, Zn, Cd, Cu, Mn, Cr, and Ni into plants from the Poaceae and Asteraceae families has been studied. Soil and plant contamination by anthropogenic emissions from industrial enterprises leads the decreasing of crop quality; therefore, the monitoring investigation of plants and soils acquires special importance. The herbaceous plants may be used as bioindicators for main environmental changes. It was found that the high level of anthropogenic load related to atmospheric emissions from the power plant favors the heavy metal (HM) accumulation in herbaceous plants. Contamination with Pb, Cd, Cr, and Ni was revealed in plants growing near the power plant. Heavy metals arrive to plants from the soil in the form of mobile compounds. Plant family is one of the main factors affecting the HM distribution in the above- and underground parts of plants. Plants from the Poaceae family accumulate less chemical elements in their aboveground parts than the Asteraceae plants. Ambrosia artemisiifolia and Artemisia austriaca are HM accumulators. For assessing the stability of plants under contamination with HMs, metal accumulation by plants from soil (the bioconcentration factor) and metal phytoavailability from plants above- and underground parts (the acropetal coefficient) were calculated. According to the bioconcentration factor and translocation factor values, Poaceae species are most resistant to technogenic contamination with HMs. The translocation factor highest values were found for Tanacetum vulgare; the lowest bioconcentration factor values were typical for Poa pratensis.
Thomas, Evert; Vandebroek, Ina; Sanca, Sabino; Van Damme, Patrick
2009-02-25
Medicinal plant use was investigated in Apillapampa, a community of subsistence farmers located in the semi-arid Bolivian Andes. The main objectives were to identify the culturally most significant medicinal plant families and species in Apillapampa. A total of 341 medicinal plant species was inventoried during guided fieldtrips and transect sampling. Data on medicinal uses were obtained from fifteen local Quechua participants, eight of them being traditional healers. Contingency table and binomial analyses of medicinal plants used versus the total number of inventoried species per family showed that Solanaceae is significantly overused in traditional medicine, whereas Poaceae is underused. Also plants with a shrubby habitat are significantly overrepresented in the medicinal plant inventory, which most likely relates to their year-round availability to people as compared to most annual plants that disappear in the dry season. Our ranking of medicinal species according to cultural importance is based upon the Quality Use Agreement Value (QUAV) index we developed. This index takes into account (1) the average number of medicinal uses reported for each plant species by participants; (2) the perceived quality of those medicinal uses; and (3) participant consensus. According to the results, the QUAV index provides an easily derived and valid appraisal of a medicinal plant's cultural significance.
Cloning and characterization of cDNA encoding xyloglucan ...
African Journals Online (AJOL)
Jane
2011-08-22
Aug 22, 2011 ... plays important role in growth and development of plants. XETs are a family of enzymes .... cloned into pGEM-T Easy vector (Promega Corporation, WI, USA). The recombinant ..... wall modification in the poaceae. Protein Sci.
International Nuclear Information System (INIS)
Yilmaz, R.; Cabi, E.; Dogan, M.
2014-01-01
RAPD-PCR (Random Amplified Polymorphic DNA Polymerase Chain Reaction) and Post PCR (Polymerase Chain Reaction) Melting Curve Analysis (MCA) have been used to investigate the pattern of genetic variation among some species in the genera Eremopyrum (Ledeb.) Jaub. and Spach and Agropyron Gaertner (Poaceae). Thirteen primers have been used in the study based on the RAPD-PCR and MCA analyses. Each species produced a distinct pattern of DNA fragments which have been used as a measure of the degree of relationship between species by means of using the RAPD-PCR results with three primers selected for identifying the genetic similarities. Polymorphic melting profiles have been obtained with Post PCR MCA method using three primers. Genetic similarities are calculated for all the species studied with RAPD-PCR and MCA methods, the dendrograms are obtained with the MVSP (Multi Variate Statistical Package) software using UPGMA (Unweighted Pair Group Method with Arithmetic Averages) and Jaccard's Coefficient. Polymorphism between 18 populations of Eremopyrum and 6 Agropyron populations and within the species are determined by using RAPD-PCR and Post PCR melting curve analysis (MCA) respectively. (author)
Liu, J Y; Song, Y C; Zhang, Z; Wang, L; Guo, Z J; Zou, W X; Tan, R X
2004-11-09
Aspergillus fumigatus CY018 was recognized as an endophytic fungus for the first time in the leaf of Cynodon dactylon. By bioassay-guided fractionation, the EtOAc extract of a solid-matrix steady culture of this fungus afforded two new metabolites, named asperfumoid (1) and asperfumin (2), together with six known bioactive compounds including monomethylsulochrin, fumigaclavine C, fumitremorgin C, physcion, helvolic acid and 5alpha,8alpha-epidioxy-ergosta-6,22-diene-3beta-ol as well as other four known compounds ergosta-4,22-diene-3beta-ol, ergosterol, cyclo(Ala-Leu) and cyclo(Ala-Ile). Through detailed spectroscopic analyses including HRESI-MS, homo- and hetero-nuclear correlation NMR experiments (HMQC, COSY, NOESY and HMBC), the structures of asperfumoid and asperfumin were established to be spiro-(3-hydroxyl-2,6-dimethoxyl-2,5-diene-4-cyclohexone-(1,3')-5'-methoxyl-7'-methyl-(1'H, 2'H, 4'H)-quinoline-2',4'-dione) and 5-hydroxyl-2-(6-hydroxyl-2-methoxyl-4-methylbenzoyl)-3,6-dimethoxyl-benzoic methyl ester, respectively. All of the 12 isolates were subjected to in vitro bioactive assays against three human pathogenic fungi Candida albicans, Tricophyton rubrum and Aspergillus niger. As a result, asperfumoid, fumigaclavine C, fumitremorgin C, physcion and helvolic acid were shown to inhibit C. albicans with MICs of 75.0, 31.5, 62.5, 125.0 and 31.5 microg/mL, respectively.
International Nuclear Information System (INIS)
Tufail, A.; Ahmad, F.; Hameed, M.; Ahmad, R.
2017-01-01
Evolution has great ecological significance in terms of plant morphological and stomatal characteristics that must have been genetically fixed during the long evolutionary period. Impact of environmental conditions on growth and stomatal features of twelve ecotypes of Cynodon dactylon that were collected from ecologically different habitats in the Punjab, Pakistan were evaluated. The collected ecotypes Derawar Fort-saline desert (DF-SD), Muzaffar garh-River bank (M-RB), Khabbeki Lake-hyper saline (KL-HS), Ucchali Lake-hyper saline (UL-HS), Kalar Kahar Lake-saline (KKL-S), Treemu-saline wetland (T-SW), Sahianwala-saline wetland (S-SW), Sahianwala-hyper saline (S-HS), Pakka Anna-hyper saline (PA-HS), Pakka Anna-reclaimed field (PA-RF), Botanic Garden-non saline (BG-NS) and Gatwala-saline semiarid (G-SSA) were grown in controlled environments at University of Agriculture, Faisalabad till their acclimatization to evaluate genetically fixed characteristics. After 6-month growth in soil, the plants were transferred to half-strength Hoagland's nutrient medium. There was a huge variation in all morphological characteristics recorded during the investigation, which were due to environmental heterogeniety to which these ecotypes were originally adapted. An exclusive feature of the DF-SD ecotypes is the long and numerous roots, and tillering capacity that surpassed all other ecotypes. Leaves per plant were also exceptionally high that may improve the photosymthetic efficiency of the plant. It showed a good potential of overall growth and biomass production. The robust growth was also recorded in the KKL-S ecotypes, and this can be related to the complete dominance of these two ecotypes in their respective habitats. Small stomata were recorded in the three ecotypes (DF-SD, KL-HS and PA-HS), which are of great ecological significance. Stomatal shape, however, is different in different ecotypes, but its contribution towards stress tolerance is still to be investigated. (author)
Contribution of chloroplast DNA in the biodiversity of some Aegilops ...
African Journals Online (AJOL)
user
2011-03-21
Mar 21, 2011 ... caudata) belonging to the family Poaceae were used in this study. Nucleotides of 1651 ... terranean basin and grow well in the high rainy areas. Syria is ... ate and easy identification of Aegilops species is required. Molecular ...
Directory of Open Access Journals (Sweden)
Ethel Lourenzi Barbosa Novelli
2002-05-01
Full Text Available Este experimento foi conduzido para avaliar a seletividade em plantas dos herbicidas acetochlor, atrazine e oxyfluorfen em relação à atividade da glutationa S-transferase (GST em plantas de milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae. A atividade da GST foi detectada às 24, 48 e 72 horas após as aplicaç��es dos tratamentos. Os tratamentos do experimento consistiram de aplicação com água (controle, acetochlor (3 L.ha-1, atrazine (4 L.ha-1 e oxyfluorfen (1 L.ha-1. As maiores atividades de GST foram observadas na presença de acetochlor, principalmente às 48 horas após o tratamento. Esses aumentos foram 105, 148 e 118% em relação ao controle para milho, sorgo e trigo, respectivamente. É sugerido que a GST pode ter papel na degradação de acetochlor e pode ser uma das razões para a seletividade desse herbicida para essas culturas.This experiment was conducted to evaluate the acetochlor, atrazine and oxyfluorfen herbicides plant selectivity, in relation to glutathione S-transferase activity (GST in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivum L (Poaceae plants. GST activity was detected 24, 48 and 72 hours after treatment applications. The experiment's treatments consisted of spraying plants with water (control, acetochlor (3 L.ha-1`, atrazine (4 L.ha-1 and oxyfluorfen (1 L.ha-1. The highest GST activities were observed in presence of acetochlor, mainly at 48 hours after treatment. These increments were 105, 148 and 118% when compared to maize, sorghum and wheat control groups, respectively. It is suggested that the GST may have a role in acetochlor degradation and it may be a reason for this herbicide's selectivity in these crops.
Directory of Open Access Journals (Sweden)
Jörg Dörrstein
2018-04-01
Full Text Available This article presents experimental data of organosolv lignin from Poacea grass and structural changes after compounding and injection molding as presented in the research article “Effects of high-lignin-loading on thermal, mechanical, and morphological properties of bioplastic composites” [1]. It supplements the article with morphological (SEM, spectroscopic (31P NMR, FT-IR and chromatographic (GPC, EA data of the starting lignin as well as molar mass characteristics (mass average molar mass (Mw and Polydispersity (D of the extracted lignin. Refer to Schwarz et al. [2] for a detailed description of the production of the organosolv residue and for further information on the raw material used for lignin extraction. The dataset is made publicly available and can be useful for extended lignin research and critical analyzes.
Directory of Open Access Journals (Sweden)
Flávio França
2003-12-01
Full Text Available Foram selecionados seis açudes que margeiam a Estrada do Feijão (BA 052, nos municípios de Feira de Santana e Angüera, entre as coordenadas 39º30'-39º00'W e 12º00'-12º30'S. Com a finalidade de se conhecer a flora vascular dos mesmos, esses tipos de plantas foram coletadas de agosto/1996 a dezembro/1997. Registraram-se 121 espécies distribuídas em 46 famílias. As famílias mais representativas foram: Cyperaceae, com 18 espécies (14,9%, Poaceae, com 13 (10,7%, Asteraceae, com 10 (8,3%, Scrophulariaceae e Fabaceae, com 6 (5,0%. As espécies que ocorreram em todos os açudes foram Pistia stratiotes L. (Araceae, Echinochloa colona (L. Link (Poaceae, Nymphaea ampla (Salisb. DC. (Nymphaeaceae e Oxycarium cubense (Poepp. & Kunth. Lye (Cyperaceae.Six ponds were studied between August/1996 and December/1997 at the edge of State Highway BA 052, in the municipalities of Feira de Santana and Angüera, 39º30'-39º00'W and 12º00'-12º30'S.With the aim to know their vascular flora, one hundred and twenty-one species of vascular plants were collected, representing 46 families. The most frequent families were: Cyperaceae with 18 species (14.9%, Poaceae with 13 (10.7%, Asteraceae with 10 (8.3%, Scrophulariaceae and Fabaceae with 6 (5.0%. The species which were recorded in all lakes were: Pistia stratiotes L. (Araceae, Echinochloa colona (L. Link (Poaceae, Nymphaea ampla (Salisb. DC. (Nymphaeaceae and Oxycarium cubense (Poepp. & Kunth. Lye (Cyperaceae.
Ecology and management of the Prairie Division
Roger C. Anderson
2012-01-01
Grasslands occurred on all continents, comprised almost 42 percent of the worldâs plant cover, and once covered approximately 46 million km2 of the Earthâs surface. Grasslands contain few trees or shrubs, are dominated by grasses (members of the family Poaceae), and have a mixture of nongraminoid herbaceous species called forbs. Plant families...
Directory of Open Access Journals (Sweden)
Rodrigo Carvalho Cardoso
2009-12-01
Full Text Available The work was developed in the experimental station of Embrapa Gado de Leite (Dairy Cattle Embrapa, in Coronel Pacheco, in Zona da Mata Region of Minas Gerais, with the purpose of evaluating the productive performance of Holstein cows kept on 'Coast-cross' (Cynodon dactylon (L. Pears pasture, fertilized, strategically irrigated and where the cows were daily supplemented with 3 or 6 kg of concentrate/cow/day. The data were collected during three years (October/2000 to October/2003, involving 108 lactations. An experimental randomized block design with two replicate areas per treatment was adopted, with nine animals per area and eighteen animals per treatment being utilized, with fixed stocking rate of five cows/ha. The system of grazing, under rotated stocking, with one day occupation of the enclosures (piquetes and 25 and 35 days rest in the rainy and dry seasons, respectively was used. The pasture was irrigated in the months of lowest rainfall and fertilized with NPK broadcast at six applications/year. The availability of dry matter of the pasture was 7,280 kg/ha and 6,167 kg/ha in early grazing, with the post-grazing waste stubble of 4,885 kg/ha and 3,994 kg/ha, in the rainy (Spring/Summer and dry (Fall/Winter seasons, respectively. During part of the experimental period, a few morphogenic characteristics of the pasture were evaluated, recording availability of 83.9; 125.6 and 89.5 kg of DM of leaf blades/ha/day, on spring, summer and fall, respectively. The daily averages of milk production per cow were 15.57 and 18.80 kg/ day with 3.5% of fat and per area 77.80 and 94.00 kg/ha, when 3 or 6 kg of concentrate/cow/day were fed, respectively. It was concluded that supplemented and managed 'Coast-cross' pasture adequately enables high milk production per animal and per area, as quantitatively and qualitatively adequate for milk production.O trabalho foi desenvolvido na base física da Embrapa Gado de Leite, em Coronel Pacheco, na Zona da Mata de
African Journals Online (AJOL)
DR. AMINU
From the data, Euphorbiaceae,. Solanaceae, Rutaceae, Malvaceae, Caesalpiniaceae, Poaceae and Apocynaceae (in order of decreasing number of species) were the most frequent Families. Taxa such as Musa species,. Vernonia amygdalina, Citrus species, Psidium guajava and Terminalia catappa were found to be the.
Characterization of novel multi-seeded (msd) mutants of sorghum for increasing grain number
The tribe Andropogoneae of the Poaceae family exhibits highly branched inflorescence known as panicle or tassel. Characteristically, each spikelet in a panicle or tassel comprise of a combination of sessile/fertile and sterile florets. In sorghum, (Sorghum bicolor L. Moench), the existing cultivars ...
Directory of Open Access Journals (Sweden)
Flávia V. Moreira
2010-08-01
Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.
Wang, Shuo; Gao, Li-Zhi
2016-11-01
The complete chloroplast genome sequence of foxtail millet (Setaria italica), an important food and fodder crop in the family Poaceae, is first reported in this study. The genome consists of 1 35 516 bp containing a pair of inverted repeats (IRs) of 21 804 bp separated by a large single-copy (LSC) region and a small single-copy (SSC) region of 79 896 bp and 12 012 bp, respectively. Coding sequences constitute 58.8% of the genome harboring 111 unique genes, 71 of which are protein-coding genes, 4 are rRNA genes, and 36 are tRNA genes. Phylogenetic analysis indicated foxtail millet clustered with Panicum virgatum and Echinochloa crus-galli belonging to the tribe Paniceae of the subfamily Panicoideae. This newly determined chloroplast genome will provide valuable information for the future breeding programs of valuable cereal crops in the family Poaceae.
Jeffries, Matthew D; Gannon, Travis W; Brosnan, James T; Ahmed, Khalied A; Breeden, Gregory K
2016-01-01
Research to date has confirmed 2,4-D residues may dislodge from turfgrass; however, experiments have not been conducted on hybrid bermudagrass (Cynodon dactylon L. x C. transvaalensis), the most common athletic field turfgrass in subtropical climates. More specifically, previous research has not investigated the effect of post-application irrigation on dislodgeable 2,4-D residues from hybrid bermudagrass and across turfgrass species, research has been nondescript regarding sample time within a d (TWD) or conducted in the afternoon when the turfgrass canopy is dry, possibly underestimating potential for dislodgement. The effect of irrigation and TWD on 2,4-D dislodgeability was investigated. Dislodgeable 2,4-D amine was reduced > 300% following irrigation. From 2 to 7 d after treatment (DAT), ≤ 0.5% of applied 2,4-D was dislodged from irrigated turfgrass, while ≤ 2.3% of applied 2,4-D was dislodged when not irrigated. 2,4-D dislodgeability decreased as TWD increased. Dislodgeable 2,4-D residues declined to < 0.1% of the applied at 1 DAT- 13:00, and increased to 1 to 3% of the applied 2 DAT- 5:00, suggesting 2,4-D re-suspended on treated turfgrass vegetation overnight. In conclusion, irrigating treated turfgrass reduced dislodgeable 2,4-D. 2,4-D dislodgeability increased as TWD decreased, which was attributed to non-precipitation climatic conditions favoring turfgrass canopy wetness. This research will improve turfgrass management practices and research designed to minimize human 2,4-D exposure.
Both sugarcane (Saccharum officinarum) and sweet sorghum (Sorghum bicolor) crops are members of the grass (Poaceae) family, and consist of stalks rich in soluble sugars. The extracted juice from both of these crops contains insoluble starch, with much greater quantities occurring in sweet sorghum. ...
Comparative analysis and relationships of six important crop ...
African Journals Online (AJOL)
Administrator
tools using complete chloroplast genomes. Results obtained depict cases of major genome rearrangements, translocation, duplication, inversion and deletion of genes. Members of the poaceae family indicate a close relationship in the nature of conserved sequences while Oryza sativa and. Chlorella vulgaris, which are not ...
Phylogeny of Eleusine (Poaceae: Chloridoideae) based on nuclear ITS and plastid trnT-trnF sequences.
Neves, Susana S; Swire-Clark, Ginger; Hilu, Khidir W; Baird, Wm Vance
2005-05-01
Phylogenetic relationships in the genus Eleusine (Poaceae: Chloridoideae) were investigated using nuclear ITS and plastid trnT-trnF sequences. Separate and combined data sets were analyzed using parsimony, distance, and likelihood based methods, including Bayesian. Data congruence was examined using character and topological measures. Significant data heterogeneity was detected, but there was little conflict in the topological substructure measures for triplets and quartets, and resolution and clade support increased in the combined analysis. Data incongruence may be a result of noise and insufficient information in the slower evolving trnT-trnF. Monophyly of Eleusine is strongly supported in all analyses, but basal relationships in the genus remain uncertain. There is good support for a CAIK clade (E. coracana subsp. coracana and africana, E. indica, and E. kigeziensis), with E. tristachya as its sister group. Two putative ITS homeologues (A and B loci) were identified in the allotetraploid E. coracana; the 'B' locus sequence type was not found in the remaining species. Eleusine coracana and its putative 'A' genome donor, the diploid E. indica, are confirmed close allies, but sequence data contradicts the hypothesis that E. floccifolia is its second genome donor. The 'B' genome donor remains unidentified and may be extinct.
Genome-wide analysis of the GRAS gene family in physic nut (Jatropha curcas L.).
Wu, Z Y; Wu, P Z; Chen, Y P; Li, M R; Wu, G J; Jiang, H W
2015-12-29
GRAS proteins play vital roles in plant growth and development. Physic nut (Jatropha curcas L.) was found to have a total of 48 GRAS family members (JcGRAS), 15 more than those found in Arabidopsis. The JcGRAS genes were divided into 12 subfamilies or 15 ancient monophyletic lineages based on the phylogenetic analysis of GRAS proteins from both flowering and lower plants. The functions of GRAS genes in 9 subfamilies have been reported previously for several plants, while the genes in the remaining 3 subfamilies were of unknown function; we named the latter families U1 to U3. No member of U3 subfamily is present in Arabidopsis and Poaceae species according to public genome sequence data. In comparison with the number of GRAS genes in Arabidopsis, more were detected in physic nut, resulting from the retention of many ancient GRAS subfamilies and the formation of tandem repeats during evolution. No evidence of recent duplication among JcGRAS genes was observed in physic nut. Based on digital gene expression data, 21 of the 48 genes exhibited differential expression in four tissues analyzed. Two members of subfamily U3 were expressed only in buds and flowers, implying that they may play specific roles. Our results provide valuable resources for future studies on the functions of GRAS proteins in physic nut.
Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying
2017-07-01
Proso millet ( Panicum miliaceum ; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future.
INVENTORY OF THE INVASIVE ALIE N PLANT SPECIES IN INDONESIA
Directory of Open Access Journals (Sweden)
SRI S UDARMIYATI T JITROSOEDIRDJO
2005-01-01
Full Text Available An inventory of the alien plant species in Indone sia based on the existing references and herbarium specimens concluded that 1936 alien plant species ar e found in Indonesia which belong to 187 families. Field studies should be done to get the complete figur es of alien plant species in Indonesia. Based on the existing figures of the plant species, the invasive alien plant species can be iden tified, followed by studies on the assessment of losses, biology, management and their possible utilizations. Alien plant species are imported to Indonesia for cultivation, collection of the botanical garden, as experimental plants or other curiosities. Aside from plants purposely imported, there are also introduced plant propagules conta-minating imported agricultural products. These alien plant species can be beneficial or have a potential of being invasive. The alien cultivated species consisted of 67% of the total number. More than half of the cultivated plants are ornamental plants. Some of th e species are naturalized or escaped from cultivation and become wild and invasive. Some other natura lized species, adapted well without any problems of invasion. There are 339 species or 17% of the species r ecorded as weeds. The highest record of weeds is found in the family of Poaceae (57 species, follo wed by Asteraceae (53 species and Cyperaceae (35 species. There are 6 families having more than 10 species of weeds: Amaranthaceae, Asteraceae, Cyperaceae, Euphorbiaceae, Poaceae, and Rubiaceae. Three families have more than 100 species: Asteraceae 162 species, Poaceae 120 species, and Papillionaceae 103 species. Five species of aquatic and 20 species of terrestrial plants considered as important alien plant species in Indonesia were identified and some of their distributions noted
Nafisi, Saeid; Nezhady, Mohammad Ali Mohammad; Asghari, Mohammad Hossein
2012-12-01
New investigations are in progress to find some alternative treatments for diabetes mellitus. Herbs are some of the interesting medications in this regard. Cynodon dactylon (C.d) is a potential plant to be considered as a new medication. On the other hand, the effect of the Electromagnetic Field (EMF) on bio organisms is becoming clearer. In this study, the effect of C.d, EMF and insulin have been investigated on the diabetic mouse. Diabetes was induced by a combination of ketamine (60 mg/Kg) and xylazine (10 mg/Kg) which induces a sustained hyperglycemia. Mice were divided into 12 groups: 1) control, 2) normal saline, 3 and 4) 50mg/Kg C.d, 5 and 6) 100 mg/Kg C.d, 7) insulin, 8) insulin and C.d, 9) EMF (110 KHz, 700±20 mG), 10) insulin and EMF, 11) EMF plus C.d and 12) insulin plus C.d and EMF. Blood glucose level was measured after 5 and 60 minutes in C.d administrated groups, and 5 minutes in the other groups by a glucometer set. The data were analyzed by ANOVA and different means were compared by Tukey and Bonferroni tests (p<0.05). According to results, both dosages of C.d had significant lowering effect on blood glucose level. The first dose was more effective than the second, and its impact was just like insulin. The 6(th), 9(th) and 10(th) groups were significant, also. However, they did not show a higher effect than insulin or C.d. The application of EMF had a significant effect compared to the second group, but it did not reduce the glucose level to the normal range. The effect of the 8th group was very impressive and the mean glucose levels in this group were lower than the control group. Considering the data, C.d is a good alternative medication for diabetes mellitus.
Directory of Open Access Journals (Sweden)
Melissa C. M. do Couto
2009-06-01
Full Text Available Esse estudo foi realizado no período de julho de 2003 a novembro de 2004, para avaliar o desenvolvimento, a sobrevivência, a migração das larvas infectantes em gramínea "coast cross" (Cynodon dactylon e o horário de maior disponibilidade, em condições de clima tropical, na Baixada Fluminense, RJ, Brasil. De julho de 2003 a setembro de 2004, massas fecais de equinos naturalmente infectados foram depositadas mensalmente sobre a gramínea. Sete dias após, amostras de fezes e gramínea foram coletadas semanalmente em diferentes horários (8, 13 e 17 horas, pesadas e processadas pela técnica de Baermann. O desenvolvimento, a sobrevivência e a migração das larvas infectantes nas fezes e na gramínea foram observados durante todo o período. A sobrevivência das L3 foi de até 15 semanas nas fezes e 12 semanas na gramínea no período seco e de nove e oito semanas, respectivamente, para o período chuvoso. No período chuvoso, maior número de L3 foi recuperado nas fezes e, no período seco, na gramínea. Condições climáticas influenciaram diretamente o número larvas infectantes. Pela análise multivariada, ficou demonstrado uma forte relação entre o tempo e o número de L3 nas fezes, sendo esta relação menos acentuada para a gramínea. Não se observou diferença significativa entre os horários de coleta.A study following the development and migration of Cyathostominae infective larvae was conducted from July 2003 to November 2004 in tropical climate, Baixada Fluminense, RJ, Brazil. Samples of naturally infected feces were placed on 12 m² plot each month on a cyathostomin-free "Bermuda grass" pasture (Cynodon dactylon. After Seven days, samples of feces and grass were collected every week at 8 a.m, 1 and 5 p.m., weighed and processed by Baermann technique. Higher survival of L3 was found at dry season, 15 and 12 weeks on feces and sward respectively, at rainy season the survival was smaller. The multivariable analysis of main
International Nuclear Information System (INIS)
Alonso, R.; Bermejo, V.; Sanz, J.; Valls, B.; Elvira, S.; Gimeno, B.S.
2007-01-01
Intra-genus and intra-specific variation and the influence of nitrogen enrichment on net assimilation and stomatal conductance of some annual Trifolium species of Mediterranean dehesa grasslands were assessed under experimental conditions. Also gas exchange rates were compared between some Leguminosae and Poaceae species growing in the field in a dehesa ecosystem in central Spain. The results showed that the previously reported different O 3 sensitivity of some Trifolium species growing in pots does not seem to be related to different maximum g s values. In addition, no clear differences on gas exchange rates could be attributed to Leguminosae and Poaceae families growing in the field, with intra-genus variation being more important than differences found between families. Further studies are needed to increase the database for developing a flux-based approach for setting O 3 critical levels for semi-natural Mediterranean species. - The stomatal conductance model incorporated within the EMEP DO 3 SE deposition module needs to be re-parameterised for Mediterranean semi-natural vegetation
Illustrated weed flora of cotton crop of khairpur district, sindh, pakistan
International Nuclear Information System (INIS)
Memon, R.A.; Bhatti, G.R.
2014-01-01
A survey was carried out for the composition of weed flora of cotton crop of Khairpur district, Sindh, Pakistan. Thirty six weed species belonging to 16 families were noted. Poaceae was found to be most dominant family representing seven species followed by Asteraceae and Papilionaceae, each with five species. Botanical descriptions and illustrations/line drawings of all the recorded taxa were prepared in order to identify the weed species. (author)
Directory of Open Access Journals (Sweden)
Carnevalli Roberta Aparecida
1999-01-01
Full Text Available Este trabalho consiste na avaliação de uma pastagem tropical Cynodon dactylon, enfocando, principalmente necessidade de adaptação, aferição da precisão e transferência de metodologias comumente utilizadas para plantas de clima temperado. Neste estudo, pôde-se avaliar produção de forragem, composição botânica, crescimento por perfilho e senescência foliar (fluxo e renovação de tecidos e dinâmica populacional de perfilhos (morte, sobrevivência e aparecimento de perfilhos, relacionada com a densidade de perfilhos (números de perfilhos/m2, possibilitando a detecção de falhas e imprecisões nestes métodos quando transferidos de forma direta de comunidades de plantas de clima temperado para plantas de clima tropical. Foram geradas, ainda, equações de calibração, ou seja, relação entre altura e massa de forragem do pasto, as quais sofreram modificações ao longo do ano devido a mudanças, principalmente, na estrutura do pasto.
Chen, Liang; Fan, Jibiao; Hu, Longxing; Hu, Zhengrong; Xie, Yan; Zhang, Yingzi; Lou, Yanhong; Nevo, Eviatar; Fu, Jinmin
2015-09-11
Cold stress is regarded as a key factor limiting widespread use for bermudagrass (Cynodon dactylon). Therefore, to improve cold tolerance for bermudagrass, it is urgent to understand molecular mechanisms of bermudagrass response to cold stress. However, our knowledge about the molecular responses of this species to cold stress is largely unknown. The objective of this study was to characterize the transcriptomic response to low temperature in bermudagrass by using RNA-Seq platform. Ten cDNA libraries were generated from RNA samples of leaves from five different treatments in the cold-resistant (R) and the cold-sensitive (S) genotypes, including 4 °C cold acclimation (CA) for 24 h and 48 h, freezing (-5 °C) treatments for 4 h with or without prior CA, and controls. When subjected to cold acclimation, global gene expressions were initiated more quickly in the R genotype than those in the S genotype. The R genotype activated gene expression more effectively in response to freezing temperature after 48 h CA than the S genotype. The differentially expressed genes were identified as low temperature sensing and signaling-related genes, functional proteins and transcription factors, many of which were specifically or predominantly expressed in the R genotype under cold treatments, implying that these genes play important roles in the enhanced cold hardiness of bermudagrass. KEGG pathway enrichment analysis for DEGs revealed that photosynthesis, nitrogen metabolism and carbon fixation pathways play key roles in bermudagrass response to cold stress. The results of this study may contribute to our understanding the molecular mechanism underlying the responses of bermudagrass to cold stress, and also provide important clues for further study and in-depth characterization of cold-resistance breeding candidate genes in bermudagrass.
7 CFR 201.56-5 - Grass family, Poaceae (Gramineae).
2010-01-01
... ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.56-5 Grass.... During germination the scutellum remains inside the seed to absorb nutrients from the endosperm and... with the endosperm. During germination the scutellum remains inside the seed to absorb nutrients from...
Zheng, Yiqi; Xu, Shaojun; Liu, Jing; Zhao, Yan; Liu, Jianxiu
2017-01-01
Bermudagrass [Cynodon dactylon (L.) Pers.], an important turfgrass used in public parks, home lawns, golf courses and sports fields, is widely distributed in China. In the present study, sequence-related amplified polymorphism (SRAP) markers were used to assess genetic diversity and population structure among 157 indigenous bermudagrass genotypes from 20 provinces in China. The application of 26 SRAP primer pairs produced 340 bands, of which 328 (96.58%) were polymorphic. The polymorphic information content (PIC) ranged from 0.36 to 0.49 with a mean of 0.44. Genetic distance coefficients among accessions ranged from 0.04 to 0.61, with an average of 0.32. The results of STRUCTURE analysis suggested that 157 bermudagrass accessions can be grouped into three subpopulations. Moreover, according to clustering based on the unweighted pair-group method of arithmetic averages (UPGMA), accessions were divided into three major clusters. The UPGMA dendrogram revealed that accessions from identical or adjacent areas were generally, but not entirely, clustered into the same cluster. Comparison of the UPGMA dendrogram and the Bayesian STRUCTURE analysis showed general agreement between the population subdivisions and the genetic relationships among accessions. Principal coordinate analysis (PCoA) with SRAP markers revealed a similar grouping of accessions to the UPGMA dendrogram and STRUCTUE analysis. Analysis of molecular variance (AMOVA) indicated that 18% of total molecular variance was attributed to diversity among subpopulations, while 82% of variance was associated with differences within subpopulations. Our study represents the most comprehensive investigation of the genetic diversity and population structure of bermudagrass in China to date, and provides valuable information for the germplasm collection, genetic improvement, and systematic utilization of bermudagrass.
Directory of Open Access Journals (Sweden)
Marcos R. Furlan
2010-11-01
Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.The essential oil extracted from Cymbopogon citratus (DC Staf, Poaceae, is rich in citral and has many applications in chemical and pharmaceutical industry. The aims of this study were evaluate the amount of citral in populations of C. citratus collected in two different regions (Ibiúna and Pindamonhangaba, São Paulo State. The essential oil extracted of a cultivated population in Pidamonhangaba-SP, showed a high content of citral (approximately 96.0%, while the essential oil from Ibiuna-SP, showed citral and high amounts of another monoterpene, geraniol. Additionally, the essential oils from this population of C. citratus were extracted and analyzed during 24 h (each 3 h, being the major concentration of citral in the night period, indicating that studies which evaluated the chemical differences associated to circadian changes. The components of essential oils were identified through 13C NMR, GC/MS, GC and
Directory of Open Access Journals (Sweden)
Kaijie Xu
2016-03-01
Full Text Available Abstract Switchgrass (Panicum virgatum L.; family Poaceae is a warm-season C4 perennial grass. Tillering plays an important role in determining the morphology of aboveground parts and the final biomass yield of switchgrass. Auxin distribution in plants can affect a variety of important growth and developmental processes, including the regulation of shoot and root branching, plant resistance and biological yield. Auxin transport and gradients in plants are mediated by influx and efflux carriers. PvPIN1, a switchgrass PIN1-like gene that is involved in regulating polar transport, is a putative auxin efflux carrier. Neighbor-joining analysis using sequences deposited in NCBI databases showed that the PvPIN1gene belongs to the PIN1 family and is evolutionarily closer to the Oryza sativa japonica group. Tiller emergence and development was significantly promoted in plants subjected toPvPIN1 RNA interference (RNAi, which yielded a phenotype similar to that of wild-type plants treated with the auxin transport inhibitor TIBA (2,3,5-triiodobenzoic acid. A transgenic approach that inducedPvPIN1 gene overexpression or suppression altered tiller number and the shoot/root ratio. These data suggest that PvPIN1plays an important role in auxin-dependent adventitious root emergence and tillering.
Nisyawati, Aini, R. N.; Silalahi, M.; Purba, E. C.; Avifah, N.
