Potassium cyanate-induced modification of toxic and mutagenic effects of gamma-radiation and benzo(A)-pyrene

International Nuclear Information System (INIS)

Serebryanyj, A.M.; Sal'nikova, L.E.; Bakhitova, L.M.; Pashin, Yu.V.; AN SSSR, Moscow

1989-01-01

In experiments with CHO-AT3-2 cell culture, a study was made of the effect of potassium cyanate (KNCO) on the effect of gamma-radiation and benzo(a)pyrene (BP) by the following tests: cell viability, induction of cells with micronuclei and fragmentated nuclei and mutations by thymidinekinase (TK) and Na + /K + -ATPase loci. Some tests have revealed the increase in the effect of gamma-radiation and BP produced by potassium cyanate. It is suggested that sensitizing effects are related to repair system inhibition and/or changes in the cell chromatin structure produced by KNCO

Structure/Property Relationships of Cyanate Ester Resins from Renewable Sources

Science.gov (United States)

2013-04-11

derived from lignin . These materials possess favorable thermal and water uptake properties with dry glass transition temperatures above 200°C and wet...Differential scanning calorimetry showed that resins with more sterically restrictive bridge groups between the reactive moieties cure more slowly...distribution is unlimited. Creosol as a Monomer Source 7 • Input material cost is an important consideration for cyanate ester resins • Lignin is

Reduction of ferrate(VI) and oxidation of cyanate in a Fe(VI)-TiO2-UV-NCO- system.

Science.gov (United States)

Winkelmann, Kurt; Sharma, Virender K; Lin, Yekaterina; Shreve, Katherine A; Winkelmann, Catherine; Hoisington, Laura J; Yngard, Ria A

2008-08-01

The aqueous photocatalytic degradation of cyanate (NCO(-)), which is a long-lived neurotoxin formed during the remediation of cyanide in industrial waste streams, was studied in the ferrate(VI)-UV-TiO2-NCO(-) system. Kinetics measurements of the photocatalytic reduction of ferrate(VI) were carried out as a function of [NCO(-)], [ferrate(VI)], [O(2)], light intensity (I(o)), and amount of TiO2 in suspensions at pH 9.0. The photocatalytic reduction rate of ferrate(VI) in the studied system can be expressed as -d[Fe(VI)]/dt=kI(o)(0.5) [NCO(-)] [TiO2]. The rate of photocatalytic oxidation of cyanate with ferrate(VI) was greater than the rate in the analogous system without ferrate(VI). The possibility of involvement of reactive ferrate(V) species for this enhancement was determined by studying the reactivity of ferrate(V) with NCO(-) in a homogeneous solution using a premix pulse radiolysis technique. The rate constant for the reaction of ferrate(V) and NCO(-) in alkaline medium was estimated to be (9.60+/-0.07) x 10(2) M(-1) s(-1), which is much slower than the ferrate(VI) self-decomposition reaction (k approximately 10(7) M(-1) s(-1)). An analysis of the kinetic data in the Fe(VI)-UV-TiO2-NCO(-) system suggests that ferrate(V) is not directly participating in the oxidation of cyanate. Possible reactions in the system are presented to explain results of ferrate(VI) reduction and oxidation of cyanate.

GAS-PHASE CHEMISTRY OF THE CYANATE ION, OCN{sup −}

Energy Technology Data Exchange (ETDEWEB)

Cole, Callie A.; Wang, Zhe-Chen; Bierbaum, Veronica M. [Department of Chemistry and Biochemistry, 215 UCB, University of Colorado, Boulder, CO 80309 (United States); Snow, Theodore P. [Center for Astrophysics and Space Astronomy, 389 UCB, University of Colorado, Boulder, CO 80309 (United States)

2015-10-10

Cyanate (OCN{sup −}) is the only ion to date whose presence has been confirmed in the icy mantles that coat interstellar dust grains. Understanding the chemical behavior of cyanate at a fundamental level is therefore integral to the advancement of astrochemistry. We seek to unravel the chemistry of this intriguing anion through a combination of gas-phase experiments and theoretical explorations. Our approach is twofold: first, employing a flowing afterglow-selected ion flow tube apparatus, the reactions between OCN{sup −} and three of the most abundant atomic species in the interstellar medium, hydrogen, nitrogen, and oxygen, are examined. Hydrogen atoms readily react by associative detachment, but the remarkable stability of OCN{sup −} does not give rise to an observable reaction with either nitrogen or oxygen atoms. To explain these results, the potential energy surfaces of several reactions are investigated at the B3LYP/6-311++G(d,p) level of theory. Second, collision induced dissociation experiments involving deprotonated uracil, thymine, and cytosine in an ion trap mass spectrometer reveal an interesting connection between these pyrimidine nucleobase anions and OCN{sup −}. Theoretical calculations at the B3LYP/6-311++G(d,p) level of theory are performed to delineate the mechanisms of dissociation and explore the possible role of OCN{sup −} as a biomolecule precursor.

Azobisisobutyronitrile initiated aerobic oxidative transformation of amines: coupling of primary amines and cyanation of tertiary amines.

Science.gov (United States)

Liu, Lianghui; Wang, Zikuan; Fu, Xuefeng; Yan, Chun-Hua

2012-11-16

In the presence of a catalytic amount of radical initiator AIBN, primary amines are oxidatively coupled to imines and tertiary amines are cyanated to α-aminonitriles. These "metal-free" aerobic oxidative coupling reactions may find applications in a wide range of "green" oxidation chemistry.

Clustering of two genes putatively involved in cyanate detoxification evolved recently and independently in multiple fungal lineages

Science.gov (United States)

Fungi that have the enzymes cyanase and carbonic anhydrase show a limited capacity to detoxify cyanate, a fungicide employed by both plants and humans. Here, we describe a novel two-gene cluster that comprises duplicated cyanase and carbonic anhydrase copies, which we name the CCA gene cluster, trac...

Linear uranium complexes X2UL5 with L=cyanide, iso-cyanate: DFT evidence for similarities between uranyl (X = O) and uranocene (X = Cp) derivatives

International Nuclear Information System (INIS)

Iche-Tarrat, N.; Marsden, Colin J.; Barros, N.; Maron, L.; Barros, N.

2008-01-01

A DFT study of the isostructural compounds [UO 2 L 5 ] n- with n=3-5 and linear [Cp 2 UL 5 ] m- with m=1-3 has been carried out for two different anionic ligands. Structurally stable structures are obtained for all systems. The coordination competition between cyanide (CN - ) and isocyanide (NC - ) as well as between cyanate (OCN - ) and iso-cyanate (NCO - ) has been studied in the uranyl case. A clear preference for cyanide and iso-cyanate complexes is reported. The coordination of five ligands in the equatorial plane is rationalized by the analysis of the MO diagram of both systems. Moreover, the qualitative comparison of the two MO diagrams shows a high similarity in agreement with the isolobality concept. The existence of linear [Cp 2 UL 5 ] - organometallic U(VI) complexes is thus proposed, as well as the possibility of obtaining complexes of both types for U(VI) and U(V) with OCN - ligands. In addition, the U(IV) linear metallocene is calculated to be stable for the latter ligand. (authors)

Silicon-Containing Tri- and Tetra-Functional Cyanate Esters: Synthesis, Cure Kinetics, and Network Properties

Science.gov (United States)

2014-01-01

organosilane monomers have also been described recently for use in the formation of microporous structures.15 Though the incorporation of silicon at...Song, J. K.; Alagar, M. Microporous Mesoporous Mater. 2013, 179, 157-164. 26. Wu, G. L.; Kou, K. C.; Chao, M.; Zhuo, L. H.; Zhang, J. Q. J. Wuhan Univ...Cambrea, L. R. Insights into moisture uptake and processability from new cyanate ester monomer and blend studies. SAMPE International Technical

Low dielectric and low surface free energy flexible linear aliphatic alkoxy core bridged bisphenol cyanate ester based POSS nanocomposites

Directory of Open Access Journals (Sweden)

Muthukaruppan eAlagar

2013-10-01

Full Text Available The aim of the present work is to develop a new type of flexible linear aliphatic alkoxy core bridged bisphenol cyanate ester (AECE based POSS nanocomposites for low k applications. The POSS-AECE nanocomposites were developed by incorporating varying weight percentages (0, 5 and 10 wt % of octakis (dimethylsiloxypropylglycidylether silsesquioxane (OG-POSS into cyanate esters. Data from thermal and dielectric studies imply that the POSS reinforced nanocomposite exhibits higher thermal stability and low dielectric value of k=2.4 (10 wt% POSS-AECE4 compared than those of neat AECE. From the contact angle measurement, it is inferred that, the increase in the percentage incorporation of POSS in to AECE, the values of water contact angle was enhanced. Further, the value of surface free energy was lower when compared to that of neat AECE. The molecular level dispersion of POSS into AECE was ascertained from SEM and TEM analyses.

Development of high radiation-resistant glass fiber reinforced plastics with cyanate-based resin for superconducting magnet systems

Energy Technology Data Exchange (ETDEWEB)

Idesaki, Akira, E-mail: idesaki.akira@qst.go.jp [Quantum Beam Science Directorate, Japan Atomic Energy Agency, Watanuki 1233, Takasaki, Gunma 370-1292 (Japan); Nakamoto, Tatsushi [Cryogenic Science Center, High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Yoshida, Makoto [Institute of Particle and Nuclear Studies, High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Shimada, Akihiko [Quantum Beam Science Directorate, Japan Atomic Energy Agency, Watanuki 1233, Takasaki, Gunma 370-1292 (Japan); Iio, Masami; Sasaki, Kenichi; Sugano, Michinaka [Cryogenic Science Center, High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Makida, Yasuhiro [Institute of Particle and Nuclear Studies, High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Ogitsu, Toru [Cryogenic Science Center, High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan)

2016-11-15

Highlights: • GFRPs for superconducting magnet systems were developed. • Cyanate-based resins were used for GFRPs as matrices. • Radiation resistance was evaluated based on gas evolution and mechanical properties. • GFRP with bismaleimide-triazine resin exhibited excellent radiation resistance. - Abstract: Glass fiber reinforced plastics (GFRPs) with cyanate ester resin/epoxy resin, bismaleimide resin/epoxy resin, and bismaleimide-triazine resin as matrices were developed for the superconducting magnet systems used in high intensity accelerators. The radiation resistance of these GFRPs was evaluated based on their gas evolution and changes in their mechanical properties after gamma-ray irradiation with dose of 100 MGy in vacuum at ambient temperature. After irradiation, a small amount of gas was evolved from all of the GFRPs, and a slight decrease in mechanical properties was observed compared with the conventional epoxy resin-GFRP, G10. Among the GFRPs, the smallest amount of gas (6 × 10{sup −5} mol/g) was evolved from the GFRP with the bismaleimide-triazine resin, which also retained more than 88% of its flexural strength after 100 MGy irradiation; this GFRP is thus considered the most promising material for superconducting magnet systems.

Fourier transform infrared spectroscopy of azide and cyanate ion pairs in AOT reverse micelles

Science.gov (United States)

Owrutsky, Jeffrey C.; Pomfret, Michael B.; Barton, David J.; Kidwell, David A.

2008-07-01

Evidence for ion pair formation in aqueous bis(2-ethylhexyl) sulfosuccinate (AOT) reverse micelles (RMs) was obtained from infrared spectra of azide and cyanate with Li+, Na+, K+, and NH4+ counterions. The anions' antisymmetric stretching bands near 2000 cm-1 are shifted to higher frequency (blueshifted) in LiAOT and to a lesser extent in NaAOT, but they are very similar to those in bulk water with K+ and NH4+ as the counterions. The shifts are largest for low values of wo=[water]/[AOT] and approach the bulk value with increasing wo. The blueshifts are attributed to ion pairing between the anions and the counterions. This interpretation is reinforced by the similar trend (Li+>Na+>K+) for producing contact ion pairs with the metal cations in bulk dimethyl sulfoxide (DMSO) solutions. We find no evidence of ion pairs being formed in NH4AOT RMs, whereas ammonium does form ion pairs with azide and cyanate in bulk DMSO. Studies are also reported for the anions in formamide-containing AOT RMs, in which blueshifts and ion pair formation are observed more than in the aqueous RMs. Ion pairs are preferentially formed in confined RM systems, consistent with the well established ideas that RMs exhibit reduced polarity and a disrupted hydrogen bonding network compared to bulk water and that ion-specific effects are involved in mediating the structure of species at interfaces.

Triptycene-Based Microporous Cyanate Resins for Adsorption/Separations of Benzene/Cyclohexane and Carbon Dioxide Gas.

Science.gov (United States)

Deng, Gaoyang; Wang, Zhonggang

2017-11-29

Triptycene-based cyanate monomers 2,6,14-tricyanatotriptycene (TPC) and 2,6,14-tris(4-cyanatophenyl)triptycene (TPPC) that contain different numbers of benzene rings per molecule were synthesized, from which two microporous cyanate resins PCN-TPC and PCN-TPPC were prepared. Of interest is the observation that the two polymers have very similar porosity parameters, but PCN-TPPC uptakes considerably higher benzene (77.8 wt %) than PCN-TPC (17.6 wt %) at room temperature since the higher concentration of phenyl groups in PCN-TPPC enhances the π-π interaction with benzene molecules. Besides, the adsorption capacity of benzene in PCN-TPPC is dramatically 7 times as high as that of cyclohexane. Contrary to the adsorption of organic vapors, at 273 K and 1.0 bar, PCN-TPC with more heteroatoms in the network skeleton displays larger uptake of CO 2 and higher CO 2 /N 2 selectivity (16.4 wt %, 60) than those of PCN-TPPC (14.0 wt %, 39). The excellent and unique adsorption properties exhibit potential applications in the purification of small molecular organic hydrocarbons, e.g., separation of benzene from benzene/cyclohexane mixture as well as CO 2 capture from flue gas. Moreover, the results are helpful for deeply understanding the effect of porous and chemical structures on the adsorption properties of organic hydrocarbons and CO 2 gas.

Nickel-Catalyzed C–CN Bond Formation via Decarbonylative Cyanation of Esters, Amides, and Intramolecular Recombination Fragment Coupling of Acyl Cyanides

KAUST Repository

Chatupheeraphat, Adisak; Liao, Hsuan-Hung; Lee, Shao-Chi; Rueping, Magnus

2017-01-01

An efficient nickel-catalyzed decarbonylative cyanation reaction which allows the direct functional-group interconversion of readily available esters into the corresponding nitriles was developed. This reaction successfully offers access to structurally diverse nitriles with high efficiency and excellent functional-group tolerance and provides a good alternative to classical synthetic pathways from diazonium salts or organic halide compounds.

Nickel-Catalyzed C–CN Bond Formation via Decarbonylative Cyanation of Esters, Amides, and Intramolecular Recombination Fragment Coupling of Acyl Cyanides

KAUST Repository

Chatupheeraphat, Adisak

2017-08-07

An efficient nickel-catalyzed decarbonylative cyanation reaction which allows the direct functional-group interconversion of readily available esters into the corresponding nitriles was developed. This reaction successfully offers access to structurally diverse nitriles with high efficiency and excellent functional-group tolerance and provides a good alternative to classical synthetic pathways from diazonium salts or organic halide compounds.

Thermal conductivity and Kapitza resistance of cyanate ester epoxy mix and tri-functional epoxy electrical insulations at superfluid helium temperature

CERN Document Server

Pietrowicz, S; Jones, S; Canfer, S; Baudouy, B

2012-01-01

In the framework of the European Union FP7 project EuCARD, two composite insulation systems made of cyanate ester epoxy mix and tri-functional epoxy (TGPAP-DETDA) with S-glass fiber have been thermally tested as possible candidates to be the electrical insulation of 13 T Nb$_{3}$Sn high field magnets under development for this program. Since it is expected to be operated in pressurized superfluid helium at 1.9 K and 1 atm, the thermal conductivity and the Kapitza resistance are the most important input parameters for the thermal design of this type of magnet and have been determined in this study. For determining these thermal properties, three sheets of each material with different thicknesses varying from 245 μm to 598 μm have been tested in steady-state condition in the temperature range of 1.6 K - 2.0 K. The thermal conductivity for the tri-functional epoxy (TGPAP-DETDA) epoxy resin insulation is found to be k=[(34.2±5.5).T-(16.4±8.2)]×10-3 Wm-1K-1 and for the cyanate ester epoxy k=[(26.8±4.8).T- (9...

Optimization and Validation of a Surface Wipe Method to Determine Cyanide and Cyanate: Application to the Emergency Destruction System

Science.gov (United States)

2012-08-01

NJ b WC-7 Grade 42, 55 mm filter paper Whatman, Piscataway, NJ b WC-8 Cellulose nitrate membrane filter, 47 mm Whatman, Piscataway, NJ b WC-9...density polypropylene plastic bottle. 2.5 Standards Sodium cyanide (NaCN, ≥97.0%, CAS no. 143-33-9) and potassium cyanate (KOCN, ≥97.0...Agilent Technologies model 3D CE system, with an ultraviolet (deuterium lamp) diode array detector, was used to determine the quantities of CN and OCN

4He permeation and H2O uptake of cyanate ester resins — an alternative to commonly used epoxy resins at low temperature

Science.gov (United States)

Nakamura, Sachiko; Fujii, Takenori; Matsukawa, Shoji; Katagiri, Masayuki; Fukuyama, Hiroshi

2018-03-01

Cyanate ester (CE) thermoset is a polymer with a high glass-transition temperature of ≈ 300 °C. CE is expected to be an alternative to Stycast 1266 as a sealing and casting glue for low temperature experiments, especially for adsorption experiments where baking of the substrate at T > 100 °C before cooling is required to eliminate surface contaminations. We experimentally confirmed that thermosets of CE monomers are non-porous and absorbs/desorbs water very little from measurements of (1) 4He permeation properties at temperatures from room temperature (RT) to 77 K and of (2) weight gains (δW) after storage for days in water and in air at RT. The 4He permeation is rather large at RT but negligibly small at T ⪅ 130 K where the diffusion constant of 4He in CE is vanishingly small. δW in water and air are 0.3–0.5% and 0.5–1.0%, respectively, which are much smaller than those of Stycast 1266. Therefore, cyanate ester is an excellent alternative to commonly used epoxy resins especially in surface-sensitive experiments at low temperature.

Space charge dynamic of irradiated cyanate ester/epoxy at cryogenic temperatures

Science.gov (United States)

Wang, Shaohe; Tu, Youping; Fan, Linzhen; Yi, Chengqian; Wu, Zhixiong; Li, Laifeng

2018-03-01

Glass fibre reinforced polymers (GFRPs) have been widely used as one of the main electrical insulating structures for superconducting magnets. A new type of GFRP insulation material using cyanate ester/epoxy resin as a matrix was developed in this study, and the samples were irradiated by Co-60 for 1 MGy and 5 MGy dose. Space charge distributed within the sample were tested using the pulsed electroacoustic method, and charge concentration was found at the interfaces between glass fibre and epoxy resin. Thermally stimulated current (TSC) and dc conduction current were also tested to evaluate the irradiation effect. It was supposed that charge mobility and density were suppressed at the beginning due to the crosslinking reaction, and for a higher irradiation dose, molecular chain degradation dominated and led to more sever space charge accumulation at interfaces which enhance the internal electric field higher than the external field, and transition field for conduction current was also decreased by irradiation. Space charge dynamic at cryogenic temperature was revealed by conduction current and TSC, and space charge injection was observed for the irradiated samples at 225 K, which was more obvious for the irradiated samples.

Tailoring the toughness and CTE of high temperature bisphenol E cyanate ester (BECy resin

Directory of Open Access Journals (Sweden)

M. Thunga

2014-05-01

Full Text Available The objective of the present work is to enhancing the toughness and minimizing the CTE of a special class of bisphenol E cyanate ester (BECy resin by blending it with a thermoplastic toughening agent. Poly(ether sulfone was chosen as a high temperature resistant thermoplastic resin to enhance the thermo-mechanical properties of BECy. The influence of poly(ether sulfone/BECy blend composition on the morphology and phase behavior was studied using scanning electron microscopy and dynamic mechanical analysis. The mechanical properties of the blends were evaluated by flexural tests, which demonstrated significant enhancement in the material’s toughness with an increase in PES concentration from 0 to 15 wt%. The coefficient of thermal expansion of pure BECy was reduced from 61 to 48 ppm/°C in the blends with PES, emphasizing the multi-functional benefits of PES as a toughening agent in BECy.

Nanoporous Polymer Films of Cyanate Ester Resins Designed by Using Ionic Liquids as Porogens.

Science.gov (United States)

Fainleib, Alexander; Vashchuk, Alina; Starostenko, Olga; Grigoryeva, Olga; Rogalsky, Sergiy; Nguyen, Thi-Thanh-Tam; Grande, Daniel

2017-12-01

Novel nanoporous film materials of thermostable cyanate ester resins (CERs) were generated by polycyclotrimerization of dicyanate ester of bisphenol E in the presence of varying amounts (from 20 to 40 wt%) of an ionic liquid (IL), i.e., 1-heptylpyridinium tetrafluoroborate, followed by its quantitative extraction after complete CER network formation. The completion of CER formation and IL extraction was assessed using gel fraction content determination, FTIR, 1 H NMR, and energy-dispersive X-ray spectroscopy (EDX). SEM and DSC-based thermoporometry analyses demonstrated the formation of nanoporous structures after IL removal from CER networks, thus showing the effective role of IL as a porogen. Pore sizes varied from ~20 to ~180 nm with an average pore diameter of around 45-60 nm depending on the initial IL content. The thermal stability of nanoporous CER-based films was investigated by thermogravimetric analysis.

Di(cyanate Ester) Networks Based on Alternative Fluorinated Bisphenols with Extremely Low Water Uptake

Science.gov (United States)

2013-11-01

Bisphenol  A.   A variation on  the AroCy F® monomer  in an  oligomeric   liquid  form has also been studied by Yameen et al.21   Recently, the use of polymers...co‐workers,31‐33  synthesized a variety of fluoroaliphatic dicyanate ester mon‐ omers.  These  monomers were  liquids  at room temperature,  and cured...to  greatly  affect  the rates of cyclotrimerization in cyanate esters.  At both 210  °C and 250 °C, the  ionic  viscosity in PFCBCy is higher than in

Interpenetrating polymer networks based on cyanate ester and fluorinated ethynyl-terminated imide oligomers

Directory of Open Access Journals (Sweden)

Y. Wen

2017-12-01

Full Text Available Highly soluble fluorinated ethynyl-terminated imide (FETI oligomers were prepared via a conventional one-step method in m-cresol, using 4, 4′-(hexafluoroisopropylidene diphthalic anhydride and 2, 2′-bis(trifluoromethyl benzidine as the monomers, and ethynylphthalic anhydride as the end-capper; then interpenetrating polymer networks (IPN were formulated from FETI oligomers and bisphenol A dicyanate ester (BADCy through a solvent-free procedure, and their thermal, mechanical, and dielectric properties were fully characterized. The curing mechanism was studied by model reactions using nitrogen nuclear magnetic resonance. As evidenced by differential scanning calorimetry analysis and rheological measurements, the FETI/BADCy blends exhibited lower curing temperature and shorter gelation time in comparison with pure BADCy due to the catalytic effects of ethynyl and residue amic acid groups. The properties of IPNs were fully compared with those of polycyanurate, and the results revealed that the incorporation of FETI into cyanate ester resins could significantly improve the toughness, glass transition temperatures, mechanical and dielectric properties of the resultant IPNs.

Synthesis and preliminary scintigraphic evaluation of in vivo distribution of 11C-hydroxyurea/isohydroxyurea and 11C-cyanate

International Nuclear Information System (INIS)

Winstead, M.B.; Chern, C.-I.; Lin, T.-H.; Khentigan, A.; Lamb, J.F.; Winchell, H.S.

1978-01-01

H 11 CN, produced directly from proton bombardment of 99% N 2 -1% H 2 [ 14 N(p, α) 11 C], was oxidized by KMn0 4 to 11 C-cyanate which was added to hydroxylamine at -5 to 0 0 C to yield a mixture of hydroxyurea and isohydroxyurea. Scintigraphic evaluation of in vivo distribution in a dog following administration of K0 11 CN showed diffuse whole-body distribution, apparently including brain, with greater activity seen in regions of the heart, liver, and kidneys. Similar evaluation of a dog given 11 C-hydroxyurea/isohydroxyurea showed early localization of activity in the region of the heart which appeared to be due to activity in the myocardium. However, tissue activity measured in rats after administration of this material failed to demonstrate concentration in the myocardium. (author)

Viscosity of aqueous and cyanate ester suspensions containing alumina nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Lawler, Katherine [Iowa State Univ., Ames, IA (United States)

2009-01-01

The viscosities of both aqueous and cyanate ester monomer (BECy) based suspensions of alumina nanoparticle were studied. The applications for these suspensions are different: aqueous suspensions of alumina nanoparticles are used in the production of technical ceramics made by slip casting or tape casting, and the BECy based suspensions are being developed for use in an injection-type composite repair resin. In the case of aqueous suspensions, it is advantageous to achieve a high solids content with low viscosity in order to produce a high quality product. The addition of a dispersant is useful so that higher solids content suspensions can be used with lower viscosities. For BECy suspensions, the addition of nanoparticles to the BECy resin is expected to enhance the mechanical properties of the cured composite. The addition of saccharides to aqueous suspensions leads to viscosity reduction. Through DSC measurements it was found that the saccharide molecules formed a solution with water and this resulted in lowering the melting temperature of the free water according to classic freezing point depression. Saccharides also lowered the melting temperature of the bound water, but this followed a different rule. The shear thinning and melting behaviors of the suspensions were used to develop a model based on fractal-type agglomeration. It is believed that the structure of the particle flocs in these suspensions changes with the addition of saccharides which leads to the resultant viscosity decrease. The viscosity of the BECy suspensions increased with solids content, and the viscosity increase was greater than predicted by the classical Einstein equation for dilute suspensions. Instead, the Mooney equation fits the viscosity behavior well from 0-20 vol% solids. The viscosity reduction achieved at high particle loadings by the addition of benzoic acid was also investigated by NMR. It appears that the benzoic acid interacts with the surface of the alumina particle which may

Chromatographic determination of nanomolar cyanate concentrations in estuarine and sea waters by precolumn fluorescence derivatization.

Science.gov (United States)

Widner, Brittany; Mulholland, Margaret R; Mopper, Kenneth

2013-07-16

Recent studies suggest that cyanate (OCN(-)) is a potentially important source of reduced nitrogen (N) available to support the growth of aquatic microbes and, thus, may play a role in aquatic N cycling. However, aquatic OCN(-) distributions have not been previously described because of the lack of a suitable assay for measuring OCN(-) concentrations in natural waters. Previous methods were designed to quantify OCN(-) in aqueous samples with much higher reduced N concentrations (micromolar levels) than those likely to be found in natural waters (nanomolar levels). We have developed a method to quantify OCN(-) in dilute, saline environments. In the method described here, OCN(-) in aqueous solution reacts with 2-aminobenzoic acid to produce a highly fluorescent derivative, 2,4-quinazolinedione, which is then quantified using high performance liquid chromatography. Derivatization conditions were optimized to simultaneously minimize the reagent blank and maximize 2,4-quinazolinedione formation (>90% reaction yield) in estuarine and seawater matrices. A limit of detection (LOD) of 0.4 nM was achieved with only minor matrix effects. We applied this method to measure OCN(-) concentrations in estuarine and seawater samples from the Chesapeake Bay and coastal waters from the mid-Atlantic region. OCN(-) concentrations ranged from 0.9 to 41 nM. We determined that OCN(-) concentrations were stable in 0.2 μm filtered seawater samples stored at -80 °C for up to nine months.

Electron spin ressonance of radicals produced by ultra-violet photolysis of KCL dopped with potassium cyanide and potassium cyanate

International Nuclear Information System (INIS)

Duran, J.E.R.

1975-01-01

The production of radicals by ultra-violet photolysis of KCL dopped with potassium cyanide and potassium cyanate is studied by electron spin resonance. Several new paramagnetic species are detected which are identified as HCNO - , NCN - /NCNO - , CNN - /CNON - and CNOsup(=) all giving isotropic spectra at 77 0 K. The temperature dependence of the CNOsup(=) spectrum is investigated down to 1.6 0 K. It is found that two different recrientation motions ocurr which freeze at different temperatures. The effect of this motion on the line width is analized using Anderson's theory of exchange narrowing. The electronic structure of the CNOsup(=) radical is discussed using the measured the carbon and nitrogen hfs constants. It is found that a bonding scheme similar to that accepted for the isoelectronic molecule NO 2 is applicable, and a one electron molecular orbital scheme is given. Within this scheme a negative contribution to the nitrogen isotropic hfs constant is found which is assumed to originate from the polarization of the fully occupied ls orbitals [pt

Influences of surface modification of nano-silica by silane coupling agents on the thermal and frictional properties of cyanate ester resin

Science.gov (United States)

Chuang, Wang; Geng-sheng, Jiao; Lei, Peng; Bao-lin, Zhu; Ke-zhi, Li; Jun-long, Wang

2018-06-01

The surface of nano-silicon dioxide (nano-SiO2) particles was modified by small molecular coupling agent KH-560 and macromolecular coupling agent SEA-171, respectively, to change the surface activity and structure. The modified nano-SiO2 was then used for reinforcing cyanate ester resin (CE). Influences of the content of nano-SiO2 and the interfacial structure over the thermal and frictional properties of nano-SiO2/CE composites were investigated. The mechanism of the surface modification of silicon dioxide by KH-560 and SEA-171 was discussed. The experimental results show that the addition of coupling agents increased the interfacial bonding between nano-SiO2 particles and the CE resin so that the heat resistance and friction properties of the composites were improved. After surface treatment of nano-SiO2 by SEA-171, the thermal decomposition temperature of the 3.0 wt% nano-SiO2/CE composites increased nearly by 75 °C and the frictional coefficient was reduced by 25% compared with that of the pure CE, and the wear resistance increased by 77%.

Reactions of nitriles in ices relevant to Titan, comets, and the interstellar medium: formation of cyanate ion, ketenimines, and isonitriles

Science.gov (United States)

Hudson, R. L.; Moore, M. H.

2004-12-01

Motivated by detections of nitriles in Titan's atmosphere, cometary comae, and the interstellar medium, we report laboratory investigations of the low-temperature chemistry of acetonitrile, propionitrile, acrylonitrile, cyanoacetylene, and cyanogen (CH 3CN, CH 3CH 2CN, CH 2CHCN, HCCCN, and NCCN, respectively). A few experiments were also done on isobutyronitrile and trimethylacetonitrile ((CH 3) 2CHCN and (CH 3) 3CCN, respectively). Trends were sought, and found, in the photo- and radiation chemical products of these molecules at 12-25 K. In the absence of water, all of these molecules isomerized to isonitriles, and CH 3CN, CH 3CH 2CN, and (CH 3) 2CHCN also formed ketenimines. In the presence of H 2O, no isonitriles were detected but rather the cyanate ion (OCN -) was seen in all cases. Although isonitriles, ketenimines, and OCN - were the main focus of our work, we also describe cases of hydrogen loss, to make smaller nitriles, and hydrogen addition (reduction), to make larger nitriles. HCN formation also was seen in most experiments. The results are presented in terms of nitrile ice chemistry on Titan, in cometary ice, and in the interstellar medium. Possible connections to prebiotic chemistry are briefly discussed.

Ex situ generation of stoichiometric HCN and its application in the Pd-catalysed cyanation of aryl bromides: evidence for a transmetallation step between two oxidative addition Pd-complexes.

Science.gov (United States)

Kristensen, Steffan K; Eikeland, Espen Z; Taarning, Esben; Lindhardt, Anders T; Skrydstrup, Troels

2017-12-01

A protocol for the Pd-catalysed cyanation of aryl bromides using near stoichiometric and gaseous hydrogen cyanide is reported for the first time. A two-chamber reactor was adopted for the safe liberation of ex situ generated HCN in a closed environment, which proved highly efficient in the Ni-catalysed hydrocyanation as the test reaction. Subsequently, this setup was exploited for converting a range of aryl and heteroaryl bromides (28 examples) directly into the corresponding benzonitriles in high yields, without the need for cyanide salts. Cyanation was achieved employing the Pd(0) precatalyst, P( t Bu) 3 -Pd-G3 and a weak base, potassium acetate, in a dioxane-water solvent mixture. The methodology was also suitable for the synthesis of 13 C-labelled benzonitriles with ex situ generated 13 C-hydrogen cyanide. Stoichiometric studies with the metal complexes were undertaken to delineate the mechanism for this catalytic transformation. Treatment of Pd(P( t Bu) 3 ) 2 with H 13 CN in THF provided two Pd-hydride complexes, (P( t Bu) 3 ) 2 Pd(H)( 13 CN), and [(P( t Bu) 3 )Pd(H)] 2 Pd( 13 CN) 4 , both of which were isolated and characterised by NMR spectroscopy and X-ray crystal structure analysis. When the same reaction was performed in a THF : water mixture in the presence of KOAc, only (P( t Bu) 3 ) 2 Pd(H)( 13 CN) was formed. Subjection of this cyano hydride metal complex with the oxidative addition complex (P( t Bu) 3 )Pd(Ph)(Br) in a 1 : 1 ratio in THF led to a transmetallation step with the formation of (P( t Bu) 3 ) 2 Pd(H)(Br) and 13 C-benzonitrile from a reductive elimination step. These experiments suggest the possibility of a catalytic cycle involving initially the formation of two Pd(ii)-species from the oxidative addition of L n Pd(0) into HCN and an aryl bromide followed by a transmetallation step to L n Pd(Ar)(CN) and L n Pd(H)(Br), which both reductively eliminate, the latter in the presence of KOAc, to generate the benzonitrile and L n Pd(0).

Additive manufacturing of short and mixed fibre-reinforced polymer

Science.gov (United States)

Lewicki, James; Duoss, Eric B.; Rodriguez, Jennifer Nicole; Worsley, Marcus A.; King, Michael J.

2018-01-09

Additive manufacturing of a fiber-reinforced polymer (FRP) product using an additive manufacturing print head; a reservoir in the additive manufacturing print head; short carbon fibers in the reservoir, wherein the short carbon fibers are randomly aligned in the reservoir; an acrylate, methacrylate, epoxy, cyanate ester or isocyanate resin in the reservoir, wherein the short carbon fibers are dispersed in the acrylate, methacrylate, epoxy, cyanate ester or isocyanate resin; a tapered nozzle in the additive manufacturing print head operatively connected to the reservoir, the tapered nozzle produces an extruded material that forms the fiber-reinforced polymer product; baffles in the tapered nozzle that receive the acrylate, methacrylate, epoxy, cyanate ester or isocyanate resin with the short carbon fibers dispersed in the acrylate, methacrylate, epoxy, cyanate ester or isocyanate resin; and a system for driving the acrylate, methacrylate, epoxy, cyanate ester or isocyanate resin with the short carbon fibers dispersed in the acrylate, methacrylate, epoxy, cyanate ester or isocyanate resin from the reservoir through the tapered nozzle wherein the randomly aligned short carbon fibers in the acrylate, methacrylate, epoxy, cyanate ester or isocyanate resin are aligned by the baffles and wherein the extruded material has the short carbon fibers aligned in the acrylate, methacrylate, epoxy, cyanate ester or isocyanate resin that forms the fiber-reinforced polymer product.

High-k 3D-barium titanate foam/phenolphthalein poly(ether sulfone)/cyanate ester composites with frequency-stable dielectric properties and extremely low dielectric loss under reduced concentration of ceramics

Science.gov (United States)

Zheng, Longhui; Yuan, Li; Guan, Qingbao; Liang, Guozheng; Gu, Aijuan

2018-01-01

Higher dielectric constant, lower dielectric loss and better frequency stability have been the developing trends for high dielectric constant (high-k) materials. Herein, new composites have been developed through building unique structure by using hyperbranched polysiloxane modified 3D-barium titanate foam (BTF) (BTF@HSi) as the functional fillers and phenolphthalein poly(ether sulfone) (cPES)/cyanate ester (CE) blend as the resin matrix. For BTF@HSi/cPES/CE composite with 34.1 vol% BTF, its dielectric constant at 100 Hz is as high as 162 and dielectric loss is only 0.007; moreover, the dielectric properties of BTF@HSi/cPES/CE composites exhibit excellent frequency stability. To reveal the mechanism behind these attractive performances of BTF@HSi/cPES/CE composites, three kinds of composites (BTF/CE, BTF/cPES/CE, BTF@HSi/CE) were prepared, their structure and integrated performances were intensively investigated and compared with those of BTF@HSi/cPES/CE composites. Results show that the surface modification of BTF is good for preparing composites with improved thermal stability; while introducing flexible cPES to CE is beneficial to fabricate composites with good quality through effectively blocking cracks caused by the stress concentration, and then endowing the composites with good dielectric properties at reduced concentration of ceramics.

Protein synthesis in the presence of carbamoyl-amino acids

International Nuclear Information System (INIS)

Kraus, L.M.; Stephens, M.C.

1987-01-01

The role of exogenous carbamoyl-amino acids in protein biosynthesis has been examined in vitro using a mixture of 14 C amino acids to label newly synthesized protein in human reticulocyte rich (8-18%) peripheral blood. Aliquots of the radiolabeled newly synthesized protein were acid precipitated, washed and the radioactivity measured. Control samples which measured the synthetic capacity of the blood were aliquots of the same blood- 14 C amino acid mixture without added carbamoyl-amino acids or cyanate. N-carbamoyl leucine alone or a 3 N-carbamoyl amino acid mixture of leucine, aspartic acid and tyrosine were used to test inhibition of protein synthesis. Also carbamoyl-amino acids were synthesized using cyanate and Pierce hydrolyzate amino acid calibration standards or the mixture of 14 C amino acids. In this system the carbamoylation of endogenous amino acids by cyanate up to 8 μmol/100μl showed a linear decrease in protein synthesis with time which is inversely related to the cyanate concentration. At greater cyanate levels the inhibition of protein synthesis reaches a plateau. When N-carbamoyl-amino acids only are present there is about a 50% decrease in the 14 C protein at 30 minutes as compared to the synthesis of 14 C protein without N-carbamoyl-amino acids. These results indicate that the presence of carbamoyl-amino acids interferes with protein synthesis

Copper(II) catalysis in cyanide conversion into ethyl carbamate in spirits and relevant reactions.

Science.gov (United States)

Aresta, M; Boscolo, M; Franco, D W

2001-06-01

The role of copper(II) species in the oxidation of inorganic cyanide to cyanate and in the conversion of cyanate or urea into ethyl carbamate was investigated. The oxidation process has been shown to be independent from the dissolved oxygen. Elemental analysis and infrared spectroscopy have shown the formation of a mixed copper carbonate/hydroxide in the process of oxidation of cyanide to cyanate in water/ethanol. The complexation to Cu(II) of cyanate formed upon cyanide oxidation makes the former more susceptible to nucleophilic attack from ethanol, with conversion into ethyl carbamate. Comparatively, urea has a minor role with respect to cyanide in the formation of ethyl carbamate. Therefore, the urea present in some samples of Brazilian sugar cane spirit (cachaça) has been shown to have almost no influence on the ethyl carbamate content of cachaças, which comes essentially from cyanide. Fe(II,III) affords results similar to those found with Cu(II). Some suggestions are presented to avoid ethyl carbamate formation in spirits during distillation.

Thermosetting Polymer-Matrix Composites for Strucutral Repair Applications

Energy Technology Data Exchange (ETDEWEB)

Goertzen, William Kirby [Iowa State Univ., Ames, IA (United States)

2007-12-01

Several classes of thermosetting polymer matrix composites were evaluated for use in structural repair applications. Initial work involved the characterization and evaluation of woven carbon fiber/epoxy matrix composites for structural pipeline repair. Cyanate ester resins were evaluated as a replacement for epoxy in composites for high-temperature pipe repair applications, and as the basis for adhesives for resin infusion repair of high-temperature composite materials. Carbon fiber/cyanate ester matrix composites and fumed silica/cyanate ester nanocomposites were evaluated for their thermal, mechanical, viscoelastic, and rheological properties as they relate to their structure, chemistry, and processing characteristics. The bisphenol E cyanate ester under investigation possesses a high glass transition temperature, excellent mechanical properties, and unique ambient temperature processability. The incorporate of fumed silica served to enhance the mechanical and rheological properties of the polymer and reduce thermal expansion without sacrificing glass transition or drastically altering curing kinetics. Characterization of the composites included dynamic mechanical analysis, thermomechanical analysis, differential scanning calorimetry, thermogravimetric analysis, rheological and rheokinetic evaluation, and transmission electron microscopy.

Synthesis of electrophilic 11C-synthons: 11C-cyanogen bromide and some 11C-cyano reagents

International Nuclear Information System (INIS)

Westerberg, G.; Malmborg, P.; Langstroem, B.

1990-01-01

A fast, simple, and reliable method has been developed for the synthesis of carbon-11 labelled cyanogen bromide and several of its stabilized amine salts or cyanates. Preparation of cyanogen bromide is by bromination (bromine gas) of carbon-11 labelled hydrocyanic acid, followed by reaction with a tertiary amine or a phenol to yield the ammonium salts or cyanates

Synthesis of improved phenolic and polyester resins

Science.gov (United States)

Delano, C. B.

1980-01-01

Thirty-seven cured phenolic resin compositions were prepared and tested for their ability to provide improved char residues and moisture resistance over state of the art epoxy resin composite matrices. Cyanate, epoxy novolac and vinyl ester resins were investigated. Char promoter additives were found to increase the anaerobic char yield at 800 C of epoxy novolacs and vinyl esters. Moisture resistant cyanate and vinyl ester compositions were investigated as composite matrices with Thornel 300 graphite fiber. A cyanate composite matrix provided state of the art composite mechanical properties before and after humidity exposure and an anaerobic char yield of 46 percent at 800 C. The outstanding moisture resistance of the matrix was not completely realized in the composite. Vinyl ester resins showed promise as candidates for improved composite matrix systems.