2017-07-01
Research on the local knowledge of food plants used by Karo ethnic in the Semangat Gunung Village, North Sumatra has been done. The aim of this study is to reveal plant species that used by the people of Karo ethnic as food. We used the ethnobotanical approach which included open-ended, semi-structural interview, and exploration method. One eldervillage, 2 traditional healers, and 30 respondents have been selected as sources of information. Descriptive statistics have been used to analyze the gathered data. A number of 109 species which belong to 83 genus and 45 families known to be used as food sources by Karo people. Four families have the highest number of food plant species, which are Solanaceae (8 species), Poaceae (7 species), Fabaceae (6 species), and Zingiberaceae (6 species). All of those families are found in the village, both wild and Cultivated. Solanaceae is used as source of fruits, vegetables, and spices. Poaceae is used as the source of the staple food, alternative food sources, snacks, spices, and traditional foods. Fabaceae is used as source of vegetables and traditional foods. Zingiberaceae is used as source of spices.
7 CFR 201.17 - Noxious-weed seeds in the District of Columbia.
2010-01-01
...), Canada thistle (Cirsium arvense), field bindweed (Convolvulus arvensis), bermudagrass (Cynodon dactylon), giant bermudagrass (Cynodon dactylon var. aridus), annual bluegrass (Poa annua), and wild garlic or wild...
Gnigler, Luciana; Caddah, Mayara
2015-01-01
A floristic survey was carried out in a contact area between Araucaria Forest and Seasonal Forest areas, in the municipality of Guaraciaba, Far West of Santa Catarina state, southern Brazil. We provide a checklist containing 108 species and 42 plant families for the area. Families with the most encountered number of species were Myrtaceae (eight species), Solanaceae (eight), Euphorbiaceae (seven) and Poaceae (six). Two species are classified as endangered of extinction, following IUCN criteri...
Du, Hongmei; Wang, Zhaolong; Yu, Wenjuan; Liu, Yimin; Huang, Bingru
2011-03-01
Differential metabolic responses to heat stress may be associated with variations in heat tolerance between cool-season (C₃) and warm-season (C₄) perennial grass species. The main objective of this study was to identify metabolites associated with differential heat tolerance between C₄ bermudagrass and C₃ Kentucky bluegrass by performing metabolite profile analysis using gas chromatography-mass spectrometry. Plants of Kentucky bluegrass (Poa Pratensis'Midnight') and hybrid bermudagrass (Cynodon transvaalensis x Cynodon dactylon'Tifdwarf') were grown under optimum temperature conditions (20/15 °C for Kentucky bluegrass and 30/25 °C for bermudagrass) or heat stress (35/30 °C for Kentucky bluegrass and 45/40 °C for bermudagrass). Physiological responses to heat stress were evaluated by visual rating of grass quality, measuring photochemical efficiency (variable fluorescence to maximal fluorescence) and electrolyte leakage. All of these parameters indicated that bermudagrass exhibited better heat tolerance than Kentucky bluegrass. The metabolite analysis of leaf polar extracts revealed 36 heat-responsive metabolites identified in both grass species, mainly consisting of organic acids, amino acids, sugars and sugar alcohols. Most metabolites showed higher accumulation in bermudagrass compared with Kentucky bluegrass, especially following long-term (18 days) heat stress. The differentially accumulated metabolites included seven sugars (sucrose, fructose, galactose, floridoside, melibiose, maltose and xylose), a sugar alcohol (inositol), six organic acids (malic acid, citric acid, threonic acid, galacturonic acid, isocitric acid and methyl malonic acid) and nine amino acids (Asn, Ala, Val, Thr, γ-aminobutyric acid, IIe, Gly, Lys and Met). The differential accumulation of those metabolites could be associated with the differential heat tolerance between C₃ Kentucky bluegrass and C₄ bermudagrass. Copyright © Physiologia Plantarum 2010.
Yoshioka, Akira; Takada, Mayura; Washitani, Izumi
2011-10-01
Source populations of polyphagous pests often occur on host plants other than the economically damaged crop. We evaluated the contribution of patches of a non-native meadow grass, Lolium multiflorum Lam. (Poaceae), and other weeds growing in fallow fields or meadows as source hosts of an important native pest of rice, Stenotus rubrovittatus (Matsumura) (Hemiptera: Miridae), in an agricultural landscape of northern Japan. Periodical censuses of this mirid bug by using the sweeping method, vegetation surveys, and statistical analysis revealed that L. multiflorum was the only plant species that was positively correlated with the density of adult S. rubrovittatus through two generations and thus may be the most stable and important host of the mirid bug early in the season before the colonization of rice paddies. The risk and cost of such an indirect negative effect on a crop plant through facilitation of a native pest by a non-native plant in the agricultural landscape should not be overlooked.
Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying
2017-01-01
Premise of the study: Proso millet (Panicum miliaceum; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Methods: Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. Results: In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. Discussion: A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future. PMID:28791202
Linder, H P; Lehmann, Caroline E R; Archibald, Sally; Osborne, Colin P; Richardson, David M
2018-05-01
Poaceae (the grasses) is arguably the most successful plant family, in terms of its global occurrence in (almost) all ecosystems with angiosperms, its ecological dominance in many ecosystems, and high species richness. We suggest that the success of grasses is best understood in context of their capacity to colonize, persist, and transform environments (the "Viking syndrome"). This results from combining effective long-distance dispersal, efficacious establishment biology, ecological flexibility, resilience to disturbance and the capacity to modify environments by changing the nature of fire and mammalian herbivory. We identify a diverse set of functional traits linked to dispersal, establishment and competitive abilities. Enhanced long-distance dispersal is determined by anemochory, epizoochory and endozoochory and is facilitated via the spikelet (and especially the awned lemma) which functions as the dispersal unit. Establishment success could be a consequence of the precocious embryo and large starch reserves, which may underpin the extremely short generation times in grasses. Post-establishment genetic bottlenecks may be mitigated by wind pollination and the widespread occurrence of polyploidy, in combination with gametic self-incompatibility. The ecological competitiveness of grasses is corroborated by their dominance across the range of environmental extremes tolerated by angiosperms, facilitated by both C 3 and C 4 photosynthesis, well-developed frost tolerance in several clades, and a sympodial growth form that enabled the evolution of both annual and long-lived life forms. Finally, absence of investment in wood (except in bamboos), and the presence of persistent buds at or below ground level, provides tolerance of repeated defoliation (whether by fire, frost, drought or herbivores). Biotic modification of environments via feedbacks with herbivory or fire reinforce grass dominance leading to open ecosystems. Grasses can be both palatable and productive
DEFF Research Database (Denmark)
Zhang, Gengyun; Liu, Xin; Quan, Zhiwu
2012-01-01
Foxtail millet (Setaria italica), a member of the Poaceae grass family, is an important food and fodder crop in arid regions and has potential for use as a C(4) biofuel. It is a model system for other biofuel grasses, including switchgrass and pearl millet. We produced a draft genome (∼423 Mb) an...
Directory of Open Access Journals (Sweden)
Bambang Tjahyono Hariadi
2014-06-01
Full Text Available The objective of this experiment was to know carrying capacity of rusa deer (Cervus timorensisi at Mar, Wasur National Park Merauke district. The data collected were spesies of grasses, production each species and carrying capacity. The results showed species of grasses were Cynadon dactylon, Imperata cylindrica and Phragmites karka. Mar was dominated by Cynadon dactylon. The production of Cynodon dactylon was 2.183 kg/ha. The carryng capacity of rusa deer was 0.5 ha/head/year.
Hwang, Sun-Nyoung; Kim, Jae-Cheon; Bhuiyan, Mohammad Iqbal Hossain; Kim, Joo Youn; Yang, Ji Seon; Yoon, Shin Hee; Yoon, Kee Dong; Kim, Seong Yun
2018-04-01
Rice is the most commonly consumed grain in the world. Black rice has been suggested to contain various bioactive compounds including anthocyanin antioxidants. There is currently little information about the nutritional benefits of black rice on brain pathology. Here, we investigated the effects of black rice ( Oryza sativa L ., Poaceae) extract (BRE) on the hippocampal neuronal damage induced by ischemic insult. BRE (300 mg/kg) was orally administered to adult male C57BL/6 mice once a day for 21 days. Bilateral common carotid artery occlusion (BCCAO) was performed for 23 min on the 8th day of BRE or vehicle administration. Histological analyses conducted on the 22nd day of BRE or vehicle administration revealed that administering BRE profoundly attenuated neuronal cell death, inhibited reactive astrogliosis, and prevented loss of glutathione peroxidase expression in the hippocampus when compared to vehicle treatment. In addition, BRE considerably ameliorated BCCAO-induced memory impairment on the Morris water maze test from the 15th day to the 22nd day of BRE or vehicle administration. These results indicate that chronic administration of BRE is potentially beneficial in cerebral ischemia.
Contribution of chloroplast DNA in the biodiversity of some Aegilops ...
African Journals Online (AJOL)
Four Aegilops species (Aegilops longissima, Aegilops speltoides, Aegilops searsii and Aegilops caudata) belonging to the family Poaceae were used in this study. Nucleotides of 1651 bp from 5.8 S rRNA gene and the intergenic spacers trnT-trnL and trnL-trnF from the chloroplast DNA were combined together in order to ...
Lori, M.
2015-05-22
Plant elicitor peptides (Peps) are potent inducers of pattern-triggered immunity and amplify the immune response against diverse pathogens. Peps have been discovered and studied extensively in Arabidopsis and only recently orthologs in maize were also identified and characterized in more detail. Here, the presence of PROPEPs, the Pep precursors, and PEPRs, the Pep receptors, was investigated within the plant kingdom. PROPEPs and PEPRs were identified in most sequenced species of the angiosperms. The conservation and compatibility of the Pep-PEPR-system was analysed by using plants of two distantly related dicot families, Brassicaceae and Solanaceae, and a representative family of monocot plants, the Poaceae. All three plant families contain important crop plants, including maize, rice, tomato, potato, and canola. Peps were not recognized by species outside of their plant family of origin, apparently because of a divergence of the Pep sequences. Three family-specific Pep motifs were defined and the integration of such a motif into the Pep sequence of an unrelated Pep enabled its perception. Transient transformation of Nicotiana benthamiana with the coding sequences of the AtPEPR1 and ZmPEPR1a led to the recognition of Pep peptides of Brassicaceae or Poaceae origin, respectively, and to the proper activation of downstream signalling. It was concluded that signalling machinery downstream of the PEPRs is highly conserved whereas the leucine-rich repeat domains of the PEPRs co-evolved with the Peps, leading to distinct motifs and, with it, interfamily incompatibility.
Directory of Open Access Journals (Sweden)
Juan Ormeño-Núñez
2008-09-01
Full Text Available Two field trials (Los Andes 1998-1999 and Santiago 2004-2005 were carried out to determine growth inhibition of yellow nutsedge (Cyperus esculentus L. and bermudagrass (Cynodon dactylon (L. Pers., growing on the plantation row, by mulch derived from a rye (Secale cereale L. cover crop established between grapevine (Vitis vinifera L. rows on overhead (cv. Flame Seedless and vertical (cv. Cabernet Sauvignon training. Spring mowing of the rye sown in the fall allowed for developing a thick and long lasting mulch along the grape rows. Nutsedge and bermudagrass control was 81 and 82%, respectively, and was more effective than conventional chemical (in the row + mechanical (between rows control. Glyphosate at 2% for nutsedge and 1% for bermudagrass control, applied twice (October and December, was insufficient to control either perennial weed adequately. Total broadleaved and grass/sedge weed control was 67.3 and 43.0% more effective with the rye mulch than with conventional treatments at Los Andes and Santiago, respectively. Perennial weed control levels could be explained as the new foliage of yellow nutsedge and bermudagrass was particularly susceptible to the shading provided by the rye mulch assembled prior to mid spring shoot emergence, and this effect remained active up until the beginning of autumn. The subsequent rye foliage mowing at the vegetative stage fully expressed the allelopathic effect produced by this local rye cultivar. The use of rye cover crop management and mulch could be applied as an effective weed control technique in conventional, as well as organic deciduous tree orchards.En dos ensayos de campo (Los Andes 1998-1999 y Santiago 2004-2005 se determinó el efecto inhibitorio sobre chufa (Cyperus esculentus L. y pasto bermuda (Cynodon dactylon (L. Pers. de residuos de centeno (Secale cereale L. establecido en otoño entre las hileras de vides (Vitis vinifera L. en parronal (cv. Flame Seedless y espaldera (cv. Cabernet Sauvignon
Weckerle, Caroline S; Cabras, Stefano; Castellanos, Maria Eugenia; Leonti, Marco
2011-09-01
We introduce and explain the advantages of the Bayesian approach and exemplify the method with an analysis of the medicinal flora of Campania, Italy. The Bayesian approach is a new method, which allows to compare medicinal floras with the overall flora of a given area and to investigate over- and underused plant families. In contrast to previously used methods (regression analysis and binomial method) it considers the inherent uncertainty around the analyzed data. The medicinal flora with 423 species was compiled based on nine studies on local medicinal plant use in Campania. The total flora comprises 2237 species belonging to 128 families. Statistical analysis was performed with the Bayesian method and the binomial method. An approximated χ(2)-test was used to analyze the relationship between use categories and higher taxonomic groups. Among the larger plant families we find the Lamiaceae, Rosaceae, and Malvaceae, to be overused in the local medicine of Campania and the Orchidaceae, Caryophyllaceae, Poaceae, and Fabaceae to be underused compared to the overall flora. Furthermore, do specific medicinal uses tend to be correlated with taxonomic plant groups. For example, are the Monocots heavily used for urological complaints. Testing for over- and underused taxonomic groups of a flora with the Bayesian method is easy to adopt and can readily be calculated in excel spreadsheets using the excel function Inverse beta (INV.BETA). In contrast to the binomial method the presented method is also suitable for small datasets. With larger datasets the two methods tend to converge. However, results are generally more conservative with the Bayesian method pointing out fewer families as over- or underused. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011 ... grasses) contribute more food seeds than any other plant family; it contributes about 50% per capita energy ...
Directory of Open Access Journals (Sweden)
Hai Du
Full Text Available Cytochrome P450 93 family (CYP93 belonging to the cytochrome P450 superfamily plays important roles in diverse plant processes. However, no previous studies have investigated the evolution and expression of the members of this family. In this study, we performed comprehensive genome-wide analysis to identify CYP93 genes in 60 green plants. In all, 214 CYP93 proteins were identified; they were specifically found in flowering plants and could be classified into ten subfamilies-CYP93A-K, with the last two being identified first. CYP93A is the ancestor that was derived in flowering plants, and the remaining showed lineage-specific distribution-CYP93B and CYP93C are present in dicots; CYP93F is distributed only in Poaceae; CYP93G and CYP93J are monocot-specific; CYP93E is unique to legumes; CYP93H and CYP93K are only found in Aquilegia coerulea, and CYP93D is Brassicaceae-specific. Each subfamily generally has conserved gene numbers, structures, and characteristics, indicating functional conservation during evolution. Synonymous nucleotide substitution (dN/dS analysis showed that CYP93 genes are under strong negative selection. Comparative expression analyses of CYP93 genes in dicots and monocots revealed that they are preferentially expressed in the roots and tend to be induced by biotic and/or abiotic stresses, in accordance with their well-known functions in plant secondary biosynthesis.
Biomass yield from an urban landscape
Utilizing biomass from urban landscapes could significantly contribute to the nation’s renewable energy needs. In 2007, an experiment was begun to evaluate the biomass production from a bermudagrass, Cynodon dactylon var. dactylon (L.) Pers., lawn in Woodward, Oklahoma and to estimate the potential...
Directory of Open Access Journals (Sweden)
Łopieńska-Biernat Elżbieta
2017-06-01
Full Text Available Plants adapt to extremely low temperatures in polar regions by maximizing their photosynthetic efficiency and accumulating cryoprotective and osmoprotective compounds. Flowering plants of the family Poaceae growing in the Arctic and in the Antarctic were investigated. Their responses to cold stress were analyzed under laboratory conditions. Samples were collected after 24 h and 48 h of cold treatment. Quantitative and qualitative changes of sugars are found among different species, but they can differ within a genus of the family Poaceae. The values of the investigated parameters in Poa annua differed considerably depending to the biogeographic origin of plants. At the beginning of the experiment, Antarctic plants were acclimatized in greenhouse characterized by significantly higher content of sugars, including storage reserves, sucrose and starch, but lower total protein content. After 24 h of exposure to cold stress, much smaller changes in the examined parameters were noted in Antarctic plants than in locally grown specimens. Total sugar content and sucrose, starch and glucose levels were nearly constant in P. annua, but they varied significantly. Those changes are responsible for the high adaptability of P. annua to survive and develop in highly unsupportive environments and colonize new regions.
Devis, Deborah L; Davies, Janet M; Zhang, Dabing
2017-09-01
Allergic diseases are characterized by elevated allergen-specific IgE and excessive inflammatory cell responses. Among the reported plant allergens, grass pollen and grain allergens, derived from agriculturally important members of the Poaceae family such as rice, wheat and barley, are the most dominant and difficult to prevent. Although many allergen homologs have been predicted from species such as wheat and timothy grass, fundamental aspects such as the evolution and function of plant pollen allergens remain largely unclear. With the development of genetic engineering and genomics, more primary sequences, functions and structures of plant allergens have been uncovered, and molecular component-based allergen-specific immunotherapies are being developed. In this review, we aim to provide an update on (i) the distribution and importance of pollen and grain allergens of the Poaceae family, (ii) the origin and evolution, and functional aspects of plant pollen allergens, (iii) developments of allergen-specific immunotherapy for pollen allergy using biotechnology and (iv) development of less allergenic plants using gene engineering techniques. We also discuss future trends in revealing fundamental aspects of grass pollen allergens and possible biotechnological approaches to reduce the amount of pollen allergens in grasses. Copyright © 2017. Published by Elsevier Inc.
International Nuclear Information System (INIS)
Hussain, F.; Shah, S.M.; Badshahi, L.; Durrani, M.J.
2015-01-01
This study revealed that the floristic diversity consisted of 571 species belonging to 82 families including 65 dicots, 13 monocots, 2 gymnosperms and 2 pteridophyte families. There were 334 genera including 3 Pteridophytes, 2 gymnosperms, 54 monocot and 275 dicot genera. Asteraceae (91 Spp., 15.95 %), Poaceae (58 Spp., 10.16 %), Papilionaceae (38 Spp., 6.65 %), Lamiaceae and Rosaceae (each with 26 Spp., 4.55 %), Polygonaceae (25 spp; 4.38), Caryophyllaceae (23 spp.; 4.03%), Apiaceae (21 Spp., 3.68 %), Boraginaceae and Brassicaceae (20 Spp., each with 3.50 %) were the leading families. There were 45 (13.47%), 32 (9.58%), 19 (5.69%), 18 (5.39%) and 16 (4.79%) genera respectively in Asteraceae, Poaceae, Brassicaceae, Apiaceae and Papilionaceae. Flora consisted of 91.59% wild species, 92.64% deciduous species, 92.12% nonspiny species, 80.04% mesophytes and 94.57% heliophytes. Biological spectrum was dominated by therophytes (234 spp., 40.98%), followed by hemicryptophytes (154 spp., 26.97%), geophytes (82 spp., 14.36%), chamaephytes (44 spp., 7.71%), nanophanerophytes (31 spp, 5.43%) and megaphanerophytes (24 spp., 4.20%). The leaf size spectra was dominated by nanophylls (40.98%), leptophylls (24.87%), mesophylls 18.56%) and microphylls (9.11%). Further plant exploration is suggested in this remote inaccessible valley in the Hindukush Range, Pakistan. (author)
Residual value analyses of the medicinal flora of the western himalayas: the Naran valley, Pakistan
International Nuclear Information System (INIS)
Khan, S.M.; Harper, D.; Page, S.; Ahmad, H.
2011-01-01
Statistical analyses of the medicinal flora of the Naran Valley in the Western Himalayas were performed using Moerman's methods and Principal Components Analysis (PCA). The results demonstrate that the valley's indigenous people utilize medicinal plants in a systematic way. Sixty-eight families of plants were identified during the study, of which 52 contained one or more species of medicinal value. The standard deviation for residual values of all the 68 families was 0.993 and the results of the residual analysis revealed that seven of these plant families were overused by the local people, indicated by residual values greater than the standard deviation. Residual values obtained from a regression analysis of plant species with their medicinal uses showed that the families with the highest rank were Polygonaceae, Gentianaceae, Lamiaceae, Rosaceae and Plantaginaceae, indicating their medicinal importance. By comparison, Poaceae, Boraginaceae, Primulaceae, Salicaceae, and Ranunculaceae were the lowest ranking families, containing few species of medicinal value. Although a few of the most species-rich families in the valley contained a high number of medicinal plants and hence displayed high residual values, some other species-rich families contained few or no species of medicinal value. For example, the third largest family, Poaceae, is the lowest in terms of its residual value, while the largest family, Asteraceae, contains only seven species noted as having medicinal uses. Sixteen plant families in the valley contained no species with reported medicinal use, while seven families contained only one species with medicinal value. In contrast, all of the species in several of the least species-rich families were recorded as having a medicinal use. The results of a Principal Components Analysis showed a gradient of medicinal plant use along the valley. Using robust statistical approaches, our study provides a clear indication that the indigenous people of this Western
Phytosociological Survey on the Central Coastal Lowlands of Eastern Saudi Arabia
International Nuclear Information System (INIS)
Farghali, Kotb Amer; Zareh, Moumn Mustafa
2005-01-01
The vegetation composition of the central coastal low lands of Eastern Saudi Arabia was analyzed. The appearance and distribution of the studied plant groupings were affected by atmospheric, by edaphic conditions as well as topography. Eighty seven species belonging to (33) families of flowering plants were recorded in the following seven plant communities which are dominated and co-dominated by (Zygophyllum qatarense), (Lasiurus scindicus and Lycium shawii), (Alhagi graecorum and Cynodon dactylon), (Phoenix dactelifera and Tamarix aphylla),(Aeluropuslagopoides and Sporobolous ioclados), ( Halocnemum strobilacium and Arthrocenemum macrostachyum) and (Avicennia marina). (author)
Directory of Open Access Journals (Sweden)
Qingshui Ren
2018-05-01
Full Text Available Soil enzymes and microbes are central to the decomposition of plant and microbial detritus, and play important roles in carbon, nitrogen, and phosphorus biogeochemistry cycling at the ecosystem level. In the present study, we characterized the soil enzyme activity and microbial biomass in revegetated (with Taxodium distichum (L. Rich. and Cynodon dactylon (L. Pers. versus unplanted soil in the riparian zone of the Three Gorges Dam Reservoir (TGDR, in order to quantify the effect of revegetation on the edaphic microenvironment after water flooding in situ. After revegetation, the soil physical and chemical properties in revegetated soil showed significant differences to those in unplanted soil. The microbial biomass carbon and phosphorus in soils of T. distichum were significantly higher than those in C. dactylon and unplanted soils, respectively. The microbial biomass nitrogen in revegetated T. distichum and C. dactylon soils was significantly increased by 273% and 203%, respectively. The enzyme activities of T. distichum and C. dactylon soils displayed no significant difference between each other, but exhibited a great increase compared to those of the unplanted soil. Elements ratio (except C/N (S did not vary significantly between T. distichum and C. dactylon soils; meanwhile, a strong community-level elemental homeostasis in the revegetated soils was found. The correlation analyses demonstrated that only microbial biomass carbon and phosphorus had a significantly positive relationship with soil enzyme activities. After revegetation, both soil enzyme activities and microbial biomasses were relatively stable in the T. distichum and C. dactylon soils, with the wooded soil being more superior. The higher enzyme activities and microbial biomasses demonstrate the C, N, and P cycling and the maintenance of soil quality in the riparian zone of the TGDR.
Sapkota, Sirjan; Conner, Joann A.; Hanna, Wayne W.; Simon, Bindu; Fengler, Kevin; Deschamps, St?phane; Cigan, Mark; Ozias-Akins, Peggy
2016-01-01
Apomixis, or clonal propagation through seed, is a trait identified within multiple species of the grass family (Poaceae). The genetic locus controlling apomixis in Pennisetum squamulatum (syn Cenchrus squamulatus) and Cenchrus ciliaris (syn Pennisetum ciliare, buffelgrass) is the apospory-specific genomic region (ASGR). Previously, the ASGR was shown to be highly conserved but inverted in marker order between P. squamulatum and C. ciliaris based on fluorescence in situ hybridization (FISH) a...
Magnano, Andrea L.; Nanni, Analía S.; Krug, Pamela; Astrada, Elizabeth; Vicari, Ricardo; Quintana, Rubén D.
2018-01-01
In Argentina, the intensification of soybean production has displaced a substantial proportion of cattle ranching to fluvial wetlands such as those in the Delta of the Paraná River. Cattle grazing affects structure and dynamics of native forage plants but there is little information on this impact in populations from fluvial wetlands. This study addresses the effect of cattle ranching on density, survival, mean life-span and aerial biomass of Hymenachne pernambucense (Poaceae), an important forage species in the region. The study was carried out monthly for one year in permanents plots subject to continuous grazing and plots excluded from grazing in the Middle Delta of the Paraná River. In plots excluded from grazing, tillers showed significantly higher population density and survival, and a two-fold increase in mean life-span, while continuous grazing decreased survival of cohorts. The largest contribution to tiller density in ungrazed and grazed populations was made by spring and summer cohorts, respectively. Total and green biomass were significantly higher in the ungrazed population, with highest differences in late spring-early summer. Cattle grazing affected the relationship between tiller density and green biomass suggesting that cattle prefer sprouts because they are more palatable and nutritious than older tissue.
Hydrocarbon phytoremediation in the family Fabaceae--a review.
Hall, Jessica; Soole, Kathleen; Bentham, Richard
2011-04-01
Currently, studies often focus on the use of Poaceae species (grasses) for phytoremediation of hydrocarbon-contaminated soils. Research into the use of Fabaceae species (legumes) to remediate hydrocarbons in soils has been conducted, but these plants are commonly overlooked due to slower recorded rates of degradation compared with many grass species. Evidence in the literature suggests that in some cases Fabaceae species may increase total degradation of hydrocarbons and stimulate degradative capacity of the soil microbial community, particularly for contaminants which are normally more recalcitrant to degradation. As many recalcitrant hydrocarbons have negative impacts on human and ecosystem health, development of remediation options is crucial. Reconsideration of Fabaceae species for removal of such contaminants may lead to environmentally and economically sustainable technologies for remediation of contaminated sites.
The influence of land use on soil organic carbon and nitrogen content and redox potential
DEFF Research Database (Denmark)
Kusliene, Gedrime
2010-01-01
different farming systems (conventional and organic) as well as abandoned lands. We choose the plants of two botanical species (Poaceae and Fabaceae) in organic and conventional farming systems as well as abandoned lands. Experimental results show that the best soil organic matter status according...... to the investigated indexes is in the soils of conventional and orgaic farming systems occupied with mixtures of Poaceae and Fabaceae and the worst - in the soils of abandoned Poaceae meadowa. In the abandoned lands, Fabaceae (galega) had better influence on soil organic matter status than Poaceae....
Directory of Open Access Journals (Sweden)
Lorelys Valerio González
2018-05-01
Full Text Available With the purpose to make a floristic inventory of El Morro Lagoon, which is a protected area of Margarita Island, three zones were sampled with transects bordering the lagoon, between the months March and May and from October to December 2008. At least, 98 species were recorded, distributed in 43 families. The best represented families were Poaceae, Fabaceae and Euphorbiaceae. Mangrove is the dominating biotope, mainly Avicennia germinans (L. L. and Laguncularia racemosa (L. C. F. Gaertn. The alteration of flora could be related to anthropogenic activities, such as urbanism, informal economy and local tourism.
Floristic diversity in bashemsin valley of kackar mountains national park of rize, turkey
International Nuclear Information System (INIS)
Baykal, H.
2016-01-01
The floristical structure of Bashemsin and its environs as a protected and isolated area within Kackar Mountains National Park, situated in Rize, a province in the Blacksea region of Turkey, is studied. 1830 plant specimens were collected and 503 taxa were identified in 234 genera and 75 families. Sixteen Pteridophytes and 487 Spermatophytes were determined. Two of Spermatophytes are Gymnospermae while 485 of them are Angiospermae (98 Monocotyledones and 389 Dicotyledones). The richest families in taxa are Asteraceae, Poaceae, Brassicaceae, and Fabaceae (55 Asteraceae, 49 Poaceae, 28 Brassicaceae, and 27 Fabaceae). Phytogeographic elements are listed in order as: Euro-Siberian 247 (49.1%), Irano-Turanian 17 (3.4%), Mediterranean 6 (1.2%), multiregional-unknown phytogeographic root 233 (46.3%). Hemicryptophytes are the richest with 224 (44.5%) taxa and it is followed by cryptophytes 144 (28.6%), therophytes 53 (10.5%), chamaephytes 59 (11.7%), phanerophytes 19 (3.8%), vasicular parasites 2 (0.4%), nanophanerophytes/chamaephytes 1 (0.2%) and hydrophytes 1 (0.2%). 34 endemic taxa were determined (6.7%). 13 threatened taxa were detected in the research area and we determined that Sorbus caucasica Zinserl. var. yaltirikii Goksin population has fallen into CR endangered category with only 2 individuals in the study area. (author)
Ma, Peng-Fei; Zhang, Yu-Xiao; Zeng, Chun-Xia; Guo, Zhen-Hua; Li, De-Zhu
2014-11-01
The temperate woody bamboos constitute a distinct tribe Arundinarieae (Poaceae: Bambusoideae) with high species diversity. Estimating phylogenetic relationships among the 11 major lineages of Arundinarieae has been particularly difficult, owing to a possible rapid radiation and the extremely low rate of sequence divergence. Here, we explore the use of chloroplast genome sequencing for phylogenetic inference. We sampled 25 species (22 temperate bamboos and 3 outgroups) for the complete genome representing eight major lineages of Arundinarieae in an attempt to resolve backbone relationships. Phylogenetic analyses of coding versus noncoding sequences, and of different regions of the genome (large single copy and small single copy, and inverted repeat regions) yielded no well-supported contradicting topologies but potential incongruence was found between the coding and noncoding sequences. The use of various data partitioning schemes in analysis of the complete sequences resulted in nearly identical topologies and node support values, although the partitioning schemes were decisively different from each other as to the fit to the data. Our full genomic data set substantially increased resolution along the backbone and provided strong support for most relationships despite the very short internodes and long branches in the tree. The inferred relationships were also robust to potential confounding factors (e.g., long-branch attraction) and received support from independent indels in the genome. We then added taxa from the three Arundinarieae lineages that were not included in the full-genome data set; each of these were sampled for more than 50% genome sequences. The resulting trees not only corroborated the reconstructed deep-level relationships but also largely resolved the phylogenetic placements of these three additional lineages. Furthermore, adding 129 additional taxa sampled for only eight chloroplast loci to the combined data set yielded almost identical
Łopieńska-Biernat Elżbieta; Pastorczyk Marta; Giełwanowska Irena; Żółtowska Krystyna; Stryiński Robert; Zaobidna Ewa
2017-01-01
Plants adapt to extremely low temperatures in polar regions by maximizing their photosynthetic efficiency and accumulating cryoprotective and osmoprotective compounds. Flowering plants of the family Poaceae growing in the Arctic and in the Antarctic were investigated. Their responses to cold stress were analyzed under laboratory conditions. Samples were collected after 24 h and 48 h of cold treatment. Quantitative and qualitative changes of sugars are found among different species, but they c...
Pushing the boundaries of resistance: insights from Brachypodium-rust interactions
Figueroa, Melania; Castell-Miller, Claudia V.; Li, Feng; Hulbert, Scot H.; Bradeen, James M.
2015-01-01
The implications of global population growth urge transformation of current food and bioenergy production systems to sustainability. Members of the family Poaceae are of particular importance both in food security and for their applications as biofuel substrates. For centuries, rust fungi have threatened the production of valuable crops such as wheat, barley, oat, and other small grains; similarly, biofuel crops can also be susceptible to these pathogens. Emerging rust pathogenic races with i...
A maize resistance gene functions against bacterial streak disease in rice
Zhao, Bingyu; Lin, Xinghua; Poland, Jesse; Trick, Harold; Leach, Jan; Hulbert, Scot
2005-01-01
Although cereal crops all belong to the grass family (Poacea), most of their diseases are specific to a particular species. Thus, a given cereal species is typically resistant to diseases of other grasses, and this nonhost resistance is generally stable. To determine the feasibility of transferring nonhost resistance genes (R genes) between distantly related grasses to control specific diseases, we identified a maize R gene that recognizes a rice pathogen, Xanthomonas oryzae pv. oryzicola, wh...
Directory of Open Access Journals (Sweden)
Ryan Dierking
2015-03-01
Full Text Available Temperate grasses belonging to the complex are important throughout the world in pasture and grassland agriculture. Tall fescue ( Schreb. is the predominant species in the United States, covering approximately 15 million ha. Tall fescue has distinctive morphotypes, two of which are Continental (summer active and Mediterranean (summer semidormant. This is the first report of a linkage map created for Mediterranean tall fescue, while updating the Continental map with additional simple sequence repeat and sequence-tagged site markers. Additionally, this is the first time that diversity arrays technology (DArT markers were used in the construction of a tall fescue map. The male parent (Continental, R43-64, map consisted of 594 markers arranged in 22 linkage groups (LGs and covered a total of 1577 cM. The female parent (Mediterranean, 103-2, map was shorter (1258 cM and consisted of only 208 markers arranged in 29 LGs. Marker densities for R43-64 and 103-2 were 2.65 and 6.08 cM per marker, respectively. When compared with the other Poaceae species, meadow fescue ( Huds., annual ryegrass ( Lam., perennial ryegrass ( L., (L. Beauv., and barley ( L., a total of 171 and 98 orthologous or homologous sequences, identified by DArT analysis, were identified in R43-64 and 103-2, respectively. By using genomic in situ hybridization, we aimed to identify potential progenitors of both morphotypes. However, no clear conclusion on genomic constitution was reached. These maps will aid in the search for quantitative trait loci of various traits as well as help define and distinguish genetic differences between the two morphotypes.
Ecological Genetics of Vernalization Response in Bromus tectorum L. (Poaceae)
MEYER, SUSAN E.; NELSON, DAVID L.; CARLSON, STEPHANIE L.
2004-01-01
• Background and Aims Bromus tectorum (cheatgrass or downy brome) is an exotic annual grass that is dominant over large areas of former shrubland in western North America. To flower in time for seed production in early summer, B. tectorum plants generally require vernalization at winter temperatures, either as imbibed seeds or as established seedlings. • Methods Variation in response to increasing periods of vernalization as seeds or seedlings for progeny of ten full‐sib families from each of four B. tectorum populations from contrasting habitats was studied. • Key Results As vernalization was increased from 0 to 10 weeks, the proportion of plants flowering within 20 weeks increased, weeks to initiation of flowering decreased, and seed yield per plant increased, regardless of whether plants were vernalized as seeds or seedlings. Most of the variation was accounted for by differences among populations. Plants of the warm desert population flowered promptly even without vernalization, while those of the cold desert, foothill and montane populations showed incremental changes in response variables as a function of vernalization period. Populations differed in among‐family variance, with the warm desert population generally showing the least variance and the cold desert population the most. Variation among populations and among families within populations decreased as vernalization period increased, whereas the non‐genetic component of variance showed no such pattern. • Conclusions Variation in vernalization response was found to be adaptively significant and apparently represents the result of contrasting selection regimes on a range of founder genotypes. PMID:15087300
Marshall, Christopher Scott
2007-01-01
An active football season during the fall acclimation period tests the traffic tolerance of bermudagrass. Exogenous applications of synthetic cytokinins or cytokinin-enhancing plant growth regulators (PGRs), such as trinexapac-ethyl, may improve the traffic tolerance of "Patriot" and "Tifsport" hybrid berudagrasses (Cynodon dactylon var. dactylon x Cynodon transvaalensis). This study was designed to mimic the agronomic practices and traffic stresses experienced at Virginia Tech's Worsham Fiel...
USE OF ELEUSINE INDICA (L. GAERTN. (KECHILA GHAS AS AN ANTIPYRETIC MEDICINE OF HERBIVORES
Directory of Open Access Journals (Sweden)
Shibabrata Pattanayak
2017-06-01
Full Text Available In Murshidabad district of West Bengal state, India, the traditionally animal rearing people feed parts of Kechila ghas as an antipyretic medicine to their herbivorous animals. The plant is identified as Eleusine indica (L. Gaertn. of the family Poaceae. After collection from the soil, the plants are washed and the whole root along with 1-2 centimeter of stems are cut and fed directly at fresh, succulent stage to the ailing animals for that purpose.
Phytochemical profile of sugarcane and its potential health aspects
Singh, Amandeep; Lal, Uma Ranjan; Mukhtar, Hayat Muhammad; Singh, Prabh Simran; Shah, Gagan; Dhawan, Ravi Kumar
2015-01-01
Sugarcane (Saccharum officinarum Linn.) is an important perennial grass of Poaceae family, indigenous to tropical South Asia and Southeast Asia. It is cultivated worldwide due to the economical and medicinal value of its high yielding products. Sugarcane juice is well known as a raw material for the production of refined sugar and its wax is considered as a potential substitute for the expensive carnauba wax, which is of cosmetic and pharmaceutical interest. Refined sugar is the primary produ...
Living life the natural way – Wheatgrass and Health
Jaspreet Kaur Kamboj; Satyavati Rana; Vandana Gandhi
2011-01-01
Abstract:The Human diet is enriched with young parts of plants (so called ―green foods‖), which can improve nutrient balance intake in natural way. Wheatgrass (Triticum aestivum) refers to young grass of the common wheat plant, which belongs to Poaceae family. This is the most commonly found herb in India, although its nativity is currently unknown. This plant is believed to have many nutritional values; it has been shown to have anti-inflammatory, antioxidant, anticarcinogenic, immunomodul...
Aurora Armienta, M.; Beltrán-Villavicencio, Margarita; Ruiz-Villalobos, Carlos E.; Labastida, Israel; Ceniceros, Nora; Cruz, Olivia; Aguayo, Alejandra
2017-04-01
Green house experiments were carried out to evaluate the growth and Sb assimilation of a grass assemblage: Faestuca Rubra, Cynodon Dactylon, Lolium Multiflorum and Pennisetum sp, in tailings and Sb-rich soils. Tailings and soil samples were obtained at the Mexican historical mining zone of Zimapán, Central México. More than 6 tailings impoundments are located at the town outskirts and constitute a contamination source from windblown and waterborne deposit on soils, besides acid mine drainage. Four substrates were used in the experiments: 100% tailings, 20% tailings + 80% soil, 50% tailings + 50% soil , and a soil sample far from tailings as a background. Concentrations of Sb ranged from 310 mg/kg to 413 mg/kg in tailings. A pH of 7.43, 1.27% organic matter, and high concentrations of N, K and P indicated adequate conditions for plant growth. The grass assemblage was raised during 21 days as indicated by OECD (Organisation for Economic Co-operation and Development) Guideline 208 Terrestrial Plant Test: Seedling Emergence and Seedling Growth Test. The highest Sb concentrations were measured in plants grown on tailings with 139 mg/kg in the aerial part and 883 mg/kg in roots. Concentrations of Sb decreased as the proportion of tailings diminished with 22.1 mg/kg in the aerial part and 10 mg/kg in roots corresponding to the plants grown in the 20 % tailings + 80% soil . Bioaccumulation (BAC) and bioconcentration factors (BF) of plants grown on tailings (BAC= 0.42, BCF=3.93) indicated their suitability as a phyto-stabilization option. The grass mixture may be thus applied to control windblown particulate tailings taking advantage to their tolerance to high Sb levels.
Reasor, Eric H; Brosnan, James T; Staton, Margaret E; Lane, Thomas; Trigiano, Robert N; Wadl, Phillip A; Conner, Joann A; Schwartz, Brian M
2018-01-01
Interspecific hybrid bermudagrass [ Cynodon dactylon (L.) Pers. x C. transvaalensis Burtt-Davy] is one of the most widely used grasses on golf courses, with cultivars derived from 'Tifgreen' or 'Tifdwarf' particularly used for putting greens. Many bermudagrass cultivars established for putting greens can be genetically unstable and lead to the occurrence of undesirable off-type grasses that vary in phenotype. The objective of this research was to genetically and phenotypically differentiate off-type grasses and hybrid cultivars. Beginning in 2013, off-type and desirable hybrid bermudagrass samples were collected from golf course putting greens in the southeastern United States and genetically and phenotypically characterized using genotyping-by-sequencing and morphology. Genotyping-by-sequencing determined that 11% (5) of off-type and desirable samples from putting greens were genetically divergent from standard cultivars such as Champion, MiniVerde, Tifdwarf, TifEagle, and Tifgreen. In addition, genotyping-by-sequencing was unable to genetically distinguish all standard cultivars from one another due to their similar origin and clonal propagation; however, over 90,000 potentially informative nucleotide variants were identified among the triploid hybrid cultivars. Although few genetic differences were found in this research, samples harvested from golf course putting greens had variable morphology and were clustered into three distinct phenotypic groups. The majority of off-type grasses in hybrid bermudagrass putting greens were genetically similar with variable morphological traits. Off-type grasses within golf course putting greens have the potential to compromise putting surface functionality and aesthetics.
Mustapha, Hassana Ibrahim; van Bruggen, J J A; Lens, P N L
2018-01-02
This study examined the performance of pilot-scale vertical subsurface flow constructed wetlands (VSF-CWs) planted with three indigenous plants, i.e. Typha latifolia, Cyperus alternifolius, and Cynodon dactylon, in removing heavy metals from secondary treated refinery wastewater under tropical conditions. The T. latifolia-planted VSF-CW had the best heavy metal removal performance, followed by the Cyperus alternifolius-planted VSF-CW and then the Cynodon dactylon-planted VSF-CW. The data indicated that Cu, Cr, Zn, Pb, Cd, and Fe were accumulated in the plants at all the three VSF-CWs. However, the accumulation of the heavy metals in the plants accounted for only a rather small fraction (0.09-16%) of the overall heavy metal removal by the wetlands. The plant roots accumulated the highest amount of heavy metals, followed by the leaves, and then the stem. Cr and Fe were mainly retained in the roots of T. latifolia, Cyperus alternifolius, and Cynodon dactylon (TF < 1), meaning that Cr and Fe were only partially transported to the leaves of these plants. This study showed that VSF-CWs planted with T. latifolia, Cyperus Alternifolius, and Cynodon dactylon can be used for the large-scale removal of heavy metals from secondary refinery wastewater.
histone H3 predominantly mark the pericentromeric chromatin
Indian Academy of Sciences (India)
SANTOSH KUMAR SHARMA
pericentromeric chromatin during mitosis in monokinetic plants. J. Genet. .... bigger), cytological preparations (easy to difficult) as well as their habitat ... Poaceae. Monocot. Land. 14. Triticum aestivum. Common wheat. Poaceae. Monocot. Land.
International Nuclear Information System (INIS)
Urooj, R.; Ahmad, S. S.; Ahmad, M. N.; Ahmad, H.; Nawaz, M.
2016-01-01
Present study was conducted at Mangla Dam for vegetation ordinal classification by applying multivariate analysis in order to find relationship between vegetation and their edaphic factors. Samples of soil and herbaceous vegetation were randomly collected by using 1*1 square meter quadrats. Total 37 plant species belonging to 17 families were identified. Canonical Correspondence Analysis as direct ordination technique was applied by using CANOCO software. Results of analytical tests revealed that concentration of micro and macro nutrients along electrical conductivity and pH in different soil samples were varying to a greater level in study area while Cynodon dactylon showed higher abundance over broad range of all edaphic factors concentration. (author)
The effect of geographical and climatic properties on grass pollen and Phl p 5 allergen release
Alan, Şenol; Şahin, Aydan Acar; Sarışahin, Tuğba; Şahin, Serap; Kaplan, Ayşe; Pınar, Nur Münevver
2018-04-01
The Poaceae family, including grasses, comprises several cosmopolitan and allergenic species. The aim of this study was to determine the correlations between Poaceae pollen and Phl p 5 allergen concentrations in two cities with different geographical and climatic properties in Turkey. Pollen were collected from Burkard traps in Ankara and Zonguldak. Phl p 5 sampling was carried out between March and October in both 2015 and 2016 using a BGI900 Cascade High Volume Air Sampler (900 L/min.). The concentrations of Phl p 5 were measured by the enzyme-linked immunosorbent assay (ELISA) technique. The annual sum of Poaceae pollen (pollen index) during 2015-2016 was 5454 in Ankara and 4142 in Zonguldak. The total Phl p 5 concentration was 1309 pg/m3 in Zonguldak, whereas it was 8181 pg/m3 in Ankara over 2 years. About 90% of the allergen was found in the fraction with particulate matter (PM) > 10 μm in both cities. It was found that the main meteorological parameter which affected pollen and Phl p 5 was temperature in both stations. Rainfall was also found to be important for Zonguldak, due to its climatic and geographic properties. Lastly, we suggest that the primary wind direction, which is from the south of Zonguldak, could have a `drift effect' for allergens because of the airborne pollen concentrations and the dates on which the allergen is released into the atmosphere. The wind direction may be an important factor in the distribution of allergen and pollen grains in stations, especially those with a hilly topography.
Directory of Open Access Journals (Sweden)
Dorin Rechiţean
2011-10-01
Full Text Available The researches carried out between the altitude levels of 236 and 1300 m, in 13 localities from Banat Mountains, proved the influence exerted by stationary natural conditions on the botanic diversity of the vegetal cover. From one vegetal association to another, the total number of botanic species ranged between 9 and 21; the biggest number of species was recorded between 236 – 630 m altitude, and the smallest one between 462 – 650 m. The mean coverage degree of these species was 42.69% in the species belonging to the Poaceae Family (with a variation of 30-70% and 12.85% in the species belonging to the Fabaceae Family (variation of 25-65%.
Floristic diversity of 'Chinarite' protected area – Rodopi municipality, Bulgaria
Directory of Open Access Journals (Sweden)
L. Dospatliev
2017-06-01
Full Text Available Abstract. Study on the species composition of vascular plants in 'Chinarite' protected area in Belashtitsa village, Rodopi Municipality, Bulgaria was conducted using the floristic analysis method. A total of 147 species of vascular plants were identified, belonging to 124 genera and 51 families. The families Poaceae, Asteraceae, Lamiaceae, Brassicaceae, Apiaceae, Rosaceae and Fabaceae are the most highly represented. The comparative analysis shows that the angiosperm taxa are dominating in the studied area. Dicotyledonous plants are prevailing among them, while monocotyledonous are significantly less in number. Molinia caerulea species, identified in the present study, has not been reported to have been found so far in the Thracian lowland floristic region.
Flora of the city of Podgorica, Montenegro: Taxonomic analysis
Directory of Open Access Journals (Sweden)
Stešević Danijela
2008-01-01
Full Text Available In this paper we present the taxonomic segment of a floristic study undertaken in the city of Podgorica in the period of 2002-2007. The check-list of spontaneously growing vascular plants includes 1227 species and subspecies belonging to 545 genera and 118 families. The dominant families are Poaceae (11.7%, asteraceae (11.2% and Fabaceae (9.2%. The most abundant genera are Trifolium (2.1%, Euphorbia (1.5%, Carex (1.5%, Bromus (1.3% and Vicia (1.2%. Analysis of the flora of Podgorica in comparison with some other european cities showed that the flora of Podgorica is most similar to that of Rome (Q/S= 0,7.
Family Structure and Family Processes in Mexican American Families
Zeiders, Katharine H.; Roosa, Mark W.; Tein, Jenn-Yun
2011-01-01
Despite increases in single-parent families among Mexican Americans (MA), few studies have examined the association of family structure and family adjustment. Utilizing a diverse sample of 738 Mexican American families (21.7% single parent), the current study examined differences across family structure on early adolescent outcomes, family functioning, and parent-child relationship variables. Results revealed that early adolescents in single parent families reported greater school misconduct,...
Utami, Rini
2011-01-01
Black sticky rice (Oryza sativa L.) belongs to Poaceae family which is used by people as food stuffs such as tape and porridge. Black sticky rice is red/purple and its dye stuff is strong enough. In cosmetic, dye stuff is one of the causes of irritation and allergy on skin so that the researcher has made the formulation of lipstick component using natural dye stuff made of black sticky rice. The formulation of lipstick component consisted of some components such as cera alba, lanolin,...
A preliminaryfloristic checklist of thal desert punjab, pakistan
International Nuclear Information System (INIS)
Shaheen, H.; Qureshi, R.
2014-01-01
The floristic survey of the Thal desert, Punjab, Pakistan was carried out during 2010 to 2013. So far, 248 species distributed across 166 genera and 38 families were identified during the report period. Besides, one species viz., Themeda triandra was recorded for the first time from Pakistan. Of them, one fern, 4 monocots and 33 dicots families were determined. The most dominating family was Poaceae that contributed 52 species (21.49%), followed by Fabaceae (34 spp., 13.05%) and Amaranthaceae and Asteraceae (17 spp., 7.02% each). The largest genera were Euphorbia (6 spp.), Cyperus, Eragrostis and Solanum (5 spp. each), Mollugo, Heliotropium and Cenchrus (4 spp. each), Acacia, Prosopis, Tephrosia, Corchorus, Boerhavia and Ziziphus (3 spp. each). This checklist consists of updated systematic families and plants names that will provide a useful starting point for further ecological and bioprospective research of the area under study. (author)
Young, intact and nested retrotransposons are abundant in the onion and asparagus genomes.
Vitte, C; Estep, M C; Leebens-Mack, J; Bennetzen, J L
2013-09-01
Although monocotyledonous plants comprise one of the two major groups of angiosperms and include >65 000 species, comprehensive genome analysis has been focused mainly on the Poaceae (grass) family. Due to this bias, most of the conclusions that have been drawn for monocot genome evolution are based on grasses. It is not known whether these conclusions apply to many other monocots. To extend our understanding of genome evolution in the monocots, Asparagales genomic sequence data were acquired and the structural properties of asparagus and onion genomes were analysed. Specifically, several available onion and asparagus bacterial artificial chromosomes (BACs) with contig sizes >35 kb were annotated and analysed, with a particular focus on the characterization of long terminal repeat (LTR) retrotransposons. The results reveal that LTR retrotransposons are the major components of the onion and garden asparagus genomes. These elements are mostly intact (i.e. with two LTRs), have mainly inserted within the past 6 million years and are piled up into nested structures. Analysis of shotgun genomic sequence data and the observation of two copies for some transposable elements (TEs) in annotated BACs indicates that some families have become particularly abundant, as high as 4-5 % (asparagus) or 3-4 % (onion) of the genome for the most abundant families, as also seen in large grass genomes such as wheat and maize. Although previous annotations of contiguous genomic sequences have suggested that LTR retrotransposons were highly fragmented in these two Asparagales genomes, the results presented here show that this was largely due to the methodology used. In contrast, this current work indicates an ensemble of genomic features similar to those observed in the Poaceae.
Birch, Joanne L; Walsh, Neville G; Cantrill, David J; Holmes, Gareth D; Murphy, Daniel J
2017-01-01
In Australia, Poaceae tribe Poeae are represented by 19 genera and 99 species, including economically and environmentally important native and introduced pasture grasses [e.g. Poa (Tussock-grasses) and Lolium (Ryegrasses)]. We used this tribe, which are well characterised in regards to morphological diversity and evolutionary relationships, to test the efficacy of DNA barcoding methods. A reference library was generated that included 93.9% of species in Australia (408 individuals, [Formula: see text] = 3.7 individuals per species). Molecular data were generated for official plant barcoding markers (rbcL, matK) and the nuclear ribosomal internal transcribed spacer (ITS) region. We investigated accuracy of specimen identifications using distance- (nearest neighbour, best-close match, and threshold identification) and tree-based (maximum likelihood, Bayesian inference) methods and applied species discovery methods (automatic barcode gap discovery, Poisson tree processes) based on molecular data to assess congruence with recognised species. Across all methods, success rate for specimen identification of genera was high (87.5-99.5%) and of species was low (25.6-44.6%). Distance- and tree-based methods were equally ineffective in providing accurate identifications for specimens to species rank (26.1-44.6% and 25.6-31.3%, respectively). The ITS marker achieved the highest success rate for specimen identification at both generic and species ranks across the majority of methods. For distance-based analyses the best-close match method provided the greatest accuracy for identification of individuals with a high percentage of "correct" (97.6%) and a low percentage of "incorrect" (0.3%) generic identifications, based on the ITS marker. For tribe Poeae, and likely for other grass lineages, sequence data in the standard DNA barcode markers are not variable enough for accurate identification of specimens to species rank. For recently diverged grass species similar challenges are
Dowd, Patrick F; Sattler, Scott E
2015-01-01
The presence of lignin within biomass impedes the production of liquid fuels. Plants with altered lignin content and composition are more amenable to lignocellulosic conversion to ethanol and other biofuels but may be more susceptible to insect damage where lignin is an important resistance factor. However, reduced lignin lines of switchgrasses still retained insect resistance in prior studies. Therefore, we hypothesized that sorghum lines with lowered lignin content will also retain insect resistance. Sorghum excised leaves and stalk pith Sorghum bicolor (L.) Moench (Poales: Poaceae) from near isogenic brown midrib (bmr) 6 and 12 mutants lines, which have lowered lignin content and increased lignocellulosic ethanol conversion efficiency, were examined for insect resistance relative to wild-type (normal BTx623). Greenhouse and growth chamber grown plant tissues were fed to first-instar larvae of corn earworms, Helicoverpa zea (Boddie) and fall armyworms Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae), two sorghum major pests. Younger bmr leaves had significantly greater feeding damage in some assays than wild-type leaves, but older bmr6 leaves generally had significantly less damage than wild-type leaves. Caterpillars feeding on the bmr6 leaves often weighed significantly less than those feeding on wild-type leaves, especially in the S. frugiperda assays. Larvae fed the pith from bmr stalks had significantly higher mortality compared with those larvae fed on wild-type pith, which suggested that bmr pith was more toxic. Thus, reducing lignin content or changing subunit composition of bioenergy grasses does not necessarily increase their susceptibility to insects and may result in increased resistance, which would contribute to sustainable production. Published by Oxford University Press on behalf of the Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.
Field diet of the grasshopper Abracris dilecta Walker (Orthoptera, Acrididae
Directory of Open Access Journals (Sweden)
Carlos Frankl Sperber
1996-01-01
Full Text Available Abracris dilecta Walker, 1870 (Orthoptera, Acrididae, Ommatolampinae ate leafs of at least 14 plant species, in the families Asteraceae, Lamiaceae, Malvales (Sterculiaceae, Tiliaceae or Malvaceae, Poaceae, Fabaceae, Verbenaceae, Aristolochiaceae, Rubiaceae and Melastomataccae. Elephantopus mollis H.B.K. (Asteraceae and Hyptis suaveolens Poit. (Lamiaceae comprised 50% of the diet. The diet breadth of A. dilecta was compared to that of other 11 grasshopper species of the same sub-family, with rarefaction curves. The number of plant species eaten by A. dilecta was greater than that of nine other grasshopper species of the same sub-family (Rhachicreagra spp. but was lower then two others (Microptylopteryx hebardi Rehn, 1905 and Rhachicreagra astytophallus Jago & Rowell, 1981. This results are discussed in view of the broad geographical range and possession of developed wings by A. dilecta, which contrasts with most Ommatolampinae grasshoppers.
Directory of Open Access Journals (Sweden)
Plamen S. Stoyanov
2016-06-01
Full Text Available The study presents data on the diversity of grass species in the region of the village of Mugla (the Western Rhodopes. One hundred forty-one species of higher plants belonging to 40families were registered. (Apiaceae, Aspleniaceae, Asteraceae, Boraginaceae, Brassicaceae,Campanulaceae, Caryophyllaceae, Cistaceae, Cyperaceae, Dipsacaceae, Equisetaceae, Ericaceae,Euphorbiaceae, Fabaceae, Gentianaceae, Geraniaceae, Gesneriaceae, Hypericaceae, Juncaceae,Lamiaceae, Lemnaceae, Liliaceae, Linaceae, Menyanthaceae, Oleacea, Onagraceae, Orchidaceae,Parnassiaceae, Plantaginaceae, Plumbaginaceae, Poaceae, Polygalaceae, Primulaceae,Ranunculaceae, Rosaceae, Rubiaceae, Saxifragaceae, Scrophulariaceae, Valerianaceae andViolaceae. Their conservation status was presented, as well as medicinal plants.
Situmorang, Betty Meilya
2013-01-01
Essential oil is a term used for volatile oil and obtained from part of plant such as leaves, flowers, fruit, bark and roots. Lemongrass oil is a major export commodities among the various types of essential oil. The main content of lemongrass oil are sitronellal and geraniol, and content oil of lemongrass is 0.5 to 1.2%. Andropogon citratus DC. of the family Poaceae is one of plant that contains essential oil and is widely used as a liniment. The objective of this research is to determine th...
Geographical distribution of present day Poaceae as evidence for the origin of African floras
Directory of Open Access Journals (Sweden)
W. D. Clayton
1983-11-01
Full Text Available The major tribes and sub-families of grasses occupy worldwide latitudinal belts, which can be related to an evolutionary sequence of climatic adaptations. However, genera tend to be confined to individual continents, suggesting that grasses do not easily cross the oceans, and that the worldwide distribution of the family may have been achieved when the continents were closer together. Species distributions are likewise strongly influenced by the effect of climatic adaptation and continental isolation, but they show a number of aberrations. These are probably a legacy of climatic disturbance during the Pleistocene.
Asaf, Sajjad; Khan, Abdul Latif; Khan, Abdur Rahim; Waqas, Muhammad; Kang, Sang-Mo; Khan, Muhammad Aaqil; Shahzad, Raheem; Seo, Chang-Woo; Shin, Jae-Ho; Lee, In-Jung
2016-01-01
Oryza minuta (Poaceae family) is a tetraploid wild relative of cultivated rice with a BBCC genome. O. minuta has the potential to resist against various pathogenic diseases such as bacterial blight (BB), white backed planthopper (WBPH) and brown plant hopper (BPH). Here, we sequenced and annotated the complete mitochondrial genome of O. minuta. The mtDNA genome is 515,022 bp, containing 60 protein coding genes, 31 tRNA genes and two rRNA genes. The mitochondrial genome organization and the gene content at the nucleotide level are highly similar (89%) to that of O. rufipogon. Comparison with other related species revealed that most of the genes with known function are conserved among the Poaceae members. Similarly, O. minuta mt genome shared 24 protein-coding genes, 15 tRNA genes and 1 ribosomal RNA gene with other rice species (indica and japonica). The evolutionary relationship and phylogenetic analysis revealed that O. minuta is more closely related to O. rufipogon than to any other related species. Such studies are essential to understand the evolutionary divergence among species and analyze common gene pools to combat risks in the current scenario of a changing environment.
Angiosperms, Hydrophytes of five ephemeral lakes of Thiruvallur District, Tamil Nadu, India
Directory of Open Access Journals (Sweden)
Udayakumar, M.
2010-01-01
Full Text Available The aim of this study was to document the Angiosperm diversity of five ephemeral lakes of ThiruvallurDistrict of Tamil Nadu South India. Qualitative floristic surveys were carried out during 2005-2007. Herbarium specimenswith voucher number, taxonomical and ecological information were deposited to the herbarium, Pachaiyappa’s College(PCH Chennai, Tamilnadu. Forty five species of hydrophytes belonging to 21 families and 34 genera were documented.Most speciose families were Poaceae with 5 species followed by Polygalaceae and Nymphaeaceae (4 Cyperaceae,Hydrocharitaceae, Najadaceae, and Scrophulariaceae (3 species each. Mean depth of all five lakes shrinking gradually dueto severe anthropogenic pressure. Conservation of wetlands is the need of the hour to protect the biota as well as quality ofdrinking water.
Directory of Open Access Journals (Sweden)
Somayeh Salimi
2014-12-01
Full Text Available This study focused on Zarabad, Cheraghabad and Nogombecom plants of sub-basin watershed city of Chabahar, Iran. The studied flora included 78 species which belonged to 66 genera and 29 families. Poaceae with 16 genera and 19 species, Asteraceae with 7 genera and 8 species, Chenopodiaceae with 5 genera and 4 species, Papilionaceae, with 5 genera and 6 species, constituted the largest plant families respectively. The largest genera of the region were: Salsola, Heliotropium and Plantago, respectively. 42% of the flora belonged to Nobo-Sindian elements, 35%to Irano-Turanian, 18%were bioregional elements and 5% of the species were cosmopolitan. Flora of the studied area, included therophytes (56%, chamaephytes (15%, phanerophytes (14%, geophytes (12% and hemicryptophytes (3%.
Current glimpse of airborne allergenic pollen in Indian subcontinent
Directory of Open Access Journals (Sweden)
Kavita Ghosal
2015-12-01
Full Text Available Respiratory allergic diseases such as bronchial asthma, rhinitis, urticaria, atopic dermatitis have been steadily increasing all over the world, including India. Owing to its alarming trend, several aerobiological surveys have been undertaken in different parts of India to delineate the variety of pollen and spore load. In this review, we have reported the current state of aerobiological knowladge in India with particular reference to allergenic airborn pollen occurence in 2001–2015. Pollen have been found to contribute a significant proportion in the air and caused allergy symptoms in the local inhabitants. Aerobiological records, a questionnaire survey and hospitalization records have been employed for the analysis. Holoptelea integrifolia, Amaranthus spinosus in northern region, Sorghum vulgare, Pennisetum, Gynandropsis gynandra, Parthenium hysterophorus, Dolichandrone platycalyx in southern regions, and Parthenium hysterophorus from the western region; Cynodon dactylon, Cenchrus ciliaris in the central area; Acacia auriculiformis, Cleome gynandra, Catharanthus roseus, Phoenix sylvestris, Areca catechu, and Lantana camara in the eastern regions as potential aeroallergens in India. The statistical approach confirmed the correlation between hospitalization rate associated with allergy-related health troubles and the prevalent allergenic pollen in the air. The Poaceae group has been found to be dominant throughout India. Immuno-biochemical studies identified various protein with allergenic potential found in the pollen recorded. Epitope identification and homology of the major allergenic protein Cat r1 of Catharanthus sp and Par j 1 of Parietaria judaica have been found. Identification of allergenic pollen grains and the modern approach concerning cross-reactivity and epitope revelation of dominant airborne pollen have important clinical implications for the prevention, diagnosis and treatments of allergic diseases in India.
Early inflorescence development in the grasses (Poaceae
Directory of Open Access Journals (Sweden)
Elizabeth A. Kellogg
2013-07-01
Full Text Available The shoot apical meristem of grasses produces the primary branches of the inflorescence, controlling inflorescence architecture and hence seed production. Whereas leaves are produced in a distichous pattern, with the primordia separated from each other by an angle of 180o, inflorescence branches are produced in a spiral in most species. The morphology and developmental genetics of the shift in phyllotaxis have been studied extensively in maize and rice. However, in wheat, Brachypodium, and oats, all in the grass subfamily Pooideae, the change in phyllotaxis does not occur; primary inflorescence branches are produced distichously. It is unknown whether the distichous inflorescence originated at the base of Pooideae, or whether it appeared several times independently. In this study, we show that Brachyelytrum, the genus sister to all other Pooideae has spiral phyllotaxis in the inflorescence, but that in the remaining 3000+ species of Pooideae, the phyllotaxis is two-ranked. These two-ranked inflorescences are not perfectly symmetrical, and have a clear front and back; this developmental axis has never been described in the literature and it is unclear what establishes its polarity. Strictly distichous inflorescences appear somewhat later in the evolution of the subfamily. Two-ranked inflorescences also appear in a few grass outgroups and sporadically elsewhere in the family, but unlike in Pooideae do not generally correlate with a major radiation of species. After production of branches, the inflorescence meristem may be converted to a spikelet meristem or may simply abort; this developmental decision appears to be independent of the branching pattern.
Winterfeld, Grit; Becher, Hannes; Voshell, Stephanie; Hilu, Khidir; Röser, Martin
2018-01-01
Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae) is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH) of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1) the exclusively Mediterranean genome A based on x = 6, (2) the cosmopolitan genome B based on x = 7 and (3) a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.
Directory of Open Access Journals (Sweden)
Grit Winterfeld
Full Text Available Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1 the exclusively Mediterranean genome A based on x = 6, (2 the cosmopolitan genome B based on x = 7 and (3 a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.
Soler, Jorge H; Caldwell, Cleopatra H; Córdova, David; Harper, Gary; Bauermeister, José A
2018-06-01
Gay and bisexual men may form chosen families in addition to or in place of families of origin. However, the characteristics of these diverse families remain largely unexamined in the quantitative literature. The purpose of this study was to develop a family typology based on responses from a racially and ethnically diverse sample of young adult gay and bisexual men (YGBM) recruited from the Detroit Metropolitan Area (N=350; 18-29 years old). To explore the role of family, we then examined family social support and social undermining in relation to YGBM psychological distress within different family types. A series of multivariate regressions were used to examine associations between family social support and social undermining with depression and anxiety outcomes. The majority (88%) of YGBM included family of origin in their definitions of family and 63% indicated having chosen families. Associations between family social processes and psychological outcomes varied by type of family, suggesting that family composition shapes how perceptions of support and undermining relate to experiencing symptoms of depression and anxiety. Chosen families play a prominent role in the lives of YGBM and should not be overlooked in family research. Findings also highlight the importance of examining co-occurring family social support and social stress processes to further address psychological distress symptoms among YGBM.
Family Violence and Family Physicians
Herbert, Carol P.
1991-01-01
The acronym IDEALS summarizes family physicians' obligations when violence is suspected: to identify family violence; document injuries; educate families and ensure safety for victims; access resources and coordinate care; co-operate in the legal process; and provide support for families. Failure to respond reflects personal and professional experience and attitudes, fear of legal involvement, and lack of knowledge. Risks of intervention include physician burnout, physician overfunctioning, escalation of violence, and family disruption. PMID:21228987
Family functioning in the families of psychiatric patients: a comparison with nonclinical families.
Trangkasombat, Umaporn
2006-11-01
To examine family functioning in the families of psychiatric patients. Families of psychiatric patients and nonclinical families were compared. There were 60 families in each group. The instrument included a semistructured interview of family functioning and the Chulalongkorn Family Inventory (CFI), a self-report questionnaire designed to assess the perception of one's family. From the assessment by semistructured interview, 83.3% of psychiatric families and 45.0% of nonclinical families were found to be dysfunctional in at least one dimension. The difference was statistically significant (p dysfunctional dimensions in the psychiatric families was significantly higher than in the nonclinical control group, 3.5 +/- 1.9 and 0.98 +/- 1.5 respectively, p families were significantly lower than the control group, reflecting poor family functioning. The dysfunctions were mostly in the following dimensions: problem-solving, communication, affective responsiveness, affective involvement, and behavior control. Psychiatric families faced more psychosocial stressors and the average number of stressors was higher than the control families, 88.3% vs. 56.7% and 4.2 +/- 2.7 vs. 1.3 +/- 1.47 stressors respectively, p < 0.0001. Family functioning of psychiatric patients was less healthy than the nonclinical control. The present study underlined the significance of family assessment and family intervention in the comprehensive care of psychiatric patients.
A Floristic Study of Hamun Lake Basin, South East of Iran
Directory of Open Access Journals (Sweden)
Maryam Keshavarzi
2017-06-01
Full Text Available Lake Hamun is the largest freshwater resource in Iran with area of about 3820 km2. The present study aims to evaluate the floristic elements of the studied site. Plant samples were gathered from nature, from March to July at the growing season. Life form and chorotype of plants in Lake Hamun basin were investigated. Totally 128 plant species belonging to 80 genera and 30 families were identified. Families as Poaceae, Amaranthaceae and Fabaceae were the most dominant and frequent families. Considering biological types revealed that the most frequent forms were therophytes (61% and hemicryptophytes (17%. Floristic elements of the area were mainly Iranotouranian mixed with Saharo-Arabian and Sindu-Sudanian types, although multi- and bi- regional elements were also frequent. As the lake has recently become an international conserved area, the complete biological and ecological study of the site is a necessity.
Diversity among Cynodon accessions and taxa based on DNA amplification fingerprinting.
Assefa, S; Taliaferro, C M; Anderson, M P; de los Reyes, B G; Edwards, R M
1999-06-01
The genus Cynodon (Gramineae), comprised of 9 species, is geographically widely distributed and genetically diverse. Information on the amounts of molecular genetic variation among and within Cynodon taxa is needed to enhance understanding of phylogenetic relations and facilitate germplasm management and breeding improvement efforts. Genetic relatedness among 62 Cynodon accessions, representing eight species, was assessed using DNA amplification fingerprinting (DAF). Ten 8-mer oligonucleotides were used to amplify specific Cynodon genomic sequences. The DNA amplification products of individual accessions were scored for presence (1) or absence (0) of bands. Similarity matrices were developed and the accessions were grouped by cluster (UPGMA) and principal coordinate analysis. Analyses were conducted within ploidy level (2x = 18 and 4x = 36) and over ploidy levels. Each primer revealed polymorphic loci among accessions within species. Of 539 loci (bands) scored, 496 (92%) were polymorphic. Cynodon arcuatus was clearly separated from other species by numerous monomorphic bands. The strongest species similarities were between C. aethiopicus and C. arcuatus, C. transvaalensis and C. plectostachyus, and C. incompletus and C. nlemfuensis. Intraspecific variation was least for C. aethiopicus, C. arcuatus, and C. transvaalensis, and greatest for C. dactylon. Accessions of like taxonomic classification were generally clustered, except the cosmopolitan C. dactylon var. dactylon and C. dactylon var. afganicus. Within taxa, accessions differing in chromosome number clustered in all instances indicating the 2x and 4x forms to be closely related. Little, if any, relationship was found between relatedness as indicated by the DAF profiles and previous estimates of hybridization potential between the different taxa.