Interactions Between Structure and Processing that Control Moisture Uptake in High-Performance Polycyanurates (Briefing Charts)

Science.gov (United States)

2015-03-24

Motivation • SOTA Theories of Moisture Uptake in Thermosetting Networks • New Tools and New Discoveries • Unresolved Issues and Ways to Address Them...Temperature Thermosetting Polymers: Cyanate Esters • Glass transition temperatures at full cure of 200 – 400°C • Uncured resins exist as low-melting solids...Summary: Basic Studies of Moisture Uptake in Cyanate Ester Networks • Many aspects of moisture uptake (and its minimization) in thermosetting polymer

Synthesis of 13N and/or 11C single or doubly labelled urea

International Nuclear Information System (INIS)

Emran, A.M.

1989-01-01

Utilization of nitrogen by plants encounters two important problems which are denitrification and deficiency or inactivation of certain enzyme. In the first process the fertilizer is affected by certain bacteria to produce nitrogen or its oxides which cannot be utilized by plants. In the second process, transformation of urea nitrogen into forms usable by plants depends on abundance and activity of the enzyme urease. Study of inorganic nitrogen transport has been underway using 13 N-nitrate as a tracer. Behavior of organic nitrogen can be studied using labelled urea. [ 13 N] and/or [ 11 C] single or doubly labelled urea are good tracers for this purpose. Reaction of trace amounts of potassium cyanate with 13 N-ammonium sulfate produced 13 N-ammonium cyanate which was thermally transformed into [ 13 N]-urea with no added carrier. Similarly, [ 11 C]-potassium cyanate reacted with 13 N-ammonium sulfate to produce 13 N/ 11 C-doubly labelled urea. Thin layer and high performance liquid chromatography were used to identify the products and determine the yields

4-Bromo-N-(di-n-propyl­carbamothioyl)­benzamide

OpenAIRE

Binzet, Gün; Flörke, Ulrich; Külcü, Nevzat; Arslan, Hakan

2009-01-01

The synthesis of the title compound, C14H19BrN2OS, involves the reaction of 4-bromo­benzoyl chloride with potassium thio­cyanate in acetone followed by condensation of the resulting 4-bromo­benzoyl isothio­cyanate with di-n-propyl­amine. Typical thio­urea carbonyl and thio­carbonyl double bonds, as well as shortened C—N bonds, are observed in the title compound. The short C—N bond lengths in the centre of the mol­ecule reveal the effects of resonance in this part of the mol­ecule. The asymmet...

Study of SiO2/PMMA/CE tri-component interpenetrating polymer network composites

International Nuclear Information System (INIS)

Wang Junlong; Wang Chuang; Jiao Gengsheng; Wang Qiuya

2010-01-01

A technology of conjugated tri-component interpenetrating polymer networks was applied to synthesize a nano-SiO 2 /polymethylmethacrylate (PMMA)/cyanate (CE) composite through an asynchronous synthesis way. The microstructure of the composite was characterized using infrared spectroscopy (IR) and transmission electron microscopy (TEM). The mechanical properties were measured in German-made DL-1000B and XCL-40 universal material test machines, respectively. Results showed that both the impact strength and the flexural strength were in the optimum status when 3% SiO 2 /PMMA/CE was chosen as a sample with the PMMA/CE ratio of 20/80. Compared with the strengths of pure cyanate, those of the composite were raised by 137.28% and 31.29%, respectively. When 3% nano-SiO 2 was added, the impact strength was increased by 29.96% and the flexural strength by 20.05%, compared with the strengths of polymers without SiO 2 . Analysis and measurements by IR and TEM indicated that no chemical reactions took place among components in the composite. The interpenetration of the conjugated tri-component improved the loading capacity of the polymer, hence the toughness enhancement of cyanate.

A high-performance renewable thermosetting resin derived from eugenol.

Science.gov (United States)

Harvey, Benjamin G; Sahagun, Christopher M; Guenthner, Andrew J; Groshens, Thomas J; Cambrea, Lee R; Reams, Josiah T; Mabry, Joseph M

2014-07-01

A renewable bisphenol, 4,4'-(butane-1,4-diyl)bis(2-methoxyphenol), was synthesized on a preparative scale by a solvent-free, Ru-catalyzed olefin metathesis coupling reaction of eugenol followed by hydrogenation. After purification, the bisphenol was converted to a new bis(cyanate) ester by standard techniques. The bisphenol and cyanate ester were characterized rigorously by NMR spectroscopy and single-crystal X-ray diffraction studies. After complete cure, the cyanate ester exhibited thermal stability in excess of 350 °C and a glass transition temperature (Tg ) of 186 °C. As a result of the four-carbon chain between the aromatic rings, the thermoset displayed a water uptake of only 1.8% after a four day immersion in 85 °C water. The wet Tg of the material (167 °C) was only 19 °C lower than the dry Tg , and the material showed no significant degradation as a result of the water treatment. These results suggest that this resin is well suited for maritime environments and provide further evidence that full-performance resins can be generated from sustainable feedstocks. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Protein (Cyanobacteria): 504984996 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available WP_015172098.1 ... 1117:412 ... 1150:57188 1301283:78930 ... 63132:2073 1173025:1687 ... cyanate lyase Geit...lerinema sp. PCC 7407 MSIPEITEKLLAAKKAKDMTFADLEQILGRDEVWIASVIYRQASASEEEAQKIVEALGLGPEVAIALTD

Protein (Cyanobacteria): 428225487 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available YP_007109584.1 NC_019703 1117:412 ... 1150:57188 1301283:78930 ... 63132:2073 1173025:...1687 ... cyanate lyase Geitlerinema sp. PCC 7407 MSIPEITEKLLAAKKAKDMTFADLEQILGRDEVWIASVIYRQASASEEEAQKIVEALGLG

Biochemical and structural properties of cyanases from Arabidopsis thaliana and Oryza sativa.

Directory of Open Access Journals (Sweden)

Dan Qian

Full Text Available Cyanate is toxic to all organisms. Cyanase converts cyanate to CO₂ and NH₃ in a bicarbonate-dependent reaction. The biophysical functions and biochemical characteristics of plant cyanases are poorly studied, although it has been investigated in a variety of proteobacteria, cyanobacteria and fungi. In this study, we characterised plant cyanases from Arabidopsis thaliana and Oryza sativa (AtCYN and OsCYN. Prokaryotic-expressed AtCYN and OsCYN both showed cyanase activity in vitro. Temperature had a similar influence on the activity of both cyanases, but pH had a differential impact on AtCYN and OsCYN activity. Homology modelling provided models of monomers of AtCYN and OsCYN, and a coimmunoprecipitation assay and gel filtration indicated that AtCYN and OsCYN formed homodecamers. The analysis of single-residue mutants of AtCYN indicated that the conserved catalytic residues also contributed to the stability of the homodecamer. KCNO treatment inhibited Arabidopsis germination and early seedling growth. Plants containing AtCYN or OsCYN exhibited resistance to KCNO stress, which demonstrated that one role of cyanases in plants is detoxification. Transcription level of AtCYN was higher in the flower than in other organs of Arabidopsis. AtCYN transcription was not significantly affected by KCNO treatment in Arabidopsis, but was induced by salt stress. This research broadens our knowledge on plant detoxification of cyanate via cyanase.

Properties of halloysite nanotube-epoxy resin hybrids and the interfacial reactions in the systems

Energy Technology Data Exchange (ETDEWEB)

Liu Mingxian; Guo Baochun; Du Mingliang; Cai Xiaojia; Jia Demin [Department of Polymer Materials and Engineering, South China University of Technology, Guangzhou 510640 (China)

2007-11-14

A naturally occurred microtubullar silicate, halloysite nanotubes (HNTs), was co-cured with epoxy/cyanate ester resin to form organic-inorganic hybrids. The coefficient of thermal expansion (CTE) of the hybrids with low HNT concentration was found to be substantially lower than that of the plain cured resin. The moduli of the hybrids in the glassy state and rubbery state were significantly higher than those for the plain cured resin. The dispersion of HNTs in the resin matrix was very uniform as revealed by the transmission electron microscopy (TEM) results. The interfacial reactions between the HNTs and cyanate ester (CE) were revealed by the results of Fourier transform infrared spectroscopy (FTIR) and x-ray photoelectron spectroscopy (XPS). The substantially increased properties of the hybrids were attributed to the covalent bonding between the nanotubes and the matrix.

Properties of halloysite nanotube-epoxy resin hybrids and the interfacial reactions in the systems

International Nuclear Information System (INIS)

Liu Mingxian; Guo Baochun; Du Mingliang; Cai Xiaojia; Jia Demin

2007-01-01

A naturally occurred microtubullar silicate, halloysite nanotubes (HNTs), was co-cured with epoxy/cyanate ester resin to form organic-inorganic hybrids. The coefficient of thermal expansion (CTE) of the hybrids with low HNT concentration was found to be substantially lower than that of the plain cured resin. The moduli of the hybrids in the glassy state and rubbery state were significantly higher than those for the plain cured resin. The dispersion of HNTs in the resin matrix was very uniform as revealed by the transmission electron microscopy (TEM) results. The interfacial reactions between the HNTs and cyanate ester (CE) were revealed by the results of Fourier transform infrared spectroscopy (FTIR) and x-ray photoelectron spectroscopy (XPS). The substantially increased properties of the hybrids were attributed to the covalent bonding between the nanotubes and the matrix

Fire-Resistant Cyanate Ester-Epoxy Blends

National Research Council Canada - National Science Library

Walters, Richard

2002-01-01

.... The dicyanate and diepoxide of 1,1-dichloro-2,2-bis(4-hydroxyphenyl)ethylene (bisphenol-C, BPC) were combined in various molar ratios, and the reaction chemistry was monitored using Fourier Transform Infrared Spectroscopy...

PHYTOCHEMICAL SCREENING AND ANTIMICROBIAL EFFECT ...

African Journals Online (AJOL)

Administrator

well as some metabolites such as tannins, saponins, cyanates, oxalate and anthrax- .... production of secondary metabolite in the plant (Waterman & Mole,. 1989).There was no ... positive and gram negative bacteria) and fungi shows its application as a ... marine algae of Visakhapatna city, Andhra Pradesh. Asian Journal.

Mechanism of Intramolecular Rhodium- and Palladium-Catalyzed Alkene Alkoxyfunctionalizations

KAUST Repository

Vummaleti, Sai V. C.

2015-11-13

Density functional theory calculations have been used to investigate the reaction mechanism for the [Rh]-catalyzed intramolecular alkoxyacylation ([Rh] = [RhI(dppp)+] (dppp, 1,3-bis(diphenylphosphino)propane) and [Pd]/BPh3 dual catalytic system assisted intramolecular alkoxycyanation ([Pd] = Pd-Xantphos) using acylated and cyanated 2-allylphenol derivatives as substrates, respectively. Our results substantially confirm the proposed mechanism for both [Rh]- and [Pd]/ BPh3-mediated alkoxyfunctionalizations, offering a detailed geometrical and energetical understanding of all the elementary steps. Furthermore, for the [Rh]-mediated alkoxyacylation, our observations support the hypothesis that the quinoline group of the substrate is crucial to stabilize the acyl metal complex and prevent further decarbonylation. For [Pd]/BPh3-catalyzed alkoxycyanation, our findings clarify how the Lewis acid BPh3 cocatalyst accelerates the only slow step of the reaction, corresponding to the oxidative addition of the cyanate O-CN bond to the Pd center. © 2015 American Chemical Society.

Mechanism of Intramolecular Rhodium- and Palladium-Catalyzed Alkene Alkoxyfunctionalizations

KAUST Repository

Vummaleti, Sai V. C.; Alghamdi, Miasser; Poater, Albert; Falivene, Laura; Scaranto, Jessica; Beetstra, Dirk J.; Morton, Jason G.; Cavallo, Luigi

2015-01-01

Density functional theory calculations have been used to investigate the reaction mechanism for the [Rh]-catalyzed intramolecular alkoxyacylation ([Rh] = [RhI(dppp)+] (dppp, 1,3-bis(diphenylphosphino)propane) and [Pd]/BPh3 dual catalytic system assisted intramolecular alkoxycyanation ([Pd] = Pd-Xantphos) using acylated and cyanated 2-allylphenol derivatives as substrates, respectively. Our results substantially confirm the proposed mechanism for both [Rh]- and [Pd]/ BPh3-mediated alkoxyfunctionalizations, offering a detailed geometrical and energetical understanding of all the elementary steps. Furthermore, for the [Rh]-mediated alkoxyacylation, our observations support the hypothesis that the quinoline group of the substrate is crucial to stabilize the acyl metal complex and prevent further decarbonylation. For [Pd]/BPh3-catalyzed alkoxycyanation, our findings clarify how the Lewis acid BPh3 cocatalyst accelerates the only slow step of the reaction, corresponding to the oxidative addition of the cyanate O-CN bond to the Pd center. © 2015 American Chemical Society.

77 FR 58931 - Technical Corrections Relating to the Rules of Origin for Goods Imported Under the NAFTA and for...

Science.gov (United States)

2012-09-25

...; or A change to fulminates, cyanates or thiocyanates of heading 2852 from any other good of heading 2852 or from any other heading; or A change to any other good of subheading 2852.90 from fulminates..., prostagladins, thromboxanes and leukotrienes, natural or reproduced by synthesis, derivatives and structural...

Preparation and characterization of BADCy/MMA semi-IPN%BADCy/MMA半互穿网络的制备及性能表征

Institute of Scientific and Technical Information of China (English)

祝保林

2012-01-01

The cyanate ester resin/PMMA（BADCy/MMA-SIPN） with semi-interpenetrating polymers network were prepared by adding methyl methacrylate（MMA） monomer（synchronous synthisis）or MMA prepolymer（asynchronous synthesis）into the melting cyanate ester resin（BADCy） and caused.The bulk polymerization occurred.The effects of MMA contents on the mechanical properties and thermal performance of the BADCy/MMA-SIPN were investigated by the mechanical testing,infrared and DSC analysis.The results showed that the mechanical properties and heat resistance of the cyanate ester resin system were greatly improved by the formation of interpenetrating network.The impact strength,flexural strength and glass transition temperature were increased by 97.8%,58.6%,and 65 ℃,respectively.%在加热熔融的氰酸酯树脂（BADCy）中加入甲基丙烯酸甲酯（MMA）单体（同步合成法）或MMA预聚体（异步合成法）并引发使其发生本体聚合,制备了具有半互穿聚合物网络结构的氰酸酯树脂/聚甲基丙烯酸甲酯（BADCy/MMA-SIPN）,通过力学性能测试,红外及DSC分析研究了MMA含量对体系力学性能和热性能的影响。结果表明,互穿网絡的形成使氰酸酯树脂体系的力学性能和耐热性能都有较大的提高,冲击强度、弯曲强度及玻璃化温度分别提高了97.8%、58.6%和65℃。

Reactivity of halide and pseudohalide ligands

International Nuclear Information System (INIS)

Kukushkin, Yu.N.

1987-01-01

Reactivity of halide and pseudohalide (cyanide, azide, thiocyanate, cyanate) ligands tending to form bridge bonds in transition metal (Re, Mo, W) complexes is considered. Complexes where transition metal salts are ligands of other, complex-forming ion, are described. Transformation of innerspheric pseudohalide ligands is an important way of directed synthesis of these metal coordination compounds

Selective bromination of 4-chloro-1-indanone and synthesis of (4-chloro-2, 3-dihydro-1H-indene-2-yl)methanamine

OpenAIRE

Jasouri, S.; Khalafy, J.; Badali, M.; Piltan, M.

2010-01-01

The synthesis of 4-chloro-1-indanone in four steps from 2-chlorobenzaldehyde was investigated. Bromination of this compound under various conditions occurred in the cyclopentanone ring, producing mono- and dibromo derivatives. Cyanation of 2-bromo-4-chloro-1-indanone followed by reduction gave (4-chloro-2, 3-dihydro-1H-indene-2-yl)methanamine in quantitative yield.

Asphaltenes-based polymer nano-composites

Science.gov (United States)

Bowen, III, Daniel E

2013-12-17

Inventive composite materials are provided. The composite is preferably a nano-composite, and comprises an asphaltene, or a mixture of asphaltenes, blended with a polymer. The polymer can be any polymer in need of altered properties, including those selected from the group consisting of epoxies, acrylics, urethanes, silicones, cyanoacrylates, vulcanized rubber, phenol-formaldehyde, melamine-formaldehyde, urea-formaldehyde, imides, esters, cyanate esters, allyl resins.

Carbamylation of proteins – mechanism, causes and consequences

Directory of Open Access Journals (Sweden)

Anna Pieniążek

2016-05-01

Full Text Available Carbamylation (carbamoylation is a post-translational modification resulting from the nonenzymatic reaction between isocyanic acid and free functional groups of proteins, in particular with the free amino groups. This reaction alters structural and functional properties of proteins and results in faster aging of proteins.Urea present in the body can be transformed into cyanate and its more reactive form, isocyanic acid. High concentration of urea is associated with some diseases, especially with chronic renal failure and atherosclerosis. In human tissues, urea and cyanate are in equilibrium in aqueous solutions. Surprisingly, concentration of isocyanate in the body is much lower than it would appear from the kinetic parameters of urea decomposition. The low concentration of isocyanic acid results from its high reactivity and short half-life.In this review we describe the biochemical mechanism of carbamylation of proteins and freeamino acids. We summarize the literature data for carbamylation of hemoglobin, lipoproteins,albumin, membrane proteins and erythropoietin in chronic renal failure.In summary, the carbamylation of proteins may have a negative impact on their biologicalactivity and may contribute to the deterioration of patients with chronic renal failure.

Versatile preparation method for mesoporous TiO2 electrodes ...

Indian Academy of Sciences (India)

Unknown

cyanate into CuI layer further enhanced the efficiency up to 2⋅75% under the irradiance .... an extremely easy way to dope films with virtually any .... to see the effect of ionic liquid on CuI, 1-ethyl-3-methyl- ... This analysis showed that TiO2 electrodes were polycrys- .... thin insulating layer of Al2O3 by using dip-coating meth-.

Criss-cross Cycloadditions on Ketazines Derived from Alicyclic Ketones

Directory of Open Access Journals (Sweden)

Milan Potacek

2006-01-01

Full Text Available The reactivity of alicyclic ketazines in criss-cross cycloadditions was investigated. They react with potassium cyanate and ammonium thiocyanate in the presence of acetic acid to form spirocyclic perhydro[1,2,4]triazolo[1,2-a][1,2,4]triazole-1,5-diones and perhydro[1,2,4]triazolo[1,2-a][1,2,4]triazole-1,5-dithiones, respectively, in relatively high yields.

Artemisia vulgaris pollen allergoids digestibility in the simulated conditions of the gastrointestinal tract

OpenAIRE

RATKO M. JANKOV; NATALIJA DJ. POLOVIC; MARIJA DJ. GAVROVIC-JANKULOVIC; LIDIJA BURAZER; DANICA DJERGOVIC-PETROVIC; OLGA VUCKOVIC; OLIKA DROBNJAK; ZORICA SPORCIC; MARINA ATANASKOVIC-MARKOVIC; RATKO M. JANKOV

2006-01-01

Chemically modified allergens (allergoids) have found use in both traditional and novel forms of immunotherapy of allergic disorders. Novel forms of immunotherapy include local allergen delivery, via the gastrointestinal tract. This study conveys the gastrointestinal stability of three types ofmugwort pollen allergoids under simulated conditions of the gut. Allergoids of the pollen extract of Artemisia vulgaris were obtained by means of potassium cyanate, succinic and maleic anhydride. Gastro...

Cross-species and tissue variations in cyanide detoxification rates in rodents and non-human primates on protein-restricted diet.

Science.gov (United States)

Kimani, S; Moterroso, V; Morales, P; Wagner, J; Kipruto, S; Bukachi, F; Maitai, C; Tshala-Katumbay, D

2014-04-01

We sought to elucidate the impact of diet, cyanide or cyanate exposure on mammalian cyanide detoxification capabilities (CDC). Male rats (~8 weeks old) (N=52) on 75% sulfur amino acid (SAA)-deficient diet were treated with NaCN (2.5mg/kg bw) or NaOCN (50mg/kg bw) for 6 weeks. Macaca fascicularis monkeys (~12 years old) (N=12) were exclusively fed cassava for 5 weeks. CDC was assessed in plasma, or spinal cord, or brain. In rats, NaCN induced seizures under SAA-restricted diet whereas NaOCN induced motor deficits. No deficits were observed in non-human primates. Under normal diet, the CDC were up to ~80× faster in the nervous system (14 ms to produce one μmol of thiocyanate from the detoxification of cyanide) relative to plasma. Spinal cord CDC was impaired by NaCN, NaOCN, or SAA deficiency. In M. fascicularis, plasma CDC changed proportionally to total proteins (r=0.43; pcyanide may result from a "multiple hit" by the toxicity of cyanide or its cyanate metabolite, the influences of dietary deficiencies, and the tissue variations in CDC. Chronic dietary reliance on cassava may cause metabolic derangement including poor CDC. Copyright © 2014 Elsevier Ltd. All rights reserved.

Syntheses of organic compounds in the presence of the fused iron catalyst and their mechanisms and kinetics

Science.gov (United States)

Glebov, L. S.; Kliger, G. A.

1989-10-01

New synthetic possibilities of the reduced promoted fused iron catalyst in intermolecular and intramolecular amination, cyanation, hydrogenation-dehydrogenation, and hydrodeoxygenation reactions and intermolecular and intramolecular dehydration, polymerisation, and isotope exchange are examined. The mechanisms and kinetics of the reactions leading to the synthesis of amines, alcohols, hydrocarbons, and other organic compunds are discussed. A laser Raman spectroscopic method is described for the investigation of heterogeneous organic catalysis in situ. The bibliography includes 148 references.

IgG binding of mugwort pollen allergens and allergoids exposed to simulated gastrointestinal conditions measured by a self-developed ELISA test

OpenAIRE

RATKO M. JANKOV; OLGA VUCKOVIC; DANICA DJERGOVIC-PETROVIC; LIDIJA BURAZER; TANJA D. CIRKOVICVELICKOVIC; MARIJA DJ. GAVROVIC-JANKULOVIC; NATALIJA DJ. POLOVIC

2004-01-01

This study considers the influence of exposure to simulated gastrointestinal conditions (saliva, gut, intestine and acidic conditions of the gut) on IgG binding of unmodified allergens and three types of LMW allergoids of Artemisia vulgaris pollen extract obtained by means of potassium cyanate, succinic and maleic anhydride. It also concerns the optimization of a self-developed ELISA assay for comparison of the specific IgG binding of mugwort pollen extract and modified mugwort pollen derivat...

Economical and scalable synthesis of 6-amino-2-cyanobenzothiazole

Directory of Open Access Journals (Sweden)

Jacob R. Hauser

2016-09-01

Full Text Available 2-Cyanobenzothiazoles (CBTs are useful building blocks for: 1 luciferin derivatives for bioluminescent imaging; and 2 handles for bioorthogonal ligations. A particularly versatile CBT is 6-amino-2-cyanobenzothiazole (ACBT, which has an amine handle for straight-forward derivatisation. Here we present an economical and scalable synthesis of ACBT based on a cyanation catalysed by 1,4-diazabicyclo[2.2.2]octane (DABCO, and discuss its advantages for scale-up over previously reported routes.

Biomolecules from HCN

Science.gov (United States)

Ferris, J. P.; Wos, J. D.; Ryan, T. J.; Lobo, A. P.; Donner, D. B.

1974-01-01

It has been suggested by Sanchez et al. (1967) that HCN might have been one of the more important precursors of biological molecules on the primitive earth. Studies were conducted to determine the mechanisms involved in HCN oligomerizations in dilute aqueous solutions and to identify the compounds which are produced in these oligomerization mixtures. Indirect evidence for the formation of cyanate was obtained along with direct evidence for the formation of citrulline, aspartic acid, and orotic acid.

Electron-withdrawing groups induced remarkable changes in sensory property based on single micro/nanostructure of perylenediimide derivatives

International Nuclear Information System (INIS)

Huang, Yongwei; Zhang, Weiguang; Wang, Junchao; Fu, Lina; Shi, Jiahua

2015-01-01

Two perylenediimide derivatives, N, N′-bis(3,7-dimethyloctyl)- 1,7-dicyanoperylene-3,4:9,10-tetracarboxyldiimide and N, N′- bis(3,7-dimethyloctyl)- 1,2,6,7-tetrachloroperylene-3,4:9,10-tetracarboxyldiimide, were prepared and their one-dimensional micro/nanorods were obtained in chloroform/methanol solution. The determination of sensing properties based on their conductometric gas sensors revealed that the increased current was one order of magnitude higher for core-tetrachlorinated perylene than that of core-cyanated one in hydrazine vapor (8 part per million). While better ambient stability in air was found for core-cyanated perylene due to its lower lowest unoccupied molecular orbital (LUMO) energy level and high-ordered arrangement in solid materials. The differential response to hydrazine vapor was less dependent on their surface area and morphologies. It should be ascribed to the difference in activation energy level and twisted skeleton, which are originated from chloride and cyano groups on the bay positions. Discussion for structure-function relationships suggest core-substituted groups have significant impact on the performance of perylene sensing device by modulating band gap and structure of skeleton. - Highlights: • PTCDIs micro/nanorods were prepared in chloroform/methanol solutions. • High sensitivities to hydrazine were found based on PTCDIs gas sensors. • It showed that core-substituted groups had impact on sensitivity and stability

Highly radiation-resistant vacuum impregnation resin systems for fusion magnet insulation

International Nuclear Information System (INIS)

Fabian, P.E.; Munshi, N.A.; Denis, R.J.

2002-01-01

Magnets built for fusion devices such as the newly proposed Fusion Ignition Research Experiment (FIRE) need to be highly reliable, especially in a high radiation environment. Insulation materials are often the weak link in the design of superconducting magnets due to their sensitivity to high radiation doses, embrittlement at cryogenic temperatures, and the limitations on their fabricability. An insulation system capable of being vacuum impregnated with desirable properties such as a long pot-life, high strength, and excellent electrical integrity and which also provides high resistance to radiation would greatly improve magnet performance and reduce the manufacturing costs. A new class of insulation materials has been developed utilizing cyanate ester chemistries combined with other known radiation-resistant resins, such as bismaleimides and polyimides. These materials have been shown to meet the demanding requirements of the next generation of devices, such as FIRE. Post-irradiation testing to levels that exceed those required for FIRE showed no degradation in mechanical properties. In addition, the cyanate ester-based systems showed excellent performance at cryogenic temperatures and possess a wide range of processing variables, which will enable cost-effective fabrication of new magnets. This paper details the processing parameters, mechanical properties at 76 K and 4 K, as well as post-irradiation testing to dose levels surpassing 10 8 Gy

Identification of an Isothiocyanate on the HypEF Complex Suggests a Route for Efficient Cyanyl-Group Channeling during [NiFe]-Hydrogenase Cofactor Generation.

Directory of Open Access Journals (Sweden)

Sven T Stripp

Full Text Available [NiFe]-hydrogenases catalyze uptake and evolution of H2 in a wide range of microorganisms. The enzyme is characterized by an inorganic nickel/ iron cofactor, the latter of which carries carbon monoxide and cyanide ligands. In vivo generation of these ligands requires a number of auxiliary proteins, the so-called Hyp family. Initially, HypF binds and activates the precursor metabolite carbamoyl phosphate. HypF catalyzes removal of phosphate and transfers the carbamate group to HypE. In an ATP-dependent condensation reaction, the C-terminal cysteinyl residue of HypE is modified to what has been interpreted as thiocyanate. This group is the direct precursor of the cyanide ligands of the [NiFe]-hydrogenase active site cofactor. We present a FT-IR analysis of HypE and HypF as isolated from E. coli. We follow the HypF-catalyzed cyanation of HypE in vitro and screen for the influence of carbamoyl phosphate and ATP. To elucidate on the differences between HypE and the HypEF complex, spectro-electrochemistry was used to map the vibrational Stark effect of naturally cyanated HypE. The IR signature of HypE could ultimately be assigned to isothiocyanate (-N=C=S rather than thiocyanate (-S-C≡N. This has important implications for cyanyl-group channeling during [NiFe]-hydrogenase cofactor generation.

4-Bromo-N-(di-n-propyl-carbamothioyl)-benzamide.

Science.gov (United States)

Binzet, Gün; Flörke, Ulrich; Külcü, Nevzat; Arslan, Hakan

2009-02-04

The synthesis of the title compound, C(14)H(19)BrN(2)OS, involves the reaction of 4-bromo-benzoyl chloride with potassium thio-cyanate in acetone followed by condensation of the resulting 4-bromo-benzoyl isothio-cyanate with di-n-propyl-amine. Typical thio-urea carbonyl and thio-carbonyl double bonds, as well as shortened C-N bonds, are observed in the title compound. The short C-N bond lengths in the centre of the mol-ecule reveal the effects of resonance in this part of the mol-ecule. The asymmetric unit of the title compound contains two crystallographically independent mol-ecules, A and B. There is very little difference between the bond lengths and angles of these mol-ecules. In mol-ecule B, one di-n-propyl group is twisted in a -anti-periplanar conformation with C-C-C-H = -179.1 (3)° and the other adopts a -synclinal conformation with C-C-C-H = -56.7 (4)°; in mol-ecule A the two di-n-propyl groups are twisted in + and -anti-periplanar conformations, with C-C-C-H = -179.9 (3) and 178.2 (3)°, respectively. In the crystal, the mol-ecules are linked into dimeric pairs via pairs of N-H⋯S hydrogen bonds.

Enhanced Cyanate Ester Nanocomposites through Improved Nanoparticle Surface Interactions

Science.gov (United States)

2013-05-01

then removed and any residual unreacted 3- aminopropytrimethoxy silane and side products were removed by three days of Soxhlet extraction in a...each type of nanoparticle surface. The nanocomposites were prepared in such a way as to yield samples with identical total nanoparticle surface area

Cyanate Ester Composite Resins Derived from Renewable Polyphenol Sources

Science.gov (United States)

2011-03-16

NDGA). Other promising polyphenols are resveratrol, a well-known antioxidant found in grape skins and extracted from Japanese Knotweed, and curcumin ...the phenolic rings of 4- methyl-2-methoxyphenol,18 a procedure detailed by Marques and coworkers19 uses the methylene chloride soluble permanganate

Free volume of cyanate resins studied by positron annihilation

International Nuclear Information System (INIS)

Suzuki, T.; Oki, Y.; Numajiri, M.; Miura, T.; Kondo, K.; Oshima, N.; Hayashi, T.; Nakamura, H.; Ito, Y.

1996-01-01

The polymerization process of bisphenol-A dicyanate (BADCy) has been studied using a positron-annihilation lifetime technique (PAL). The polymerization was conducted at 150 deg C, and the process was followed by PAL. Seven kinds of samples with different curing times were also formed at 150 deg C, and the relation between the period of the curing time and the degree of polymerization was studied. It has been shown that the ο-Ps lifetime increases in samples with a higher polymerization than 85%, which is consistent with measurements of the specific volume of BADCy. (author)

Monoclinic form of (cyanato-κN{2,2′-[ethane-1,2-diylbis(nitrilomethylidyne]diphenolato-κ4O,N,N′,O′}manganese(III

Directory of Open Access Journals (Sweden)

Daopeng Zhang

2010-12-01

Full Text Available The title compound, [Mn(C16H14N2O2(NCO], is a monoclinic polymorph of the previously published orthorhombic form [Lu et al. (2006. Inorg. Chem. 45, 3538–3548]. The MnIII ion is chelated by a tetradentate Schiff base ligand and coordinated by the N atom of a cyanate ligand in a distorted square-pyramidal arrangement. In the crystal, there are short intermolecular Mn...Ophenolate distances of 2.752 (3 Å between pairs of inversion-related molecules.

"Nanorust"-catalyzed benign oxidation of amines for selective synthesis of nitriles.

Science.gov (United States)

Jagadeesh, Rajenahally V; Junge, Henrik; Beller, Matthias

2015-01-01

Organic nitriles constitute key precursors and central intermediates in organic synthesis. In addition, nitriles represent a versatile motif found in numerous medicinally and biologically important compounds. Generally, these nitriles are synthesized by traditional cyanation procedures using toxic cyanides. Herein, we report the selective and environmentally benign oxidative conversion of primary amines for the synthesis of structurally diverse aromatic, aliphatic and heterocyclic nitriles using a reusable "nanorust" (nanoscale Fe2 O3 )-based catalysts applying molecular oxygen. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Evaluation of Pterin, a Promising Drug Candidate from Cyanide Degrading Bacteria.

Science.gov (United States)

Mahendran, Ramasamy; Thandeeswaran, Murugesan; Kiran, Gopikrishnan; Arulkumar, Mani; Ayub Nawaz, K A; Jabastin, Jayamanoharan; Janani, Balraj; Anto Thomas, Thomas; Angayarkanni, Jayaraman

2018-06-01

Pterin is a member of the compounds known as pteridines. They have the same nucleus of 2-amino-4-hydroxypteridine (pterin); however, the side-chain is different at the position 6, and the state of oxidation of the ring may exist in different form viz. tetrahydro, dihydro, or a fully oxidized form. In the present study, the microorganisms able to utilize cyanide, and heavy metals have been tested for the efficient production of pterin compound. The soil samples contaminated with cyanide and heavy metals were collected from Salem steel industries, Tamil Nadu, India. Out of 77 isolated strains, 40 isolates were found to utilize sodium cyanate as nitrogen source at different concentrations. However, only 13 isolates were able to tolerate maximum concentration (60 mM) of sodium cyanate and were screened for pterin production. Among the 13 isolates, only 1 organism showed maximum production of pterin, and the same was identified as Bacillus pumilus SVD06. The compound was extracted and purified by preparative high-performance liquid chromatography and analyzed by UV/visible, FTIR, and fluorescent spectrum. The antioxidant property of the purified pterin compound was determined by cyclic voltammetry. In addition, antimicrobial activity of pterin was also studied which was substantiated by antagonistic activity against Escherichia coli, and Pseudomonas aeruginosa. Besides that the pterin compound was proved to inhibit the formation of biofilm. The extracted pterin compounds could be proposed further not only for antioxidant and antimicrobial but also for its potency to aid as anticancer and psychotic drugs in future.

Lithium cyanide supported by O- and N-donors

Energy Technology Data Exchange (ETDEWEB)

Budanow, Alexandra; Franz, Klaus-Dieter; Vitze, Hannes; Fink, Lothar; Alig, Edith; Bolte, Michael; Wagner, Matthias; Lerner, Hans-Wolfram [Institut fuer Anorganische Chemie, Goethe-Universitaet Frankfurt, Max-von-Laue-Str. 7, 60438, Frankfurt (Germany)

2017-02-15

A series of adducts of LiCN, namely [Li(Me{sub 2}CO{sub 3})CN], [Li(Et{sub 2}CO{sub 3})CN], and [Li(NMP)CN] (NMP = N-methyl-2-pyrrolidone) were prepared by treatment of solvent-free LiCN with the appropriate donor. The starting material for these approaches, donor-free LiCN, was quantitatively prepared from Me{sub 3}SiCN and Li[Me] in diethyl ether at 0 C. Alternatively, [Li(NMP)CN] was synthesized by metathesis reaction of LiCl with NaCN in the presence of stoichiometric amounts of NMP. Although [Li(Me{sub 2}CO{sub 3})CN] and [Li(Et{sub 2}CO{sub 3})CN] are water-sensitive compounds and decompose at the exposure to air, [Li(NMP)CN] is stable in air, even at elevated temperatures. The thermal stability of [Li(NMP)CN] was proven by differential thermal analysis (DTA). [Li(NMP)CN] shows thermal stability up to temperatures of about 132 C. To evaluate the cyanation ability the reactions of 1-bromooctane and 3-bromocyclohexene with unsupported LiCN, [Li(NMP)CN], and a mixture of NaCN/LiCl/NMP were investigated. We found that [Li(NMP)CN] as well as LiCl/NaCN/NMP are efficient cyanation reagents comparable to the expensive and air-sensitive, donor-free LiCN. A product of the chloride-cyanide-bromide exchange could be isolated and structurally characterized by X-ray diffraction. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

The effect of reactor geometry on the synthesis of graphene materials in plasma jets

Science.gov (United States)

Shavelkina, M. B.; Amirov, R. H.; Shatalova, T. B.

2017-05-01

The possibility of synthesis of graphene and graphane (hydrogenated graphene) using the decomposition of hydrocarbons by thermal plasma has been investigated. Investigations of the influence of the plasma-forming gas on the efficiency of synthesis and the morphology of graphene materials were carried out. The synthesis products have been characterized by the methods of scanning microscopy, Raman spectroscopy and thermal analysis. It is found that the morphology of graphene materials is affected by the geometry of the reactor. It was demonstrated that the obtained graphene materials are uniformly distributed in the volume of plastic based on cyanate ester resins under mixing.

Catalytic effect of carbon nanotubes on polymerization of cyanate ester resins

Directory of Open Access Journals (Sweden)

2009-08-01

Full Text Available Kinetic peculiarities of polycyclotrimerization process of dicyanate ester of bisphenol A (DCBA in the presence of multi-walled carbon nanotubes (MWCNTs have been investigated using Fourier Transform Infrared Spectroscopy (FTIR spectroscopy technique. It has been found that even very small amounts of MWCNTs (0.01–0.1 wt% catalyze the reaction of polycyclotrimerization of DCBA leading to formation of polycyanurate network (PCN/MWCNTs nanocomposite. However, some decrease in final degree of conversion for nanocomposites compared to the neat PCN within the temperature/time schedule used was observed. The kinetic rate constants increased with addition of MWCNTs and energies of activation were found to be significantly decreased even at low contents of MWCNTs.

Mechanisms of Decreased Moisture Uptake in ortho- Methylated Di(Cyanate Esters)

Science.gov (United States)

2014-10-01

the lower dry TG of the ortho- methylated networks. The measured “knock down” depends on plasticization of the networks by any moisture remaining...The addition of catalyst results in a higher degree of conversion, but generally decreases the dry TG at full conversion due to plasticization of...of DBTDL, however, results in severe damage to the samples on exposure to hot water, with networks 3 and 4 undergoing disintegration during the 96

Environmentally Benign Repair of Composites Using High Temperature Cyanate Ester Nanocomposites

Science.gov (United States)

2010-10-01

from the laminate at a shallow angle with a high-speed grinder followed by filling the removed area with repair plies (as shown in Figure 1). While...these common “scarfed” repairs are often significantly lower than the virgin laminate because of the inherent destruction of the outer plies during the...was rheologically tuned to match the room temperature viscosity of BECy. Bismaleimide-carbon fiber (BMI-cf) prepreg used for manufacturing the PMC

Theoretical Investigation on Charge Transfer Properties of 1,3,5-Tripyrrolebenzene (TPB and its Derivatives with Electron-withdrawing Substituents

Directory of Open Access Journals (Sweden)

Yong Hu

2016-06-01

Full Text Available The electronic structures and charge transport properties of 1,3,5-tripyrrolebenzene (TPB and its substituted derivatives with –F and –CN groups have been investigated by DFT calculations in combination with the Marcus hopping model. The dimer geometry was optimized by density functional theory method with dispersion force correction being included (DFT-D. Consequently, the charge transfer integral was evaluated. The calculation results show that the introduction of electron-withdrawing substituents does not significantly change the bond lengths and molecular symmetry of TPB, but lower the coplanarity between the pyrrole and benzene rings, especially in the case of CN substitution. Meanwhile, the introduction of electron-withdrawing groups can decrease the energy of the frontier molecular orbital and enhance the air stability. Fluorination makes the λe increase obviously while cyanation dose not. Generally speaking, the λe values of the title compounds are larger than their λh. Except for compounds 6 and 9, all others keep the face to face packing or have a slight slip in dimers, but the center of mass distances increase after fluorination or cyanation due to the distortion of the monomer’s coplanarity. The predicted quasi-one-dimensional electron mobility of the dimers is up to 0.433 cm2 V-1 s-1 at 298.15 K. The electron injection barriers of 2 and 7 are lower than that of TPB. The TPB derivatives of 1, 2, and 7 are potential n-channel materials with the high electron mobility. This work is licensed under a Creative Commons Attribution 4.0 International License.

Alternative High Performance Polymers for Ablative Thermal Protection Systems

Science.gov (United States)

Boghozian, Tane; Stackpoole, Mairead; Gonzales, Greg

2015-01-01

Ablative thermal protection systems are commonly used as protection from the intense heat during re-entry of a space vehicle and have been used successfully on many missions including Stardust and Mars Science Laboratory both of which used PICA - a phenolic based ablator. Historically, phenolic resin has served as the ablative polymer for many TPS systems. However, it has limitations in both processing and properties such as char yield, glass transition temperature and char stability. Therefore alternative high performance polymers are being considered including cyanate ester resin, polyimide, and polybenzoxazine. Thermal and mechanical properties of these resin systems were characterized and compared with phenolic resin.

1-(3-Cyano­phen­yl)-3-(2-furo­yl)thio­urea

Science.gov (United States)

Theodoro, Jahyr E.; Mascarenhas, Yvonne; Ellena, Javier; Estévez-Hernández, Osvaldo; Duque, Julio

2008-01-01

The title compound, C13H9N3O2S, was synthesized from furoyl isothio­cyanate and 3-amino­benzonitrile in dry acetone. The thio­urea group is in the thio­amide form. The thio­urea fragment makes dihedral angles of 3.91 (16) and 37.83 (12)° with the ketofuran group and the benzene ring, respectively. The mol­ecular geometry is stabilized by N—H⋯O hydrogen bonds. In the crystal structure, centrosymmetrically related mol­ecules are linked by two inter­molecular N—H⋯S hydrogen bonds to form dimers. PMID:21202835

Indirect electrocatalytic degradation of cyanide at nitrogen-doped carbon nanotube electrodes.

Science.gov (United States)

Wiggins-Camacho, Jaclyn D; Stevenson, Keith J

2011-04-15

Nitrogen-doped carbon nanotube (N-CNT) mat electrodes exhibit high catalytic activity toward O(2) reduction, which can be exploited for the remediation of free cyanide (CN(-)). During the electrochemical O(2) reduction process, the hydroperoxide anion (HO(2)(-)) is formed and then reacts to chemically oxidize cyanide (CN(-)) to form cyanate (OCN(-)). The proposed electrochemical-chemical (EC) mechanism for CN(-) remediation at N-CNTs is supported by cyclic voltammetry and bulk electrolysis, and the formation of OCN(-) is confirmed via spectroscopic methods and electrochemical simulations. Our results indicate that by exploiting their catalytic behavior for O(2) reduction, N-CNTs can efficiently convert toxic CN(-) to the nontoxic OCN(-).