Agbodeka, Kodjovi; Gbekley, Holaly E; Karou, Simplice D; Anani, Kokou; Agbonon, Amegnona; Tchacondo, Tchadjobo; Batawila, Komlan; Simpore, Jacques; Gbeassor, Messanvi
2016-03-01
In Togo, malaria constitutes a major public health problem but, until now, the population still mostly relies on herbal medicine for healing. This study aimed to document medicinal plants used for malaria therapy in the Plateau region of the country. Semi-structured questionnaire interviews were used to gather ethnobotanical and sociodemographic data from traditional healers of the study area. A total of 61 plants species belonging to 33 families were found to be in use for malaria therapy in the Plateau region. Caesalpiniaceae were the most represented family with 7 species, followed by Euphorbiaceae and Poaceae with 4 species each. According to the relative frequency of citation (RFC), Newbouldia laevis Seem. (RFC =0.52), Sarcocephalus latifolius (Sm.) E.A. Bruce (RFC =0.48), Acanthospermum hispidum DC. (RFC =0.43), and Senna siamea (Lam.) H.S. Irwin and Barneby (RFC =0.40) were the most cited in the treatment of malaria in the traditional medicine in the Plateau region. The parts of plants used could either be the barks, roots, leaves, or whole plants. The recipes also could be a combination of various species of plants or plant parts. This study highlights the potential sources for the development of new antimalarial drugs from indigenous medicinal plants found in the Plateau region of Togo. Such results could be a starting point for in vitro antimalarial screenings. 61 plants species from 33 families are use for malaria therapy in the Plateau region of TogoThe main families are Caesalpiniaceae Euphorbiaceae and PoaceaeThe most used species are Newbouldia laevis Seem. (RFC = 0.52), Sarcocephalus latifolius (Sm.) E.A. Bruce (RFC = 0.48), Acanthospermum hispidum DC. (RFC = 0.43), and Senna siamea (Lam.) H.S. Irwin and Barneby (RFC = 0.40) Abbreviations Used: RFC: Relative frequency of citation, FC: Frequency of citation, Dec: Decoction, Orl: Oral route, Mac: Maceration, Jui: Juice, Inf: Infusion, Sau: Sauce, Kne: Kneading, Le: Leaves, Rt: Roots, Wp: Whole plant
Strengthening Family Practices for Latino Families.
Chartier, Karen G; Negroni, Lirio K; Hesselbrock, Michie N
2010-01-01
The study examined the effectiveness of a culturally-adapted Strengthening Families Program (SFP) for Latinos to reduce risks for alcohol and drug use in children. Latino families, predominantly Puerto Rican, with a 9-12 year old child and a parent(s) with a substance abuse problem participated in the study. Pre- and post-tests were conducted with each family. Parental stress, parent-child dysfunctional relations, and child behavior problems were reduced in the families receiving the intervention; family hardiness and family attachment were improved. Findings contribute to the validation of the SFP with Latinos, and can be used to inform social work practice with Puerto Rican families.
Liu, Qing; Triplett, Jimmy K; Wen, Jun; Peterson, Paul M
2011-11-01
Eleusine (Poaceae) is a small genus of the subfamily Chloridoideae exhibiting considerable morphological and ecological diversity in East Africa and the Americas. The interspecific phylogenetic relationships of Eleusine are investigated in order to identify its allotetraploid origin, and a chronogram is estimated to infer temporal relationships between palaeoenvironment changes and divergence of Eleusine in East Africa. Two low-copy nuclear (LCN) markers, Pepc4 and EF-1α, were analysed using parsimony, likelihood and Bayesian approaches. A chronogram of Eleusine was inferred from a combined data set of six plastid DNA markers (ndhA intron, ndhF, rps16-trnK, rps16 intron, rps3, and rpl32-trnL) using the Bayesian dating method. The monophyly of Eleusine is strongly supported by sequence data from two LCN markers. In the cpDNA phylogeny, three tetraploid species (E. africana, E. coracana and E. kigeziensis) share a common ancestor with the E. indica-E. tristachya clade, which is considered a source of maternal parents for allotetraploids. Two homoeologous loci are isolated from three tetraploid species in the Pepc4 phylogeny, and the maternal parents receive further support. The A-type EF-1α sequences possess three characters, i.e. a large number of variations of intron 2; clade E-A distantly diverged from clade E-B and other diploid species; and seven deletions in intron 2, implying a possible derivation through a gene duplication event. The crown age of Eleusine and the allotetraploid lineage are 3·89 million years ago (mya) and 1·40 mya, respectively. The molecular data support independent allotetraploid origins for E. kigeziensis and the E. africana-E. coracana clade. Both events may have involved diploids E. indica and E. tristachya as the maternal parents, but the paternal parents remain unidentified. The habitat-specific hypothesis is proposed to explain the divergence of Eleusine and its allotetraploid lineage.
The floristic characteristics of plants in gardens and streets in urban areas of adana, turkey
International Nuclear Information System (INIS)
Karakus, H.
2014-01-01
This study was carried out to determine the flora of the gardens and road sides in Adana from March 2008 to April 2012. During the floristic studies, 337 vascular plant taxa belonging to 259 genera and 93 families were determined. Families with the greatest number of taxa are Asteraceae 35 species (10%), Fabaceae 30 species (9%), Poaceae 20 species (6%), Rosaceae 11 species (3%) and Lamiaceae 10 species (3%). According to the life-forms phanerophytes 134 species (40%) and therophytes 118 species (35%) are more than the others (chamaephytes, hemicryptophytes, and geophytes). Forty-eight percent (162 taxa) of total flora in the area is exotic species and the rest (52%) are indigenous. Total flora consists of 62% (209 taxa) ornamental species and 38% (128 taxa) ruderal species. (author)
Indian Academy of Sciences (India)
1987; Bernini and Marin-Morales. 2001; Mendes-Bonato et al. 2002, 2006; Utsunomiya et al. 2005). More recently, a new number, x = 6, was determined for several accessions of B. dictyoneura (Risso-Pascotto et al. 2006), a species suggested to belong to the same agamic complex as B. humidicola (Renvoize et al. 1996).
Indian Academy of Sciences (India)
Department of Bioengineering and Biotechnology, Qingdao University of Science and Technology, Qingdao, Shandong ... entire chloroplast DNA sequence of common wheat (T. aes- ... a CTAB method as previously described by Liu et al.
Directory of Open Access Journals (Sweden)
Marcos R. Furlan
2010-10-01
Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.
Family emotional expressiveness and family structure
Directory of Open Access Journals (Sweden)
Čotar-Konrad Sonja
2016-01-01
Full Text Available The present paper scrutinizes the relationship between family emotional expressiveness (i.e., the tendency to express dominant and/or submissive positive and negative emotions and components of family structure as proposed in Olson’s Circumplex model (i.e., cohesion and flexibility, family communication, and satisfaction in families with adolescents. The study was conducted on a sample of 514 Slovenian adolescents, who filled out two questionnaires: the Slovenian version of Family Emotional Expressiveness - FEQ and FACES IV. The results revealed that all four basic dimensions of family functioning were significantly associated with higher/more frequent expressions of positive submissive emotions, as well as with lower/less frequent expressions of negative dominant emotions. Moreover, expressions of negative submissive emotions explained a small, but significant amount of variance in three out of four family functioning variables (satisfaction, flexibility, and communication. The importance of particular aspects of emotional expressiveness for family cohesion, flexibility, communication, and satisfaction is discussed, and the relevance of present findings for family counselling is outlined.
The Role of Family in Family Firms
Marianne Bertrand; Antoinette Schoar
2006-01-01
History is replete with examples of spectacular ascents of family businesses. Yet there are also numerous accounts of family businesses brought down by bitter feuds among family members, disappointed expectations between generations, and tragic sagas of later generations unable to manage their wealth. A large fraction of businesses throughout the world are organized around families. Why are family firms so prevalent? What are the implications of family control for the governance, financing an...
Family doctors' involvement with families in Estonia
Directory of Open Access Journals (Sweden)
Lember Margus
2004-10-01
Full Text Available Abstract Background Family doctors should care for individuals in the context of their family. Family has a powerful influence on health and illness and family interventions have been shown to improve health outcomes for a variety of health problems. The aim of the study was to investigate the Estonian family doctors' (FD attitudes to the patients' family-related issues in their work: to explore the degree of FDs involvement in family matters, their preparedness for management of family-related issues and their self-assessment of the ability to manage different family-related problems. Methods A random sample (n = 236 of all FDs in Estonia was investigated using a postal questionnaire. Altogether 151 FDs responded to the questionnaire (response rate 64%, while five of them were excluded as they did not actually work as FDs. Results Of the respondents, 90% thought that in managing the health problems of patients FDs should communicate and cooperate with family members. Although most of the family doctors agreed that modifying of the health damaging risk factors (smoking, alcohol and drug abuse of their patients and families is their task, one third of them felt that dealing with these problems is ineffective, or perceived themselves as poorly prepared or having too little time for such activities. Of the respondents, 58% (n = 83 were of the opinion that they could modify also relationship problems. Conclusions Estonian family doctors are favourably disposed to involvement in family-related problems, however, they need some additional training, especially in the field of relationship management.
Hohashi, Naohiro; Honda, Junko
2011-11-01
Although the number of employees on overseas assignments accompanied by their families has increased steadily, little is known about the effects of this experience on family functioning. Japanese families on family-accompanied assignments living in Hong Kong were compared with families living in Japan (consisting of 135 and 248 paired partners, respectively). Applying an ecological framework, family functioning was examined using the Feetham Family Functioning Survey-Japanese (FFFS-J). Japanese wives living in Hong Kong rated family functioning lower, particularly in the area of "relationship between family and family members." Between paired marital partners living in Hong Kong, the level of satisfaction in the area of "relationship between family and society" was significantly lower for wives than for husbands. This study provides application of the family ecological framework in families in a multicultural environment and identifies potential areas for family assessment and intervention that may of interest to health care professionals who care for families living away from their home countries.
Families and family therapy in Hong Kong.
Tse, Samson; Ng, Roger M K; Tonsing, Kareen N; Ran, Maosheng
2012-04-01
Family therapy views humans not as separate entities, but as embedded in a network of relationships, highlighting the reciprocal influences of one's behaviours on one another. This article gives an overview of family demographics and the implementation of family therapy in Hong Kong. We start with a review of the family demographics in Hong Kong and brief notes on families in mainland China. Demographics show that the landscape has changed markedly in the past decade, with more cross-border marriages, an increased divorce rate, and an ageing overall population - all of which could mean that there is increasing demand for professional family therapy interventions. However, only a limited number of professionals are practising the systems-based approach in Hong Kong. Some possible reasons as to why family therapy is not well disseminated and practised are discussed. These reasons include a lack of mental health policy to support family therapy, a lack of systematic family therapy training, and a shortage of skilled professionals. Furthermore, challenges in applying the western model in Chinese culture are also outlined. We conclude that more future research is warranted to investigate how family therapy can be adapted for Chinese families.
Family environment patterns in families with bipolar children.
Belardinelli, Cecilia; Hatch, John P; Olvera, Rene L; Fonseca, Manoela; Caetano, Sheila C; Nicoletti, Mark; Pliszka, Steven; Soares, Jair C
2008-04-01
We studied the characteristics of family functioning in bipolar children and healthy comparison children. We hypothesized that the family environment of bipolar children would show greater levels of dysfunction as measured by the Family Environment Scale (FES). We compared the family functioning of 36 families that included a child with DSM-IV bipolar disorder versus 29 comparison families that included only healthy children. All subjects and their parents were assessed with the K-SADS-PL interview. The parents completed the FES to assess their current family functioning. Multivariate analysis of variance was used to compare the family environment of families with and without offspring with bipolar disorder. Parents of bipolar children reported lower levels of family cohesion (pfamilies where a parent had a history of mood disorders compared to families where parents had no history of mood disorders. Length of illness in the affected child was inversely associated with family cohesion (r=-0.47, p=0.004). Due to the case-control design of the study, we cannot comment on the development of these family problems or attribute their cause specifically to child bipolar disorder. Families with bipolar children show dysfunctional patterns related to interpersonal interactions and personal growth. A distressed family environment should be addressed when treating children with bipolar disorder.
Family interactions in adoptive compared to nonadoptive families.
Rueter, Martha A; Keyes, Margaret A; Iacono, William G; McGue, Matt
2009-02-01
Despite the large and growing numbers of adoptive families, little research describes interactions in families with adopted adolescents. Yet, adopted adolescents' increased risk for adjustment problems, combined with the association between family interactions and adolescent adjustment in nonadoptive families, raises questions about differences in adoptive and nonadoptive family interactions. We compared observed and self-reported family interactions between 284 adoptive and 208 nonadoptive families and within 123 families with 1 adopted and 1 nonadopted adolescent. Adolescents averaged 14.9 years of age. Comparisons were made using analysis of variance incorporating hierarchical linear methods in SAS PROC MIXED to control family-related correlations in the data. Parents and children reported more conflict in adoptive families when compared with nonadoptive families. Families with 1 adopted and 1 nonadopted adolescent reported more conflict between parents and adopted adolescents. Observed parental behavior was similar across adoptive and nonadoptive children although adopted adolescents were less warm and, in families with 2 adopted children, more conflictual than nonadopted adolescents. These findings suggest a need for further investigation of the association between family interactions and adopted adolescent problem behavior. Copyright 2009 APA, all rights reserved.
Directory of Open Access Journals (Sweden)
Flávia V. Moreira
2010-12-01
Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.C. citratus é utilizada na medicina popular para tratar hipertensão. Este trabalho investigou a composição química e os efeitos cardiovasculares do óleo essencial do C. citratus (OECC. Foram identificados oito constituintes no OECC, sendo geranial o majoritário (43,08%. Em ratos, o OECC (1, 5, 10 e 20 mg/kg, i.v. induziu hipotensão e bradicardia que foram atenuadas pela atropina e tiopental sódico, mas não por L-NAME ou indometacina. Em anéis de artéria mesentérica de ratos pré-contraídos com fenilefrina, o OECC (1 a 3000 µg/mL induziu relaxamento que não foi afetado após remoção do endotélio, após TEA ou em anéis pré-contraídos com KCl (80 mM. Além disso, o OECC (1000 µg/mL não induziu efeito adicional sobre o relaxamento máximo da nifedipina (10 µM. Em conclusão, o OECC induz hipotensão possivelmente devido à redução da resistência vascular que pode ser causada
The Family in Us: Family History, Family Identity and Self-Reproductive Adaptive Behavior.
Ferring, Dieter
2017-06-01
This contribution is an essay about the notion of family identity reflecting shared significant experiences within a family system originating a set of signs used in social communication within and between families. Significant experiences are considered as experiences of events that have an immediate impact on the adaptation of the family in a given socio-ecological and cultural context at a given historical time. It is assumed that family history is stored in a shared "family memory" holding both implicit and explicit knowledge and exerting an influence on the behavior of each family member. This is described as transgenerational family memory being constituted of a system of meaningful signs. The crucial dimension underlying the logic of this essay are the ideas of adaptation as well as self-reproduction of systems.
Family and non-family business differences in Estonia
Directory of Open Access Journals (Sweden)
Maret Kirsipuu
2014-01-01
Full Text Available This paper seeks to identify differences between family enterprises and non-family enterprises. The concepts of entrepreneurship, entrepreneur and enterprise/business are clarified. The paper contains the results of research conducted by the author among family entrepreneurs in 2007–2012 that can be compared to the research results reached by Wahl (2011. This research demonstrates that there are differences between family entrepreneurs and non-family entrepreneurs, which are primarily caused by that family entrepreneurs value first of all their family members, family traditions and only then profit earning.
Panganiban-Corales, Avegeille T; Medina, Manuel F
2011-10-31
Severe illness can disrupt family life, cause family dysfunction, strain resources, and cause caregiver burden. The family's ability to cope with crises depends on their resources. This study sought to assess families of children with cancer in terms of family function-dysfunction, family caregiver strain and the adequacy of family resources using a new family resources assessment instrument. This is a cross-sectional study involving 90 Filipino family caregivers of children undergoing cancer treatment. This used a self-administered questionnaire composed of a new 12-item family resources questionnaire (SCREEM-RES) based on the SCREEM method of analysis, Family APGAR to assess family function-dysfunction; and Modified Caregiver Strain Index to assess strain in caring for the patient. More than half of families were either moderately or severely dysfunctional. Close to half of caregivers were either predisposed to strain or experienced severe strain, majority disclosed that their families have inadequate economic resources; many also report inaccessibility to medical help in the community and insufficient educational resources to understand and care for their patients. Resources most often reported as adequate were: family's faith and religion; help from within the family and from health providers. SCREEM-RES showed to be reliable with Cronbach's alpha of 0.80. There is good inter-item correlation between items in each domain: 0.24-0.70. Internal consistency reliability for each domain was also good: 0.40-0.92. Using 2-point scoring system, Cronbach's alpha were slightly lower: full scale (0.70) and for each domain 0.26-.82. Results showed evidence of association between family resources and family function based on the family APGAR but none between family resources and caregiver strain and between family function and caregiver strain. Many Filipino families of children with cancer have inadequate resources, especially economic; and are moderately or severely
Directory of Open Access Journals (Sweden)
Panganiban-Corales Avegeille T
2011-10-01
Full Text Available Abstract Background Severe illness can disrupt family life, cause family dysfunction, strain resources, and cause caregiver burden. The family's ability to cope with crises depends on their resources. This study sought to assess families of children with cancer in terms of family function-dysfunction, family caregiver strain and the adequacy of family resources using a new family resources assessment instrument. Methods This is a cross-sectional study involving 90 Filipino family caregivers of children undergoing cancer treatment. This used a self-administered questionnaire composed of a new 12-item family resources questionnaire (SCREEM-RES based on the SCREEM method of analysis, Family APGAR to assess family function-dysfunction; and Modified Caregiver Strain Index to assess strain in caring for the patient. Results More than half of families were either moderately or severely dysfunctional. Close to half of caregivers were either predisposed to strain or experienced severe strain, majority disclosed that their families have inadequate economic resources; many also report inaccessibility to medical help in the community and insufficient educational resources to understand and care for their patients. Resources most often reported as adequate were: family's faith and religion; help from within the family and from health providers. SCREEM-RES showed to be reliable with Cronbach's alpha of 0.80. There is good inter-item correlation between items in each domain: 0.24-0.70. Internal consistency reliability for each domain was also good: 0.40-0.92. Using 2-point scoring system, Cronbach's alpha were slightly lower: full scale (0.70 and for each domain 0.26-.82. Results showed evidence of association between family resources and family function based on the family APGAR but none between family resources and caregiver strain and between family function and caregiver strain. Conclusion Many Filipino families of children with cancer have inadequate
Family roles as family functioning regulators
STEPANYAN ARMINE
2015-01-01
The author examines the problems of formation and functioning of family roles. Having social roots, family roles appear on individual level by performing the social function of the formation of family as a social institute.
Family identity: black-white interracial family health experience.
Byrd, Marcia Marie; Garwick, Ann Williams
2006-02-01
The purpose of this interpretive descriptive study was to describe how eight Black-White couples with school-aged children constructed their interracial family identity through developmental transitions and interpreted race to their children. Within and across-case data analytic strategies were used to identify commonalities and variations in how Black men and White women in couple relationships formed their family identities over time. Coming together was the core theme described by the Black-White couples as they negotiated the process of forming a family identity. Four major tasks in the construction of interracial family identity emerged: (a) understanding and resolving family of origin chaos and turmoil, (b) transcending Black-White racial history, (c) articulating the interracial family's racial standpoint, and (d) explaining race to biracial children across the developmental stages. The findings guide family nurses in promoting family identity formation as a component of family health within the nurse-family partnership with Black-White mixed-race families.
Yuen, Cynthia X; Fuligni, Andrew J; Gonzales, Nancy; Telzer, Eva H
2018-02-01
Youth who do not identify with or value their families (i.e., low family centrality) are considered to be at risk for maladjustment. However, the current study investigated whether low family centrality may be adaptive in negative family contexts (i.e., high family conflict) because youth's self-worth should be less tied to the quality of their family relationships. Multilevel models using daily diaries and latent variable interactions using longitudinal questionnaires indicated that, among a sample of 428 Mexican American adolescents (49.8% male, M age = 15.02 years), lower family centrality was generally detrimental to youth's well-being. However, for youth in adverse family environments, low family centrality ceased to function as a risk factor. The present findings suggest that family centrality values play a more nuanced role in youth well-being than previously believed, such that low family centrality may be an adaptive response to significant family challenges.
Directory of Open Access Journals (Sweden)
Ron Stauder
2018-03-01
Full Text Available Strigolactones (SLs are apocarotenoid phytohormones synthesized from carotenoid precursors. They are produced most abundantly in roots for exudation into the rhizosphere to cope with mineral nutrient starvation through support of root symbionts. Abscisic acid (ABA is another apocarotenoid phytohormone synthesized in roots, which is involved in responses to abiotic stress. Typically low carotenoid levels in roots raise the issue of precursor supply for the biosynthesis of these two apocarotenoids in this organ. Increased ABA levels upon abiotic stress in Poaceae roots are known to be supported by a particular isoform of phytoene synthase (PSY, catalyzing the rate-limiting step in carotenogenesis. Here we report on novel PSY3 isogenes from Medicago truncatula (MtPSY3 and Solanum lycopersicum (SlPSY3 strongly expressed exclusively upon root interaction with symbiotic arbuscular mycorrhizal (AM fungi and moderately in response to phosphate starvation. They belong to a widespread clade of conserved PSYs restricted to dicots (dPSY3 distinct from the Poaceae-PSY3s involved in ABA formation. An ancient origin of dPSY3s and a potential co-evolution with the AM symbiosis is discussed in the context of PSY evolution. Knockdown of MtPSY3 in hairy roots of M. truncatula strongly reduced SL and AM-induced C13 α-ionol/C14 mycorradicin apocarotenoids. Inhibition of the reaction subsequent to phytoene synthesis revealed strongly elevated levels of phytoene indicating induced flux through the carotenoid pathway in roots upon mycorrhization. dPSY3 isogenes are coregulated with upstream isogenes and downstream carotenoid cleavage steps toward SLs (D27, CCD7, CCD8 suggesting a combined carotenoid/apocarotenoid pathway, which provides “just in time”-delivery of precursors for apocarotenoid formation.
Directory of Open Access Journals (Sweden)
D'Apolito
2010-12-01
Full Text Available We present data on the pollen harvest by Apismellifera L. at a central-western Brazil site not yet studied. Corbiculae pollen loads were collected during one year in front of the hive, acetolysed and slides mounted for optical microscopy. Identification followed comparisons with a local pollen collection. Forty-two pollen types were utilized by the bee; the most important families were Myrtaceae, Asteraceae, Euphorbiaceae, Brassicaceae and Poaceae. The genus/species level ranking of relative importance showed Eucalyptus (19%, Raphanus raphanistrum (13%, Poaceae type 2 (7.5%, Jatropha cf. gossypiifolia (7% and Sapium glandulatum (6.5%. Overall, the majority of pollen types (80% were not abundantly harvested, and a minority (4% reached values of 10%. Given that the study area has cultivated plants and not natural vegetation, we indicate most of the identified species as manageable and point out that weedy vegetation can be an important food source for bees since it frequently occurred in the pollen spectra even within a totally cultivated area.Apresentamos dados sobre a coleta de pólen por Apis mellifera L. em uma localidade no centro-oeste do Brasil, ainda não estudada. Cargas corbiculares de pólen foram coletadas durante um ano em frente ao ninho, acetolisadas e montadas em lâminas para microscopia óptica. A identificação foi feita por comparação com uma coleção de referência local. Quarenta e dois tipos polínicos foram utilizados pelas abelhas; as famílias mais importantes foram Myrtaceae, Asteraceae, Euphorbiaceae, Brassicaceae e Poaceae. O ranqueamento de importância relativa para gênero/espécie mostrou Eucalyptus (19%, Raphanus raphanistrum (13%, Poaceae tipo 2 (7,5%, Jatropha cf. gossypiifolia (7% e Sapium glandulatum (6,5%. No geral, a maioria dos recursos (80% não foi utilizada com abundância, e uma minoria (4% alcançou valores de 10%. Dado que a área de estudo não possui uma vegetação natural, mas cultivares, n
75 FR 17946 - Family Report, MTW Family Report
2010-04-08
... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-25] Family Report, MTW Family... comments on the subject proposal. Tenant data is collected to understand demographic, family profile.... This Notice Also Lists the Following Information Title of Proposal: Family Report, MTW Family Report...
Ordinal classification of vegetation along mangla dam, mirpur, ajk
International Nuclear Information System (INIS)
Urooj, R.; Ahmad, S.S.
2015-01-01
Vegetation plays an important role in ecosystem maintenance. But the construction of dams transform the riparian vegetation into impoundment region. The present study was conducted to identify and quantify herbaceous flora around the vicinity of Mangla dam. Study area was divided into two zones on the basis of distance from the dam boundary. Pattern of vegetation distribution and their association in area was grouped in to different communities by using ordination techniques. Two ordination techniques TWINSPAN and DECORANA were used. A total of 37 species belonging to 17 families were identified from fifty quadrats. Random sampling was done by using 1*1 m sized quadrat. Percentage of vegetation was assessed by using Domin cover scale. TWINSPAN classified two groups and four communities in Zone-I, while in Zone-II two groups and six communities were formed. Dominance curve showed that Cynodon dactylon, Desmostachya bipinnata and Rhynchosia minima were dominant species in Zone-I and Croton bonplandianus, C. dactylon, D. bipinnata and Brachiaria decumbens were frequent species in Zone-II. DCA as indirect multivariate technique based on reciprocal averaging determined the environmental gradients that affect the species richness and also verified the groups of species and indicated four communities in both Zones. Monte Carlo test of significance was used to analyze stress in relation to number of axis/dimensionality under Non-metric Multidimensional Scaling (NMS) through p-value. This study provided the significant results of least abundant and most abundant herbaceous species around the dam which will be helpful for biodiversity conservation and in decision making for further land planning
Directory of Open Access Journals (Sweden)
Palmer Jeffrey D
2006-07-01
Full Text Available Abstract Background Many mitochondrial genes, especially ribosomal protein genes, have been frequently transferred as functional entities to the nucleus during plant evolution, often by an RNA-mediated process. A notable case of transfer involves the rps14 gene of three grasses (rice, maize, and wheat, which has been relocated to the intron of the nuclear sdh2 gene and which is expressed and targeted to the mitochondrion via alternative splicing and usage of the sdh2 targeting peptide. Although this transfer occurred at least 50 million years ago, i.e., in a common ancestor of these three grasses, it is striking that expressed, nearly intact pseudogenes of rps14 are retained in the mitochondrial genomes of both rice and wheat. To determine how ancient this transfer is, the extent to which mitochondrial rps14 has been retained and is expressed in grasses, and whether other transfers of rps14 have occurred in grasses and their relatives, we investigated the structure, expression, and phylogeny of mitochondrial and nuclear rps14 genes from 32 additional genera of grasses and from 9 other members of the Poales. Results Filter hybridization experiments showed that rps14 sequences are present in the mitochondrial genomes of all examined Poales except for members of the grass subfamily Panicoideae (to which maize belongs. However, PCR amplification and sequencing revealed that the mitochondrial rps14 genes of all examined grasses (Poaceae, Cyperaceae, and Joinvilleaceae are pseudogenes, with all those from the Poaceae sharing two 4-NT frameshift deletions and all those from the Cyperaceae sharing a 5-NT insertion (only one member of the Joinvilleaceae was examined. cDNA analysis showed that all mitochondrial pseudogenes examined (from all three families are transcribed, that most are RNA edited, and that surprisingly many of the edits are reverse (U→C edits. Putatively nuclear copies of rps14 were isolated from one to several members of each of these
Directory of Open Access Journals (Sweden)
João Augusto Alves Meira Neto
2007-10-01
''S and 49º 10' 30'' to 49º15'30'' W, 600 to 680m high. A total of 14 angiospermic species were found, 285 of these in Cerrado sensu lato physiognomies. The richest families in species number were Asteraceae, Fabaceae, Myrtaceae and Poaceae. Asteraceae, Fabaceae and Poaceae were the richest families similar to other Cerrado's sites. The EESB biological spectra have patterns similar to other Cerrados, but with one change: chamaephytes were richer than hemycryptophytes in the open savannic physiognomies of EESB. Fire protection may be the reason of this alteration.
Directory of Open Access Journals (Sweden)
Marco Otávio Pivari
2008-06-01
floristic similarities among these mats were calculated to show aspects of sucessional dynamics on floating mats. A total of 66 species of epiphytic aquatic macrophytes were found, distributed in 27 families, Cyperaceae and Poaceae being the most representative. The number of species per mat varied from 7 and 39, with some taxa common to all mats, such as Ludwigia leptocarpa (Nutt. H. Hara and Oxycaryum cubense (Poepp. & Kunth Palla, at the specific level, and Asteraceae, Cyperaceae, Onagraceae, Poaceae and Polygonaceae, at the family level. Other biological forms besides epiphytes were found associated with " baceiros" or adapted to histosol conditions, being considered " casual epiphytes" . " Baceiros" in similar successional stages of development have high floristic similarity, and in general, the more advanced the natural succession, the higher the number of species.
Family Ties: The Role of Family Context in Family Health History Communication about Cancer
Rodríguez, Vivian M.; Corona, Rosalie; Bodurtha, Joann N.; Quillin, John M.
2016-01-01
Family health history about cancer is an important prevention and health promotion tool. Yet, few studies have identified family context factors that promote such discussions. We explored relations among family context (cohesion, flexibility, and openness), self-efficacy, and cancer communication (gathering family history, sharing cancer risk information, and frequency) in a diverse group of women enrolled in a randomized control trial. Baseline survey data for 472 women were analyzed. Average age was 34 years, 59% identified as Black, 31% graduated high school, and 75% reported a family history of any cancer. Results showed that greater family cohesion and flexibility were related to higher communication frequency and sharing cancer information. Women who reported greater self-efficacy were more likely to have gathered family history, shared cancer risk information, and communicated more frequently with relatives. Openness was not associated with communication but was related to greater family cohesion and flexibility. Adjusting for demographic variables, self-efficacy and family cohesion significantly predicted communication frequency. Women with higher self-efficacy were also more likely to have gathered family health history about cancer and shared cancer risk information. Future research may benefit from considering family organization and self-efficacy when developing psychosocial theories that, in turn, inform cancer prevention interventions. PMID:26735646
Family Ties: The Role of Family Context in Family Health History Communication About Cancer.
Rodríguez, Vivian M; Corona, Rosalie; Bodurtha, Joann N; Quillin, John M
2016-01-01
Family health history about cancer is an important prevention and health promotion tool. Yet few studies have identified family context factors that promote such discussions. We explored relations among family context (cohesion, flexibility, and openness), self-efficacy, and cancer communication (gathering family history, sharing cancer risk information, and frequency) in a diverse group of women enrolled in a randomized control trial. Baseline survey data for 472 women were analyzed. The women's average age was 34 years, 59% identified as Black, 31% had graduated high school, and 75% reported a family history of any cancer. Results showed that greater family cohesion and flexibility were related to higher communication frequency and sharing cancer information. Women who reported greater self-efficacy were more likely to have gathered family history, shared cancer risk information, and communicated more frequently with relatives. Openness was not associated with communication but was related to greater family cohesion and flexibility. Adjusting for demographic variables, self-efficacy, and family cohesion significantly predicted communication frequency. Women with higher self-efficacy were also more likely to have gathered family health history about cancer and shared cancer risk information. Future research may benefit from considering family organization and self-efficacy when developing psychosocial theories that in turn inform cancer prevention interventions.
Family Psychology and Family Therapy in Japan.
Kameguchi, Kenji; Murphy-Shigematsu, Stephen
2001-01-01
Reviews the development of family psychology and family therapy in Japan, tracing the origins of these movements, explaining how these fields were activated by the problem of school refusal, and describing an approach to family therapy that has been developed to work with families confronting this problem, as well as preventive programs of family…
Engaging Families in In-Home Family Intervention
Thompson, Ronald W.; Koley, Sarah
2014-01-01
Boys Town has created a program called In-Home Family Services to deliver help to families in stress. In-home family intervention programs have become widely used to help more families who are at risk and experiencing difficulties with a wide range of problems including domestic violence, child behavior problems, parent-child and family…
Directory of Open Access Journals (Sweden)
Paulinea Andreazza Ferreira Porto
2008-01-01
Full Text Available In order to determinate the floristic check-list of a inselberg at the Fazenda Timbaúba (35o52'50.3", 7o1'0.8", municipality of Esperança/PB, Agreste da Borborema Microregion, were realized the present study. The inselberg flora comprise 127 species, 101 genera and 53 families of wich the Leguminosae family with 17 species showed the higher richness, followed by the Asteraceae (9 spp., Poaceae (7 spp., Euphorbiaceae and Orchidaceae (6 spp. families. Bromeliaceae and Cactaceae, despite of not be the higher richness, are covering extents areas, suggesting a higher importance for those families in inselbergs colonization. Comparing the families with other inselberg floras, 29 of them also were raising in Quixadá/CE, 28 in Pão de Açúcar and 24 in Serra do Mar/RJ inselbergs. The majority of species showed xenomorphic adaptations due hydric stress observed in the Southern and Northeastern Brazilian inselbergs. The differences in the floristic composition, especially at genus and species level seem to result of different speciation pressure what aid the taxa with better adaptation at these environments.
Directory of Open Access Journals (Sweden)
Try Susanti
2016-01-01
Full Text Available Abstrak. Nepenthes merupakan tumbuhan unik yaitu mempunyai kemampuan untuk mencerna serangga yang terperangkap dalam organ berbentuk kantong pada ujung daun untuk memenuhi kebutuhan proteinnya. Nephentes dapat dijadikan sebagai tanaman hias yang memiliki nilai komersial tinggi dan juga sebagai obat-obatan. Sumatera merupakan wilayah terbesar kedua dari penyebaran Nepenthes setelah Kalimantan. Habitat alami dari jenis Nepenthes di Sumatera setiap tahunnya semakin terancam, baik oleh pembalakan liar, kebakaran hutan maupun konversi lahan hutan. Penelitian ini bertujuan untuk menganalisis jenis vegetasi dalam komunitas Nepenthes mirabilis di hutan kampus Institut Agama Islam Negeri Sulthan Thaha Saifuddin Jambi. Penelitian ini merupakan penelitian kualitatif. Metode yang digunakan adalah metode transek. Berdasarkan hasil pengamatan tumbuhan yang ditemukan di sekitar komunitas Nepenthes mirabilis pada plot pengamatan adalah sebanyak 17 famili, yang terdiri dari 26 jenis dan 3547 individu. Jenis tumbuhan yang paling banyak ditemukan di sekitar komunitas Nepenthes mirabilis adalah dari famili Poaceae yaitu Axonopus compressus sebanyak 1336 individu, pada famili Gleicheniaceae yaitu Dicranopteris linearis sebanyak 470 individu dan pada famili Leguminoceae yaitu Mimosa pudica sebanyak 419 individu. Sedangkan jenis tumbuhan yang paling sedikit ditemukan pada famili Polygalaceae dengan jenis Polygala paniculata terdapat 6 individu. Kata Kunci: Vegetasi, Komunitas, Nepenthes mirabilis.
Another way to teach family: family nursing game
Directory of Open Access Journals (Sweden)
Carla Sílvia Neves da Nova Fernandes
2014-10-01
Full Text Available Current paper describes the application of an innovative strategy to teach family, within a hospital context, by sensitizing nurses on the family subject through the use of a game. Given the hospitalization of a relative, the family faces changes in its dynamics caused by the crisis it is exposed to. It is the relevance for including the family within the care process. Since nurses are expected to assume a key role for which they need specific competence to intervene in families when experiencing an eventual crisis. The in-service education becomes a strategy of generating new skills and enhances human capital to improve the quality of nursing care. Considering the importance of including family in the care context, a playful tool called Family Nursing Game has been invented for teaching the family, especially by passing a model of family intervention. The strategy is based on the belief of the existence of relationship between game and learning.