Final Report for Radiation Resistant Magnets II

International Nuclear Information System (INIS)

A. F. Zeller

2005-01-01

Report on techniques for the fabrication of radiation resistant magnets for the RIA Fragment Separator. The development of magnet designs capable of reasonable life times in high-radiation environments and having reasonable performance is of paramount importance for RIA as well as other high-intensity projects under consideration, such as the Neutrino Factory and FAIR project at GSI. Several approaches were evaluated for radiation resistant superconducting magnets. One approach was to simply use a more radiation resistant epoxy for the coil fabrication. Another approach for cryostable magnets, like the S800 Spectrograph dipole, is the use of all-inorganic materials. The final approach was the development of radiation resistant Cable-In-Conduit-Conductor (CICC) like that used in fusion magnets; though these are not radiation resistant because an organic insulator is used. Simulations have shown that the nuclear radiation heating of the first quadrupoles in the RIA Fragment Separator will be so large that cold mass minimization will be necessary with the magnet iron being at room temperature. Three different types of conductor for radiation resistant superconducting magnets have been built and successfully tested. The cyanate ester potted coils will work nicely for magnets where the lifetime dose is a factor of 20 less than the end of life of the superconductor and the rate of energy deposition is below the heat-removal limit of the coil. The all-inorganic cryostable coil and the metal oxide insulated CICC will provide conductor that will work up to the life of the superconductor and have the ability to remove large quantities of nuclear heating. Obviously, more work needs to be done on the CICC to increase the current density and to develop different insulations; and on the cyanate esters to increase the heat transfer

Polytetramethylene glycol-modified polycyanurate matrices reinforced with nanoclays: synthesis and thermomechanical performance

Science.gov (United States)

Anthoulis, G. I.; Kontou, E.; Fainleib, A.; Bei, I.

2009-03-01

The outstanding improvement in the physical properties of cyanate esters (CEs) compared with those of competitor resins, such as epoxies, has attracted appreciable attention recently. Cyanate esters undergo thermal polycyclotrimerization to give polycyanurates (PCNs). However, like most thermo setting resins, the main draw back of CEs is brittleness. To over come this disadvan tage, CEs can be toughened by the introduction of polytetramethylene glycol (PTMG), a hydroxyl-terminated polyether. How ever, PTMG has a detrimental impact on Young's modulus. To simultaneously enhance both the ductility and the stiffness of CE, we added PTMG and an organoclay (mont morillonite, MMT) to it. A series of PCN/PTMG/MMT nanocomposites with a constant PTMG weight ratio was pre pared, and the resulting nanophase morphology, i.e., the degree of filler dispersion and distribution in the composite and the thermomechanical properties, in terms of glass-transition behaviour, Young's modulus, tensile strength, and elongation at break, were examined using the scanning elec tron micros copy (SEM), a dynamic mechanical analysis (DMA), and stress-strain measurements, re spectively. It was found that, at a content of MMT below 2 wt.%, MMT nanoparticles were distributed uniformly in the matrix, suggesting a lower degree of agglomeration for these materials. In the glassy state, the significant increase in the storage modulus revealed a great stiffening effect of MMT due to its high Young's modulus. The modification with PTMG led to a 233% greater elongation at break compared with that of neat PCN. The nanocomposites exhibited an invariably higher Young's modulus than PCN/PTMG for all the volume factors of organoclay examined, with the 2 wt.% material displaying the most pronounced in crease in the modulus, in agreement with micros copy results.

Carbamylation of N-terminal proline.

Science.gov (United States)

Olajuyigbe, Folasade M; Demitri, Nicola; Ajele, Joshua O; Maurizio, Elisa; Randaccio, Lucio; Geremia, Silvano

2010-09-09

Protein carbamylation is of great concern both in vivo and in vitro. Here, we report the first structural characterization of a protein carbamylated at the N-terminal proline. The unexpected carbamylation of the α-amino group of the least reactive codified amino acid has been detected in high-resolution electron density maps of a new crystal form of the HIV-1 protease/saquinavir complex. The carbamyl group is found coplanar to the proline ring with a trans conformation. The reaction of N-terminal with cyanate ion derived from the chaotropic agent urea was confirmed by mass spectra analysis on protease single crystals. Implications of carbamylation process in vitro and in vivo are discussed.

Thermal-mechanical behavior of high precision composite mirrors

Science.gov (United States)

Kuo, C. P.; Lou, M. C.; Rapp, D.

1993-01-01

Composite mirror panels were designed, constructed, analyzed, and tested in the framework of a NASA precision segmented reflector task. The deformations of the reflector surface during the exposure to space enviroments were predicted using a finite element model. The composite mirror panels have graphite-epoxy or graphite-cyanate facesheets, separated by an aluminum or a composite honeycomb core. It is pointed out that in order to carry out detailed modeling of composite mirrors with high accuracy, it is necessary to have temperature dependent properties of the materials involved and the type and magnitude of manufacturing errors and material nonuniformities. The structural modeling and analysis efforts addressed the impact of key design and materials parameters on the performance of mirrors.

Synthesis of isotopically labelled angiotensin II receptor antagonist GR138950X

International Nuclear Information System (INIS)

Carr, R.M.; Cable, K.M.; Newman, J.J.; Sutherland, D.R.

1996-01-01

Syntheses of [ 13 C] and [ 14 C]-labelled versions of angiotensin II receptor antagonist GR138950X, labelled in the imidazole carboxamide residue, are described. These involved preparation of an iodoimidazole substrate by a novel iododecarboxylation procedure, followed by cyanation with a mixture of carbon-labelled potassium cyanide and copper (l) iodide in DMF at high temperature. The preparation of a mass-labelled (M+5) version of GR138950X is also described. This involved the synthesis of an [ 13 C 3 , 15 N 2 ]-labelled imidazole from a 1,2,3-tricarbonyl compound, [ 13 C 3 ]propionaldehyde and [ 15 N]ammonia. The labelled imidazole was further elaborated into multiply-labelled GR138950X. (Author)

Continuous-flow oxidative cyanation of primary and secondary amines using singlet oxygen.

Science.gov (United States)

Ushakov, Dmitry B; Gilmore, Kerry; Kopetzki, Daniel; McQuade, D Tyler; Seeberger, Peter H

2014-01-07

Primary and secondary amines can be rapidly and quantitatively oxidized to the corresponding imines by singlet oxygen. This reactive form of oxygen was produced using a variable-temperature continuous-flow LED-photoreactor with a catalytic amount of tetraphenylporphyrin as the sensitizer. α-Aminonitriles were obtained in good to excellent yields when trimethylsilyl cyanide served as an in situ imine trap. At 25°C, primary amines were found to undergo oxidative coupling prior to cyanide addition and yielded secondary α-aminonitriles. Primary α-aminonitriles were synthesized from the corresponding primary amines for the first time, by an oxidative Strecker reaction at -50 °C. This atom-economic and protecting-group-free pathway provides a route to racemic amino acids, which was exemplified by the synthesis of tert-leucine hydrochloride from neopentylamine. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Delayed-action battery with an improved depolarizer. Einen verbesserten Depolarisator enthaltende Batterie mit verzoegerter Wirkung

Energy Technology Data Exchange (ETDEWEB)

Koontz, R.F.; Klein, L.E.

1978-11-27

The invention refers to a delayed action battery, which has an anode made of magnesium, aluminium or zinc, and whose cathode consists of a conducting metal grid, and is coated with a depolarising material. The depolarising material consists of caprothio cyanate, carbon sulphur and a binder such as PTFE (polytetrafluoroethylene). This mixture is heated to a certain temperature, in order to melt the sulphur contained in it, before it is applied to the metal grid, in order to melt the sulphur contained in it, before it is applied to the metal grid, in order to form the cathode depolariser. The metal grid is also used as current terminal. The delayed action battery is activated by normal seawater or any other suitable aquaeous solution.

Influence of Reinforcement Anisotropy on the Stress Distribution in Tension and Shear of a Fusion Magnet Insulation System

Science.gov (United States)

Humer, K.; Raff, S.; Prokopec, R.; Weber, H. W.

2008-03-01

A glass fiber reinforced plastic laminate, which consists of half-overlapped wrapped Kapton/R-glass-fiber reinforcing tapes vacuum-pressure impregnated in a cyanate ester/epoxy blend, is proposed as the insulation system for the ITER Toroidal Field coils. In order to assess its mechanical performance under the actual operating conditions, cryogenic (77 K) tensile and interlaminar shear tests were done after irradiation to the ITER design fluence of 1×1022 m-2 (E>0.1 MeV). The data were then used for a Finite Element Method (FEM) stress analysis. We find that the mechanical strength and the fracture behavior as well as the stress distribution and the failure criteria are strongly influenced by the winding direction and the wrapping technique of the reinforcing tapes.

Thermal-mechanical behavior of high precision composite mirrors

Energy Technology Data Exchange (ETDEWEB)

Kuo, C.P.; Lou, M.C.; Rapp, D.

1993-01-01

Composite mirror panels were designed, constructed, analyzed, and tested in the framework of a NASA precision segmented reflector task. The deformations of the reflector surface during the exposure to space enviroments were predicted using a finite element model. The composite mirror panels have graphite-epoxy or graphite-cyanate facesheets, separated by an aluminum or a composite honeycomb core. It is pointed out that in order to carry out detailed modeling of composite mirrors with high accuracy, it is necessary to have temperature dependent properties of the materials involved and the type and magnitude of manufacturing errors and material nonuniformities. The structural modeling and analysis efforts addressed the impact of key design and materials parameters on the performance of mirrors. 4 refs.

Eco-efficient one-pot synthesis of quinazoline-2,4(1H,3H)-diones at room temperature in water.

Science.gov (United States)

Tian, Xin-Chuan; Huang, Xing; Wang, Dan; Gao, Feng

2014-01-01

An efficient one-pot synthesis of quinazoline-2,4(1H,3H)-diones was developed. First, the reactions of anthranilic acid derivatives with potassium cyanate afforded the corresponding urea derivatives. Then, cyclization of the urea derivatives with NaOH afforded the monosodium salts of benzoylene urea. Finally, HCl treatment afforded the desired products in near-quantitative yields. This is an eco-efficient method because all the reactions were carried out in water, and the desired products were obtained simply by filtration. The aqueous filtrate was the only waste generated from the reaction. We scaled up the reaction to 1 kg starting material, thus establishing an alternative approach for the green synthesis of quinazoline-2,4(1H,3H)-diones in the chemical and pharmaceutical industries.

Next-generation avionics packaging and cooling 'test results from a prototype system'

Science.gov (United States)

Seals, J. D.

The author reports on the design, material characteristics, and test results obtained under the US Air Force's advanced aircraft avionics packaging technologies (AAAPT) program, whose charter is to investigate new designs and technologies for reliable packaging, interconnection, and thermal management. Under this program, AT&T Bell Laboratories has completed the preliminary testing of and is evaluating a number of promising materials and technologies, including conformal encapsulation, liquid flow-through cooling, and a cyanate ester backplane. A fifty-two module system incorporating these and and other technologies has undergone preliminary cooling efficiency, shock, sine and random vibration, and maintenance testing. One of the primary objectives was to evaluate the interaction compatibility of new materials and designs with other components in the system.

Cyanated diazatetracene diimides with ultrahigh electron affinity for n-channel field effect transistors

KAUST Repository

Ye, Qun

2013-03-15

Several diazatetracene diimides with high electron affinity (up to 4.66 eV!) were prepared and well characterized. The LUMO energy level of these electron-deficient molecules was found to be closely related to their material stability. Compound 7 with ultrahigh electron affinity suffered from reduction and hydrolysis in the presence of silica gel or water. The stable compounds 3 and 6 showed n-channel FET behavior with an average electron mobility of 0.002 and 0.005 cm2 V-1 s-1, respectively, using a solution processing method. © 2013 American Chemical Society.

The influence of a residual group in low-molecular-weight allergoids of Artemisia vulgaris pollen on their allergenicity, IgE- and IgG-binding properties.

Science.gov (United States)

Cirković, T; Gavrović-Jankulović, M; Prisić, S; Jankov, R M; Burazer, L; Vucković, O; Sporcić, Z; Paranos, S

2002-11-01

Reaction of epsilon-amino groups of lysine with potassium cyanate, maleic, or succinic anhydride leads to allergoids of low molecular weight. No study has been performed to compare their properties and investigate the influence of a residual group on allergenicity and human IgE- and IgG-binding of these derivatives. Allergoids of a pollen extract of Artemisia vulgaris were obtained by means of potassium cyanate, and succinic and maleic anhydride. Biochemical properties were investigated by determination of amino groups, enzyme activity, isoelectric focusing IEF and SDS-PAGE. IgE- and IgG-binding was determined using immunoblots and ELISA inhibition. Allergenicity was investigated by skin prick tests (SPT) on a group of 52 patients, of which 6 were control subjects, 30 were patients with no previous immunotherapy (IT), and 16 were patients undergoing immunotherapy. The same degree of amino-group modification (more than 85%), residual enzyme activity (less then 15%), IEF, and SDS-PAGE pattern were noted. In the immunoblots of IgE-binding, there was more pronounced reduction in the succinyl and maleyl derivatives than in the carbamyl one. IgG-binding was less affected by carbamylation than by acid anhydride modification. The SPT showed that the succinylated derivative had the most reduced allergenicity (98% showed a reduced wheal diameter when tested with the succinyl derivative, 87% with the maleyl allergoid, and 83% with the carbamyl allergoid). The most significant difference among allergoids could be seen in the group of patients with high skin reactivity (83% of patients showed no reaction to the succinyl derivative when compared to the value of 28% for the carbamyl derivative or 22% for the maleyl derivative). According to our results, all three modification procedures yielded allergoids with a similar extent of modification. No single biochemical parameter investigated in the study could predict the degree of reduced allergenicity in vivo. The most reduced

Verification Test for Ultra-Light Deployment Mechanism for Sectioned Deployable Antenna Reflectors

Science.gov (United States)

Zajac, Kai; Schmidt, Tilo; Schiller, Marko; Seifart, Klaus; Schmalbach, Matthias; Scolamiero, Lucio

2013-09-01

The ultra-light deployment mechanism (UDM) is based on three carbon fibre reinforced plastics (CFRP) curved tape springs made of carbon fibre / cyanate ester prepregs.In the frame of the activity its space application suitability for the deployment of solid reflector antenna sections was investigated. A projected diameter of the full reflector of 4 m to 7 m and specific mass in the order of magnitude of 2.6kg/m2 was focused for requirement derivation.Extensive verification tests including health checks, environmental and functional tests were carried out with an engineering model to enable representative characterizing of the UDM unit.This paper presents the design and a technical description of the UDM as well as a summary of achieved development status with respect to test results and possible design improvements.

Organic Crystal Engineering of Thermosetting Cyanate Ester Monomers: Influence of Structure on Melting Point

Science.gov (United States)

2016-05-27

NUMBER 5f. WORK UNIT NUMBER Q16J 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT NO. Air Force Research...SPONSOR/MONITOR’S ACRONYM(S) Air Force Research Laboratory (AFMC) AFRL/RQR 11. SPONSOR/MONITOR’S REPORT 5 Pollux Drive NUMBER(S) Edwards AFB...in purification , as well as decreased storability and “out time” due to the comparative ease with which moisture infiltrates liquids, leading to

3D Multifunctional Ablative Thermal Protection System

Science.gov (United States)

Feldman, Jay; Venkatapathy, Ethiraj; Wilkinson, Curt; Mercer, Ken

2015-01-01

NASA is developing the Orion spacecraft to carry astronauts farther into the solar system than ever before, with human exploration of Mars as its ultimate goal. One of the technologies required to enable this advanced, Apollo-shaped capsule is a 3-dimensional quartz fiber composite for the vehicle's compression pad. During its mission, the compression pad serves first as a structural component and later as an ablative heat shield, partially consumed on Earth re-entry. This presentation will summarize the development of a new 3D quartz cyanate ester composite material, 3-Dimensional Multifunctional Ablative Thermal Protection System (3D-MAT), designed to meet the mission requirements for the Orion compression pad. Manufacturing development, aerothermal (arc-jet) testing, structural performance, and the overall status of material development for the 2018 EM-1 flight test will be discussed.

Plastic use in technology of scintillation detector fabrication

International Nuclear Information System (INIS)

Mlika, V.

1977-01-01

The technique of plastic mandrel fabrication for scintillation detectors is developed. ''Forsan 548'' (thermopolimer of ABS type) and ''Krasten 127'' (polystyrene) are used. The mandrel is fabricated by the casting method under pressure with a subsequent parts adhesion. An adhesive substance is applied on the basis of polymerizing monomer of acrylate rotors and organic polysis cyanates. The developed construction consists totally of 5 components, only one of them being machined (lightquide). Testing under trying conditions (during 300 hours at the temperature from -30 deg to +50 deg C under the silicon oil layer or at the humidity up to 95% have shown high reliability of the construction. It is supposed, that the suggested technology will economize 3, 4 hours of turning lathe work for one mandrel and will reduce for 1-3 hours the scintillation mandrel frlming process

Gold leaching by organic base polythionates: new non-toxic and secure technology.

Science.gov (United States)

Smolyaninov, Vladislav; Shekhvatova, Galina; Vainshtein, Mikhail

2014-01-01

The article present a review on own experimental and some published data which are related with the gold leaching. It is well-known that the most common and usual process of the leaching with cyanide can be dangerous, needs a great water consumption, and additional costs for remediation of the poisoned and toxic sites. The experimental data described production of poythionates which are not toxic but perspective for the prosperous gold leaching. The paper dedicated to the safe gold leaching with thiosulfates and organic salts of polythionic acids (organic base polythionates). The method of production of these polythionates based on the Smolyaninov reaction is described in stages and in details for the first time. Possible application of the polythionates application in the gold leaching is discussed and its advantages are compared with the gold leaching by cyanation.

Preparation and characterization of antimicrobial Ce-doped ZnO nanoparticles for photocatalytic detoxification of cyanide

International Nuclear Information System (INIS)

Karunakaran, Chockalingam; Gomathisankar, Paramasivan; Manikandan, Govindasamy

2010-01-01

2% Ce-doped ZnO, prepared by sonochemical wet impregnation method and calcined at 500 deg. C, was characterized by XRD, EDS, XPS, SEM, FT-IR, UV-visible DRS, PL, EIS, and N 2 -adsorption and desorption isotherms. Doping reduces the intragranular resistance and recombination of the photogenerated electron-hole pairs. It also shifts the optical absorption edge to visible region. Under UV-A light or natural sunlight (950 ± 25 W m -2 ), the doped oxide effectively catalyzes the oxidation of cyanide and subsequently the cyanate also. The catalysis follows Langmuir-Hinshelwood kinetics. The solar photocatalysis depends on the area of catalyst bed and the UV photocatalysis enhances with the photon flux. The doped oxide is also an antibacterial agent and its bactericidal efficiency, tested with Escherichia coli in absence of any illumination, is larger than those of undoped oxides.

Novel matrix resins for composites for aircraft primary structures, phase 1

Science.gov (United States)

Woo, Edmund P.; Puckett, P. M.; Maynard, S.; Bishop, M. T.; Bruza, K. J.; Godschalx, J. P.; Mullins, M. J.

1992-01-01

The objective of the contract is the development of matrix resins with improved processability and properties for composites for primarily aircraft structures. To this end, several resins/systems were identified for subsonic and supersonic applications. For subsonic aircraft, a series of epoxy resins suitable for RTM and powder prepreg was shown to give composites with about 40 ksi compressive strength after impact (CAI) and 200 F/wet mechanical performance. For supersonic applications, a thermoplastic toughened cyanate prepreg system has demonstrated excellent resistance to heat aging at 360 F for 4000 hours, 40 ksi CAI and useful mechanical properties at greater than or equal to 310 F. An AB-BCB-maleimide resin was identified as a leading candidate for the HSCT. Composite panels fabricated by RTM show CAI of approximately 50 ksi, 350 F/wet performance and excellent retention of mechanical properties after aging at 400 F for 4000 hours.

Design of optical instruments; Proceedings of the Meeting, Orlando, FL, Apr. 22-24, 1992

Science.gov (United States)

Aikens, David M.; Genberg, Victor L.; Krumweide, Gary C.; Thomas, Michael J.

1992-09-01

Topics discussed in this volume include optical system design, recent application of composite materials to precision optical instrument structure, development of composite mirrors and reflectos, development of composite materials for dimensionally stable structures, and structural mechanics. Papers are presented on adjustable distortion correctors, the optical design for the ATLAS multispectral scanner, an internal thermal emission analysis of an IR seeker, recent developments with the Mars Observer Camera graphite/epoxy structure, and moisture effects and control for the Ultraviolet Coronagraph Spectrograph composite structure. Attention is also given to composite materials for precision space reflector panels, the structural design and analysis for an ultralow-CTE optical bench for the Hubbale Space Telescope corrective optics, the evaluation of high-modulus pitch/cyanate material systems for dimensionally stable structures, weight minimization of an active mirror, and a compliant optical mount design. (For individual items see A93-29782 to A93-29798)

Recent progress and tests of radiation resistant impregnation materials for Nb3Sn coils

International Nuclear Information System (INIS)

Bossert, R.; Krave, S.; Ambrosio, G.; Andreev, N.; Chlachidze, G.; Nobrega, A.; Novitski, I.; Yu, M.; Zlobin, A. V.

2014-01-01

Fermilab is collaborating with Lawrence Berkeley National Laboratory (LBNL) and Brookhaven National Laboratory (BNL) (US-LARP collaboration) to develop a large-aperture Nb 3 Sn superconducting quadrupole for the Large Hadron Collider (LHC) luminosity upgrade. An important component of this work is the development of materials that are sufficiently radiation resistant for use in critical areas of the upgrade. This paper describes recent progress in characterization of materials, including the baseline CTD101K epoxy, cyanate ester blends, and Matrimid 5292, a bismaleimide-based system. Structural properties of “ten stacks” of cable impregnated with these materials are tested at room and cryogenic temperatures and compared to the baseline CT-101K. Experience with potting 1 and 2 meter long coils with Matrimid 5292 are described. Test results of a single 1-m coil impregnated with Matrimid 5292 are reported and compared to similar coils impregnated with the traditional epoxy

Recent progress and tests of radiation resistant impregnation materials for Nb3Sn coils

Science.gov (United States)

Bossert, R.; Krave, S.; Ambrosio, G.; Andreev, N.; Chlachidze, G.; Nobrega, A.; Novitski, I.; Yu, M.; Zlobin, A. V.

2014-01-01

Fermilab is collaborating with Lawrence Berkeley National Laboratory (LBNL) and Brookhaven National Laboratory (BNL) (US-LARP collaboration) to develop a large-aperture Nb3Sn superconducting quadrupole for the Large Hadron Collider (LHC) luminosity upgrade. An important component of this work is the development of materials that are sufficiently radiation resistant for use in critical areas of the upgrade. This paper describes recent progress in characterization of materials, including the baseline CTD101K epoxy, cyanate ester blends, and Matrimid 5292, a bismaleimide-based system. Structural properties of "ten stacks" of cable impregnated with these materials are tested at room and cryogenic temperatures and compared to the baseline CT-101K. Experience with potting 1 and 2 meter long coils with Matrimid 5292 are described. Test results of a single 1-m coil impregnated with Matrimid 5292 are reported and compared to similar coils impregnated with the traditional epoxy.

Pyridinium bis­(pyridine-κN)tetra­kis­(thio­cyanato-κN)ferrate(III)–pyrazine-2-carbo­nitrile–pyridine (1/4/1)

Science.gov (United States)

Shylin, Sergii I.; Gural’skiy, Il’ya A.; Haukka, Matti; Golenya, Irina A.

2013-01-01

In the title compound, (C5H6N)[Fe(NCS)4(C5H5N)2]·4C5H3N3·C5H5N, the FeIII ion is located on an inversion centre and is six-coordinated by four N atoms of the thio­cyanate ligands and two pyridine N atoms in a trans arrangement, forming a slightly distorted octa­hedral geometry. A half-occupied H atom attached to a pyridinium cation forms an N—H⋯N hydrogen bond with a centrosymmetrically-related pyridine unit. Four pyrazine-2-carbo­nitrile mol­ecules crystallize per complex anion. In the crystal, π–π stacking inter­actions are present [centroid–centroid distances = 3.6220 (9), 3.6930 (9), 3.5532 (9), 3.5803 (9) and 3.5458 (8) Å]. PMID:23723782

Glass Transition Temperature Measurement for Undercured Cyanate Ester Networks: Challenges, Tips, and Tricks (Briefing Charts)

Science.gov (United States)

2014-01-29

DISTRIBUTION A: Approved for public release; distribution is unlimited. Thermosetting Polymers Have a TG Envelope – Not Just a TG 4 • The glass transition...glass transition temperature of a thermosetting polymer can vary over a wide range of temperatures depending on how the polymer is processed • A... thermosetting polymer with only one kind of network formation and negligible side reactions, the conversion may be determined at every point in the scan. • By

Nano-Particle Enhanced Polymer Materials for Space Flight Applications

Science.gov (United States)

Criss, Jim M., Jr.; Powell, William D.; Connell, John W.; Stallworth-Bordain, Yemaya; Brown, Tracy R.; Mintz, Eric A.; Schlea, Michelle R.; Shofne, Meisha L.

2009-01-01

Recent advances in materials technology both in polymer chemistry and nano-materials warrant development of enhanced structures for space flight applications. This work aims to develop spacecraft structures based on polymer matrix composites (PMCs) that utilize these advancements.. Multi-wall carbon nano-tubes (MWCNTs) are expected ·to increase mechanical performance, lower coefficient of thermal expansion (CTE), increase electrical conductivity (mitigate electrostatic charge), increase thermal conductivity, and reduce moisture absorption of the resultant space structures. In this work, blends of MWCNTs with PETI-330 were prepared and characterized. The nano-reinforced resins were then resin transfer molded (RTM) into composite panels using M55J carbon fabric and compared to baseline panels fabricated from a cyanate ester (RS-3) or a polyimide (PETI-330) resin containing no MWCNTs. In addition, methods of pre-loading the fabric with the MWCNTs were also investigated. The effects of the MWCNTs on the resin processing properties and on the composite end-use properties were also determined.

Secretome analysis of the thermophilic xylanase hyper-producer Thermomyces lanuginosus SSBP cultivated on corn cobs.

Science.gov (United States)

Winger, A M; Heazlewood, J L; Chan, L J G; Petzold, C J; Permaul, K; Singh, S

2014-11-01

Thermomyces lanuginosus is a thermophilic fungus known for its ability to produce industrially important enzymes including large amounts of xylanase, the key enzyme in hemicellulose hydrolysis. The secretome of T. lanuginosus SSBP was profiled by shotgun proteomics to elucidate important enzymes involved in hemicellulose saccharification and to characterise the presence of other industrially interesting enzymes. This study reproducibly identified a total of 74 proteins in the supernatant following growth on corn cobs. An analysis of proteins revealed nine glycoside hydrolase (GH) enzymes including xylanase GH11, β-xylosidase GH43, β-glucosidase GH3, α-galactosidase GH36 and trehalose hydrolase GH65. Two commercially produced Thermomyces enzymes, lipase and amylase, were also identified. In addition, other industrially relevant enzymes not currently explored in Thermomyces were identified including glutaminase, fructose-bisphosphate aldolase and cyanate hydratase. Overall, these data provide insight into the novel ability of a cellulase-free fungus to utilise lignocellulosic material, ultimately producing a number of enzymes important to various industrial processes.

Predicting Cyanide Consumption in Gold Leaching: A Kinetic and Thermodynamic Modeling Approach

Directory of Open Access Journals (Sweden)

Yaser Kianinia

2018-03-01

Full Text Available The consumption of cyanide during processing operations is a major economic cost in the extraction of gold from its ores, while the discharge of cyanide wastes may result in significant environmental pollution. Many factors influence the levels of consumption and discharge of cyanide, including ore mineralogy and lixiviant solution chemistry. This paper proposes a robust methodology to estimate leaching cyanide consumption due to oxidation and reactions with gold, chalcopyrite and pyrite minerals forming various cyanide complexes, cyanate, thiocyanate and hydroxide precipitates of copper and iron. The method involves concurrent modelling of both the oxidation and leaching kinetics of minerals and the chemical speciation of the lixiviant solutions. The model was calibrated by conducting cyanide leaching experiments on pyrite, chalcopyrite, pyrite + chalcopyrite, pyrite + chalcopyrite + gold and pyrite + chalcopyrite + gold + quartz systems and determining the total Cu, Fe, Au and CN− concentrations in solution. We show that this model can successfully estimate the formation of cyanide complexes and, hence, the consumption of cyanide.

Role of Carbamylated Biomolecules in Human Diseases.

Science.gov (United States)

Badar, Asim; Arif, Zarina; Alam, Khursheed

2018-04-01

Carbamylation (or carbamoylation) is a non-enzymatic modification of biomolecules mediated by cyanate, a dissociation product of urea. Proteins are more sensitive to carbamylation. Two major sites of carbamylation reaction are: N α -amino moiety of a protein N-terminus and the N ɛ -amino moiety of proteins' lysine residues. In kidney diseases, urea accumulates and the burden of carbamylation increases. This may lead to alteration in the structure and function of many important proteins relevant in maintenance of homeostasis. Carbamylated proteins namely, carbamylated-haemoglobin and carbamylated-low density lipoprotein (LDL) have been implicated in hypoxia and atherosclerosis, respectively. Furthermore, carbamylation of insulin, oxytocin, and erythropoietin have caused changes in the action of these hormones vis-à-vis the metabolic pathways they control. In this short review, authors have compiled the data on role of carbamylated proteins, enzymes, hormones, LDL, and so on, in human diseases. © 2018 IUBMB Life, 70(4):267-275, 2018. © 2018 International Union of Biochemistry and Molecular Biology.

Electron-Poor Thiophene 1,1-Dioxides: Synthesis, Characterization, and Application as Electron Relays in Photocatalytic Hydrogen Generation.

Science.gov (United States)

Tsai, Chia-Hua; Chirdon, Danielle N; Kagalwala, Husain N; Maurer, Andrew B; Kaur, Aman; Pintauer, Tomislav; Bernhard, Stefan; Noonan, Kevin J T

2015-08-03

The synthesis and characterization of electron-poor thiophene 1,1-dioxides bearing cyanated phenyl groups are reported. The electron-accepting nature of these compounds was evaluated by cyclic voltammetry, and highly reversible and facile reductions were observed for several derivatives. Moreover, some of the reduced thiophene dioxides form colorful anions, which were investigated spectroelectrochemically. Photoluminescence spectra of the electron-deficient sulfones were measured in CH2 Cl2, and they emit in the blue-green region with significant variation in the quantum yield depending on the aryl substituents. By expanding the degree of substitution on the phenyl rings, quantum yields up to 34 % were obtained. X-ray diffraction data are reported for two of the thiophene 1,1-dioxides, and the electronic structure was probed for all synthesized derivatives through DFT calculations. The dioxides were also examined as electron relays in a photocatalytic water reduction reaction, and they showed potential to boost the efficiency. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Preparation of Organic-Inorganic Hybrid Materials Based on MCM-41 and Its Applications

Directory of Open Access Journals (Sweden)

Sana M. Alahmadi

2013-01-01

Full Text Available This work reports the covalent attachment of three different calix[4]arenes (calix[4]arene (C4, p-sulfonatocalix[4]arene (C4S, and p-tert-butyl-calix[4]arene (PC4 to MCM-41, using a three-step modification process. 3-Chloropropyltrimethoxysilane (ClPTS was first attached to the mesoporous silica surface and subsequently converted to amides via the reaction with toluene diisocyanate (TDI. Finally, calix[4]arene derivatives attached to the isocyanate ending remained available on toluene di-iso-cyanate. Changes in the surface properties of the mesoporous silica caused by the chemical modification were monitored using the Fourier transform infrared spectroscopy (FTIR, thermal analysis (TGA, and elemental analysis. The FTIR spectra and TGA analysis verify that the calix[4]arene derivatives are covalently attached to the mesoporous silica. The preservation of the MCM-41 channel system was checked by the X-ray diffraction and nitrogen adsorption analysis. These materials were then used to evaluate the sorption properties of some organotins compounds (Tributyltin (TBT, Triphenyltin (TPT, and Dibutyltin (DBT.

Simulating Large Area, High Intensity AM0 Illumination – Test Results from Bepicolombo and Solar Orbiter Qualification

Directory of Open Access Journals (Sweden)

Oberhüttinger C.

2017-01-01

Specifically, the following topics will be treated. Different methods like electrical performance, thermo-optical and external quantum efficiency measurements have been used to characterize the behaviour of the solar cells after illumination under these conditions. A special focus has been put on the electrical performance. A comparison to other solar cell qualification tests under solely UV radiation has been undertaken. The results have also been compared to a theoretical model. However, the paper will not cover only characterization results but will also give some insight in challenges experienced during the test execution itself. Deviating from other solar cell qualification tests, a representatively equipped photovoltaic assembly on carbon fibre reinforced cyanate has also been included. On these coupon segments, solar cell assemblies connected to shunt diodes and placed next to optical surface reflectors have been exposed to AM0 illumination to qualify the solar cells including their surroundings which therefore covers also contamination effects. Last but not least, first results from the Solar Orbiter qualification are presented. This test with additional 1000 hours and increased intensity has been completed recently.

Estimation of the lifetime of resin insulators against baking temperature for JT-60SA in-vessel coils

Energy Technology Data Exchange (ETDEWEB)

Sukegawa, Atsuhiko M., E-mail: morioka.atsuhiko@jaea.go.jp; Murakami, Haruyuki; Matsunaga, Go; Sakurai, Shinji; Takechi, Manabu; Yoshida, Kiyoshi; Ikeda, Yoshitaka

2015-10-15

Highlights: • The lifetime of resin insulators at about 200 °C was estimated. • We make use of the Arrhenius plot by the Weibull analysis for the estimation. • A suitable temperatures for the in-vessel coils were discussed. - Abstract: In the present study, the thermal endurance of epoxy-based, bismaleimides, and cyanate ester resins for the current design of the in-vessel coils was measured by performing acceleration tests to assess their insulation properties using the thermal endurance defined by the International Electrotechnical Commission (IEC-60216 Part1–Part 6) for a minimum of 5,000 h in the 180–240 °C temperature range. It was found that none of the resin insulators could tolerate the baking conditions of 40,000 h at ∼200 °C in the JT-60SA vacuum vessel. Therefore, the design of the in-vessel coils, including the error field correction coils (EFCC), was changed from the type without water cooling to with water cooling on JT-60SA.

Cyanide and the human brain: perspectives from a model of food (cassava) poisoning.

Science.gov (United States)

Tshala-Katumbay, Desire D; Ngombe, Nadege N; Okitundu, Daniel; David, Larry; Westaway, Shawn K; Boivin, Michael J; Mumba, Ngoyi D; Banea, Jean-Pierre

2016-08-01

Threats by fundamentalist leaders to use chemical weapons have resulted in renewed interest in cyanide toxicity. Relevant insights may be gained from studies on cyanide mass intoxication in populations relying on cyanogenic cassava as the main source of food. In these populations, sublethal concentrations (up to 80 μmol/l) of cyanide in the blood are commonplace and lead to signs of acute toxicity. Long-term toxicity signs include a distinct and irreversible spastic paralysis, known as konzo, and cognition deficits, mainly in sequential processing (visual-spatial analysis) domains. Toxic culprits include cyanide (mitochondrial toxicant), thiocyanate (AMPA-receptor chaotropic cyanide metabolite), cyanate (protein-carbamoylating cyanide metabolite), and 2-iminothiazolidine-4-carboxylic acid (seizure inducer). Factors of susceptibility include younger age, female gender, protein-deficient diet, and, possibly, the gut functional metagenome. The existence of uniquely exposed and neurologically affected populations offers invaluable research opportunities to develop a comprehensive understanding of cyanide toxicity and test or validate point-of-care diagnostic tools and treatment options to be included in preparedness kits in response to cyanide-related threats. © 2016 New York Academy of Sciences.

The fate of cyanide in leach wastes at gold mines: an environmental perspective

Science.gov (United States)

Johnson, Craig A.

2015-01-01

This paper reviews the basic chemistry of cyanide, methods by which cyanide can be analyzed, and aspects of cyanide behavior that are most relevant to environmental considerations at mineral processing operations associated with gold mines. The emphasis is on research results reported since 1999 and on data gathered for a series of U.S. Geological Survey studies that began in the late 1990s. Cyanide is added to process solutions as the CN− anion, but ore leaching produces numerous other cyanide-containing and cyanide-related species in addition to the desired cyanocomplex of gold. These can include hydrogen cyanide (HCN); cyanometallic complexes of iron, copper, zinc, nickel, and many other metals; cyanate (CNO−); and thiocyanate (SCN−). The fate of these species in solid wastes and residual process solutions that remain once gold recovery activities are terminated and in any water that moves beyond the ore processing facility dictates the degree to which cyanide poses a risk to aquatic organisms and aquatic-dependent organisms in the local environment.

[11C]copper(I) cyanide: a new radioactive precursor or 11C-cyanation and functionalization of haloarenes

International Nuclear Information System (INIS)

Ponchant, M.; Hinnen, F.; Demphel, S.; Crouzel, C.

1997-01-01

Radiosyntheses of [cyano- 11 C]benzonitriles, [carboyxyl- 11 C]benzoic acids, [carbonyl- 11 C]benzamides and [tetrazoyl- 11 C]5-biphenyl-1H-tetrazoles are described. [Cyano- 11 C]benzonitriles were prepared using the Rosenmund-von Braun reaction in one step from [ 11 C]hydrogen cyanide via [ 11 C]copper(1) cyanide in 2 min. [Carboxyl- 11 C]benzoic acids and [carbonyl- 11 C]benzamides were prepared from [cyano- 11 C]benzonitrile-complexes using basic hydrogen peroxide for 3 min in N,N-dimethylformamide at 180 and 80 o C, respectively. [Tetrazoyl- 11 C]5-biphenyl-1H-tetrazoles were obtained from [cyano- 11 C]benzonitrile-complexes in 7 min by cyclization with trimethyltin azide followed by acid hydrolysis at 180 o C. These labelled compounds were obtained in a one-pot procedure with good average specific radioactivities [500 mCi/μmol) at the end of synthesis] and in satisfactory average radiochemical yields (24-69%) at 40 min from the end of radionuclide production. This new radioactive precursor, [ 11 C]copper(I) cyanide, should give access to new 11 C-labelled ligands for positron emission tomography. (author)

Structure and composition of enamel and dentin after thermal treatment or infrared laser irradiation

International Nuclear Information System (INIS)

Bachmann, Luciano

2004-01-01

The main purpose of this work is to identify the crystallographic structure, optical properties, chemical composition and electron paramagnetic signals that laser irradiation or oven heating produces on the tissue. The thermal treatment was conducted in oven with temperature range below 1000 deg C and the laser irradiation with holmium (Ho:YLF - 2,065 μm) and erbium (Er:YAG - 2,94 μm) laser. The tissue characterization was carried out with X-ray diffraction, scanning electron microscopy, ultraviolet and visible transmission spectroscopy, light microscopy, infrared transmission/reflection spectroscopy and electron paramagnetic resonance. The holmium irradiated enamel (600-800 J/cm 2 ) shows the presence of tetracalcium phosphate that coexists with the natural phase (hydroxyapatite). The irradiated dentin shows only the sharper diffraction peaks of the natural phase. The narrows peaks, observed after irradiation, could be assigned to the dentin crystal growth and impurities elimination. Tissue discoloration is observed after thermal treatment with temperatures above 100 deg C. Heated enamel become white-opaque and the origin is assigned to the water elimination, which promotes higher light scattering by the prismatic structure. On the other hand, heated dentin, with similar temperatures becomes brown. The dentin browning changes with the temperature and shown two peaks, at 375 deg C and 700 deg C. The peak at 375 deg C is assigned to the collagen structure degradation and at 700 deg C to the cyanate formation. The dentin discoloration produced with temperatures below 200 deg C is reversible after the tissue hydration. Both enamel and dentin discoloration are also observed in erbium irradiated tissues. Thermal treatments, heating in oven or laser irradiation, change mainly the organic matrix composition and water present in the tissues. The inorganic matrix is more stable and its radicals are changed, with more predominance, only at temperatures higher than 500 deg

Ionic Liquid-Modified Thermosets and Their Nanocomposites: Dispersion, Exfoliation, Degradation, and Cure

Science.gov (United States)

Throckmorton, James A.

This dissertation explores the application of a room temperature ionic liquid (RTIL) to problems in the chemistry, processing, and modification of thermosetting polymers. In particular, the solution properties and reaction chemistry of 1-ethyl-3-methyl imidazolium dicyanamide (EMIM-DCN) are applied to problems of nanoparticle dispersion and processing, graphite exfoliation, cyanate ester (CE) cure, and the environmental degradation of CEs. Nanoparticle Dispersion: Nanocomposite processing can be simplified by using the same compound as both a nanoparticle solvent and an initiator for polymerization. This dual-function molecule can be designed both for solvent potential and reaction chemistry. EMIM-DCN, previously shown by our lab to act as an epoxy initiator, is used in the synthesis of silica and acid expanded graphite composites. These composites are then characterized for particle dispersion and physical properties. Individual particle dispersion of silica nanocomposites is shown, and silica nanocomposites at low loading show individual particle dispersion and improved modulus and fracture toughness. GNP nanocomposites show a 70% increase in modulus along with a 10-order of magnitude increase in electrical conductivity at 6.5 vol%, and an electrical percolation threshold of 1.7 vol%. Direct Graphite Exfoliation By Laminar Shear: This work presents a laminar-shear alternative to chemical processing and chaotic flow-fields for the direct exfoliation of graphite and the single-pot preparation of nanocomposites. Additionally, we develop the theory of laminar flow through a 3-roll mill, and apply that theory to the latest developments in the theory of graphite interlayer shear. The resulting nanocomposite shows low electrical percolation (0.5 vol%) and low thickness (1-3 layer) graphite/graphene flakes. Additionally, the effect of processing conditions by rheometry and comparison with solvent-free conditions reveal the interactions between processing and matrix

Catalyst displacement assay: a supramolecular approach for the design of smart latent catalysts for pollutant monitoring and removal† †Electronic supplementary information (ESI) available. See DOI: 10.1039/c6sc05584b Click here for additional data file.