"Not a Real Family": Microaggressions Directed toward LGBTQ Families.
Haines, Kari M; Boyer, C Reyn; Giovanazzi, Casey; Galupo, M Paz
2018-01-01
The present study investigates microaggressions toward individuals in lesbian, gay, bisexual, transgender, and queer (LGBTQ) families. Microaggressions are subtle forms of discrimination experienced on a daily basis as verbal or behavioral slights against individuals in oppressed groups. LGBTQ microaggressions are often studied at an individual level and understood as being directed toward an individual based on perceived identity. The present study allows for an understanding of bias directed at the family system level. Participants included 46 adults who identified as being part of an LGBTQ family. Participants completed an online questionnaire and described their experiences of LGBTQ family microaggressions. Thematic analysis revealed that LGBTQ family microaggressions were salient to individuals across multiple family roles. Three specific themes emerged: family legitimacy, conflicts with family values, and gender violation within family. These findings highlight the way LGBTQ microaggressions are influenced by cultural notions of family and impact the family system.
Hsiao, C-Y.
2014-01-01
Background: Down syndrome (DS) affects not only children but also their families. Much remains to be learned about factors that influence how families of children with DS function, especially families in non-Western populations. The purpose of this cross-sectional, correlational study was to examine how family demographics, family demands and…
Stewart, Lisa M.
2013-01-01
This study compared work-family and family-work conflict for employed family caregivers with disability-related care responsibilities in contrast to employed family caregivers with typical care responsibilities. Using data from the 2002 National Study of the Changing Workforce, a population-based survey of the U.S. workforce, formal and informal…
Directory of Open Access Journals (Sweden)
Paulo Henrique Mazza Rodrigues
2000-01-01
Full Text Available Foram estudados os efeitos da lasalocida sódica e de diferentes proporções volumoso:concentrados sobre a degradabilidade da fibra (FDN e FDA e PB através de experimento em Quadrado Latino 4 x 4, utilizando-se quatro fêmeas bovinas dotadas de cânulas ruminais, pesando em média 500 kg de peso vivo. Os tratamentos foram dispostos em arranjo fatorial 2 x 2 com 40% ou 70% de volumoso na dieta (39% ou 59% de FDN e zero ou 200 mg de lasalocida/animal/dia. Utilizaram-se subperíodos de 21 dias, sendo os 16 primeiros destinados à adaptação dos animais à dieta, composta de feno de Coast Cross (Cynodon dactylon e mistura de concentrados. O ensaio de degradabilidade in situ pela técnica dos sacos de náilon foi realizado do 17º ao 21º dia, incubando-se o farelo de soja durante 0, 1,5, 3, 6, 12, 24 e 48 horas e o feno por 0, 6, 12, 24, 48, 72 e 96 horas. Interação foi observada entre lasalocida e a proporção volumoso:concentrados da dieta sobre a degradabilidade efetiva da FDN e FDA do feno (p < 0,05. Na ausência de lasalocida, menor proporção de volumoso diminuiu a degradabilidade da FDN e FDA em 12,0% e 12,7%, respectivamente, enquanto na sua presença as diminuições foram de 7,0% e 4,9%. Nenhum dos tratamentos alterou significativamente a degradabilidade efetiva da PB do farelo de soja.
Directory of Open Access Journals (Sweden)
Gladys Ferreira de Sousa
2003-01-01
. This work have undertaken a survey and phytosociological analysis of some aspects of weed species that occur in agroforestry systems with cupuassu. The treatments consisted of three crops arrangements (cassava+fruit trees; annuals crops+fruit trees; passion fruit+fruit trees, and three fertilizer management (NPK+OM, with Phosphorus and Phosphorus+leguminous. Three harvests of weed plants were accomplished, being six samples of 0,25 m² per plot. The identification of the species of the weed plants were carried out in the laboratory. The 55 weed species identified were distributed in 23 botanical families, being 43 of dicotyledonous species, 11 of monocotyledonous, and one of pteridophyta. The families Poaceae (monocotyledonous and Asteraceae (dicotyledonous were the most frequent and with large number of individuals. The most frequent species and with large number of plants per m² were Paspalum conjugatum P.J. Bergius (area A and Homolepis aturensis (Kunth Chase (area B of the Poaceae family; Ageratum conyzoides L. of the Asteraceae family, presented the largest density. The similarity coefficients varied among the areas studied, being the largest indexes observed in the treatments that received fertilizers with organic matter (NPK+OM, particularly in the system cassava+fruit trees. The agricultural practices and the soil and crops management systems, had a great influence to the flora composition and in the weed plants communities size in each local area. The number of monocotyledonous was smaller in the treatment with NPK+OM than in the other treatments.
Directory of Open Access Journals (Sweden)
Monier Abd EL-GHANI
2015-03-01
Full Text Available The relationship between vegetation and soil supporting the habitats in 4 new industrial cities were assessed. Five main habitats were distinguished from inner city toward outskirts: lawns, home gardens, public gardens, waste lands and desert outskirts. After application of Twinspan, 26 vegetation groups were identified in the 5 recognized habitats, demonstrating that some groups are chatracteristic of a certain city, e.g. Asphodelus aestivus - Deverra tortuosa - Thymelaea hirsuta group was confined to the desert habitat of Burg El-Arab city; Thymelaea hirsuta - Linaria albifrons and Atriplex halimus - Atriplex lindleyi subsp. inflata - Suaeda vermiculata - Typha domingensis groups were found in the waste lands of Burg El-Arab city; Conyza bonariensis - Cynodon dactylon - Sonchus oleraceus group in the home garden habitat of 10th Ranadan city; Cynodon dactylon group in the lawns of Burg El-Arab city; Bassia indica - Plantago major group in the public gardens of Burg El-Arab city; Oxalis corniculata - Plantago lagopus group in the public gardens of 10th Ramadan city; Sonchus oleraceus - Cynodon dactylon and Dactyloctenium aegyptium - Leptochloa fusca - Phragmites australis groups in the public gardens of 6th October city. Silt, clay, organic matter, carbonates and carbon contents showed significant diffrences among the 5 habitats.
Family therapy Overview Family therapy is a type of psychological counseling (psychotherapy) that can help family members improve communication and resolve conflicts. Family therapy is usually provided by a psychologist, ...
24 CFR 982.515 - Family share: Family responsibility.
2010-04-01
... URBAN DEVELOPMENT SECTION 8 TENANT BASED ASSISTANCE: HOUSING CHOICE VOUCHER PROGRAM Rent and Housing Assistance Payment § 982.515 Family share: Family responsibility. (a) The family share is calculated by subtracting the amount of the housing assistance payment from the gross rent. (b) The family rent to owner is...
Getting a High-Speed Family Connection: Associations between Family Media Use and Family Connection
Padilla-Walker, Laura M.; Coyne, Sarah M.; Fraser, Ashley M.
2012-01-01
The way families have used the media has substantially changed over the past decade. Within the framework of family systems theory, this paper examines the relations between family media use and family connection in a sample of 453 adolescents (mean age of child = 14.32 years, SD = 0.98, 52% female) and their parents. Results revealed that cell…
Family dynamics and infant temperament in Danish families
DEFF Research Database (Denmark)
Wilson, M.E.; Hall, Elisabeth O.C.; White, M.A.
1994-01-01
temperament. A sample of 99 families in Odense, Denmark, completed the Family Dynamics Measure in the third trimester of pregnancy and again when the infant was 8-9 months old. At this second time, the mothers also completed the Revised Infant Temperament Questionnaire. Overall we found small changes......Transition to parenthood involves the fine balance of family dynamics which both affect, and are affected by, the infant's temperament. The purpose of this study was to investigate changes in family dynamics over the transition to parenthood and the relationship of family dynamics to infant......, although always in a negative direction, in family dynamics over this transition. The largest change was an increase in perceived role conflict reported by both mothers and fathers. Mothers reported more role conflict than fathers. Positive family dynamics were related to infant rhythmicity....
Family dynamics and infant temperament in Danish families
DEFF Research Database (Denmark)
Wilson, M.E.; Hall, Elisabeth O.C.; White, M.A.
1994-01-01
, although always in a negative direction, in family dynamics over this transition. The largest change was an increase in perceived role conflict reported by both mothers and fathers. Mothers reported more role conflict than fathers. Positive family dynamics were related to infant rhythmicity.......Transition to parenthood involves the fine balance of family dynamics which both affect, and are affected by, the infant's temperament. The purpose of this study was to investigate changes in family dynamics over the transition to parenthood and the relationship of family dynamics to infant...... temperament. A sample of 99 families in Odense, Denmark, completed the Family Dynamics Measure in the third trimester of pregnancy and again when the infant was 8-9 months old. At this second time, the mothers also completed the Revised Infant Temperament Questionnaire. Overall we found small changes...
Family governance practices and teambuilding : Paradox of the enterprising family
Berent-Braun, M.M.; Uhlaner, L.M.
2012-01-01
This paper explores the relationship between family governance practices and financial performance of the business and family assets of business-owning families. A business-owning family that shares a focus on preserving and growing wealth as a family is defined as the enterprising family. Results
Medicinal Plants in the Flora of Luhansk Region
Directory of Open Access Journals (Sweden)
S.Yu. Naumov
2016-11-01
Full Text Available To establish a resource base of medicinal plants of Donbass, and to develop methods for their balanced use, it is necessary to conduct an inventory and analysis of the spread of wild species, that recently was not carried out in Luhansk and Donetsk region. These circumstances have served as an incentive to carry out special investigations. Test species belong to 403 genus and 108 families. List of vascular plants of Luhansk region has more than 1,200 species. We have established that in the study area, there are 718 species of medicinal plants, representing 60 % of the total flora of the region, covering so much of the taxonomic diversity of Donbass flora. The family of the Asteraceae (105 species, 50 genuses is different in terms of the greatest number of species of medicinal plants and genus family. The families of Brassicaceae, Fabaceae, Apiaceae, Lamiaceae and Poaceae contain more than 40 species, the families of Apiaceae и Rosaceae — over 30 species, Caryophylaceae и Polygonaceae — more than 20 species, a total of 301 species. The remaining 99 families presented a small number of basic taxonomic units. The species Viscum album, Ajuga chia, Salvia nemorosa were found during expeditions. These species have not been previously described for the region.
DEFF Research Database (Denmark)
Christoffersen, Mogens
The situation in the family preceding a family separation is studied here, to identify risk factors for family dissolution. Information registers covering prospective statistics about health aspects, demographic variables, family violence, self-destructive behaviour, unemployment, and the spousal...
Vuorenmaa, M; Perälä, M-L; Halme, N; Kaunonen, M; Åstedt-Kurki, P
2016-01-01
Parental empowerment signifies parents' sense of confidence in managing their children, interacting with services that their children use and improving child care services. High empowerment is associated with parents' resilience to demands and their confidence to make decisions and take actions that positively affect their families. Most families with children access various healthcare and education services. Professionals working in these services are therefore ideally placed to reinforce parental empowerment. However, little is known about the characteristics associated with parental empowerment within a generic sample of parents or in the context of basic child care services. The aim of this study was to assess how family characteristics are associated with maternal and paternal empowerment in the family, in service situations and in the service system. Parental empowerment was measured among 955 parents (mothers = 571; fathers = 384) of children aged 0-9 years using the Generic Family Empowerment Scale. Family characteristics were assessed through questions on children, parents and the life situation. Associations between empowerment and family characteristics were evaluated using one-way analysis of variance and t-test. Parental empowerment was predicted by multiple linear regression analysis. Parents' concerns related to their parenting, such as whether they possessed sufficient skills as a parent or losing their temper with children, as well as experiences of stress in everyday life, were negatively associated with all dimensions of maternal and paternal empowerment. Both determinants were more common and more significant in empowerment than child-related problems. Promoting parental self-confidence and providing appropriate emotional and concrete support for everyday functioning may reinforce parental empowerment, thereby enhancing families' well-being and coping, as well as improving their access to required services and timely support. Finally
Miner, Dianne Cooney
2003-01-01
The study of the family in the Caribbean originated with European scholars who assumed the universality of the patriarchal nuclear family and the primacy of this structure to the healthy functioning of society. Matrifocal Caribbean families thus were seen as chaotic and disorganized and inadequate to perform the essential tasks of the social system. This article provides a more current discussion of the Jamaican family. It argues that its structure is the result of the agency and adaptation of its members and not the root cause of the increasing marginalization of peoples in the developing world. The article focuses on families living in poverty and how the family structure supports essential family functions, adaptations, and survival.
Small family, smart family? : family size and the IQ scores of young men
Black, Sandra E.; Devereux, Paul J.; Salvanes, Kjell Gunnar
2007-01-01
How do families influence the ability of children? Cognitive skills have been shown to be a strong predictor of educational attainment and future labor market success; as a result, understanding the determinants of cognitive skills can lead to a better understanding of children's long run outcomes. This paper uses a large dataset on the male population of Norway and focuses on one family characteristic: the effect of family size on IQ. Because of the endogeneity of family size, we instrument ...
Family Capital: Implications for Interventions with Families
Belcher, John R.; Peckuonis, Edward V.; Deforge, Bruce R.
2011-01-01
Social capital has been extensively discussed in the literature as building blocks that individuals and communities utilize to leverage system resources. Similarly, some families also create capital, which can enable members of the family, such as children, to successfully negotiate the outside world. Families in poverty confront serious…
Xyloglucans of Monocotyledons Have Diverse Structures
Institute of Scientific and Technical Information of China (English)
Yves S.Y. Hsieh; Philip J. Harris
2009-01-01
Except in the Poaceae, little is known about the structures of the xyloglucans in the primary walls of mono-cotyledons. Xyloglucan structures in a range of monocotyledon species were examined. Wall preparations were isolated, extracted with 6 M sodium hydroxide, and the extracts treated with a xyloglucan-specific endo-(1→4)-β-glucanase prep-aration. The oligosaccharides released were analyzed by high-performance anion-exchange chromatography and by ma-trix-assisted laser-desorption ionization time-of-flight mass spectrometry. Oligosaccharide profiles of the non-commelinid monocotyledons were similar to those of most eudicotyledons, indicating the xyloglucans were fucogalactoxyloglucans, with a XXXG ~a core motif and the fucosylated units XXFG and XLFG. An exception was Lemna minor (Araceae), which yielded no fucosylated oligosaccharides and had both XXXG and XXG_n core motifs. Except for the Arecales (palms) and the Dasypogonaceae, which had fucogalactoxyloglucans, the xyloglucans of the commelinid monocotyledons were structurally different. The Zingiberales and Commelinales had xyloglucans with both XXG_n and XXXG core motifs; small proportions of XXFG units, but no XLFG units, were present. In the Poales, the Poaceae had xyloglucans with a XXG_n core motif and no fucosylated units. In the other Poales families, some had both XXXG and XXG_n core motifs, others had only XXXG; XXFG units were present, but XLFG units were not.
Family medical leave as a resilience resource for family caregivers.
Swanke, Jayme; Zeman, Laura Dreuth
2009-01-01
Case managers mobilize family networks to care for patients. Family medical leave can be a resource for case managers who seek to enhance resilience among family caregivers. The Family Medical Leave Act, passed in 1993, was the first U.S. policy to regulate employee leaves from work for family care purposes (29 CFR 825.102). This policy offers family caregivers increased flexibility and equality. Current and emerging policies also can reduce financial strain. The discussion examines how case managers can integrate family medical leave into best-practice models to support patients and family caregivers.
Nontraditional family romance.
Corbett, K
2001-07-01
Family stories lie at the heart of psychoanalytic developmental theory and psychoanalytic clinical technique, but whose family? Increasingly, lesbian and gay families, multiparent families, and single-parent families are relying on modern reproductive technologies to form families. The contemplation of these nontraditional families and the vicissitudes of contemporary reproduction lead to an unknowing of what families are, including the ways in which psychoanalysts configure the family within developmental theory. This article focuses on the stories that families tell in order to account for their formation--stories that include narratives about parental union, parental sexuality, and conception. The author addresses three constructs that inform family stories and that require rethinking in light of the category crises posed by and for the nontraditional family: (1) normative logic, (2) family reverie and the construction of a family romance, and (3) the primal scene. These constructs are examined in tandem with detailed clinical material taken from the psychotherapy of a seven-year-old boy and his two mothers.
Urinary diseases and ethnobotany among pastoral nomads in the Middle East.
Abu-Rabia, Aref
2005-08-02
This article is derived from a broad, twenty-year study of ethnobotany and folk medicine among pastoral nomads in the Middle East which took place from 1984 to 2004. The article presents examples of different treatments of diseases and disorders of the urinary tract carried out by healer herbalists. The preparation of remedies includes boiling infusions, extraction of dry or fresh leaves, flowers, seeds or whole plants. Some of these plants were used both as food and as medicine, by ingesting different parts of the plants, such as leaves, flowers, fruits, and so on, either while soft, cooked or dried. Data were collected by using unstructured interviews and by observation. These plants were identified by healers, patients, and university botanists. This paper identified eighty-five plant species, which belong to thirty-six families. The most representative families are: Asteraceae (8), Brassicaceae (6), Poaceae (6), Umbelliferae (6).
Biodiversity of medicinal plants by Minangkabau ethnic in Guguak Sarai, West Sumatera, Indonesia
Khairiah, A.; Nisyawati, Silalahi, M.
2017-07-01
The research was carried out in Guguak Sarai, West Sumatera, Indonesia. The purpose of this study was to document the diversity of medicinal plants by Minangkabau ethnic base on local knowledge. Data were collected using ethnobotanical approach through open-ended, semi-structured interview and exploration method. The sample consisted of 3 key informants and 94 respondents with provisions age ≥ 30 years old. Data were analyzed qualitatively using descriptive statistics. Total 158 medicinal plants species which belongs to 124 genera and 54 families were reported to be used in against 52 diseases. Among the diseases, gastrointestinal disorders had the highest number of medicinal plants to be used (37 species), skin diseases (36 species), postpartum cures (29 species), urinary tract disorders (26 species) and rheumatism (19 species). Fabaceae (Leguminosae) was the dominant families that used to treat the illness (12 species) followed by Euphorbiaceae, Lamiaceae, Poaceae (10 species) and Asteraceae (9 species).
THE FLORA OF HEKIMDAG (BOZDAG, ESKISEHIR
Directory of Open Access Journals (Sweden)
Murat ARDIÇ
2011-02-01
Full Text Available In this study the flora of Eskişehir Hekimdağ (Bozdağ were investigated. According to Davis's grid system, the research area lies in B3 square. The plant samples collected in this region and determined that there are 59 families, as well as 467 species and subspecies taxa belonging to 219 genera. The phytogeographical distribution is as follows: 49 Mediterranean, 31 Euro-Siberian, 19 Irano-Turanian, 6 Euxin and 362 unknown or other-regional elements. The largest families are Asteraceae (50, Fabaceae (38, Lamiaceae (24, Poaceae (21 and Liliaceae (18 in terms of the number of species and subspecies included. Genera represented by the highest number of species are Centaurea (7, Alyssum (6, Silene, Astragalus, Trifolium, Lathyrus ve Campanula (5 . The number of endemic taxa within the study area is 41 (10.86%. 13 taxa are new records for the B3 square.
Flora in abandoned fields and adjacent crop fields on rendzina soils in the Zamość region
Directory of Open Access Journals (Sweden)
Marta Ziemińska-Smyk
2015-10-01
Full Text Available A floristic inventory of segetal flora was carried out in abandoned fields and adjacent crop fields on rendzina soils in the Zamość region in the year 2010. This study found a total of 130 weed species belonging to 30 botanical families. The following families were represented most frequently: Asteraceae, Fabaceae, Poaceae, Lamiaceae, Scrophulariaceae, and Brassicaceae. In the segetal flora, apophytes are dominant (55% of the total flora, with the highest number of meadow and xerothermic grassland species among them. Archeophytes (38% predominate in the group of anthropophytes. The species characterized by the highest constancy classes and reaching the highest cover indices posed the greatest threat to crops in the study area. The following weeds are most frequently found in fallow fields: Consolida regalis, Cichorium intybus, and Sinapis arvensis, while Papaver rhoeas is the greatest threat to cereal crops grown on rendzina soils.
A floristic study of Salaheddinkola Forests, Nowshahr, Iran
Directory of Open Access Journals (Sweden)
Omid Esmailzadeh
2014-11-01
Full Text Available This paper reports the floristic survey on the Salaheddinkola forests (Nowshahr. These forests posses high variations in elevation ranges and special physiographic properties, which form the growth platform for most of the typical Hyrcanian forest species. The floristic-physiognomic investigation of the region was performed using field-walk procedure and revealed 237 plant species belonging to 196 genera and 85 families. The important families were Asteraceae, Poaceae, Rosaceae, Lamiaceae and Fabaceae with 23, 20, 14, 13 and 10 species, respectively which represented 33.17 percent of the total species. According to Raunkaiaer method, Cryptophytes (28.7%, Hemicryptophytes (27.5% and Phanerophytes (22.5% were the most important structure groups of the local biological spectrum followed by Therophytes (17.7% and Chamaephytes (3.4% Chorotypes. According to Zohary, most of the identified species belonged to Euro-Siberian and Pluriregional regions with 79 (33.6% and 62 (26% taxa, respectively.
Urinary diseases and ethnobotany among pastoral nomads in the Middle East
Abu-Rabia, Aref
2005-01-01
This article is derived from a broad, twenty-year study of ethnobotany and folk medicine among pastoral nomads in the Middle East which took place from 1984 to 2004. The article presents examples of different treatments of diseases and disorders of the urinary tract carried out by healer herbalists. The preparation of remedies includes boiling infusions, extraction of dry or fresh leaves, flowers, seeds or whole plants. Some of these plants were used both as food and as medicine, by ingesting different parts of the plants, such as leaves, flowers, fruits, and so on, either while soft, cooked or dried. Data were collected by using unstructured interviews and by observation. These plants were identified by healers, patients, and university botanists. This paper identified eighty-five plant species, which belong to thirty-six families. The most representative families are: Asteraceae (8), Brassicaceae (6), Poaceae (6), Umbelliferae (6). PMID:16270930
Magnoliophyta species of restinga, state of Pernambuco, Brazil.
Directory of Open Access Journals (Sweden)
Zickel, C. S.
2007-01-01
Full Text Available Restinga vegetation occurs along the entire coast of Brazil. The 187 km of coastline of the state ofPernambuco demonstrates a diversity of habitats, such as beaches, dunes, and restingas. The present study sought toelaborate a checklist of the phanerogamic species found there. The species listed were compiled from surveysundertaken between 1951 and 2007, as well as from herbaria collections in that state. A total of 477 species distributedamong 303 genera and 95 families were encountered. The families with the greatest numbers of species were Poaceae(39 species, Fabaceae (34, Cyperaceae (26, Euphorbiaceae (25, Myrtaceae (24, Rubiaceae (20, Caesalpiniaceae(17, Mimosaceae (16, Asteraceae (14, Orchidaceae (14, Bromeliaceae (9, Boraginaceae (8, Malvaceae (8,Solanaceae (8, and Annonaceae, Araceae, Chrysobalanaceae, Malpighiaceae, and Melastomataceae (7 each.Approximately 60 % of the species were common to other restinga areas in northeastern Brazil, and 39.3 % wererestricted to the coast of Pernambuco.
Dual-career family as an exampleof egalitarian family
Directory of Open Access Journals (Sweden)
Joanna Ostrouch-Kamińska
2011-11-01
Full Text Available The economic, cultural, and social transformation, growth of women's economic strength as well as the level of their education, and development of ideas of equal rights of women and men on the labour market and in social life cause changes in gender relation in the family. Poles more and more often declare and support egalitarian family, and a new model of a family appears among existing ones – dual-career family.The main aim of the article is to consider the sources of its rise, description of gender positions in marital relation, the division of tasks and responsibilities, possible dilemmas and conflicts, but also emotional, intellectual and social advantages. The analysis were put into context of changes in defining and describing family, and also in context of different family discourses. One of them was underlined the most – egalitarian one as the most approximate to the way of defining and understanding dual-career family model.
Skelton, JA; Buehler, C; Irby, MB; Grzywacz, JG
2014-01-01
Family-based approaches to pediatric obesity treatment are considered the ‘gold-standard,’ and are recommended for facilitating behavior change to improve child weight status and health. If family-based approaches are to be truly rooted in the family, clinicians and researchers must consider family process and function in designing effective interventions. To bring a better understanding of family complexities to family-based treatment, two relevant reviews were conducted and are presented: (1) a review of prominent and established theories of the family that may provide a more comprehensive and in-depth approach for addressing pediatric obesity; and (2) a systematic review of the literature to identify the use of prominent family theories in pediatric obesity research, which found little use of theories in intervention studies. Overlapping concepts across theories include: families are a system, with interdependence of units; the idea that families are goal-directed and seek balance; and the physical and social environment imposes demands on families. Family-focused theories provide valuable insight into the complexities of families. Increased use of these theories in both research and practice may identify key leverage points in family process and function to prevent the development of or more effectively treat obesity. The field of family studies provides an innovative approach to the difficult problem of pediatric obesity, building on the long-established approach of family-based treatment. PMID:22531090
Structural and Functional Diversity of Weed Species in Organic and Conventional Rice Agro-Ecosystems
Directory of Open Access Journals (Sweden)
S. Y. Mousawi Toghani
2016-02-01
Full Text Available Introduction Diversity reflects the complexity of a system and can maintain its sustainability. Higherdiversity, results in higher inherent complexity of agro-ecosystems and strengthen their processes. It is necessary to realize the spatial distribution and temporal properties of the biodiversity components in agro-ecosystems, for the conservation and optimal utilization. Since weeds as a complementary component of agro-ecosystems and are inseparable, so the study of species, their functional and structural diversity of them can play an important role in weed management and balance in ecological systems. Materials and Methods This study was performed to determine the effects of different management systems on structural, and functional diversity of paddy weeds in Mazandaran province. Three rice fields, ranged from 0.3 to 0.5 ha, were chosen for each management system. Samples were collected from three fields running under each selected management system (organic and conventional. Data (number of weed species and their density were randomly gathered from 9 quadrates (1m×1m per each field in four stages (tillering, stem elongation, grain filling and after harvest. The diversity, evenness, frequency and similarity indices for weeds were determined at genera and species level. Data analysis carried out through T-test and grouping performed via cluster analysis as hierarchy. Results and Discussion All monitored weeds can be classified into four plant family including cereals (Poaceae, sedges (Cyperaceae, plantain (Plantaginaceae and chicory (Asteraceae.Under conventional systems the values of weed diversity indices were higher during tillering and stem elongation compared with organic ones, and were lower during grain filling and after harvest stages. However indices of weed evenness showed contrary tendency. Both Sympson and Shanon-Wiener diversity indices, consist of two clusters in 76% similarity. Evenness indices of Kamargo and Smith
Use of family management styles in family intervention research.
Alderfer, Melissa A
2006-01-01
Family management styles (FMSs) explain some of the complexities embedded in a family with a child who has chronic illness. The FMS typologies provide descriptions of family adjustment and management of care. These 5 distinct patterns may be valuable in tailoring and evaluating family interventions in research.
Seita, John R.
2014-01-01
Family privilege is defined as "strengths and supports gained through primary caring relationships." A generation ago, the typical family included two parents and a bevy of kids living under one roof. Now, every variation of blended caregiving qualifies as family. But over the long arc of human history, a real family was a…
Medicinal plants used in the Uzunköprü district of Edirne, Turkey
Directory of Open Access Journals (Sweden)
Fatma Güneş
2017-12-01
Full Text Available This study examined the use of plants in Uzunköprü and surrounding villages in the years 2013–2015 during the flowering and fruiting season of the studied plants (March–October. Interviews were carried out face-to-face with members of the community. Fifty-seven people in 55 villages were interviewed. Overall, medicinal plants from 96 taxa belonging to 45 families were recorded. Traditional medicinal plants were used to treat 80 diseases and ailments such as diabetes, cold, flu, cough, stomachache, and hemorrhoids. According to the results, the largest eight families are Rosaceae, Lamiaceae, Asteraceae, Poaceae, Ranunculaceae, Malvaceae, Cucurbitaceae, and Brassicaceae. The most commonly used species were Anthemis cretica subsp. tenuiloba, Cotinus coggyria, Datura stramonium, Ecballium elaterium, Hypericum perforatum, Prunus spinosa, Pyrus elaeagnifolia subsp. bulgarica, Rosa canina, Sambucus ebulus, Tribulus terestris, Urtica dioica. The herbarium numbers, Latin and local names, families, village numbers, parts used, usage forms, and uses were listed alphabetically in a table. In this study, 219 local names were identified.
Small Family, Smart Family? Family Size and the IQ Scores of Young Men
Black, Sandra E.; Devereux, Paul J.; Salvanes, Kjell G.
2010-01-01
This paper uses Norwegian data to estimate the effect of family size on IQ scores of men. Instrumental variables (IV) estimates using sex composition as an instrument show no significant negative effect of family size; however, IV estimates using twins imply that family size has a negative effect on IQ scores. Our results suggest that the effect…
Understanding familial and non-familial renal cell cancer.
Bodmer, Daniëlle; van den Hurk, Wilhelmina; van Groningen, Jan J M; Eleveld, Marc J; Martens, Gerard J M; Weterman, Marian A J; van Kessel, Ad Geurts
2002-10-01
Molecular genetic analysis of familial and non-familial cases of conventional renal cell carcinoma (RCC) revealed a critical role(s) for multiple genes on human chromosome 3. For some of these genes, e.g. VHL, such a role has been firmly established, whereas for others, definite confirmation is still pending. Additionally, a novel role for constitutional chromosome 3 translocations as risk factors for conventional RCC development is rapidly emerging. Also, several candidate loci have been mapped to other chromosomes in both familial and non-familial RCCs of distinct histologic subtypes. The MET gene on chromosome 7, for example, was found to be involved in both forms of papillary RCC. A PRCC-TFE3 fusion gene is typically encountered in t(X;1)-positive non-familial papillary RCCs and results in abrogation of the cell cycle mitotic spindle checkpoint in a dominant-negative fashion, thus leading to RCC. Together, these data turn human RCC into a model system in which different aspects of both familial and non-familial syndromes may act as novel paradigms for cancer development.
Directory of Open Access Journals (Sweden)
Amit Kumar
2014-09-01
Full Text Available 'him-Padap-Sankalan' is a digital directory of floral resources of Himachal Pradesh H.P., a biologically rich state of the Himalayan Biodiversity hotspot. It provides information on nomenclature, taxonomic classification, local name(s, trade name(s and uses of 3348 plant species along with maps showing their distribution in H.P. The information housed in 'Him-Padap-Sankalan' has been compiled from published sources, primarily the Flora of Himachal Pradesh: Analysis. The Graphic User Interface of the 'him-Padap-Sankalan' has been prepared using ASP.Net having MS-Access database in the back end. The 'scientific names', 'trade names', 'local names', 'synonyms', 'genus' and 'species' are the various search modules of 'him-Padap-Sankalan', which can be accessed using an internet browser connected through local area network. Analysis of information reveals that of the 201 families, Poaceae, Asteraceae, Papilionaceae, Scrophularariaceae, Rosaceae, Cyperaceae, Lamiaceae, Ranunculaceae, Brassicaceae and Apiaceae are the ten dominat families in the state. 24 families and 18 genera are common to all the 12 districts of H.P. The maximum number of families, genera and species are in Shimla district and the least in Bilaspur district of H.P.
A floristic study of Kuh-e Khom in Tang Shekan region of Arsanjan county in Fars province
Directory of Open Access Journals (Sweden)
Masumeh Zare
2015-10-01
Full Text Available A floristic study was done in Kuh-e Khom in east of Arsanjan county as part of the southern Zagros in Fars province. Altitude of the region is ranged from 1740 to 3270 m above sea level. The flora of the region with an emphasis on identifying habitats and the effect of altitude on vegetation were studied and sampling was done from 2010 to 2012. Totally, 440 plant specimens of vascular plant were collected which were belonging to 50 families, 198 genera and 287 species. The angiosperm plants were dominant and from them the dicot plants with 37 families, 167 genera and 246 species had the most diversity. The monocots plants with 9 families, 27 genera and 37 species were the second diversely group in the region. Gymnosperms and Pteridophyte each with two species had the lowest number of species. In respect to species richness, Asteraceae (43 species was the largest family and after that Breassicaceae (33 species, Poaceae (24 species, Fabaceae (24 species, Lamiaceae (22 species, Caryophyllaceae (19 species and Boraginaceae (13 species had the most species diversity. Half of species were therophyte and 68% of species were belonging to Irano-Turanian region.
Family Functioning and Child Psychopathology: Individual Versus Composite Family Scores.
Mathijssen, Jolanda J. J. P.; Koot, Hans M.; Verhulst, Frank C.; De Bruyn, Eric E. J.; Oud, Johan H. L.
1997-01-01
Examines the relationship of individual family members' perceptions and family mean and discrepancy scores of cohesion and adaptability with child psychopathology in a sample of 138 families. Results indicate that family mean scores, contrary to family discrepancy scores, explain more of the variance in parent-reported child psychopathology than…
Family pediatrics: report of the Task Force on the Family.
Schor, Edward L
2003-06-01
WHY A TASK FORCE ON THE FAMILY? The practice of pediatrics is unique among medical specialties in many ways, among which is the nearly certain presence of a parent when health care services are provided for the patient. Regardless of whether parents or other family members are physically present, their influence is pervasive. Families are the most central and enduring influence in children's lives. Parents are also central in pediatric care. The health and well-being of children are inextricably linked to their parents' physical, emotional and social health, social circumstances, and child-rearing practices. The rising incidence of behavior problems among children attests to some families' inability to cope with the increasing stresses they are experiencing and their need for assistance. When a family's distress finds its voice in a child's symptoms, pediatricians are often parents' first source for help. There is enormous diversity among families-diversity in the composition of families, in their ethnic and racial heritage, in their religious and spiritual orientation, in how they communicate, in the time they spend together, in their commitment to individual family members, in their connections to their community, in their experiences, and in their ability to adapt to stress. Within families, individuals are different from one another as well. Pediatricians are especially sensitive to differences among children-in their temperaments and personalities, in their innate and learned abilities, and in how they view themselves and respond to the world around them. It is remarkable and a testament to the effort of parents and to the resilience of children that most families function well and most children succeed in life. Family life in the United States has been subjected to extensive scrutiny and frequent commentary, yet even when those activities have been informed by research, they tend to be influenced by personal experience within families and by individual and
Maternity and family leave policies in rural family practices.
Mainguy, S; Crouse, B J
1998-09-01
To help recruit and retain physicians, especially women, rural family practice groups need to establish policies regarding maternity and other family leaves. Also important are policies regarding paternity leave, adoptive leave, and leave to care for elderly parents. We surveyed members of the American Academy of Family Physicians in rural practice in 1995 to assess the prevalence of leave policies, the degree to which physicians are taking family leave, and the characteristics of ideal policies. Currently, both men and women physicians are taking family leaves of absence, which indicates a need for leave policies. Furthermore, a lack of family leave policies may deter women from entering rural practice.