Science.gov (United States)

Ho, Pui-Yu; Lu, Yu-Jing; Tang, Qian

2017-01-01

Latent catalysts can be tuned to function smartly by assigning a sensing threshold using the displacement approach for targeted analytes. Three cyano-bridged bimetallic complexes were synthesized as “smart” latent catalysts through the supramolecular assembly of different metallic donors [FeII(CN)6]4–, [FeII(tBubpy)(CN)4]2–, and FeII(tBubpy)2(CN)2 with a metallic acceptor [CuII(dien)]2+. The investigation of both their thermodynamic and kinetic properties on binding with toxic pollutants provided insight into their smart off–on catalytic capabilities, enabling us to establish a threshold-controlled catalytic system for the degradation of pollutants such as cyanide and oxalate. With these smart latent catalysts, a new catalyst displacement assay (CDA) was demonstrated and applied in a real wastewater treatment process to degrade cyanide pollutants in both domestic (level I, untreated) and industrial wastewater samples collected in Hong Kong, China. The smart system was adjusted to be able to initiate the catalytic oxidation of cyanide at a threshold concentration of 20 μM (the World Health Organization’s suggested maximum allowable level for cyanide in wastewater) to the less harmful cyanate under ambient conditions. PMID:28580114

An Evaluation of Four Electrolyte Models for the Prediction of Thermodynamic Properties of Aqueous Electrolyte Solutions

Directory of Open Access Journals (Sweden)

Kamalodin Momeni

2017-04-01

Full Text Available In this work, the performance of four electrolyte models for prediction the osmotic and activity coefficients of different aqueous salt solutions at 298 K, atmospheric pressure and in a wide range of concentrations are evaluated. In two of these models, (electrolyte Non-Random Two-Liquid e-NRTL and Mean Spherical Approximation-Non-Random Two-Liquid MSA-NRTL, association between ions of opposite charges for simplification purposes is ignored and in the other two ones, (Associative Mean Spherical Approximation-Non-Random Two-Liquid AMSA-NRTL and Binding Mean Spherical Approximation BiMSA association and solvation effects are considered. The predictions of these four models for the osmotic and activity coefficients of electrolyte solutions at 298 K and atmospheric pressure are compared with the experimental data reported in the literature. This comparison includes, 28 different aqueous salt solutions including thio-cyanates, perchlorates, nitrates, hydroxides, quaternary ammonium salts and others. The results show, the performance of models that consider association effects are better than others especially for higher salt concentrations. However, the best performance belongs to BiMSA model which has some parameters with physical meaning.

SNAP Telescope Latest Developments

Science.gov (United States)

Lampton, M.; SNAP Collaboration

2004-12-01

The coming era of precision cosmology imposes new demands on space telescopes with regard to spectrophotometric accuracy and image stability. To meet these requirements for SNAP we have developed an all reflecting two-meter-class space telescope of the three-mirror anastigmat type. Our design features a large flat annular field (1.5 degrees = 580mm diameter) and a telephoto advantage of 6, delivering a 22m focal length within an optical package length of only 3.5 meters. The use of highly stable materials (Corning ULE glass and carbon-fiber reinforced cyanate ester resin for the metering structure) combined with agressive distributed thermal control and an L2 orbit location will lead to unmatched figure stability. Owing to our choice of rigid structure with nondeployable solar panels, finite-element models show no structural resonances below 10Hz. An exhaustive stray light study has been completed. Beginning in 2005, two industry studies will develop plans for fabrication, integration and test, bringing SNAP to a highly realistic level of definition. SNAP is supported by the Office of Science, US DoE, under contract DE-AC03-76SF00098.

Enhanced photoelectrocatalytic decomposition of copper cyanide complexes and simultaneous recovery of copper with a Bi2MoO6 electrode under visible light by EDTA/K4P2O7.

Science.gov (United States)

Zhao, Xu; Zhang, Juanjuan; Qiao, Meng; Liu, Huijuan; Qu, Jiuhui

2015-04-07

Simultaneous photoelectrocatalytic (PEC) oxidation of cyanides and recovery of copper in a PEC reactor with a Bi(2)MoO(6) photoanode was investigated at alkaline conditions under visible light irradiation. The surface variation of the Bi(2)MoO(6) photoanode and titanium cathode was characterized. The Cu mass distribution onto the anode, in the solution, and onto the cathode was fully investigated. In the individual PEC oxidation of copper cyanides, the formation of a black copper oxide on the anode occurred. By keeping the initial cyanide concentration at 0.01 mM, the effect of EDTA/K(4)P(2)O(7) was examined at different molar ratios of EDTA/K(4)P(2)O(7) to cyanide. It was indicated that the oxidation of cyanides increased and simultaneous copper electrodeposition with zero value onto the cathode was feasible at pH 11. Under the optimal conditions, the total cyanide concentration was lowered from 250 to 5.0 mg/L, and the Cu recovery efficiency deposited onto the cathode was higher than 90%. Cyanate was the only product. The role of the photogenerated hole in the oxidation of cyanide ions was confirmed.

Possible explosive compounds in the Savannah River Site waste tank farm facilities

International Nuclear Information System (INIS)

Hobbs, D.T.

1992-01-01

Based on a comparison of the known constituents in high-level nuclear waste stored at the Savannah River Site (SRS) and explosive compounds reported in the literature, only two classes of explosive compounds (metal NO x compounds and organic compounds) were identified as requiring further work to determine if they exist in the waste, and if so, in what quantities. Of the fourteen classes of explosive compounds identified as conceivably being present in tank farm operations, nine classes (metal fulminates, metal azides, halogen compounds, metal-amine complexes, nitrate/oxalate mixtures, metal oxalates, metal oxohalogenates, metal cyanides/cyanates, and peroxides) are not a hazard because these classes of compounds cannot be formed or accumulated in sufficient quantity, or they are not reactive at the conditions which exist in the tank farm facilities. Three of the classes (flammable gases, metal nitrides, and ammonia compounds and derivatives) are known to have the potential to build up to concentrations at which an observable reaction might occur. Controls have been in place for some time to limit the formation or control the concentration of these classes of compounds. A comprehensive list of conceivable explosive compounds is provided in Appendix 3

Polymer nanocomposites for high-temperature composite repair

Energy Technology Data Exchange (ETDEWEB)

Sheng, Xia [Iowa State Univ., Ames, IA (United States)

2008-01-01

A novel repair agent for resin-injection repair of advanced high temperature composites was developed and characterized. The repair agent was based on bisphenol E cyanate ester (BECy) and reinforced with alumina nanoparticles. To ensure good dispersion and compatibility with the BECy matrix in nanocomposites, the alumina nanoparticles were functionalized with silanes. The BECy nanocomposites, containing bare and functionalized alumina nanoparticles, were prepared and evaluated for their thermal, mechanical, rheological, and viscoelastic properties. The monomer of BECy has an extremely low viscosity at ambient temperature, which is good for processability. The cured BECy polymer is a highly cross-linked network with excellent thermal mechanical properties, with a high glass transition temperature (T_g) of 270 C and decomposition temperature above 350 C. The incorporation of alumina nanoparticles enhances the mechanical and rheological properties of the BECy nanocomposites. Additionally, the alumina nanoparticles are shown to catalyze the cure of BECy. Characterization of the nanocomposites included dynamic mechanical analysis, differential scanning calorimetry, thermogravimetric analysis, rheological and rheokinetic evaluation, and transmission electron microscopy. The experimental results show that the BECy nanocomposite is a good candidate as repair agent for resin-injection repair applications.

Evaluation of the Sebia Capillarys 3 Tera and the Bio-Rad D-100 Systems for the Measurement of Hemoglobin A1c.

Science.gov (United States)

Herpol, Margaux; Lanckmans, Katrien; Van Neyghem, Stefaan; Clement, Pascale; Crevits, Stefanie; De Crem, Kim; Gorus, Frans K; Weets, Ilse

2016-07-01

We evaluated the Bio-Rad (Irvine, CA) D-100 and the Sebia (Lisses, France) Capillarys 3 Tera for the measurement of hemoglobin A1c (HbA1c) in venous blood samples. Whole-blood samples and control material were analyzed with the D-100 and Capillarys 3 Tera and compared with our routine method, HLC-723G7 (Tosoh, Tokyo, Japan). An evaluation protocol to test precision, trueness, linearity, carryover, and selectivity was set up according to Clinical and Laboratory Standards Institute guidelines. The results were presented in National Glycohemoglobin Standardization Program and International Federation of Clinical Chemistry (IFCC) units. Both systems showed excellent precision (total coefficients of variation hemoglobin (≤0.5 mmol/L potassium cyanate), hemoglobin variants, bilirubin (≤15 mg/dL), and triglycerides (≤3,360 mg/dL). The Bio-Rad D-100 and the Sebia Capillarys 3 Tera instruments performed well for the determination of HbA1c in terms of quality criteria as well as for sample throughput. © American Society for Clinical Pathology, 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Curing of a Bisphenol-E Based Cyanate Ester using Magnetic Nanoparticles as an Internal Heat Source through Induction Heating

Science.gov (United States)

2013-11-01

reactions forming high-temperature thermosetting polymers and for innovative ways to process such polymers. 15. SUBJECT TERMS 16. SECURITY...reaction should allow for other reactions forming high-temperature thermosetting polymers and for innovative ways to process such polymers...generated by the particles in a polymer,18 1 µm nickel alloy (Nitinol) used to compare polymerizations with conventional or induction heating,19 or a

Cloning, characterization and anion inhibition study of a β-class carbonic anhydrase from the caries producing pathogen Streptococcus mutans.

Science.gov (United States)

Dedeoglu, Nurcan; De Luca, Viviana; Isik, Semra; Yildirim, Hatice; Kockar, Feray; Capasso, Clemente; Supuran, Claudiu T

2015-07-01

The oral pathogenic bacterium involved in human dental caries formation Streptococcus mutans, encodes for two carbonic anhydrase (CA, EC 4.2.1.1) one belonging to the α- and the other one to the β-class. This last enzyme (SmuCA) has been cloned, characterized and investigated for its inhibition profile with a major class of CA inhibitors, the inorganic anions. Here we show that SmuCA has a good catalytic activity for the CO2 hydration reaction, with kcat 4.2×10(5)s(-1) and kcat/Km of 5.8×10(7)M(-1)×s(-1), being inhibited by cyanate, carbonate, stannate, divannadate and diethyldithiocarbamate in the submillimolar range (KIs of 0.30-0.64mM) and more efficiently by sulfamide, sulfamate, phenylboronic acid and phenylarsonic acid (KIs of 15-46μM). The anion inhibition profile of the S. mutans enzyme is very different from other α- and β-CAs investigated earlier. Identification of effective inhibitors of this new enzyme may lead to pharmacological tools useful for understanding the role of S. mutans CAs in dental caries formation, and eventually the development of pharmacological agents with a new mechanism of antibacterial action. Copyright © 2015 Elsevier Ltd. All rights reserved.

Critical parameters for electron beam curing of cationic epoxies and property comparison of electron beam cured cationic epoxies versus thermal cured resins and composites

International Nuclear Information System (INIS)

Janke, C.J.; Norris, R.E.; Yarborough, K.; Lopata, V.J.

1997-01-01

Electron beam curing of composites is a nonthermal, nonautoclave curing process offering the following advantages compared to conventional thermal curing: substantially reduced manufacturing costs and curing times; improvements in part quality and performance; reduced environmental and health concerns; and improvements in material handling. In 1994 a Cooperative Research and Development Agreement (CRADA), sponsored by the Department of Energy Defense Programs and 10 industrial partners, was established to advance electron beam curing of composites. The CRADA has successfully developed hundreds of new toughened and untoughened resins, offering unlimited formulation and processing flexibility. Several patent applications have been filed for this work. Composites made from these easily processable, low shrinkage material match the performance of thermal cured composites and exhibit: low void contents comparable to autoclave cured composites (less than 1%); superb low water absorption values in the same range as cyanate esters (less than 1%); glass transition temperatures rivaling those of polyimides (greater than 390 C); mechanical properties comparable to high performance, autoclave cured composites; and excellent property retention after cryogenic and thermal cycling. These materials have been used to manufacture many composite parts using various fabrication processes including hand lay-up, tow placement, filament winding, resin transfer molding and vacuum assisted resin transfer molding

Ferrocyanide Safety Project Dynamic X-Ray Diffraction studies of sodium nickel ferrocyanide reactions with equimolar nitrate/nitrite salts

International Nuclear Information System (INIS)

Dodds, J.N.; UNOCAL, Brea, CA

1994-07-01

Dynamic X-ray Diffraction (DXRD) has been to used to identify and quantify the solid state reactions that take place between sodium nickel ferrocyanide, Na 2 NiFe(CN) 6 , and equimolar concentrations of sodium nitrate/nitrite, reactions of interest to the continued environmental safety of several large underground waste storage tanks at the Hanford site in eastern Washington. The results are supportive of previous work, which indicated that endothermic dehydration and melting of the nitrates take place before the occurrence of exothermic reactions that being about 300 degrees C. The DXRD results show that a major reaction set at these temperatures is the occurrence of a series reaction that produces sodium cyanate, NaCNO, as an intermediate in a mildly exothermic first step. In the presence of gaseous oxygen, NaCNO subsequently reacts exothermally and at a faster rate to form metal oxides. Measurements of the rate of this reaction are used to estimate the heat release. Comparisons of this estimated heat release rate with heat transfer rates from a hypothetical ''hot spot'' show that, even in a worst-case scenario, the heat transfer rates are approximately eight times higher than the rate of energy release from the exothermic reactions

Extraterrestrial Radiation Chemistry and Molecular Astronomy

Science.gov (United States)

Hudson, Reggie L.; Moore, Marla H.

2009-01-01

Astronomical observations of both solar system and interstellar regions have revealed a rich chemical inventory that includes most classes of organic molecules and selected inorganics. For example, gas-phase ethylene glycol and SOz have been observed by astronomers, while solidphase detections include OCS, H2O2 , and the cyanate anion.' All of these are found in environments that are, by earthly standards, exceedingly hostile: temperatures of 10 - 100 K, miniscule densities, and near-ubiquitous ionizing-radiation fields. Beyond the simplest chemical species, these conditions have made it difficult-to-impassible to account for the observed molecular abundances using gas-phase chemistry, suggesting solid-phase reactions play an important role. In extraterrestrial environments, cosmic rays, UV photons, and magnetospheric radiation all drive chemical reactions, even at cryogenic temperatures. To study this chemistry, radiation astrochemists conduct experiments on icy materials, frozen under vacuum and exposed to sources such as keV electrons and MeV protons. Compositional changes usually are followed with IR spectroscopy and, in selected cases, more-sensitive mass-spectral techniques. This talk will review some recent results on known and suspected extraterrestrial molecules and ions. Spectra and reaction pathways will be presented, and predictions made for interstellar chemistry and the chemistry of selected solar system objects. Some past radiation-chemical contributions, and future needs, will be explored.

Reactions of the melatonin metabolite N(1)-acetyl-5-methoxykynuramine with carbamoyl phosphate and related compounds.

Science.gov (United States)

Kuesel, Jana T; Hardeland, Rüdiger; Pfoertner, Henrike; Aeckerle, Nelia

2010-01-01

N-[2-(6-methoxyquinazolin-4-yl)-ethyl] acetamide (MQA) is a compound formed from the melatonin metabolite N(1)-acetyl-5-methoxykynuramine (AMK). We followed MQA production in reaction systems containing various putative reaction partners, in the absence and presence of hydrogen peroxide and/or copper(II). Although MQA may be formally described as a condensation product of either N(1)-acetyl-N(2)-formyl-5-methoxykynuramine (AFMK) with ammonia, or AMK with formamide, none of these combinations led to substantial quantities of MQA. However, MQA formation was observed in mixtures containing AMK, hydrogen peroxide, hydrogen carbonate and ammonia, or AMK, hydrogen peroxide, copper(II) and potentially carbamoylating agents, such as potassium cyanate or, more efficiently, carbamoyl phosphate. In the presence of hydrogen peroxide, copper(II) and carbamoyl phosphate, MQA was the major product obtained from AMK, but the omission of copper(II) mainly led to another metabolite, 3-acetamidomethyl-6-methoxycinnolinone (AMMC). This was caused by nitric oxide (NO) generated under oxidative conditions from carbamoyl phosphate, as shown by an NO spin trap. MQA formation with carbamoyl phosphate was not due to the possible decomposition product, formamide. The reaction of AMK with carbamoyl phosphate under oxidative conditions, in which inorganic phosphate and water are released and which differs from the typical process of carbamoylation via isocyanate, may be considered as a new physiological route of MQA formation.

IgG binding of mugwort pollen allergens and allergoids exposed to simulated gastrointestinal conditions measured by a self-developed ELISA test

Directory of Open Access Journals (Sweden)

RATKO M. JANKOV

2004-07-01

Full Text Available This study considers the influence of exposure to simulated gastrointestinal conditions (saliva, gut, intestine and acidic conditions of the gut on IgG binding of unmodified allergens and three types of LMW allergoids of Artemisia vulgaris pollen extract obtained by means of potassium cyanate, succinic and maleic anhydride. It also concerns the optimization of a self-developed ELISA assay for comparison of the specific IgG binding of mugwort pollen extract and modified mugwort pollen derivatives. The ELISA was conducted with a mugwort pollen extract coupled to the plate, using the sera from 12 mugwort-pollen allergic patients. The exposure to saliva fluid for 2 min did not influence the IgG binding properties of allergens and allergoids. Exposure of mugwort pollen allergens and LMW allergoids to the acidic conditions of the gut did not dramatically change their IgG binding properties. By exposing mugwort pollen extract and LMW derivatives to the SGF conditions for 1 h, the percent of IgG binding epitopes was reduced to a half of its starting value in the extract and to about 30 % in all the allergoid samples. After prolonged exposure only the carbamyl derivative showed reduced IgG binding. Changes of the IgG binding potential of all four samples after exposure in SIF followed a similar pattern.

Ferrate(VI) and ferrate(V) oxidation of cyanide, thiocyanate, and copper(I) cyanide

International Nuclear Information System (INIS)

Sharma, Virender K.; Yngard, Ria A.; Cabelli, Diane E.; Clayton Baum, J.

2008-01-01

Cyanide (CN - ), thiocyanate (SCN - ), and copper(I) cyanide (Cu(CN) 4 3- ) are common constituents in the wastes of many industrial processes such as metal finishing and gold mining, and their treatment is required before the safe discharge of effluent. The oxidation of CN - , SCN - , and Cu(CN) 4 3- by ferrate(VI) (Fe VI O 4 2- ; Fe(VI)) and ferrate(V) (Fe V O 4 3- ; Fe(V)) has been studied using stopped-flow and premix pulse radiolysis techniques. The rate laws for the oxidation of cyanides were found to be first-order with respect to each reactant. The second-order rate constants decreased with increasing pH because the deprotonated species, FeO 4 2- , is less reactive than the protonated Fe(VI) species, HFeO 4 - . Cyanides react 10 3 -10 5 times faster with Fe(V) than with Fe(VI). The Fe(V) reaction with CN - proceeds by sequential one-electron reductions from Fe(V) to Fe(IV) to Fe(III). However, a two-electron transfer process from Fe(V) to Fe(III) occurs in the reaction of Fe(V) with SCN - and Cu(CN) 4 3- . The toxic CN - species of cyanide wastes is converted into relatively non-toxic cyanate (NCO - ). Results indicate that Fe(VI) is highly efficient in removing cyanides from electroplating rinse water and gold mill effluent

Recycling of ferrous sulfate by the synthesis of a new super oxidant material 'Referox'

Energy Technology Data Exchange (ETDEWEB)

Evrard, O. [Universite Henri Poincare, Vandoeuvre (France); Dupre, B.; Jeannot, C.; Kanari, N.; Gaballah, I.; Ninane, L.; Verstraete, W.; Denomme, S.; Belsue, M.

2001-07-01

This European Union-sponsored project was initiated to develop a process to recycle industrial ferrous sulfate by the synthesis of a superoxidant containing hexavalent (FeVI) iron. Hexavalent iron, also called ferrates, can be used in decontamination of industrial effluents, decolorisation and purification of effluents from the textile and tanning industries, oxidation of cyanide to cyanates, soil remediation, water treatment and in a variety of other processes. Dry synthesis of potassium ferrate, using calcium hypochlorite as the oxidizing agent, was successful. By using chlorine instead of calcium hypochlorite and by partially substituting sodium hydroxide for potassium hydroxide the cost of the synthesis was significantly reduced. Recycling of ferrous sulfate at room temperature by the synthesis of potassium ferrate (FeVI) using gaseous chlorine instead of solid calcium hypochlorite was also successful. The yield of the synthesis was about 65 per cent for the used industrial ferrous sulfate samples. Large scale experimentation of the potassium ferrate synthesis was also carried out, obtaining potassium ferrate that remained stable for several months. The ferrates were used in the treatment of drinking water, wastewater, soil remediation, and effluent decontamination. Encouraging results were obtained. An additional benefit found was that use of the ferrates as bactericide for water treatment instead of chlorine gas eliminates the generation of halo-organic compounds which are suspected to be carcinogenic. 2 figs.