Opportunity NYC--Family Rewards: Qualitative Study of Family Communication
Fraker, Carolyn A.; Greenberg, David
2011-01-01
Aimed at low-income families in six of New York City's highest-poverty communities, the Family Rewards program ties cash rewards to a pre-specified set of activities. This paper presents the qualitative findings from interviews with 77 families. It examines how families incorporated the program into their households, and specifically the…
A perfect fit: connecting family therapy skills to family business needs.
Cole, Patricia M; Johnson, Kit
2012-06-01
The purpose of this article is to encourage family therapists to become more interested in family business practice. It does so in three ways: (a) highlighting the number of therapists already involved in family business issues; (b) showing the parallels between family business and family therapy by applying family business research findings to couples therapy; (c) discussing how family therapists already have the practice wisdom to be effective in working with family business clients. Limitations of this practice are also discussed along with suggestions for overcoming them. © 2012 American Association for Marriage and Family Therapy.
Directory of Open Access Journals (Sweden)
Leyda Rodríguez
2009-03-01
, savanna, scrublands and altered areas. In middle and tall forests additional collections were made in plots of 0.1 ha. In general, the families with the highest number of species were Melastomataceae (46, Rubiaceae (33, Euphorbiaceae (23, Cyperaceae (19, Myrtaceae (18, Fabaceae (18, Clusiaceae (15, Arecaceae (15, Caesalpiniaceae (14, Chrysobalanaceae (14, Lauraceae (14, Poaceae (13 and Burseraceae (12, being the most representative of the low river basin. The genera with highest number of species are Miconia (17, Psychotria (13, Ocotea (10, Myrcia (8, Protium (7, Licania (7 and Rhynchospora (7. Melastomataceae and Rubiaceae families predominated in all environments with exception of the savanna. In the forest, Lauraceae, Burseraceae, Arecaceae, Chrysobalanaceae and Euphorbiaceae were the most abundant, as such as Myrtaceae and Cyperaceae in the riverine forests. Cyperaceae and Poaceae predominated in morichal and savanna. Nineteen species were previously reported only to the Venezuelan Guayana. Twelve of these are only known to the Bolivar state, reinforcing the idea that ecological, topographic and edaphic conditions can determine the presence of particular floristic elements. Human activities are scarce, which is reflected in unaltered vegetal communities and environments. The few altered communities have been colonized by native herbaceous and scrub species.
Family dynamics in families with children with Attention Deficit Hyperactivity Disorder.
Chu, Kangkang; Li, Shasha; Chen, Yixin; Wang, Mingchun
2012-10-01
Development of adjunctive family therapy for the treatment of children with Attention Deficit Hyperactivity Disorder (ADHD) in China requires a detailed understanding of the family dynamics of these families. Assess the family dynamics of families with children who have ADHD in Nanjing, China. Forty-six children 10 to 17 years of age treated at the Nanjing Brain Hospital for ADHD and 46 control children of the same age and gender from schools in Nanjing completed the 19-item Questionnaire of Systematic Family Dynamics (QSFD) which assesses four dimensions of family functioning: Family Atmosphere, Individuation, Moral Absolutism, and Personal Responsibility for Psychological Problems. There were no differences between groups in the perceived causes of psychological problems but the ADHD children reported a poorer family atmosphere, less independence from parents, and more ambiguity about 'right' and 'wrong' in the family. After adjustment for the potential confounding effects of parental education and family economic status, the findings of poorer family atmosphere and less individuation in the ADHD children remained statistically significant. The internal consistency of the four dimensions of the QSFD as completed by the children were poor (alpha=0.44-0.53). This preliminary study on the family dynamics of families with children that have ADHD finds that the ADHD children report a poor family atmosphere and little independence from parents. Further work is needed to validate the methods for assessing family dynamics in Chinese families, particularly when using children as informants, but this method provides valuable information that could be used as the focus of adjunctive family therapy to augment the traditional pharmacological and behavioral approaches to the treatment of ADHD.
Study of a family that overcomes poverty issues: family resilience?
Directory of Open Access Journals (Sweden)
María Ángela Mattar Yunes
2015-09-01
Full Text Available Generally, researches with families focus the difficulties and the negative aspects of family life by bringing up their maladjustments and failures. The interest in family resilience contributes to change this logic by demonstrating the healthy aspects of the family world. Nevertheless, the term resilience presents ideological controversies which are more severe when the discussion is about families and poverty. In order to diminish these contradictions this study adopted a systemic concept of resilience which refers to “those processes that make possible to overcome adversities”. A case study was realized with a low income family who lived in a “very poor” neighborhood in the deep south of Brazil. The methodological strategies to the formal investigation of the family were: life history of the family using the principles of reflexive interview, genograms and data analyses through the approach of the grounded theory. The results showed that the family lived a number of risk experiences such as adoption, privation of basic needs, migration and diseases. Among the indicators of their abilities of “overcoming adversities”, emerged the belief system as the core of the discourses. The family showed that they value the interpersonal relationships through intra and extra familiar interactions based in the patterns of help, learning, affection and solidarity. During the crisis the family gives meaning to the difficulties in order to maintaining the situation controlled through cohesion, open communication, mutual respect and getting support of the extended family/ social network. The pos-adversity period is perceived as benefic and transforming as the family feels stronger and with feelings of solidarity, which is a mark of this family. Their attitude in relation to the neighborhood is active in the sense of promoting the welfare of other families who live in the same social address. Would those above identified processes be adequate to
Exploring families' experiences of health: contributions to a model of family health.
Smith, Sarah L; DeGrace, Beth; Ciro, Carrie; Bax, Ami; Hambrick, Andrea; James, Jennifer; Evans, Alexandra
2017-12-01
Child health and developmental outcomes are influenced by the health of the family and the context created. Research suggests symptoms of poor family health (e.g. suboptimal family interactions, parenting stress) yet there is limited understanding of the factors which contribute to robust family health which may unveil opportunities for targeted intervention and family health promotion. The present study examined families' experiences of family health and factors contributing to family health. We performed a qualitative study using constructivist grounded theory methods to guide our understanding of family health for families with typically developing children aged 5-18. Interviews were conducted in family homes and all members were invited to participate. Data from interviews were transcribed, coded, thematically analyzed, and verified with select families. Ten families, including 10 mothers, 8 fathers, and 15 children participated in the study. Participants described family health as a process of balance, living purposefully, and sharing experiences together in alignment with family identity. Mediating family health were processes of awareness and reflection, and adapting, adjusting, and changing in response to family life including external stress factors. Results highlight the possibility for healthcare practitioners to facilitate families' self-reflection and awareness about their health in order to mediate family health development.
Dangol, D. R.
2012-01-01
This paper enumerates 349 plant species belonging to 77 families of vascular plants collected in the winter seasons of 1996 and 2000 by the flora teams of the Population and Ecology Research Laboratory, Nepal. Of the total species, 249 species belong to dicotyledons, 87 species to monocotyledons and 13 species to pteridophytes. Among the families, dicotyledons contributed the highest number of families (55 in number) followed by monocotyledons and pteridophytes. In the study areas, species composition varies with the type of habitats in the study plots. Some species are unique in distribution. The highest unique species are contributed by common lands (87 spp.), followed by the Chitwan National Park forest (36 spp.) and Tikauli forest (32 spp.). Ageratum houstonianum Mill., Cynodon dactylon (L.) Pers., Imperata cylindrica (L.) Beauv., Rungia parviflora (Retz.) Nees, Saccharum spontaneum L. and Thelypteris auriculata (J. Sm.) K. Iwats are the most common species across all the research blocks. Of the listed plants, many plants have local names either in Nepalese or other tribal languages. Plants are named in different ways on the basis of habit, habitat, smell, taste, and morphological characters of the plants, which are also the basis of nomenclature in plant taxonomy. PMID:22962539
Family Spirituality and Family Health Among Korean-American Elderly Couples.
Kim, Suk-Sun; Kim-Godwin, Yeoun Soo; Koenig, Harold G
2016-04-01
Spirituality has been regarded as an individual and private matter; consequently, research on spirituality as a family phenomenon has been largely neglected. In addition, most published research has been focused on Western cultures. The purpose of this study was to explore the experience of family spirituality and how it influences health among Korean-American elderly couples who are the first generation to reside in the Southeastern USA. A thematic and interpretive data analysis method was used. Thirteen elderly couples (N = 26) participated in in-depth individual interviews in Korean with the primary author. Interviews were audio-taped, transcribed, and then translated by two bilingual researchers with a background in Korean and American culture. Three main themes of family spirituality were identified: (1) family togetherness, (2) family interdependence, and (3) family coping. Also, participants reported that family spirituality strengthened family health by fostering family commitment, improving emotional well-being, developing new healthy behaviors, and providing healing experiences. This finding implies that healthcare providers need to assess family spiritual issues of elderly couples to maximize their strengths for coping with health problems. As our society becomes more culturally diverse, healthcare providers should seek to understand family spirituality from different cultural perspectives to develop a more holistic approach to care.
... Some have two parents, while others have a single parent. Sometimes there is no parent and grandparents raise grandchildren. Some children live in foster families, adoptive families, or in stepfamilies. Families are much ...
A Perfect Fit: Connecting Family Therapy Skills to Family Business Needs
Cole, Patricia M.; Johnson, Kit
2012-01-01
The purpose of this article is to encourage family therapists to become more interested in family business practice. It does so in three ways: (a) highlighting the number of therapists already involved in family business issues; (b) showing the parallels between family business and family therapy by applying family business research findings to…
Directory of Open Access Journals (Sweden)
Bishnu P. Marasini
2015-01-01
Full Text Available The worldwide increase of multidrug resistance in both community- and health-care associated bacterial infections has impaired the current antimicrobial therapy, warranting the search for other alternatives. We aimed to find the in vitro antibacterial activity of ethanolic extracts of 16 different traditionally used medicinal plants of Nepal against 13 clinical and 2 reference bacterial species using microbroth dilution method. The evaluated plants species were found to exert a range of in vitro growth inhibitory action against the tested bacterial species, and Cynodon dactylon was found to exhibit moderate inhibitory action against 13 bacterial species including methicillin-resistant Staphylococcus aureus, imipenem-resistant Pseudomonas aeruginosa, multidrug-resistant Salmonella typhi, and S. typhimurium. The minimum inhibitory concentration (MIC values of tested ethanolic extracts were found from 31 to >25,000 μg/mL. Notably, ethanolic extracts of Cinnamomum camphora, Curculigo orchioides, and Curcuma longa exhibited the highest antibacterial activity against S. pyogenes with a MIC of 49, 49, and 195 μg/mL, respectively; whereas chloroform fraction of Cynodon dactylon exhibited best antibacterial activity against S. aureus with a MIC of 31 μg/mL. Among all, C. dactylon, C. camphora, C. orchioides, and C. longa plant extracts displayed a potential antibacterial activity of MIC < 100 μg/mL.
Ma, Peng-Fei; Guo, Zhen-Hua; Li, De-Zhu
2012-01-01
Compared to their counterparts in animals, the mitochondrial (mt) genomes of angiosperms exhibit a number of unique features. However, unravelling their evolution is hindered by the few completed genomes, of which are essentially Sanger sequenced. While next-generation sequencing technologies have revolutionized chloroplast genome sequencing, they are just beginning to be applied to angiosperm mt genomes. Chloroplast genomes of grasses (Poaceae) have undergone episodic evolution and the evolutionary rate was suggested to be correlated between chloroplast and mt genomes in Poaceae. It is interesting to investigate whether correlated rate change also occurred in grass mt genomes as expected under lineage effects. A time-calibrated phylogenetic tree is needed to examine rate change. We determined a largely completed mt genome from a bamboo, Ferrocalamus rimosivaginus (Poaceae), through Illumina sequencing of total DNA. With combination of de novo and reference-guided assembly, 39.5-fold coverage Illumina reads were finally assembled into scaffolds totalling 432,839 bp. The assembled genome contains nearly the same genes as the completed mt genomes in Poaceae. For examining evolutionary rate in grass mt genomes, we reconstructed a phylogenetic tree including 22 taxa based on 31 mt genes. The topology of the well-resolved tree was almost identical to that inferred from chloroplast genome with only minor difference. The inconsistency possibly derived from long branch attraction in mtDNA tree. By calculating absolute substitution rates, we found significant rate change (∼4-fold) in mt genome before and after the diversification of Poaceae both in synonymous and nonsynonymous terms. Furthermore, the rate change was correlated with that of chloroplast genomes in grasses. Our result demonstrates that it is a rapid and efficient approach to obtain angiosperm mt genome sequences using Illumina sequencing technology. The parallel episodic evolution of mt and chloroplast
Familial risks of glomerulonephritis - a nationwide family study in Sweden.
Akrawi, Delshad Saleh; Li, Xinjun; Sundquist, Jan; Fjellstedt, Erik; Sundquist, Kristina; Zöller, Bengt
2016-08-01
Familial risks of glomerulonephritis (acute, chronic and unspecified glomerulonephritis) have not been studied. This study aims to determine the familial risks of glomerulonephritis. Individuals born from1932 onwards diagnosed with glomerulonephritis (acute [n = 7011], chronic [n = 10,242] and unspecified glomerulonephritis [n = 5762]) were included. The familial risk (Standardized incidence ratio = SIR) was calculated for individuals whose parents/full-siblings were diagnosed with glomerulonephritis compared to those whose parents/full-siblings were not. The procedure was repeated for spouses. Familial concordant risk (same disease in proband and exposed relative) and discordant risk (different disease in proband and exposed relative) of glomerulonephritis were determined. Familial concordant risks (parents/full-sibling history) were: SIR = 3.57 (95% confidence interval, 2.77-4.53) for acute glomerulonephritis, SIR = 3.84 (3.37-4.36) for chronic glomerulonephritis and SIR = 3.75 (2.85-4.83) for unspecified glomerulonephritis. High familial risks were observed if two or more relatives were affected; the SIR was 209.83 (150.51-284.87) in individuals with at least one affected parent as well as one full-sibling. The spouse risk was only moderately increased (SIR = 1.53, 1.33-1.75). Family history of glomerulonephritis is a strong predictor for glomerulonephritis, and is a potentially useful tool in clinical risk assessment. Our data emphasize the contribution of familial factors to the glomerulonephritis burden in the community. Key Messages The familial risks (full-sibling/parent history) of glomerulonephritis (acute, chronic and unspecified glomerulonephritis) have not been determined previously. The familial risks of glomerulonephritis were increased among individuals with family history of acute, chronic or unspecified glomerulonephritis. The familial risks of glomerulonephritis were slightly increased among spouses indicating a
Fermentation characteristics and nutritive value of low moisture ...
African Journals Online (AJOL)
Fermentation characteristics and nutritive value of low moisture silage made from mature bermudagrass ( C. dactylon ) and switchgrass ( P. virgatum ) in mixture with alfalfa ( M. sativa ) or treated with urea and plantain ( Musa AAB )
... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Life Listen Español Text Size Email Print Share Family Arguments Page Content Article Body We seem to ...
... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Life Listen Español Text Size Email Print Share Family Disruptions Page Content Article Body No matter how ...
Family ties and economic stability concerns of migrant labour families in Jordan.
Kamiar, M S; Ismail, H F
1991-12-01
74 labor migrant families from various socioeconomic classes in Amman, Jordan were interviewed to examine changes in relationships among family members, extended family, and neighbors and their concerns about economic stability in the host country, Jordan, and the world market. Another purpose was to determine how current migration policies of the Arab oil-producing countries which prohibit labor migrants from bringing their families to the host country affect labor migration among families. The families consisted of either those who did or did not accompany the labor migrant. Overall labor migration affected unaccompanied families more than accompanied families, e.g., only 19% of the unaccompanied families reported increased family unity compared with 56% of accompanied families. Problems within unaccompanied families increased in 43% of the cases but in only 6% of the accompanied families. Many of these problems resulted in children dropping out of school which reflected the control fathers had within the family, separation, or divorce. Yet labor migration reduced family ties with extended family members and neighbors almost equally for both groups. Accompanied families were not as concerned about economic stability in Jordan as unaccompanied families (38% vs. 50%). Perhaps these families tended not to invest remittances received from the labor migrants working in Arab oil-producing countries in Jordan. Both groups were quite concerned about the economic stability in the host countries (66% and 72%, respectively) and the world market (59% and 62%, respectively), however. Since family unity suffers when families do not accompany labor migrants, it is suggested that oil-producing nations that depend on foreign labor should guarantee family unity as a human right.
Directory of Open Access Journals (Sweden)
Khalil Zaynali
2010-06-01
Full Text Available Abstract Background Sucrose phosphate synthase (SPS is an important component of the plant sucrose biosynthesis pathway. In the monocotyledonous Poaceae, five SPS genes have been identified. Here we present a detailed analysis of the wheat SPSII family in wheat. A set of homoeologue-specific primers was developed in order to permit both the detection of sequence variation, and the dissection of the individual contribution of each homoeologue to the global expression of SPSII. Results The expression in bread wheat over the course of development of various sucrose biosynthesis genes monitored on an Affymetrix array showed that the SPS genes were regulated over time and space. SPSII homoeologue-specific assays were used to show that the three homoeologues contributed differentially to the global expression of SPSII. Genetic mapping placed the set of homoeoloci on the short arms of the homoeologous group 3 chromosomes. A resequencing of the A and B genome copies allowed the detection of four haplotypes at each locus. The 3B copy includes an unspliced intron. A comparison of the sequences of the wheat SPSII orthologues present in the diploid progenitors einkorn, goatgrass and Triticum speltoides, as well as in the more distantly related species barley, rice, sorghum and purple false brome demonstrated that intronic sequence was less well conserved than exonic. Comparative sequence and phylogenetic analysis of SPSII gene showed that false purple brome was more similar to Triticeae than to rice. Wheat - rice synteny was found to be perturbed at the SPS region. Conclusion The homoeologue-specific assays will be suitable to derive associations between SPS functionality and key phenotypic traits. The amplicon sequences derived from the homoeologue-specific primers are informative regarding the evolution of SPSII in a polyploid context.
... Staying Safe Videos for Educators Search English Español Family Meals KidsHealth / For Parents / Family Meals What's in ... even more important as kids get older. Making Family Meals Happen It can be a big challenge ...
Thompson, Tess; Seo, Joann; Griffith, Julia; Baxter, Melanie; James, Aimee; Kaphingst, Kimberly A
2015-04-01
Public health initiatives encourage the public to discuss and record family health history information, which can inform prevention and screening for a variety of conditions. Most research on family health history discussion and collection, however, has predominantly involved White participants and has not considered lay definitions of family or family communication patterns about health. This qualitative study of 32 African American women-16 with a history of cancer-analyzed participants' definitions of family, family communication about health, and collection of family health history information. Family was defined by biological relatedness, social ties, interactions, and proximity. Several participants noted using different definitions of family for different purposes (e.g., biomedical vs. social). Health discussions took place between and within generations and were influenced by structural relationships (e.g., sister) and characteristics of family members (e.g., trustworthiness). Participants described managing tensions between sharing health information and protecting privacy, especially related to generational differences in sharing information, fear of familial conflict or gossip, and denial (sometimes described as refusal to "own" or "claim" a disease). Few participants reported that anyone in their family kept formal family health history records. Results suggest family health history initiatives should address family tensions and communication patterns that affect discussion and collection of family health history information.
Intra-family messaging with family circles
Schatorjé, R.J.W.; Markopoulos, P.; Neustaedter, C.; Harrison, S.; Sellen, A.
2013-01-01
This chapter makes the argument that intra-family communication is not an issue of connectivity anytime anywhere, but of providing communication media that are flexible and expressive allowing families to appropriate them and fit their own idiosyncratic ways of communicating with each other. We
Your family history includes health information about you and your close relatives. Families have many factors in common, including their genes, ... as heart disease, stroke, and cancer. Having a family member with a disease raises your risk, but ...
Bequeathing Family Continuity.
Spanier, Graham B.
1989-01-01
Notes that many children who experience abuse, family disruption, or poverty reach adulthood with a strong commitment to family life. Questions whether changes in American families are indicators of pathology, deterioration, and instability; and asks how dysfunctional families transmit commitment to the concept of family to succeeding generations.…
Type Families with Class, Type Classes with Family
DEFF Research Database (Denmark)
Serrano, Alejandro; Hage, Jurriaan; Bahr, Patrick
2015-01-01
Type classes and type families are key ingredients in Haskell programming. Type classes were introduced to deal with ad-hoc polymorphism, although with the introduction of functional dependencies, their use expanded to type-level programming. Type families also allow encoding type-level functions......, now as rewrite rules. This paper looks at the interplay of type classes and type families, and how to deal with shortcomings in both of them. Furthermore, we show how to use families to simulate classes at the type level. However, type families alone are not enough for simulating a central feature...... of type classes: elaboration, that is, generating code from the derivation of a rewriting. We look at ways to solve this problem in current Haskell, and propose an extension to allow elaboration during the rewriting phase....
Hospitalized elders and family caregivers: a typology of family worry.
Li, Hong
2005-01-01
This qualitative study explored the kinds of worry that family caregivers experience when their older relatives are hospitalized. Little is known about what kinds of worries family caregivers may have in association with the hospitalizations of older relatives. An understanding of the different patterns of family worry may help health care teams intervene more effectively to meet family caregiver's needs by reducing their anxiety. A qualitative descriptive design with Loftland and Loftland (1984) approach for the study of a phenomenon occurring in a social setting was used. A purposeful sample of 10 participants was obtained that included six family caregivers and four nurses. Participants were recruited from two hospitals in the northwest US. Intensive interviews and participant observations were used for data collection, and Loftland and Loftland's (1984) qualitative approach was used for data analysis. Family worry was defined as family caregivers' felt difficulty in fulfilling their roles because of worry. Four categories of family worry were identified as a result of this study: (i) worry about the patient's condition; (ii) worry about the patient's care received from the health care team; (iii) worry about future care for the patient provided by the family caregiver; and (iv) worry about finances. The findings of this pilot study provide nurses with the initial knowledge of the typology of family worry associated with elderly relatives' hospitalizations. The findings of this study may sensitize the nurses to more precisely evaluate family caregivers' worry about their hospitalized elders and provide more effective nursing interventions to improve outcomes of both patients and their family caregivers.
Huynh, Bich Tram; Tual, Séverine; Turbelin, Clément; Pelat, Camille; Cecchi, Lorenzo; D'Amato, Gennaro; Blanchon, Thierry; Annesi-Maesano, Isabella
2010-09-01
To investigate for the first time the short-term effects of airborne pollen counts on general practitioner (GP) consultations for asthma attacks in the Greater Paris area between 2003-2007. Counts were available for common pollens (Betula, Cupressa, Fraxinus and Poaceae). Weekly data on GP visits for asthma attacks were obtained from the French GP Sentinel Network. A quasi-Poisson regression with generalised additive models was implemented. Short-term effects of pollen counts were assessed using single and multi-pollen models after adjustment for air pollution and influenza. A mean weekly incidence rate of 25.4 cases of asthma attacks per 100,000 inhabitants was estimated during the study period. The strongest significant association between asthma attacks and pollen counts was registered for grass (Poaceae) in the same week of asthma attacks, with a slight reduction of the effect observed in the multi-pollen model. Adjusted relative risk for Poaceae was 1.54 (95% CI: 1.33-1.79) with an inter-quartile range increase of 17.6 grains/m3 during the pollen season. For the first time, a significant short-term association was observed between Poaceae pollen counts and consultations for asthma attacks as seen by GPs. These findings need to be confirmed by more consistent time-series and investigations on a daily basis.
Adoptive Family Adjustment and Its Relation to Perceived Family Environment.
Martin, Betty; Kelly, Mary Margaret; Towner-Thyrum, Elizabeth
1999-01-01
Interviewed adopted college students regarding perceptions of adoptive family life. Found that overall satisfaction with adoptive status and family life was the strongest predictor of perceived general family environment. Perception of adoptive parents' communication styles predicted different aspects of family environment. Acknowledgment of life…
Understanding Family Caregiver Communication to Provide Family-Centered Cancer Care.
Wittenberg, Elaine; Buller, Haley; Ferrell, Betty; Koczywas, Marianna; Borneman, Tami
2017-12-01
To describe a family caregiver communication typology and demonstrate identifiable communication challenges among four caregiver types: Manager, Carrier, Partner, and Lone. Case studies based on interviews with oncology family caregivers. Each caregiver type demonstrates unique communication challenges that can be identified. Recognition of a specific caregiver type will help nurses to adapt their own communication to provide tailored support. Family-centered cancer care requires attention to the communication challenges faced by family caregivers. Understanding the challenges among four family caregiver communication types will enable nurses to better address caregiver burden and family conflict. Copyright © 2017 Elsevier Inc. All rights reserved.
The conception of the family in the realm of Lithuanian family policy
Directory of Open Access Journals (Sweden)
VILIJA TARMAGADZĖ
2017-10-01
Full Text Available Th e family, its conceptualization and functioning, as well as family policy are discussed at the personal, community and state level. Th is makes sense because diff erent cultural, historical, ethical, social and other alternations aff ect the assessment and evaluation of these three signifi cant components. Besides family policy is a very important part of public policy in a state, what makes obvious impact on every human life (even those who are living not in a family. Th e aim of this article is to shed light on theconcept of family, family functioning and family policy as three mutually interacting components in a unifi ed narrative. Th e object of study is the concept of family, family functioning and family policy from the perspective of its content. Th e research methods employed include analysis and design of scientifi c literature and documents. Th e article analyzes the defi nition of family, paying particular attention that diff erent authors present various defi nitions of families. Although these defi nitions focus on different aspects of families (e.g. marriage, community, the continuity of the nation, etc., it is shown that in each country the concept of a family is regulated by laws, by which regulations (and other legal documents are prepared. Th e legal concept of a family in Lithuania is still not entirely clear. Th e concept is not defi ned in the Constitution and marriage is not indicated as an obvious attribute of being a family. Meanwhile,the FamilyPolicyConcept(2008 clearly defi nes a family,indicatingthat marriage is necessarily between a manand a woman. Th e recognition of families only by marriage has raised many discussions among politicians, particular public interest groups and private individuals in Lithuania. Th ese discussions became even stronger when the Constitutional Court stated that the FamilyPolicyConcept(2008 contradicts the Constitution of Lithuania. Having in the mind, that the implementation of family
Synthesis, characterization and antimicrobial studies of bio silica ...
Indian Academy of Sciences (India)
2018-05-16
May 16, 2018 ... Cynodon dactylon; green approach; silica nanoparticles; characterization; antimicrobial studies. 1. .... The obtained powder was well-ground with a mortar and ..... Inhalation of SiCl4 fumes irritates nose, throat and lungs.
Yeğen, Hale Nur; Çetin, Merve
2017-01-01
Me and my family, Families poem, Mother-Father, Brother-Sister, Grandparents, Uncle-Aunt, Cousin, Family, Family handgame, My family tree, Activities (Three In a Family), Digital Games, A family poem, Quiz
Wang, Man Ping; Chu, Joanna T W; Viswanath, Kasisomayajula; Wan, Alice; Lam, Tai Hing; Chan, Sophia S
2015-08-24
Family communication is central to the family and its functioning. It is a mutual process in which family members create, share, and regulate meaning. Advancement and proliferation of information and communication technologies (ICTs) continues to change methods of family communication. However, little is known about the use of different methods for family communication and the influence on family well-being. We investigated the sociodemographic factors associated with different methods of family communication and how they are associated with perceived family harmony, happiness, and health (3Hs) among Chinese adults in Hong Kong. Data came from a territory-wide probability-based telephone survey using the Family and Health Information Trend survey (FHInTs). Frequency of family communication using different methods (ie, face-to-face, phone, instant messaging [IM], social media sites, and email) were recoded and classified as frequent (always/sometimes) and nonfrequent (seldom/never) use. Family well-being was measured using 3 questions of perceived family harmony, happiness, and health with higher scores indicating better family well-being. Adjusted odds ratios for family communication methods by sociodemographic characteristics and adjusted beta coefficients for family well-being by communication methods were calculated. A total of 1502 adults were surveyed. Face-to-face (94.85%, 1408/1484) was the most frequent means of communication followed by phone (78.08%, 796/1484), IM (53.64%, 796/1484), social media sites (17.60%, 261/1484), and email (13.39%, 198/1484). Younger age was associated with the use of phone, IM, and social media sites for family communication. Higher educational attainment was associated with more frequent use of all modes of communication, whereas higher family income was only significantly associated with more frequent use of IM and email (P=.001). Face-to-face (beta 0.65, 95% CI 0.33-0.97) and phone use (beta 0.20, 95% CI 0.02-0.38) for family
75 FR 55587 - Family-to-Family Health Information Center Program
2010-09-13
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Health Resources and Services Administration Family-to-Family Health Information Center Program AGENCY: Health Resources and Services Administration, HHS... Vermont Family-to-Family Health Information Center (F2F HIC) grant (H84MC00002) from the Parent to Parent...
Family and Family Change in Ireland: An Overview
Canavan, John
2012-01-01
In Ireland, historically and in the current era, family has been a central concern for society and the State. This article provides a descriptive overview of family life in Ireland and of major family-related changes over the past 40 years. It presents a general framework of analysis within which these changes can be understood, considers the…
... es Autismo? Family Issues Home / Living with Autism / Family Issues Stress Siblings A child’s autism diagnosis affects every member of the family in different ways. Parents/caregivers must now place their ... may put stress on their marriage, other children, work, finances, and ...
Hsiao, Yun-Ju
2013-01-01
The purpose of this study was to investigate the relationship among the quality of life of families that have at least one child with autism spectrum disorder, parental stress level, and partnerships between the family and professionals. Also, parent perceptions of parental stress, family quality of life, and family-professional partnerships were…
Talbot, Yves
1981-01-01
The reconstituted or step-family is becoming more prevalent. The physician who cares for families should be acquainted with the different aspects of such family structure and family functioning. This will enable professionals to better understand and assist their patients, by anticipating the different stresses related to the new family formation, and supporting their adaptation.
Etude des groupements d'adventices dans le Maroc occidental
Directory of Open Access Journals (Sweden)
Douira, A.
2010-01-01
Full Text Available Study of the weeds groupings in western Morocco. An ecological floristic study was carried out in the principal areas of Morocco severely infested by the sterile oats. From 110 readings taken in cereals, the 324 listed species belong to 47 botanical families including 39 dicotyledons. Six families: Asteraceae, Fabaceae, Poaceae, Brassicaceae, Caryophyllaceae and Apiaceae add up 59% of the total staff complement alone. The biological aspect shows a prevalence of the therophytes with 80%, followed by the hemicryptophytes and the geophytes with respectively 11 and 7%. Mediterranean taxa are dominating with 62% of the total staff complement. The taking into account of the index partial of noxiousness made it possible to release 27 problematic species whose Avena sterilis, Phalaris paradoxa, Phalaris brachystachys, Scolymus maculates, Lolium multiflorum, Papaver rhoeas and Lolium rigidum are most harmful by far. The factorial analysis of correspondences (A.F.C., by the means of the edaphic variables, made it possible to highlight six ecological groups.
Directory of Open Access Journals (Sweden)
Ãlvaro José Ojeda
2013-01-01
Full Text Available To determine the chemical composition and nutritive value of selected browse species by buffaloes (Bubalus bubalis L. in a silvopastoral system at a semi-deciduous tropical forest (SDTF, epidermal fragments in fecal samples from 14 males of Murrah breed were evaluated. The animals grazed for 91 days in 85 ha located in Portuguesa State, Venezuela, of which 35 ha corresponded to natural grass pastures (969.3 ± 28.6 kg DM ha-1, and the rest to SDTF with 463 plant ha-1. Eleven botanical families and 22 species were identified, 40.9% belonged to the Fabaceae family. The specie Guazuma ulmifolia (Sterculiaceae had the highest relative dominancy (60.4% and an Importance Value Index of 162.6. 60.4% of epidermal fragments corresponded to herbaceous Poaceae, and the rest was distributed among five different species, with the highest occurrence (94.6% for Samanea saman and Sida acuta. There were differences (P
Directory of Open Access Journals (Sweden)
Jesús Bello Pulido
2016-08-01
Full Text Available As a contribution to the floristic knowledge of xeric zones of the country, a list of angiospermae species is presented that are found forming part of a xerophytic shrubland, located around the Bocaripo-Chacopata lagoon complex, in Araya Peninsula, Sucre state. A total of 56 families was identified which comprised 142 genus, 180 species and 3 intraspecific taxa. The most dominant families regarding to the species number were: Fabaceae (24 spp., Poaceae (15 spp., Cactaceae (10 spp., Asteraceae, Euphorbiaceae (9 spp. c/u, Malvaceae (8 spp., Convolvulaceae (7 spp., Cyperaceae, Amaranthaceae (6 spp. c/u, Portulacaceae and Bromeliaceae (5 spp. c/u. Among the most important genera, were: Senna (4 spp., Capparis, Cyperus, Opuntia, Sida and Tillandsia (3 spp. c/u. The more common biotype was herbaceous vegetation, followed by shrubs, trees, climber, epiphytes and hemiparasites. The list includes two endemic species and 8 other included in the Red Book of the Flora of Venezuela.
Vegetation structure in the mountain forest in the Turquino National Park, province of Granma
Directory of Open Access Journals (Sweden)
José Luis Rodríguez Sosa
2013-12-01
Full Text Available The research was conducted in the Jeringa site of the Turquino National Park in order to characterize the vegetation of a mountain forest fragment with Juglans jamaicensis. Floristic composition, vegetation structure, and the index value of importance were evaluated. Diameter at 1.30 m above the ground and height of all trees greater than 5 cm in diameter was measured. Data were analyzed using canonical correspondence analysis. 776 individuals of 43 species and 41 genera belonging to 30 families, reporting the Rubiaceae family as the richest in species, followed by Amigdalaceae, Araliaceae, Cyatheaceae, Euphorbiaceae, Flacourtiaceae, Meliaceae, Moraceae, Sapindaceae and Poaceae. The tree species with more IVI were the Pseudolmedia spuria, Oxandra laurifolia, Trophis racemosa, Ocotea leucoxylon, Guarea guara, Dendropanax arboreus and Juglans jamaicensis, mainly due to its abundance in the vegetation, but it was found that the main contributor to the organic weight parameter species was the relative frequency.
Hammer, Leslie B.; Kossek, Ellen E.; Anger, W. Kent; Bodner, Todd; Zimmerman, Kristi L.
2010-01-01
Drawing on a conceptual model integrating research on training, work-family interventions, and social support, we conducted a quasi-experimental field study to assess the impact of a supervisory training and self-monitoring intervention designed to increase supervisors' use of family supportive supervisor behaviors. Pre- and post-intervention surveys were completed, nine months apart, by 239 employees at six intervention (N = 117) and six control (N = 122) grocery store sites. Thirty-nine supervisors in the six intervention sites received the training consisting of one hour of self-paced computer-based training, one hour of face-to-face group training, followed by instructions for behavioral self-monitoring (recording the frequency of supportive behaviors) to support on-the-job transfer. Results demonstrated a disordinal interaction for the effect of training and family-to-work conflict on employee job satisfaction, turnover intentions and physical health. In particular, for these outcomes, positive training effects were observed for employees with high family-to-work conflict, while negative training effects were observed for employees with low family-to-work conflict. These moderation effects were mediated by the interactive effect of training and family-to-work conflict on employee perceptions of family-supportive supervisor behaviors. Implications of our findings for future work-family intervention development and evaluation are discussed. PMID:20853943
Education, Parenting and Family: The Social Geographies of Family Learning
Wainwright, Emma; Marandet, Elodie
2017-01-01
This paper explores the relationship between education, parenting and family through the prism and particularities of family learning. Family learning is an example of an educational initiative, primarily aimed at parents and linked to wider policy concerns, which can be explored through a mapping of its social geographies; family learning is…
Work Role Characteristics, Family Structure Demands, and Work/Family Conflict.
Voydanoff, Patricia
1988-01-01
Examined relationships between work role characteristics, family structure demands, and work/family conflict, using data from 757 married men and 270 married women. Found that amount and scheduling of work time, job demands, and presence of children in home were related to work/family conflict. Work role characteristics and family structure…
DEFF Research Database (Denmark)
Jensen, Lotte Groth; Lou, Stina; Aagaard, Jørgen
2017-01-01
: Qualitative interviews with members of volunteer families. Discussion: The families were motivated by helping a vulnerable person and to engaging in a rewarding relationship. However, the families often doubted their personal judgment and relied on mental health workers to act as safety net. Conclusion......Background: Social interventions targeted at people with severe mental illness (SMI) often include volunteers. Volunteers' perspectives are important for these interventions to work. The present paper investigates the experiences of volunteer families who befriend a person with SMI. Material...
Family losses following truncation selection in populations of half-sib families
J. H. Roberds; G. Namkoong; H. Kang
1980-01-01
Family losses during truncation selection may be sizable in populations of half-sib families. Substantial losses may occur even in populations containing little or no variation among families. Heavier losses will occur, however, under conditions of high heritability where there is considerable family variation. Standard deviations and therefore variances of family loss...
Hsiao, Yun-Ju; Higgins, Kyle; Pierce, Tom; Whitby, Peggy J Schaefer; Tandy, Richard D
2017-11-01
Reducing parental stress and improving family quality of Life (FQOL) are continuing concerns for families of children with autism spectrum disorder (ASD). Family-teacher partnerships have been identified as a positive factor to help parents reduce their stress and improve their FQOL. However, the interrelations among parental stress, FQOL, and family-teacher partnerships need to be further examined so as to identify the possible paths to help parents reduce their stress and improve their FQOL. The purpose of this study was to examine the interrelations among these three variables. A total of 236 parents of school children with ASD completed questionnaires, which included three measures: (a) the Beach Center Family Quality of Life Scale, (b) the Parental Stress Scale, and (c) the Beach Center Family-Professional Partnerships Scale. The structural equation modeling was used to analyze the interrelations among these three variables. Perceived parental stress had a direct effect on parental satisfaction concerning FQOL and vice versa. Perceived family-teacher partnerships had a direct effect on FQOL, but did not have a direct effect on parental stress. However, family-teacher partnerships had an indirect effect on parental stress through FQOL. Reducing parental stress could improve FQOL for families of children with ASD and vice versa. Strong family-teacher partnerships could help parents of children with ASD improve their FQOL and indirectly reduce their stress. Copyright © 2017 Elsevier Ltd. All rights reserved.
Family-nurse co-construction of meaning: a central phenomenon of family caring.
Meiers, Sonja J; Tomlinson, Patricia S
2003-06-01
The purpose of the study was to understand and interpret caring in the family health experience by exploring the interactional phenomenon of family-nurse co-construction of meaning in the paediatric intensive care unit (PICU). A hermeneutic phenomenological method within a framework of existentialism and symbolic interactionism was used in the investigation. The convenience sample for this study was four family-nurse dyads, that is four families of critically ill children (all with positive outcomes) and the four nurses assigned to their care who were participating in a larger study. Data were derived from semi-structured interviews regarding significant interactions throughout the child's illness and subsequent significant interactions of families with other nurses and nurses with other families. Trustworthiness of the study was addressed through the criteria of credibility, dependability, transferability and confirmability. Co-construction of meaning in the family health experience was found to have two dimensions: interdependent and independent. Both families and nurses described being like family as an essential component of the interdependent experience. Independent dimensions for families were journeying through troubled waters of learning the meaning of the illness event and sensing family comfort through the nurse's care. Independent dimensions described by nurses were journeying through troubled waters of learning to care for families and living with another's fear. The family-nurse interaction, the relational connection and the evolution of meanings that families and nurses construct, was affirmed as the major vehicle in the co-construction experience. Family caring is influenced by the existential meaning constructing, process-oriented, interactional nature of the family health experience. Caring in the family health experience is enhanced through actions the nurse performs on behalf of, and with, the family while understanding the family's unique
Family size and intra-family inequalities in education in Ouagadougou
Directory of Open Access Journals (Sweden)
James Lachaud
2014-12-01
Full Text Available Background: While the potential benefits for educational investment of decline in family size are well known, some questions have emerged on the distribution of these benefits. Do all the children in a family benefit equitably from the improved conditions brought about by limiting their number? And what are the consequences of reduction in family size for social inequalities in educational opportunity within the family? Objective: This study aims to analyze the inequalities in education between children within the same family in the context of falling fertility in Ouagadougou, the capital city of Burkina Faso. Methods: Inequalities in school attainment are analyzed, first in regard to family sizes and second in terms of gender, birth order, and the interactions between these two variables. Probit models are estimated and adjusted Wald F statistics with Bonferroni corrections for multiple comparisons are computed. Results: The results show that family households with fewer children exhibit different patterns of investment in children's schooling, with lower inequalities between children by gender and birth order. At the post-primary level, however, the firstborn girls in small families appear to be less likely to be enrolled in school compared with those in large families, and also to be disadvantaged in their schooling compared to other children of small families. Conclusions: Reduced fertility appears to have negative effects on the schooling of the oldest girls and beneficial effects for all other children in the household. To mitigate this disadvantage, measures should be considered to reconcile domestic work with the new opportunities emerging from expanding school systems and smaller family sizes.
Effect of family-oriented interviews on family function of young ...
African Journals Online (AJOL)
The outcome of a young person's future is affected by the support received from the family. Support that is received is related to the quality of family functioning of the young person. Family-oriented interview assesses the family of a patient who presents for consultation, through the patient. It diagnoses relationship issues in ...
Family profiles in eating disorders: family functioning and psychopathology
Directory of Open Access Journals (Sweden)
Cerniglia L
2017-10-01
Full Text Available Luca Cerniglia,1 Silvia Cimino,2 Mimma Tafà,2 Eleonora Marzilli,2 Giulia Ballarotto,2 Fabrizia Bracaglia2 1Faculty of Psychology, International Telematic University UNINETTUNO, 2Department of Dynamic and Clinical Psychology, University of Rome “La Sapienza”, Rome, Italy Abstract: Research has studied family functioning in families of patients suffering from eating disorders (EDs, particularly investigating the associations between mothers’ and daughters’ psychopathological symptoms, but limited studies have examined whether there are specific maladaptive psychological profiles characterizing the family as a whole when it includes adolescents with anorexia nervosa (AN, bulimia nervosa (BN, and binge eating disorder (BED. Through the collaboration of a network of public and private consultants, we recruited n=181 adolescents diagnosed for EDs (n=61 with AN, n=60 with BN, and n=60 with BEDs and their parents. Mothers, fathers, and youths were assessed through a self-report measure evaluating family functioning, and adolescents completed a self-report questionnaire assessing psychopathological symptoms. Results showed specific family functioning and psychopathological profiles based on adolescents’ diagnosis. Regression analyses also showed that family functioning characterized by rigidity predicted higher psychopathological symptoms. Our study underlines the importance of involving all members of the family in assessment and intervention programs when adolescent offspring suffer from EDs. Keywords: family functioning, eating disorders, adolescents, psychopathological risk
Directory of Open Access Journals (Sweden)
Heike A. Schänzel
2015-03-01
Full Text Available Purpose – Families represent a large and growing market for the tourism industry. Family tourism is driven by the increasing importance placed on promoting family togetherness, keeping family bonds alive and creating family memories. Predictions for the future of family travel are shaped by changes in demography and social structures. With global mobility families are increasingly geographically dispersed and new family markets are emerging. The purpose of this paper is to discuss the trends that shape the understanding of families and family tourism. Design/methodology/approach – This paper examines ten trends that the authors as experts in the field identify of importance and significance for the future of family tourism. Findings – What emerges is that the future of family tourism lies in capturing the increasing heterogeneity, fluidity and mobility of the family market. Originality/value – The paper contributes to the understanding about the changes taking place in family tourism and what it means to the tourism industry in the future.
Lester, Patricia; Mogil, Catherine; Saltzman, William; Woodward, Kirsten; Nash, William; Leskin, Gregory; Bursch, Brenda; Green, Sara; Pynoos, Robert; Beardslee, William
2011-01-01
The toll of multiple and prolonged deployments on families has become clearer in recent years as military families have seen an increase in childhood anxiety, parental psychological distress, and marital discord. Families overcoming under stress (FOCUS), a family-centered evidence-informed resiliency training program developed at University of California, Los Angeles and Harvard Medical School, is being implemented at military installations through an initiative from Navy Bureau of Medicine and Surgery. The research foundation for FOCUS includes evidence-based preventive interventions that were adapted to meet the specific needs of military families facing combat operational stress associated with wartime deployments. Using a family narrative approach, FOCUS includes a customized approach utilizing core intervention components, including psychoeducation, emotional regulation skills, goal setting and problem solving skills, traumatic stress reminder management techniques, and family communication skills. The purpose of this study is to describe the development and implementation of FOCUS for military families. A case example is also presented.
Parent Perceptions of Family Social Supports in Families With Children With Epilepsy.
Decker, Kim A; Miller, Wendy R; Buelow, Janice M
2016-12-01
When a child is diagnosed with epilepsy, not only has the child's life been disrupted but also the family's sense of normalcy. Although there is considerable literature discussing family concerns and social support issues in families with chronically ill children, a major gap lies in the exploration of how the specifics of childhood epilepsy affect parents and family operations. The purpose of this study was to identify psychosocial care needs of parents of children with epilepsy. Utilizing the Family Systems Nursing theory as a framework, this correlation study examined the relationships among social and community support, family needs, family empowerment, and family quality of life in 29 primary caregivers of a child with epilepsy. These families felt highly supported; they had low needs and high perceptions of empowerment. There was a negative association between social supports and the total family needs survey scale and the subscales of financial support, help regarding explaining to others, and professional support. There was no association between family empowerment or quality of life with parental perceptions of social support. In general, as parental perceptions of family needs increased, perceptions of familial social supports decreased. Further research is recommended to investigate varying socioeconomic status effects in families with children with pediatric epilepsy.
The 15-minute family interview: a family health strategy tool
Directory of Open Access Journals (Sweden)
Mariana Cristina Lobato dos Santos Ribeiro Silva
2013-06-01
Full Text Available The 15-minute family interview is a condensed form of the Calgary Family Assessment and Intervention Models (CFAM and CFIM that aims to contribute to the establishment of a therapeutic relationship between nurses and family and to implement interventions to promote health and suffering relief, even during brief interactions. This study investigated the experience of nurses from the Family Health Strategy (FHS who used the 15-minute interview on postpartum home. The qualitative research was conducted in three stages: participants' training program, utilization of the 15-minute family interview by participants, and interviews with nurses. The data were collected through semi-structured interviews with eight nurses. The thematic analysis revealed two main themes: dealing with the challenge of a new practice and evaluating the assignment. This work shows that this tool can be used to deepen relationships between nurses and families in the Family Health Strategy.
A Family Affair : Explaining Co-Working By Family Members
Ruijter, Esther de; Lippe, Tanja van der; Raub, Werner; Weessie, Jeroen
2008-01-01
This study focuses on co-working by intimate partners and other family members in entrepreneurs’ businesses. We hypothesize that co-working by family is beneficial because it reduces trust problems associated with employment relations. On the other hand, co-working is risky because co-working family
DEFF Research Database (Denmark)
Sehested, Caroline
2012-01-01
I Projekt familielæsning, der er et samarbejde mellem Nationalt Videncenter for Læsning og Hillerød Bibliotek, arbejder vi med at få kontakt til de familier, som biblioteket ellers aldrig ser som brugere og dermed også de børn, der vokser op i familier, for hvem bøger og oplæsningssituationer ikk...... er en selvfølgelig del af barndommen. Det, vi vil undersøge og ønsker at være med til at udvikle hos disse familier, er det, man kan kalde family literacy....
Adhikari,Pralhad
2018-01-01
The phenomenon of positively thinking about work and organization during the family hours by a worker is called work-family harmony. On the fag opposite of work-family conflict is work-family harmony. The work extends/intrudes into the family life of the worker, but in a positive way. This kind of positive thinking about the organization helps person's subjective well-being grow and his mental health is also nourished.
Families of bitangent planes of space curves and minimal non-fibration families
Lubbes, Niels
2014-01-01
. Such families are called minimal non-fibration families. Families of bitangent planes of cone curves correspond to minimal non-fibration families. The main motivation of this paper is to classify minimal non-fibration families. We present algorithms which
Anxiety Disorders and the Family: How families affect psychiatric disorders
Hunsley, John
1991-01-01
Family functioning and anxiety disorders, the most prevalent forms of psychiatric disorder, influence one another. The empirical literature on family studies of anxiety disorder (ie, aggregration of disorders within families), on parent-child relationships and anxiety disorders, and on marriage and anxiety disorders is reviewed. Finally, the challenges for patients and their families of post-traumatic stress disorder are discussed.
Families as Partners: Supporting Family Resiliency through Early Intervention
Frantz, Rebecca; Hansen, Sarah Grace; Squires, Jane; Machalicek, Wendy
2018-01-01
Child development occurs within the context of the child's family, neighborhood, and community environment. Early childhood providers support positive outcomes, not only for the children with whom they directly work with but also for their families. Families of children with developmental delays often experience unique challenges. A family…
Earnings Management and CSR Disclosure. Family vs. Non-Family Firms
Directory of Open Access Journals (Sweden)
Giovanna Gavana
2017-12-01
Full Text Available Building on Institutional theory and Signaling theory, integrated with the socioemotional wealth (SEW approach, we studied the effect of earnings management (EM practices on a firm’s Corporate Social Responsibility (CSR disclosure behavior. In so doing, we analyzed a sample of 226 non-financial, family and non-family listed firms for the period, 2006–2015. Our results suggest that family firms, in instances of downward earnings management, are more prone to diverting attention from these practices by means of CSR disclosure, compared to non-family firms, although the level of family ownership exerts a moderating effect. Moreover, we found that a firm’s visibility, in terms of size, significantly enhances this behavior and that the effect is higher for family firms.
Strengthening Family Practices for Latino Families
Chartier, Karen G.; Negroni, Lirio K.; Hesselbrock, Michie N.
2010-01-01
This study examined the effectiveness of a culturally adapted Strengthening Families Program (SFP) for Latinos to reduce risks for alcohol and drug use in children. Latino families, predominantly Puerto Rican, with a 9- to 12-year-old child and a parent(s) with a substance abuse problem participated in the study. Pre- and post-tests were conducted…
Prenatal family support, postnatal family support and postpartum depression.
Xie, Ri-Hua; Yang, Jianzhou; Liao, Shunping; Xie, Haiyan; Walker, Mark; Wen, Shi Wu
2010-08-01
Inadequate social support is an important determinant of postpartum depression (PPD). Social support for pregnant women consists of supports from various sources and can be measured at different gestation periods. Differentiating the effects of social support from different sources and measured at different gestation periods may have important implications in the prevention of PPD. In the family centred Chinese culture, family support is likely to be one of the most important components in social support. The aim of this study was to assess the association of prenatal family support and postnatal family support with PPD. A prospective cohort study was conducted between February and September 2007 in Hunan, China. Family support was measured with social support rating scale at 30-32 weeks of gestation (prenatal support) and again at 2 weeks of postpartum visit (postnatal support). PPD was defined as Edinburgh Postnatal Depression Scale (EPDS) score > or =13. A total of 534 pregnant women were included, and among them, 103 (19.3%) scored 13 or more on the EPDS. PPD was 19.4% in the lowest tertile versus 18.4% in the highest quartile (adjusted odds ratio: 1.04, 95% confidence interval 0.60, 1.80) for prenatal support from all family members, and PPD was 39.8% in the lowest tertile versus 9.6% in the highest tertile (adjusted odds ratio: 4.4, 95% confidence interval 2.3, 8.4) for postnatal support from all family members. Among family members, support from husband had the largest impact on the risk of developing PPD. Lack of postnatal family support, especially the support from husband, is an important risk factor of PPD.
The Growth of a Family: A family-oriented approach to pregnancy care
Carroll, June C.; Biringer, Anne
1991-01-01
Caring for a family during pregnancy and birth is an ideal opportunity for family physicians to assess family functioning and help the family adjust to the birth of a new child. Stress and support systems can influence the course of pregnancy, including obstetric and perinatal outcomes. A family-centered approach can help patients during this critical stage of family development.
Family quality of life of Chinese families of children with intellectual disabilities.
Hu, X; Wang, M; Fei, X
2012-01-01
The concepts of quality of life and family quality of life (FQOL) are increasingly being studied in the field of intellectual disabilities (ID) in China as important frameworks for: (1) assessing families' need for supports and services; (2) guiding organisational and service delivery system changes; and (3) evaluating quality family outcomes. The present study focused on exploring the perceptions of Chinese families who have a child with an ID regarding FQOL as well as examining the factor structure of FQOL concept from Chinese families. The Chinese version of the Family Quality of Life Scale was used to survey Chinese families living in the urban and suburban areas of Beijing who have a child with ID. A total of 442 families participated in this study. Confirmatory factor analysis was used to test the factor structure of FQOL. Multivariate analysis was also used to examine group differences among families in terms of family demographic variables. A five-factor structure of the FQOL construct was found in the Chinese sample, suggesting a similar factor structure found from US families in the literature. Different living conditions (e.g. housing and transportation) tended to affect significantly families' satisfaction ratings of their FQOL. It is also found that family income and severity of disability of the child are predictors of families' satisfaction ratings of FQOL. The preliminary findings of this study suggest a cross-cultural factor structure comparability of FQOL between samples in the USA and China. Results call for further examination of the family-centred service and support as a mediator on the interactive relationship between family characteristics, family needs and FQOL outcomes. © 2011 The Authors. Journal of Intellectual Disability Research © 2011 Blackwell Publishing Ltd.
Wang, Man Ping; Chu, Joanna TW; Viswanath, Kasisomayajula; Wan, Alice; Lam, Tai Hing; Chan, Sophia S
2015-01-01
Background Family communication is central to the family and its functioning. It is a mutual process in which family members create, share, and regulate meaning. Advancement and proliferation of information and communication technologies (ICTs) continues to change methods of family communication. However, little is known about the use of different methods for family communication and the influence on family well-being. Objective We investigated the sociodemographic factors associated with dif...
Deutsch, Tobias; Frese, Thomas; Sandholzer, Hagen
2014-01-01
The importance of a family-centered approach in family practice has been emphasized. Knowledge about factors associated with higher family-centered involvement seems beneficial to stimulate its realization. German office-based family physicians completed a questionnaire addressing several aspects of family-centered care. Logistic regression was used to identify associations with the involvement overall and in different domains: routine inquiry and documentation of family-related information, family orientation regarding diagnosis and treatment, family-oriented dialogues, family conferences, and case-related collaboration with marriage and family therapists. We found significant associations between physicians' family-centered involvement and expected patient receptiveness, perceived impact of the family's influence on health, self-perceived psychosocial family-care competences (overall and concerning concepts for family orientation, psychosocial intervention in family conferences, and the communication of the idea of family counseling), advanced training in psychosocial primary care (PPC), personal acquaintance with family therapists (regarding case-related collaboration), and rural office environment. Increased emphasis on the family's influence on health in medical education and training, the provision of concepts for a family-centered perspective, and versatile skills for psychosocial intervention and inquiry of patient preferences, as well as the strengthening of networking between family physicians and family therapists, might promote the family-centered approach in family practice.
Family-focused interventions and resources for veterans and their families.
Sherman, Michelle D; Larsen, Jessica L
2018-05-01
Accelerated by the decreasing military presence in Iraq and Afghanistan, many military members are currently transitioning out of active duty into civilian life. Many of these new veterans have recently experienced combat deployment(s), and some are struggling with the aftermath of combat exposure, separation from family, and reintegration stressors. These challenges often follow these military families as they enter the civilian world, a time with its own major life changes vocationally, socially, and interpersonally. Although numerous resources have been developed to assist service members during their transition to the civilian world, relatively fewer exist for partners, children, and broader family systems. Family psychoeducation is a nonpathologizing, strengths-focused model of care that has documented benefits in the arena of mental illness. This article describes some manualized family psychoeducational programs and online and phone-based resources that may be useful to veteran families during this time of change. The programs and resources described herein are all available for free, primarily online. Because of a wide variety of barriers and limitations for family based care in the Veterans Affairs health care system, veteran families are and will continue to seek mental health care in public sector settings. Community providers can enhance their military culture competence by familiarizing themselves with these resources and drawing upon them in working with transitioning military families. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Almasri, N A; Saleh, M; Dunst, C J
2014-05-01
Resource-based, family-centred practices are associated with better health, emotional, and social well-being of children with disabilities. The adequacy of resources available for families of children with disabilities in Middle Eastern countries has not been described adequately in part because of lack of measures that are culturally adapted to be used in Arabic countries. Therefore, this study aims to (1) to evaluate the psychometric properties of the Arabic-Family Resource Scale (A-FRS) on a sample of families of children cerebral palsy (CP); (2) examine the adequacy of family resources as perceived by parents of children with CP in Jordan; and (3) examine the influence of child and family demographic variables on how parents report resources available to their families. A cross-section design was applied. One-hundred fifteen parents of children with CP with mean age 4.6 years (SD = 4.4) and their parents participated in the study. Research assistants interviewed the participants to complete the A-FRS, and family and child demographic questionnaire, and determined the Gross Motor Function Classification System level of children. The principal axis factoring of the A-FRS yielded a six-factor solution that accounted for 67.39% of the variance and that is different than the factor structure reported by the developers of the FRS. Cronbach’s coefficient alpha of the total score of family resources was 0.86 indicating a good internal consistency and the test–retest reliability for the total scale score was r = 0.92 (P = 0.000) indicating excellent test–retest reliability. Child health and family income were significantly associated with the total score of the A-FRS. The A-FRS is a valid and reliable measure of family resources for Jordanian families of children with CP. Service providers are encouraged to use A-FRS with families to plan resource-based interventions in which family resources are mobilized to meet family needs.
Children's Self-Concepts as Related to Family Structure and Family Concept.
Parish, Joycelyn G.; Parish, Thomas S.
1983-01-01
Surveyed 426 children from intact, divorced, and reconstituted families, who responded to the Personal Attribute Inventory for Children to evaluate their families and themselves. Results showed a significant association between children's self-concepts and both their family structure and family concepts. (JAC)
Family Therapy for the "Truncated" Nuclear Family.
Zuk, Gerald H.
1980-01-01
The truncated nuclear family consists of a two-generation group in which conflict has produced a polarization of values. The single-parent family is at special risk. Go-between process enables the therapist to depolarize sharply conflicted values and reduce pathogenic relating. (Author)
Bundy, Michael L., Ed.; Gumaer, James, Ed.
1984-01-01
Focuses on disrupted families and the role of the school counselor in helping children adjust. Describes characteristics of healthy families, and discusses the transition to the blended family, effects of divorce groups on children's classroom behavior, counseling children in stepfamilies, single-parent families, and parenting strengths of single…
Qiu, Lin; Fan, Jinyan
2015-10-01
Although work-family border and boundary theory suggest individuals' boundary characteristics influence their work-family relationship, it is largely unknown how boundary flexibility and permeability mutually influence work-family conflict and subsequent employee outcomes. Moreover, the existing work-family conflict research has been mainly conducted in the United States and other Western countries. To address these gaps in the work-family literature, the present study examines a moderated mediation model regarding how family boundary characteristics may influence individuals' work-family conflict and life satisfaction with a sample of 278 Chinese full-time employees. Results showed that employees' family flexibility negatively related to their perceived work interference with family (WIF) and family interference with work (FIW), and both these two relationships were augmented by individuals' family permeability. In addition, WIF mediated the relationship between family flexibility and life satisfaction; the indirect effect of family flexibility on life satisfaction via WIF was stronger for individuals with higher family permeability. The theoretical and managerial implications of these findings are discussed. © 2014 International Union of Psychological Science.
Do family CEOs impact firm value? An empirical analysis of Indian family firms
Directory of Open Access Journals (Sweden)
Lakshmi Kalyanaraman
2015-01-01
Full Text Available We study the association between family CEO and firm value on a sample of 288 family firms during the 6-year period, from 2009 to 2014. The sample is drawn from domestic private companies belonging to non-financial services sector included in the NSE CNX 500 index. We find that family CEO has no significant association with firm value, when the family is not the majority shareholder. Family shareholding has positive relationship with firm value, but does not moderate the relationship of family CEO with firm value. We show that family CEO and firm value are negatively related when the family does not hold majority equity stake in the family firm. While family shareholding has no significant relationship with firm value, it has a negative interaction effect on the relationship between family CEO and firm value. The research findings have important implications for family firms as well as the nonfamily investors in the family firms.
Doyle, Angela Celio; McLean, Carmen; Washington, Blaine N; Hoste, Renee Rienecke; le Grange, Daniel
2009-03-01
To examine whether family-based treatment (FBT) for adolescent bulimia nervosa (BN), which emphasizes family involvement in helping to reduce binge eating and purging behaviors, is differentially efficacious in single-parent families versus two-parent families. Forty-one adolescents (97.6% female; 16.0 +/- 1.7 years old) with either BN (n = 18) or subthreshold BN (n = 23) were randomized to FBT as part of a larger randomized controlled trial studying treatments for adolescent BN. Two-parent (n = 27; 65.9%) and single-parent (n = 14; 34.2%) families were compared on demographic variables, presence of comorbid psychiatric illnesses, and symptoms of BN at baseline, post, and 6-month follow-up. ANOVA and chi-square analyses revealed no statistically significant differences between two-parent and single-parent families on any variables with the exception of ethnicity, for which a greater proportion of Caucasians and Hispanic families had two- parent families compared with African-American families (chi(2) = 8.68, p = .01). These findings suggest that FBT may be an appropriate and efficacious treatment for single-parent families as well as two-parent families, despite the reliance on parental intervention to reduce bulimic symptoms and normalize eating patterns.
Families, Head Injury, and Cognitive-Communicative Impairments: Issues for Family Counseling.
DePompei, Roberta; Zarski, John J.
1989-01-01
This paper calls for the incorporation of family counseling into rehabilitation programs treating cognitive-communicative disorders in head-injured individuals. The paper describes general family responses that may be anticipated when a family system experiences head injury, functional versus dysfunctional family responses to a crisis, and three…
NASA Family Science Night: Changing perceptions one family at a time
Mitchell, Sara E.; Drobnes, Emilie; Sol Colina-Trujillo, M.; Noel-Storr, Jacob
2008-12-01
Parents and families have the greatest influence on children's attitudes towards education and career choices. If students' attitudes towards science, particularly the physical sciences, are not influenced positively by parental/familial attitudes, efforts to improve the quality of content and teaching of these subjects in school may be futile. Research shows that parental involvement increases student achievement outcomes, and family-oriented programs have a direct impact on student performance. Based on this premise, the NASA Goddard Space Flight Center started a series of Family Science Nights for middle school students and their families. The program provides a non-threatening venue for families to explore the importance of science and technology in our daily lives by engaging in learning activities that change their perception and understanding of science - making it more practical and approachable for participants of all ages. Family Science Night strives to change the way that students and their families participate in science, within the program and beyond.
Work-Family Conflict, Family-Supportive Supervisor Behaviors (FSSB), and Sleep Outcomes
Crain, Tori L.; Hammer, Leslie B.; Bodner, Todd; Kossek, Ellen Ernst; Moen, Phyllis; Lilienthal, Richard; Buxton, Orfeu M.
2014-01-01
Although critical to health and well-being, relatively little research has been conducted in the organizational literature on linkages between the work-family interface and sleep. Drawing on Conservation of Resources theory, we use a sample of 623 information technology workers to examine the relationships between work-family conflict, family-supportive supervisor behaviors (FSSB), and sleep quality and quantity. Validated wrist actigraphy methods were used to collect objective sleep quality and quantity data over a one week period of time, and survey methods were used to collect information on self-reported work-family conflict, FSSB, and sleep quality and quantity. Results demonstrated that the combination of predictors (i.e., work-to-family conflict, family-to-work conflict, FSSB) was significantly related to both objective and self-report measures of sleep quantity and quality. Future research should further examine the work-family interface to sleep link and make use of interventions targeting the work-family interface as a means for improving sleep health. PMID:24730425
Schlebusch, L.; Samuels, A. E.; Dada, S.
2016-01-01
Background: The purpose of this study was to investigate the relationship between family routines, cognitive appraisal of the impact of autism spectrum disorders (ASD) on the family and family quality of life (FQOL) in families raising children with ASD in South Africa. Methods: A sample of 180 families of young children with ASD who were…
A structural model of family empowerment for families of children with special needs.
Han, Kuem Sun; Yang, Yunkyung; Hong, Yeong Seon
2018-03-01
To explain and predict family empowerment in families of children with special needs. Family empowerment of families of children with special needs can be explained using the Double ABCX model. Although constant stressors such as parenting stress and family demands can have negative effects on family empowerment, family resources and parenting efficacy can mediate the negative effect through effective coping strategies. A cross-sectional research design was employed. A survey was conducted with 240 parents of children with special needs. Upon exclusion of four responses deemed inadequate to the statistics process, 236 responses were selected for the analysis. Based on the items used in the previous research, we used the scale of family demands 38, the scale of parenting stress 24, the scale of parenting efficacy 37, the scale of pattern of organisation 30, the scale of communication process 16 and the scale of family empowerment 32. In families of children with special needs, parenting stress had a negative effect on parenting efficacy and family resources, namely, pattern of organisation and communication process. Family needs had a positive effect on parenting efficacy. Parenting stress and family demands influenced family empowerment through parenting efficacy and family resources (pattern of organisation and communication process), while parenting efficacy contributed to family empowerment. This study empirically analysed the usefulness of the Double ABCX model in predicting family empowerment. Family resource factors (organisation pattern and communication process) and perception or judgement factors (such as parenting efficacy) were found to mediate the negative impact of various stressors experienced by families of children with special needs. The study findings suggest that clinical practice and management should focus on providing efficient intervention methods to lower stress in families of children with special needs. Reinforcing factors contributing to
Familial Idiopathic Cranial Neuropathy in a Chinese Family.
Zhang, Li; Liang, Jianfeng; Yu, Yanbing
Cranial neuropathy is usually idiopathic and familial cases are uncommon. We describe a family with 5 members with cranial neuropathy over 3 generations. All affected patients were women, indicating an X-linked dominant or an autosomal dominant mode of inheritance. Our cases and a review of the literature suggest that familial idiopathic cranial neuropathy is a rare condition which may be related to autosomal dominant vascular disorders (e.g. vascular tortuosity, sclerosis, elongation or extension), small posterior cranial fossas, anatomical variations of the posterior circulation, hypersensitivity of cranial nerves and other abnormalities. Moreover, microvascular decompression is the treatment of choice because vascular compression is the main factor in the pathogenesis. To the best of our knowledge, this is the first report of familial cranial neuropathy in China.
The Role of Family Control on Financial Performance of Family Business in Gebze
Directory of Open Access Journals (Sweden)
Huriye Sabancı Özer
2012-01-01
Full Text Available This paper analysis the role of family control on financial performance of family business by using the key financial data of family businesses of 16 firm registred to Gebze Chamber of Commerce. In this paper, financial performance of a family business is measured by using Return on Assets, Return on Sales and Total Debt/Total Assets ratios. The family member CEO is more successful as far as ROA ratios concerned, but is less successful as far as TD/TA ratios concerned, in comparison to non family member CEO. In other words, the non family member CEO is more successful as far as TD/TA ratios concerned, but is less successful as far as ROA ratios concerned, in comparison to family member CEO. Additionally, as far as ROS ratios concerned, there is no significant difference between family member CEO and non family member CEO. Overall, the results are consistent with the hypotheses that there is difference between ROA of family member CEO and non family member CEO, and there is difference between TD/TA of family member CEO and non family member CEO.
Families of bitangent planes of space curves and minimal non-fibration families
Lubbes, Niels
2014-01-01
A cone curve is a reduced sextic space curve which lies on a quadric cone and does not pass through the vertex. We classify families of bitangent planes of cone curves. The methods we apply can be used for any space curve with ADE singularities, though in this paper we concentrate on cone curves. An embedded complex projective surface which is adjoint to a degree one weak Del Pezzo surface contains families of minimal degree rational curves, which cannot be defined by the fibers of a map. Such families are called minimal non-fibration families. Families of bitangent planes of cone curves correspond to minimal non-fibration families. The main motivation of this paper is to classify minimal non-fibration families. We present algorithms which compute all bitangent families of a given cone curve and their geometric genus. We consider cone curves to be equivalent if they have the same singularity configuration. For each equivalence class of cone curves we determine the possible number of bitangent families and the number of rational bitangent families. Finally we compute an example of a minimal non-fibration family on an embedded weak degree one Del Pezzo surface.
work-family-conflict and family-work-conflict as correlates of job
African Journals Online (AJOL)
User
The above nature of conflicts that employees often try to strike role balance is tagged in organizational ... Therefore, women that assume multiple roles result in work-family conflict because time and energy are ... traditional single-income family to a double-income family. The new family structure calls for multiple roles to.
International Nuclear Information System (INIS)
Dunaevskii, A.M.
1977-01-01
The subject of this work are pure gamma families consisting of the gamma quanta produced in the early stages of cosmic cascades. The criteria of selecting these families from the all measured families are presented. The characteristics of these families are given and some conclusions about the mechanism of the nuclear-electromagnetic cascades are extracted. (S.B.)
Hsiao, Chiu-Yueh
2010-12-01
The purpose of this study was to assess gender effects on family demands, social support and caregiver burden as well as to examine contributing factors of caregiver burden in caring for family members with mental illness. Providing continued care and support for people with mental illness is demanding and challenging. Findings of earlier caregiving studies on the role of caregiver gender in response to caregiver burden and caregiving-related factors have been inconsistent. Little research has been undertaken to examine gender effect on family demands, social support and caregiver burden in Taiwanese family caregivers of individuals with mental illness. Cross-sectional, descriptive correlation design. Data from 43 families, including at least one male and female family caregiver in each family, were analysed using descriptive statistics, principal component analysis and mixed linear modelling. Demographic data, Perceived Stress Scale, Perceived Social Support and Caregiver Burden Scale-Brief were used to collect data. Female family caregivers perceived less social support and experienced higher degrees of caregiver burden compared with male family caregivers. In contrast, no significant gender effect was associated with family demands. Family caregivers with greater family demands and less social support experienced higher degrees of caregiver burden. The results reinforced those of previously published studies that caregiver burden is highly prevalent among female family caregivers. Caregiver gender appears to be highly valuable for explaining family demands, social support and caregiver burden. Health care professionals should continue to collaborate with family caregivers to assess potential gender effects on available support and design gender-specific interventions to alleviate caregiver burden. © 2010 Blackwell Publishing Ltd.
DEFF Research Database (Denmark)
Rao, R Shyama Prasad; Andersen, Jeppe Reitan; Dionisio, Giuseppe
2011-01-01
Poa pratensis, a type species for the grass family (Poaceae), is an important cool season grass that accumulates fructans as a polysaccharide reserve. We studied fructan contents and expression of candidate fructan metabolism genes during cold acclimation in three varieties of P. pratensis adapted...... to different environments: Northern Norway, Denmark, and the Netherlands. Fructan content increased significantly during cold acclimation and varieties showed significant differences in the level of fructan accumulation. cDNA sequences of putative fructosyltransferase (FT), fructan exohydrolase (FEH), and cold...... acclimation protein (CAP) genes were identified and cloned. In agreement with a function in fructan biosynthesis, transcription of a putative sucrose:fructan 6-fructosyltransferase (Pp6-SFT) gene was induced during cold acclimation and fructan accumulation in all three P. pratensis varieties. Transcription...
Hsiao, Chiu-Yueh; Tsai, Yun-Fang
2015-06-01
To assess the degree of caregiver burden and family functioning among Taiwanese primary family caregivers of people with schizophrenia and to test its association with demographic characteristics, family demands, sense of coherence and family hardiness. Family caregiving is a great concern in mental illness. Yet, the correlates of caregiver burden and family functioning in primary family caregivers of individuals with schizophrenia still remain unclear. A cross-sectional descriptive study. A convenience sample of 137 primary family caregivers was recruited from two psychiatric outpatient clinics in Taiwan. Measures included a demographic information sheet and the Chinese versions of the Family Stressors Index, Family Strains Index, 13-item Sense of Coherence Scale, 18-item Caregiver Burden Scale, Family Hardiness Index and Family Adaptability, Partnership, Growth, Affection, and Resolve Index. Data analysis included descriptive statistics, Pearson's product-moment correlation coefficients, t-test, one-way analysis of variance and a stepwise multiple linear regression. Female caregivers, additional dependent relatives, increased family demands and decreased sense of coherence significantly increased caregiver burden, whereas siblings as caregivers reported lower degrees of burden than parental caregivers. Family caregivers with lower family demands, increased family hardiness and higher educational level had significantly enhanced family functioning. Sense of coherence was significantly correlated with family hardiness. Our findings highlighted the importance of sense of coherence and family hardiness in individual and family adaptation. Special attention needs to focus on therapeutic interventions that enhance sense of coherence and family hardiness, thereby improving the perception of burden of care and family functioning. Given the nature of family caregiving in schizophrenia, understanding of correlates of caregiver burden and family functioning would help
Nissen, Kathrine G; Trevino, Kelly; Lange, Theis; Prigerson, Holly G
2016-12-01
Caring for a family member with advanced cancer strains family caregivers. Classification of family types has been shown to identify patients at risk of poor psychosocial function. However, little is known about how family relationships affect caregiver psychosocial function. To investigate family types identified by a cluster analysis and to examine the reproducibility of cluster analyses. We also sought to examine the relationship between family types and caregivers' psychosocial function. Data from 622 caregivers of advanced cancer patients (part of the Coping with Cancer Study) were analyzed using Gaussian Mixture Modeling as the primary method to identify family types based on the Family Relationship Index questionnaire. We then examined the relationship between family type and caregiver quality of life (Medical Outcome Survey Short Form), social support (Interpersonal Support Evaluation List), and perceived caregiver burden (Caregiving Burden Scale). Three family types emerged: low-expressive, detached, and supportive. Analyses of variance with post hoc comparisons showed that caregivers of detached and low-expressive family types experienced lower levels of quality of life and perceived social support in comparison to supportive family types. The study identified supportive, low-expressive, and detached family types among caregivers of advanced cancer patients. The supportive family type was associated with the best outcomes and detached with the worst. These findings indicate that family function is related to psychosocial function of caregivers of advanced cancer patients. Therefore, paying attention to family support and family members' ability to share feelings and manage conflicts may serve as an important tool to improve psychosocial function in families affected by cancer. Copyright © 2016 American Academy of Hospice and Palliative Medicine. All rights reserved.
Physiological and Growth Responses of Six Turfgrass Species Relative to Salinity Tolerance
Directory of Open Access Journals (Sweden)
Md. Kamal Uddin
2012-01-01
Full Text Available The demand for salinity-tolerant turfgrasses is increasing due to augmented use of effluent or low-quality water (sea water for turf irrigation and the growing turfgrass industry in coastal areas. Experimental plants, grown in plastic pots filled with a mixture of river sand and KOSASR peat (9 : 1, were irrigated with sea water at different dilutions imparting salinity levels of 0, 8, 16, 24, 32, 40, or 48 dS m-1. Salinity tolerance was evaluated on the basis of leaf firing, shoot and root growth reduction, proline content, and relative water content. Paspalum vaginatum was found to be most salt tolerant followed by Zoysia japonica and Zoysia matrella, while Digitaria didactyla, Cynodon dactylon “Tifdwarf,” and Cynodon dactylon “Satiri” were moderately tolerant. The results indicate the importance of turfgrass varietal selection for saline environments.
75 FR 9247 - Single Family Mortgage Insurance Premium, Single Family
2010-03-01
... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-13] Single Family Mortgage Insurance Premium, Single Family AGENCY: Office of the Chief Information Officer, HUD. ACTION: Notice... is soliciting public comments on the subject proposal. Lenders use the Single Family Premium...
The family and family structure classification redefined for the current times
Directory of Open Access Journals (Sweden)
Rahul Sharma
2013-01-01
Full Text Available The family is a basic unit of study in many medical and social science disciplines. Definitions of family have varied from country to country, and also within country. Because of this and the changing realities of the current times, there is a felt need for redefining the family and the common family structure types, for the purpose of study of the family as a factor in health and other variables of interest. A redefinition of a ′′family′′ has been proposed and various nuances of the definition are also discussed in detail. A classification scheme for the various types of family has also been put forward. A few exceptional case scenarios have been envisaged and their classification as per the new scheme is discussed, in a bid to clarify the classification scheme further. The proposed scheme should prove to be of use across various countries and cultures, for broadly classifying the family structure. The unique scenarios of particular cultures can be taken into account by defining region or culture-specific subtypes of the overall types of family structure.
Families living with parental mental illness and their experiences of family interventions.
Afzelius, M; Plantin, L; Östman, M
2018-03-01
WHAT IS KNOWN ON THE SUBJECT?: Coping with parental mental illness in families can be challenging for both children and parents. Providing evidence-based family interventions to families where a parent has a mental illness can enhance the relationships in the family. Although psychiatric research has shown that evidence-based family interventions may improve the communication and understanding of parental mental illness, there is a lack in this area of research from an everyday clinical context. WHAT DOES THIS PAPER ADD TO EXISTING KNOWLEDGE?: Our study reinforces the fact that parents with mental illnesses are searching for support from psychiatric services in order to talk to their children about their illness. The finding that under-age children comply when they are told by their parents to join an intervention in psychiatric services supporting the family is something not observed earlier in research. This study once more illuminates the fact that partners of a person with parental mental illness are seldom, in an obvious way, included in family support interventions. WHAT ARE THE IMPLICATIONS FOR PRACTICE?: Psychiatric services, and especially mental health nurses, have an important task in providing families with parental mental illness with support concerning communication with their children and in including the "healthy" partner in family support interventions. Introduction Although research has shown that evidence-based family interventions in research settings improve the communication and understanding of parental mental illness, there is a lack of knowledge about interventions in an everyday clinical context. Aim This study explores how families with parental mental illness experience family interventions in a natural clinical context in psychiatric services. Method Five families with children aged 10-12 were recruited from psychiatric services in southern Sweden and interviewed in a manner inspired by naturalistic inquiry and content analysis. Both
Work, family, and gender: elements for a theory of work-family balance.
Cantera, Leonor M; Cubells, Ma Eugenia; Martínez, Luz Ma; Blanch, Josep M
2009-11-01
Over last century, work was not only a means of economic survival, but also a very strong factor of psychological structuring and of organization of personal, family, and everyday life. The new world of work provides new challenges to the balance of work and family life. A questionnaire was administered to a sample of 453 people with the aim of analyzing the relation between variables such as family burdens and domestic responsibilities, and the appraisal of work and family, values involved in work-family balance. The results of this study show that, in the present economic and cultural context, assuming family burdens and domestic responsibilities increases the positive appraisal of work and family, both in men and women. This has theoretical and practical implications concerning the challenge of work-family balance.
Working mothers: Family-work conflict, job performance and family/work variables
Directory of Open Access Journals (Sweden)
Cynthia J Patel
2006-10-01
Full Text Available The present study examined the relationship between family-work conflict, job performance and selected work and family characteristics in a sample of working mothers employed at a large retail organization. The hypothesis of a negative relationship between family-work conflict and job performance was rejected. Married women reported significantly higher family-work conflict than unmarried women, while women in the highest work category gained the highest job performance rating. More than half the sample indicated that paid work was more important than their housework and reported that their working had a positive impact on their families. The findings are discussed in relation to the changing work and family identities of non-career women.
Directory of Open Access Journals (Sweden)
Vali Joana Pott
1997-12-01
Full Text Available O Pantanal, por ser alagável, é ambiente favorável ao desenvolvimento de muitas plantas aquáticas. Para atender demandas de levantamentos florísticos regionais, fez-se a listagem das macrófitas aquáticas do Pantanal, com base em coletas depositadas nos Herbários CPAP (EMBRAPA, COR (Universidade Federal de Mato Grosso do Sul, CH (Universidade Federal de Mato Grosso e K (Kew. Até o momento, foram levantadas 242 espécies, distribuídas em 106 gêneros e 54 famílias. As famílias mais numerosas são Poaceae (22 espécies, Cyperaceae(17, Leguminosae e Scrophulariaceae(14, Alismataceae e Onagraceae(13, Pontederiaceae(11, Lentibulariaceae(10, Characeae(9, emnaceae, Malvaceae e Nymphaeaceae(8. A maioria das demais famílias apresentam uma ou duas espécies cada. Quanto à forma biológica, 39% são plantas emergentes, 28% anfíbias, 11,5% flutuantes fixas, 8% flutuantes livres, 8% submersas fixas, 3,8% submersas livres e 1,7% epífítas. Os principais gêneros em número de espécies são Nymphaea, Utricularia, Echinodorus, Ludwigia, Polygonum, Aeschynomene, Cyperus, Eleocharis e Bacopa.The Pantanal, being a wetland, is a favorable environment for the development of many aquatic plants. This list of aquatic macrophytes of the Pantanal was made based on field collections, deposited at Herbarium CPAP (EMBRAPA, COR (Universidade Federal de Mato Grosso do Sul, CH (Universidade Federal de Mato Grosso and K (Kew, to support regional floristic surveys. Until present, 242 species were listed, distributed within 106 genera and 54 families. The most numerous families were Poaceae (22 species Cyperaceae(17, Leguminosae and Scrophulariaceae(14, Alismataceae and Onagraceae(13, Pontederiaceae (11, Lentibulariaceae(10, Characeae(9, Lemnaceae, Malvaceae andNymphaeaceae(8. The majority of other families has one or two species each. The life form spectrum includes 39% emergent plants, 28% amphibious, 11,5% rooted floating, 8% free floating, 8% rooted submerged
Family Relationships and its Influence on Family Wine Firms in the Czech Republic
Directory of Open Access Journals (Sweden)
Anastasia Murinova
2017-11-01
Full Text Available Purpose of the article: There are many a studies by universities and various companies regarding the phenomenon of family business. However, a clear interpretation of the family business does not exist. Thus, the purpose of this paper is clarify the question of family relationships existing within the family business in the Czech Republic. Methodology/methods: As the wine family business is a bright representative of the oldest and traditional economic activities, it was decided to analyze the family relationships of 108 representatives of the wine family firms in the Czech Republic within the secondary research. For primary research the case study method was used. Representatives of wine family firms were interviewed to confirm the obtained results and add the details. Scientific aim: The aim of scientific research is to improve the understanding of family firm’s base from the perspective of family relationships. Findings: Coming out of the definition by Arquer (1979 and taking the applicable Civil Code of the Czech Republic into account, the author has created a definition regarding the family business to be transferred to the next generation. Accordingly, there were identified four dominant groups of family relationships within the wine trading family business. A representative interviewed among others has confirmed the existence of traditional wine trading family business saying that it is not only a mere marketing tool for the customer acquisition. Besides that, case studies make clear beyond the veil the influence of family relationships on the firm’s performance. Conclusions: This study has contributed to the theoretical body of family business research providing an important first step to gaining insights into the understanding of family relationships of the family business influencing its effective functioning.
Human Service Employees Coping with Job Stress, Family Stress and Work-Family Conflict.
Carbone, Dominic J.
The intersection of work and family life has always been a popular topic of discussion among family theorists. This study examined human service employees in direct service positions coping with work stress, family stress, and work-family conflict. The effects of work stress, family stress and work-family conflict on depression were examined.…
Directory of Open Access Journals (Sweden)
Aline Gonçalves de Freitas
2013-12-01
Full Text Available Here, we describe pollen grains extracted from a Pleistocene-Holocene sediment core (BU-91-GL-05; 22°48'45"S; 41°54'13"W taken from the Albacora Slope (22°48'45"S; 41°54'13"W, located in the Campos Basin of the northern region of the state of Rio de Janeiro, Brazil. The analysis resulted in the identification and morphological description of 46 types of pollen: one of a gymnosperm genus (Podocarpus; and 45 of angiosperm taxa across 27 families-one family of monocotyledons (Poaceae and 26 families (30 types of dicotyledons. The most common angiosperm families were Amaranthaceae (Chenopodium, Amaranthus and Gomphrena; Fabaceae (Fabaceae type, Bauhinia, Inga and Canavalia; Malpighiaceae (Tetrapteris, Heteropteris and Peixotoa; Malvaceae (Sida, Abutilon, Hibiscus and Pseudobombax; Rubiaceae (Faramea, Borreria and Psychotria; Asteraceae (Eupatorium and tribe Vernonieae; Bignoniaceae (Bignoniaceae type, Adenocalymma and Tabebuia; and Onagraceae (Fuchsia and Ludwigia. The palynoflora in this study are associated with dense montane and submontane Atlantic Forest, semideciduous forest and restinga (coastal woodland, all of which are present in the state of Rio de Janeiro. Palynological analysis can provide important data about paleovegetation and paleoclimatic changes in the studied area during the Quaternary, specifically in the last 145,000 years.
Family Care Map: Sustaining family-centered care in Polytrauma Rehabilitation Centers
Ford, James H.; Wise, Meg; Krahn, Dean; Oliver, Karen Anderson; Hall, Carmen; Sayer, Nina
2015-01-01
The study assessed sustainability of the Family Care Map, a family-centered approach to providing care for Veterans with polytrauma-related injuries, in four Department of Veterans Affairs Polytrauma Rehabilitation Centers. We applied a mixed-methods approach. Staff surveys used standardized measures of sustainability, commitment to change, information, and participation during implementation. Qualitative inquiry assessed Family Care Map implementation and facilitators and barriers to sustainability. Staff sustainability perceptions had a significant positive correlation with affective commitment to change, participation, and information received about the change process. Family Care Map integration into standard practices and use of its concepts with patients and families related to staff perceptions about sustainability. The degree of use and integration of the Family Care Map in traumatic brain injury/polytrauma care varied among the Polytrauma Rehabilitation Centers. Some successful sustainability strategies included integration into daily workflow and organizational culture. Examples of sustainability barriers included staff awareness and use and outdated information. Some practices, such as measuring and documenting the use of the Family Care Map in treatment plans, may not routinely occur. The focus on family-centered care will require further evaluation of organization-, staff-, and innovation-level attributes that influence sustainability of changes designed to improve family-centered care. PMID:25671632
THE INFLUENCE OF FAMILY RELATIONS ON DECISION MAKING IN FAMILY BUSINESSES
Directory of Open Access Journals (Sweden)
Aleksandra Stoilkovska
2013-03-01
Full Text Available The peculiarity and uniqueness of family businesses set them apart from other businesses in many things. Natural need of man to survive in these harsh circumstances forces him to constantly seek new sources of funding or simply tries to improve the existing. Secure existence is difficult to ensure.The successful family business provides many benefits: reliable operation, to be your own boss, flexible working hours, family members are taken care of, to become successful with your own strengths. Also this kind of business brings a range of difficulties that have to be overcomed.Apart from the daily struggle for enterprise development in the complex conditions of tough competition and rapid changes in the environment, family businesses face problems of internal character. Namely, the parents are thorn between the family relations, the love towards their children and the consistence in the decision making processes. Although this is a modern and very present theme however owners of family businesses rarely dare to speak publicly on the subject.This paper presents an action research conducted on a sample of 26 family businesses in FYROM. This research study is primarily exploratory in nature, and the research instruments include survey through questionnaires with family member and employees that are not family members.
An investigation of the bioaccumulation of chromium and uranium ...
African Journals Online (AJOL)
KONANANI
2013-11-13
Nov 13, 2013 ... dactylon, an indigenous grass. The grass and soil sample were collected at New Union Gold Mine and ... chromium (Cr3+), an essential element to living organisms ... of radioactive and heavy metals in mine tailings that origi-.
2003-01-01
Groundcover on base consists primarily of Bermuda grass ( Cynodon dactylon), centipede grass (Eremochloa ophiluroides), and St. Augustine grass...notification to allow adequate lime fori eview. COASTAL PROGRAM COMPLIANCE (Coastal ari • activities only) : ( ) The activity has been reviewed and
Family-based clusters of cognitive test performance in familial schizophrenia
Directory of Open Access Journals (Sweden)
Partonen Timo
2004-07-01
Full Text Available Abstract Background Cognitive traits derived from neuropsychological test data are considered to be potential endophenotypes of schizophrenia. Previously, these traits have been found to form a valid basis for clustering samples of schizophrenia patients into homogeneous subgroups. We set out to identify such clusters, but apart from previous studies, we included both schizophrenia patients and family members into the cluster analysis. The aim of the study was to detect family clusters with similar cognitive test performance. Methods Test scores from 54 randomly selected families comprising at least two siblings with schizophrenia spectrum disorders, and at least two unaffected family members were included in a complete-linkage cluster analysis with interactive data visualization. Results A well-performing, an impaired, and an intermediate family cluster emerged from the analysis. While the neuropsychological test scores differed significantly between the clusters, only minor differences were observed in the clinical variables. Conclusions The visually aided clustering algorithm was successful in identifying family clusters comprising both schizophrenia patients and their relatives. The present classification method may serve as a basis for selecting phenotypically more homogeneous groups of families in subsequent genetic analyses.
DEFF Research Database (Denmark)
Kieffer-Kristensen, Rikke; Siersma, Volkert Dirk; Teasdale, Thomas William
2013-01-01
brain injury participated. Family and brain injury characteristics were reported by the ill and healthy parents. Children self-reported post-traumatic stress symptoms (PSS) using the Child Impact of Events revised (CRIES). Emotional and behavioural problems among the children were also identified...... by the parents using the Achenbach’s Child Behaviour Checklist (CBCL). RESULTS: The family stress variables relating to the healthy spouse in all six comparisons were significant (p... scores for the children. For the adjusted associations, we again found the family stress variables in the healthy spouse to be related to the risk of emotional and behavioral problems in the children. CONCLUSIONS: The present results suggest that in ABI families, the children’s emotional functioning...
Vuchinich, S; Wood, B; Vuchinich, R
1994-12-01
This study tested the hypothesis that the mother-father coalition, parent-child coalitions, and parental warmth expressed toward the child are associated with family problem solving in families with a preadolescent child referred for treatment of behavior problems (n = 30), families with a child at-risk for conduct disorder (n = 68), and a sample of comparison families (n = 90). Referred and at-risk families displayed less effective problem solving. A regression analysis, which controlled for gender of the child, family structure, family income, marital satisfaction, and severity of child problems, showed that strong parental coalitions were linked to low levels of family problem solving in at-risk and referred families. Parent-child coalitions had little apparent impact while parental warmth was highly correlated with better family problem solving. The results may be interpreted as evidence for a tendency for parents in at-risk and referred families to "scapegoat" a preadolescent during family problem-solving sessions. This may undermine progress on family problem solutions and may complicate family-based prevention and treatment programs that use family problem-solving sessions.
Sandberg, John; Rafail, Patrick
2014-10-01
Measures of children's time use, particularly with parents and siblings, are used to evaluate three hypotheses in relation to the vocabulary and mathematical skills development: (1) the resource dilution hypothesis, which argues that parental and household resources are diluted in larger families; (2) the confluence hypothesis, which suggests that the intellectual milieu of families is lowered with additional children; and (3) the admixture ("no effect") hypothesis, which suggests that the negative relationship between family size and achievement is an artifact of cross-sectional research resulting from unobserved heterogeneity. Each hypothesis is tested using within-child estimates of change in cognitive scores over time with the addition of new children to families.
W.W. de Herder (Wouter)
2012-01-01
textabstractFamilial GH-secreting tumors are seen in association with three separate hereditary clinical syndromes: multiple endocrine neoplasia type 1, Carney complex, and familial isolated pituitary adenomas.
Family Smoking, Exposure to Secondhand Smoke at Home and Family Unhappiness in Children
Directory of Open Access Journals (Sweden)
Jian Jiu Chen
2015-11-01
Full Text Available Tobacco use adversely affects many aspects of well-being and is disliked by non-smokers. However, its association with family happiness is unknown. We investigated the associations of family unhappiness with smoking in family members and secondhand smoke (SHS exposure at home in Hong Kong children. In a school-based survey in 2012–2013, 1238 primary school students (mean age 8.5 years, standard deviation 0.9; 42.6% boys reported family smoking, SHS exposure at home and whether their families had any unpleasant experience caused by smoking or SHS in the past 30 days (tobacco-related unpleasant experience, and rated the overall level of happiness in their families (family unhappiness. Multivariable logistic regression was used to study the associations of tobacco-related unpleasant experience and family unhappiness with family smoking and SHS exposure at home. Tobacco-related unpleasant experience and family unhappiness were reported by 27.5% and 16.5% of students. Unpleasant experience was more strongly associated with family smoking than SHS exposure at home. Family unhappiness was associated with both family smoking (odds ratio 2.37; 95% confidence interval 1.51–3.71 and SHS exposure at home (1.82; 1.39–2.40. These results suggest a previously neglected possible impact of tobacco use on family happiness.
The role of family institutes in promoting the practice of family therapy.
Rampage, Cheryl
2014-09-01
Much of the development of family therapy as a discipline was an outcome of the clinical, training, and theory-building activities conducted at family institutes around the United States. Beginning in the 1960s, these institutes were the crucibles in which the concepts and practices of family therapy flourished. The author, a leader at one of the largest family institutes in the United States, discusses the role of family institutes in promoting the practice of family therapy, as well as the challenges of doing so. © 2014 FPI, Inc.
Radionuclides: Accumulation and Transport in Plants.
Gupta, D K; Chatterjee, S; Datta, S; Voronina, A V; Walther, C
Application of radioactive elements or radionuclides for anthropogenic use is a widespread phenomenon nowadays. Radionuclides undergo radioactive decays releasing ionizing radiation like gamma ray(s) and/or alpha or beta particles that can displace electrons in the living matter (like in DNA) and disturb its function. Radionuclides are highly hazardous pollutants of considerable impact on the environment, food chain and human health. Cleaning up of the contaminated environment through plants is a promising technology where the rhizosphere may play an important role. Plants belonging to the families of Brassicaceae, Papilionaceae, Caryophyllaceae, Poaceae, and Asteraceae are most important in this respect and offer the largest potential for heavy metal phytoremediation. Plants like Lactuca sativa L., Silybum marianum Gaertn., Centaurea cyanus L., Carthamus tinctorius L., Helianthus annuus and H. tuberosus are also important plants for heavy metal phytoremediation. However, transfer factors (TF) of radionuclide from soil/water to plant ([Radionuclide]plant/[Radionuclide]soil) vary widely in different plants. Rhizosphere, rhizobacteria and varied metal transporters like NRAMP, ZIP families CDF, ATPases (HMAs) family like P1B-ATPases, are involved in the radio-phytoremediation processes. This review will discuss recent advancements and potential application of plants for radionuclide removal from the environment.
Directory of Open Access Journals (Sweden)
Sami Asir Al-Robai
2017-06-01
Full Text Available The aim of this work was to study the vegetation structure of Wadi Turbah Zahran, Albaha area, Saudi Arabia and some biodiversity indices. Paleontological Statistics (PAST Software Package was used for data analysis. A total of 266 species (201 genera, 71 families were identified and most of the species were herbs (87%. Therophytes (32.7% and Chamaephytes (30.45% were the most prominent groups. Asteraceae family was represented by the highest number of species (15.4% followed by Poaceae (9.4%. Thirty-one families (43.7% were represented by a single genus and species. Thirty-four species (12.8% were common to all sites. The genus Solanum was the most speciose followed by Rumex. Most of the calculated indices showed variations among the sites. Shannon (3.71–4.06, Menhenick (2.271–4.746 and Chao-1 (106–319.6 diversity indices markedly varied among the sites while Simpson values (0.96–0.97 were almost the same. Berger-Parker values revealed the dominance of Hyparrhenia hirta in four sites. Beta diversity values indicated high diversity between site 1 and 4 and less diversity between site 1 and 6.
THOMPSON, TESS; SEO, JOANN; GRIFFITH, JULIA; BAXTER, MELANIE; JAMES, AIMEE; KAPHINGST, KIMBERLY A.
2015-01-01
Public health initiatives encourage the public to discuss and record family health history (FHH) information, which can inform prevention and screening for a variety of conditions. Most research on FHH discussion and collection, however, has involved predominantly White participants and has not considered lay definitions of family or family communication patterns about health. This qualitative study of 32 African American women, 16 with a history of cancer, analyzed participants’ definitions of family, family communication about health, and collection of FHH information. “Family” was defined by biological relatedness, social ties, interactions, and proximity. Several participants noted using different definitions of family for different purposes (e.g. biomedical vs. social). Health discussions took place between and within generations and were influenced by structural relationships (e.g. sister) and characteristics of family members (e.g. trustworthiness). Participants described managing tensions between sharing health information and protecting privacy, especially related to generational differences in sharing information, fear of familial conflict or gossip, and denial (sometimes described as refusal to “own” or “claim” a disease). Few participants reported that anyone in their family kept formal FHH records. Results suggest FHH initiatives should address family tensions and communication patterns that affect discussion and collection of FHH information. PMID:25730634
Directory of Open Access Journals (Sweden)
Chen Shen
2017-09-01
Full Text Available BackgroundFamily communication is important to maintain family relationships and family well-being. To enhance family communication and family well-being, a community-based “Learning Families Project,” based on the social ecological model was developed in Kwun Tong in Hong Kong, a district with high prevalence of family problems.MethodsThis quasi-experimental study included two nearby government subsidized low-rent housing estates separated by busy main roads, as the intervention [Tsui Ping (South Estate] and control (Shun Tin Estate estate. The main intervention was resident training programs, such as talks, day camps, and thematic activities. No program was implemented in the control estate. Participants in the intervention group received assessments before the intervention (T1, immediately after the intervention (T2, and 6 weeks after the intervention (T3. Control group participants were assessed at baseline (March to April 2011 and follow-up (December 2011 to March 2012. Assessments of family communication (time and perceived adequacy and family well-being (harmony, happiness, and health at T1 and T3 were obtained in the intervention group to examine within-group changes. In addition, these differences in outcomes in the intervention group were compared with those in the control group to examine the effectiveness of the intervention.ResultsFamily communication time and perceived communication adequacy increased significantly in the intervention group (n = 515 with a small effect size (Cohen effect d: 0.10 and 0.24, respectively. Compared with the control group (n = 476, the improvements in family communication time and perceived communication adequacy (Cohen effect d: 0.13 and 0.14, respectively, and perceived family harmony and happiness (Cohen effect d: 0.12 and 0.12, respectively were significantly greater in the intervention group, adjusting for age and education, suggesting the intervention was effective in improving
Shen, Chen; Wan, Alice; Kwok, Lit Tung; Pang, Sally; Wang, Xin; Stewart, Sunita M; Lam, Tai Hing; Chan, Sophia Siu Chee
2017-01-01
Family communication is important to maintain family relationships and family well-being. To enhance family communication and family well-being, a community-based "Learning Families Project," based on the social ecological model was developed in Kwun Tong in Hong Kong, a district with high prevalence of family problems. This quasi-experimental study included two nearby government subsidized low-rent housing estates separated by busy main roads, as the intervention [Tsui Ping (South) Estate] and control (Shun Tin Estate) estate. The main intervention was resident training programs, such as talks, day camps, and thematic activities. No program was implemented in the control estate. Participants in the intervention group received assessments before the intervention (T1), immediately after the intervention (T2), and 6 weeks after the intervention (T3). Control group participants were assessed at baseline (March to April 2011) and follow-up (December 2011 to March 2012). Assessments of family communication (time and perceived adequacy) and family well-being (harmony, happiness, and health) at T1 and T3 were obtained in the intervention group to examine within-group changes. In addition, these differences in outcomes in the intervention group were compared with those in the control group to examine the effectiveness of the intervention. Family communication time and perceived communication adequacy increased significantly in the intervention group ( n = 515) with a small effect size (Cohen effect d : 0.10 and 0.24, respectively). Compared with the control group ( n = 476), the improvements in family communication time and perceived communication adequacy (Cohen effect d : 0.13 and 0.14, respectively), and perceived family harmony and happiness (Cohen effect d : 0.12 and 0.12, respectively) were significantly greater in the intervention group, adjusting for age and education, suggesting the intervention was effective in improving family communication and
Efficacy of family mediation and the role of family violence: study protocol
2014-01-01
Background Family law reforms in Australia require separated parents in dispute to attempt mandatory family dispute resolution (FDR) in community-based family services before court attendance. However, there are concerns about such services when clients present with a history of high conflict and family violence. This study protocol describes a longitudinal study of couples presenting for family mediation services. The study aims to describe the profile of family mediation clients, including type of family violence, and determine the impact of violence profiles on FDR processes and outcomes, such as the type and durability of shared parenting arrangements and clients’ satisfaction with mediated agreements. Methods A mixed method, naturalistic longitudinal design is used. The sampling frame is clients presenting at nine family mediation centres across metropolitan, outer suburban, and regional/rural sites in Victoria, Australia. Data are collected at pre-test, completion of mediation, and six months later. Self-administered surveys are administered at the three time points, and a telephone interview at the final post-test. The key study variable is family violence. Key outcome measures are changes in the type and level of acrimony and violent behaviours, the relationship between violence and mediated agreements, the durability of agreements over six months, and client satisfaction with mediation. Discussion Family violence is a major risk to the physical and mental health of women and children. This study will inform debates about the role of family violence and how to manage it in the family mediation context. It will also inform decision-making about mediation practices by better understanding how mediation impacts on parenting agreements, and the implications for children, especially in the context of family violence. PMID:24443936
Efficacy of family mediation and the role of family violence: study protocol.
Cleak, Helen; Schofield, Margot; Bickerdike, Andrew
2014-01-21
Family law reforms in Australia require separated parents in dispute to attempt mandatory family dispute resolution (FDR) in community-based family services before court attendance. However, there are concerns about such services when clients present with a history of high conflict and family violence. This study protocol describes a longitudinal study of couples presenting for family mediation services. The study aims to describe the profile of family mediation clients, including type of family violence, and determine the impact of violence profiles on FDR processes and outcomes, such as the type and durability of shared parenting arrangements and clients' satisfaction with mediated agreements. A mixed method, naturalistic longitudinal design is used. The sampling frame is clients presenting at nine family mediation centres across metropolitan, outer suburban, and regional/rural sites in Victoria, Australia. Data are collected at pre-test, completion of mediation, and six months later. Self-administered surveys are administered at the three time points, and a telephone interview at the final post-test. The key study variable is family violence. Key outcome measures are changes in the type and level of acrimony and violent behaviours, the relationship between violence and mediated agreements, the durability of agreements over six months, and client satisfaction with mediation. Family violence is a major risk to the physical and mental health of women and children. This study will inform debates about the role of family violence and how to manage it in the family mediation context. It will also inform decision-making about mediation practices by better understanding how mediation impacts on parenting agreements, and the implications for children, especially in the context of family violence.
... Education & Training Home Conditions Familial Pulmonary Fibrosis Familial Pulmonary Fibrosis Make an Appointment Find a Doctor Ask a ... more members within the same family have Idiopathic Pulmonary Fibrosis (IPF) or any other form of Idiopathic Interstitial ...
... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Español Text Size Email Print Share Normal Functioning Family Page Content Article Body Is there any way ...
Improving Family Communications
... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Listen Español Text Size Email Print Share Improving Family Communications Page Content Article Body How can I ...
Directory of Open Access Journals (Sweden)
Wouter W. de Herder
2012-01-01
Full Text Available Familial GH-secreting tumors are seen in association with three separate hereditary clinical syndromes: multiple endocrine neoplasia type 1, Carney complex, and familial isolated pituitary adenomas.
Jeong, So-Hee; Eamon, Mary Keegan
2009-01-01
Using data from a national sample of two-parent families with 11- and 12-year-old youths (N = 591), we tested a structural model of family background, family process (marital conflict and parenting), youth self-control, and delinquency four years later. Consistent with the conceptual model, marital conflict and youth self-control are directly…
Parental experience of family resources in single-parent families having a child with cancer.
Huang, I-Chen; Mu, Pei-Fan; Chiou, Tzeon-Jye
2008-10-01
The purpose of this study was to explore the essence of family experiences in terms of family resources and how these assist a single-parent caring for a child with cancer. When families face stresses caused by cancer, they need to readjust their roles, interactive patterns and relationships, both inside and outside the family. During the adaptation process, family resources may assist recovery from stress and a return to equilibrium. Most research has emphasised the support resources available to two-parent families during the treatment process. There is a lack of information on the experiences of single-parent families and their available resources together with the functions and roles played by family resources during the adjustment process. Qualitative. Five major themes were identified: (i) facing the disease with courage; (ii) hope kindled by professionals; (iii) constructing parental role ability; (iv) assisting the children to live with the illness; and (v) family flexibility. The results of the current study demonstrate that single-parent families with a child suffering from cancer employ family resources to assist family adjustment and to maintain family function/equilibrium. These results explain the dynamic interactions between the multiple levels of resources available to the family. The study results provide evidence-based information that identifies the nature of family resources in single-parent families and describes how these resources can be applied to assist the families.
How well are families doing? A description of family well-being in South Africa
Directory of Open Access Journals (Sweden)
Nicolette Vanessa Roman
2016-08-01
Full Text Available Objective: The purpose of this study was to describe the well-being of a sample of families from low socioeconomic communities in the Western Cape South Africa in terms of family resilience, family satisfaction, parenting styles, family structure and family functioning. Methods: The study used a descriptive survey design and sampled 358 adult family members. Results: The results indicate that although family functioning is challenged, parents are perceived to be using an authoritative parenting style and having a father present enhances family satisfaction. The results also describe families as displaying low-to-average levels of family resilience. Conclusion: This study provides a descriptive study of a sample of families in the Western Cape, South Africa. Overall the families in this study are not doing very well. The implications and significance of these findings are further explained.