Transcriptomic analyses of nitrogen assimilation processes in a Chinese strain of Aureococcus anophagefferens

Directory of Open Access Journals (Sweden)

Li-Na Chen

2015-09-01

Full Text Available Aureococcus anophagefferens is a harmful alga that dominates plankton communities during brown tides in North America, Africa, and Asia. In order to figure out the processes of nitrogen assimilation in a Chinese strain of A. anophagefferens, RNA-seq technology was used to examine transcriptomic differences in A. anophagefferens that was grown on urea, nitrate, or a mixture of urea and nitrate, and that was under N-replete, limited and recovery conditions. We noted that transcripts upregulated by nitrate and N-limitation included those encoding proteins involved in amino acid, nucleotide and aminosugar transport, degradation of amides and cyanates, and nitrate assimilation pathway. The data suggest that A. anophagefferens possesses an ability to utilize a variety of dissolved organic nitrogen. Moreover, transcripts for synthesis of proteins, glutamate-derived amino acids, spermines and sterols were upregulated by urea. Transcripts encoding key enzymes that are involved in the ornithine–urea cycle (OUC and TCA cycle were differentially regulated by urea and nitrogen concentration, which suggests that the OUC may be linked to the TCA cycle and involved in reallocation of intracellular carbon and nitrogen. These genes regulated by urea may be crucial for the rapid proliferation of A. anophagefferens when urea is provided as the N source. Here, we provide the experimental procedures and analytical processes in detail. The data set is deposited in GEO with the accession number GSE60576.

Cancer cell death induced by phosphine gold(I) compounds targeting thioredoxin reductase.

Science.gov (United States)

Gandin, Valentina; Fernandes, Aristi Potamitou; Rigobello, Maria Pia; Dani, Barbara; Sorrentino, Francesca; Tisato, Francesco; Björnstedt, Mikael; Bindoli, Alberto; Sturaro, Alberto; Rella, Rocco; Marzano, Cristina

2010-01-15

The thioredoxin system, composed of thioredoxin reductase (TrxR), thioredoxin (Trx), and NADPH (nicotinamide adenine dinucleotide phosphate), plays a central role in regulating cellular redox homeostasis and signaling pathways. TrxR, overexpressed in many tumor cells and contributing to drug resistance, has emerged as a new target for anticancer drugs. Gold complexes have been validated as potent TrxR inhibitors in vitro in the nanomolar range. In order to obtain potent and selective TrxR inhibitors, we have synthesized a series of linear, 'auranofin-like' gold(I) complexes all containing the [Au(PEt(3))](+) synthon and the ligands: Cl(-), Br(-), cyanate, thiocyanate, ethylxanthate, diethyldithiocarbamate and thiourea. Phosphine gold(I) complexes efficiently inhibited cytosolic and mitochondrial TrxR at concentrations that did not affect the two related oxidoreductases glutathione reductase (GR) and glutathione peroxidase (GPx). The inhibitory effect of the redox proteins was also observed intracellularly in cancer cells pretreated with gold(I) complexes. Gold(I) compounds were found to induce antiproliferative effects towards several human cancer cells some of which endowed with cisplatin or multidrug resistance. In addition, they were able to activate caspase-3 and induce apoptosis observed as nucleosome formation and sub-G1 cell accumulation. The complexes with thiocyanate and xanthate ligands were particularly effective in inhibiting thioredoxin reductase and inducing apoptosis. Pharmacodynamic studies in human ovarian cancer cells allowed for the correlation of intracellular drug accumulation with TrxR inhibition that leads to the induction of apoptosis via the mitochondrial pathway.

Integrated metabolism in sponge-microbe symbiosis revealed by genome-centered metatranscriptomics.

Science.gov (United States)

Moitinho-Silva, Lucas; Díez-Vives, Cristina; Batani, Giampiero; Esteves, Ana Is; Jahn, Martin T; Thomas, Torsten

2017-07-01

Despite an increased understanding of functions in sponge microbiomes, the interactions among the symbionts and between symbionts and host are not well characterized. Here we reconstructed the metabolic interactions within the sponge Cymbastela concentrica microbiome in the context of functional features of symbiotic diatoms and the host. Three genome bins (CcPhy, CcNi and CcThau) were recovered from metagenomic data of C. concentrica, belonging to the proteobacterial family Phyllobacteriaceae, the Nitrospira genus and the thaumarchaeal order Nitrosopumilales. Gene expression was estimated by mapping C. concentrica metatranscriptomic reads. Our analyses indicated that CcPhy is heterotrophic, while CcNi and CcThau are chemolithoautotrophs. CcPhy expressed many transporters for the acquisition of dissolved organic compounds, likely available through the sponge's filtration activity and symbiotic carbon fixation. Coupled nitrification by CcThau and CcNi was reconstructed, supported by the observed close proximity of the cells in fluorescence in situ hybridization. CcPhy facultative anaerobic respiration and assimilation by diatoms may consume the resulting nitrate. Transcriptional analysis of diatom and sponge functions indicated that these organisms are likely sources of organic compounds, for example, creatine/creatinine and dissolved organic carbon, for other members of the symbiosis. Our results suggest that organic nitrogen compounds, for example, creatine, creatinine, urea and cyanate, fuel the nitrogen cycle within the sponge. This study provides an unprecedented view of the metabolic interactions within sponge-microbe symbiosis, bridging the gap between cell- and community-level knowledge.

Acquisition of resistance to 1-(4-amino-2-methyl-5-pyrimidinyl) methyl-3-(2-chloroethyl)-3-nitrosourea hydrochloride in V79 cells through increased removal of O6-alkylguanine.

Science.gov (United States)

Satoh, M S; Huh, N H; Horie, Y; Thomale, J; Rajewsky, M F; Kuroki, T

1987-10-01

The molecular mechanism of acquisition of resistance to 1-(4-amino-2-methyl-5-pyrimidinyl)-methyl-3-(2-chloroethyl)-3-nitroso ure a hydrochloride (ACNU) was investigated using ACNU-resistant clones (ACNUr-1-4) isolated from the V79 cell line. The binding level of alkyl cyanate, a decomposition product of ACNU, to protein in ACNUr-1 cells was not less than that in the parental V79 cells, indicating that the acquired resistance was not due to a reduced intracellular concentration of ACNU. Because O6-chloroethylguanine, an intermediate in cytotoxic interstrand cross-link formation by ACNU, is known to be repaired by the same mechanism as O6-ethyldeoxyguanosine (O6-EtdGuo), we quantitated O6-EtdGuo by radioimmunoassay at various times after exposure of cells to 100 micrograms/ml N-ethyl-N-nitrosourea for 20 min. In V79 cells, elimination of O6-EtdGuo was negligible, but in all four resistant clones, 30 to 59% of the O6-EtdGuo was removed within 24 hr after exposure. This increased removal of O6-EtdGuo among the resistant clones was associated with the activity of O6-alkylguanine DNA alkyltransferase (O6-AGT) determined using cell extracts. The present results indicate that increased removal of O6-chloroethylguanine in ACNU-resistant clones by O6-AGT is mechanistically linked to the acquisition of resistance to ACNU.

Purification and inhibition studies with anions and sulfonamides of an α-carbonic anhydrase from the Antarctic seal Leptonychotes weddellii.

Science.gov (United States)

Cincinelli, Alessandra; Martellini, Tania; Innocenti, Alessio; Scozzafava, Andrea; Supuran, Claudiu T

2011-03-15

A high activity α-carbonic anhydrase (CA, EC 4.2.1.1) has been purified from various tissues of the Antarctic seal Leptonychotes weddellii. The new enzyme, denominated lwCA, has a catalytic activity for the physiologic CO(2) hydration to bicarbonate reaction, similar to that of the high activity human isoform hCA II, with a k(cat) of 1.1×10(6) s(-1), and a k(cat)/K(m) of 1.4×10(8) M(-1) s(-1). The enzyme was highly inhibited by cyanate, thiocyanate, cyanide, bicarbonate, carbonate, as well as sulfamide, sulfamate, phenylboronic/phenylarsonic acids (K(I)s in the range of 46-100 μM). Many clinically used sulfonamides, such as acetazolamide, methazolamide, dorzolamide, brinzolamide and benzolamide were low nanomolar inhibitors, with K(I)s in the range of 5.7-67 nM. Dichlorophenamide, zonisamide, saccharin and hydrochlorothiazide were weaker inhibitors, with K(I)s in the range of 513-5390 nM. The inhibition profile with anions and sulfonamides of the seal enzyme was rather different from those of the human isoforms hCA I and II. The high sensitivity to bicarbonate inhibition of lwCA, unlike that of the human enzymes, may reflect an evolutionary adaptation to the deep water, high CO(2) partial pressure and hypoxic conditions in which Weddell seals spend much of their life. Copyright © 2011 Elsevier Ltd. All rights reserved.

Effects of benzoxazine resin on property enhancement of shape memory epoxy: A dual function of benzoxazine resin as a curing agent and a stable network segment

Directory of Open Access Journals (Sweden)

T. Tanpitaksit

2015-09-01

Full Text Available An ability of bisphenol-A/aniline based benzoxazine resin (BA-a to simultaneously acts as a curing agent and a stable or rigid network segment for shape memory epoxy, i.e. a two component system, is demonstrated. This significantly simplifies a formulation of present shape memory epoxy systems, i.e. a three or four component system. A suitable content of BA-a in the aliphatic epoxy (NGDE/polybenzoxazine (PBA-a samples for good shape memory performance is in a range of 30 to 50 mol%. The storage modulus of the obtained NGDE/PBA-a shape memory polymers (SMPs was increased from 3.57 GPa for 30 mol% BA-a content to 4.50 GPa for 50 mol% BA-a content. Glass transition temperature of the sample was also substantially increased with increasing BA-a fraction, i.e. from 51°C to 140°C. Flexural modulus and strength at room temperature of the samples at 50 mol% BA-a were found to be as high as 3.97 GPa and 132 MPa compared to the maximum values of 2.54 GPa and 100 MPa of SMP based on cyanate ester-epoxy. All samples exhibited a high value of shape fixity close to 100%. A presence of the BA-a in the samples also imparted a greater recovery stress ranging from 0.25 to 1.59 MPa. Consequently, the obtained NGDE/PBA-a copolymers are highly attractive for shape memory materials to be used in a broader range of applications particularly at elevated temperature and a higher recovery stress value.

Pyrimidine homoribonucleosides: synthesis, solution conformation, and some biological properties.

Science.gov (United States)

Lassota, P; Kuśmierek, J T; Stolarski, R; Shugar, D

1987-05-01

Conversion of uridine and cytidine to their 5'-O-tosyl derivatives, followed by cyanation with tetraethylammonium cyanide, reduction and deamination, led to isolation of the hitherto unknown homouridine (1-(5'-deoxy-beta-D-allofuranosyl)uracil) and homocytidine (1-(5'-deoxy-beta-D-allofuranosyl)cytosine), analogues of uridine and cytidine in which the exocyclic 5'-CH2OH chain is extended by one carbon to CH2CH2OH. Homocytidine was also phosphorylated to its 6'-phosphate and 6'-pyrophosphate analogues. In addition, it was converted, via its 2,2'-anhydro derivative, to arahomocytidine, an analogue of the chemotherapeutically active araC. The structures of all the foregoing were established by various criteria, including 1H and 13C NMR spectroscopy, both of which were also applied to analyses of the solution conformations of the various compounds, particularly as regards the conformations of the exocyclic chains. The behaviour of the homo analogues was examined in several enzymatic systems. Homocytidine was a feeble substrate, without inhibitory properties, of E. coli cytidine deaminase. Homocytidine was an excellent substrate for wheat shoot nucleoside phosphotransferase; while homouridine was a good substrate for E. coli uridine phosphorylase. Although homoCMP was neither a substrate, nor an inhibitor, of snake venom 5'-nucleotidase, homoCDP was a potent inhibitor of this enzyme (Ki approximately 6 microM). HomoCDP was not a substrate for M. luteus polynucleotide phosphorylase. None of the compounds exhibited significant activity vs herpes simplex virus type 1, or cytotoxic activity in several mammalian cell lines.

Cosmic ray processing of N2-containing interstellar ice analogues at dark cloud conditions

Science.gov (United States)

Fedoseev, G.; Scirè, C.; Baratta, G. A.; Palumbo, M. E.

2018-04-01

N2 is believed to lock considerable part of nitrogen elemental budget and, therefore, to be one of the most abundant ice constituent in cold dark clouds. This laboratory-based research utilizes high energetic processing of N2 containing interstellar ice analogues using 200 keV H+ and He+ ions that mimics cosmic ray processing of the interstellar icy grains. It aims to investigate the formation of (iso)cyanates and cyanides in the ice mantles at the conditions typical for cold dark clouds and prestellar cores. Investigation of cosmic ray processing as a chemical trigger mechanism is explained by the high stability of N2 molecules that are chemically inert in most of the atom- and radical-addition reactions and cannot be efficiently dissociated by cosmic ray induced UV-field. Two sets of experiments are performed to closer address solid-state chemistry occurring in two distinct layers of the ice formed at different stages of dark cloud evolution, i.e. `H2O-rich' and `CO-rich' ice layers. Formation of HNCO and OCN- is discussed in all of the performed experiments. Corresponding kinetic curves for HNCO and OCN- are obtained. Furthermore, a feature around 2092 cm-1 assigned to the contributions of 13CO, CN-, and HCN is analysed. The kinetic curves for the combined HCN/CN- abundance are derived. In turn, normalized formation yields are evaluated by interpolation of the obtained results to the low irradiation doses relevant to dark cloud stage. The obtained values can be used to interpret future observations towards cold dark clouds using James Webb Space Telescope.

Radiation-induced preparation of core/shell gold/albumin nanoparticles

Science.gov (United States)

Flores, Constanza Y.; Achilli, Estefania; Grasselli, Mariano

2018-01-01

Nanoparticles (NPs) are one of the most promising nanomaterials to be used in the biomedical field. Gold NPs (Au-NPs) have been covered with monolayers of many different molecules and macromolecules to prepare different kinds of biosensors. However, these coatings based on physisorption methods are not stable enough to prepare functional nanomaterials to be used in complex mixtures or in vivo applications. The aim of this work was to prepare a protein coating of Au-NPs based on a protein multilayer covering, stabilized by a novel radiation-induced crosslinking process. Albumins from human and bovine source were added to Au-NPs suspension and followed by ethanol addition to induce protein aggregation. Samples were irradiated with a gamma source at 10 kGy to induce a protein crosslinking according to recent findings. Samples containing 30%v/v ethanol showed a plasmon peak at about 532 nm, demonstrating the presence of non-aggregated Au-NPs. Using higher ethanol concentrations, the absorbance of plasmon peak showed NP aggregation. By Dynamic Light Scattering measurements, a new particle population with an average diameter of about 60 nm was found. Moreover, TEM images showed that the NPs had spherical shape and the presence of a low-density halo around the metal core confirmed the presence of the protein shell. An irradiation dose of one kGy was enough to show changes in the plasmon peak characteristics. The increase in the chemical stability of protein shell was demonstrated by the reduction in the NP dissolution kinetics in presence of cyanate.

A horizontally transferred cyanase gene in the spider mite Tetranychus urticae is involved in cyanate metabolism and is differentially expressed upon host plant chang

NARCIS (Netherlands)

Wybouw, N.; Balabanidou, V.; Ballhorn, D.J.; Dermauw, W.; Grbić, M.; Vontas, J.; Van Leeuwen, T.

2012-01-01

The genome of the phytophagous two-spotted spider mite Tetranychus urticae was recently sequenced, representing the first complete chelicerate genome, but also the first genome of a highly polyphagous agricultural pest. Genome analysis revealed the presence of an unexpected high number of cases of

Pilot-Scale Silicone Process for Low-Cost Carbon Dioxide Capture

Energy Technology Data Exchange (ETDEWEB)

Farnum, Rachel; Perry, Robert; Wood, Benjamin

2014-12-31

GE Global Research is developing technology to remove carbon dioxide (CO 2) from the flue gas of coal-fired powerplants. A mixture of 3-aminopropyl end-capped polydimethylsiloxane (GAP-1m) and triethylene glycol (TEG) is the preferred CO2-capture solvent. GE Global Research was contracted by the Department of Energy to test a pilot-scale continuous CO2 absorption/desorption system using a GAP-1m/TEG mixture as the solvent. As part of that effort, an Environmental, Health, and Safety (EH&S) assessment for a CO2-capture system for a 550 MW coal-fired powerplant was conducted. Five components of the solvent, CAS#2469-55-8 (GAP-0), CAS#106214-84-0 (GAP-1-4), TEG, and methanol and xylene (minor contaminants from the aminosilicone) are included in this assessment. One by-product, GAP- 1m/SOX salt, and dodecylbenzenesulfonicacid (DDBSA) were also identified foranalysis. An EH&S assessment was also completed for the manufacturing process for the GAP-1m solvent. The chemicals associated with the manufacturing process include methanol, xylene, allyl chloride, potassium cyanate, sodium hydroxide (NaOH), tetramethyldisiloxane (TMDSO), tetramethyl ammonium hydroxide, Karstedt catalyst, octamethylcyclotetrasiloxane (D4), Aliquat 336, methyl carbamate, potassium chloride, trimethylamine, and (3-aminopropyl) dimethyl silanol. The toxicological effects of each component of both the CO2 capture system and the manufacturing process were defined, and control mechanisms necessary to comply with U.S. EH&S regulations are summarized. Engineering and control systems, including environmental abatement, are described for minimizing exposure and release of the chemical components. Proper handling and storage recommendations are made for each chemical to minimize risk to workers and the surrounding community.

Artemisia vulgaris pollen allergoids digestibility in the simulated conditions of the gastrointestinal tract

Directory of Open Access Journals (Sweden)

RATKO M. JANKOV

2006-09-01

Full Text Available Chemically modified allergens (allergoids have found use in both traditional and novel forms of immunotherapy of allergic disorders. Novel forms of immunotherapy include local allergen delivery, via the gastrointestinal tract. This study conveys the gastrointestinal stability of three types ofmugwort pollen allergoids under simulated conditions of the gut. Allergoids of the pollen extract of Artemisia vulgaris were obtained by means of potassium cyanate, succinic and maleic anhydride. Gastrointestinal tract conditions (saliva, and gastric fluid were simulated in accordance with the EU Pharmacopoeia. The biochemical and immunochemical properties of the derivatives following exposure to different conditions were monitored by determining the number of residual amino groups with 2,4,6-trinitrobenzenesulfonic acid, SDS PAGE, immunoblotting and inhibition of mugwort-specific IgE. Exposure to saliva fluid for 2 min did not influence the biochemical and immunochemical properties of the derivatives. In the very acidic conditions of the simulated gastric fluid, the degree of demaleylation and desuccinylation, even after 4 h exposure, was low, ranging from 10 to 30 %. The digestion patterns with pepsin proceeded rapidly in both the unmodified and modified samples. In all four cases, a highly resistant IgE-binding protein theMwof which was about 28 – 35 kD, was present. Within the physiological conditions, no new IgE binding epitopes were revealed, as demonstrated by immunoblot and CAP inhibition of the mugwort specific IgE binding. An important conclusion of this study is the stability of the modified derivatives in the gastrointestinal tract of patients, within physiological conditions. The means that they are suitable for use inmuch higher concentrations in local forms of immunotherapy than unmodified ones.

Iron oxide nanotube layer fabricated with electrostatic anodization for heterogeneous Fenton like reaction

Energy Technology Data Exchange (ETDEWEB)

Jang, Jun-Won; Park, Jae-Woo, E-mail: jaewoopark@hanyang.ac.kr

2014-05-01

Highlights: • Iron oxide nanotube was newly fabricated with potentiostatic anodization of Fe{sup 0} foil. • Cyanide was oxidized more effectively with the iron oxide nanotube and H{sub 2}O{sub 2}, resulting in fast oxidation of cyanide and cyanate. • This nanotube of Fe{sub 2}O{sub 3} on Fe{sup 0} metal can replace conventional particulate iron catalysts in Fenton-like processes. - Abstract: Iron oxide nanotubes (INT) were fabricated with potentiostatic anodization of zero valent iron foil in 1 M Na{sub 2}SO{sub 4} containing 0.5 wt% NH{sub 4}F electrolyte, holding the potential at 20, 40, and 60 V for 20 min, respectively. Field emission scanning electron microscopy and X-ray diffractometry were used to evaluate the morphology and crystalline structure of the INT film. The potential of 40 V for 20 min was observed to be optimal to produce an optimal catalytic film. Cyanide dissolved in water was degraded through the Fenton-like reaction using the INT film with hydrogen peroxide (H{sub 2}O{sub 2}). In case of INT-40 V in the presence of H{sub 2}O{sub 2} 3%, the first-order rate constant was found to be 1.7 × 10{sup −2} min{sup −1}, and 1.2 × 10{sup −2} min{sup −1} with commercial hematite powder. Degradation of cyanide was much less with only H{sub 2}O{sub 2}. Therefore, this process proposed in this work can be an excellent alternative to traditional catalysts for Fenton-like reaction.

Novel nanostructured materials to develop oxygen-sensitive films for optical sensors

International Nuclear Information System (INIS)

Fernandez-Sanchez, Jorge F.; Cannas, Rita; Spichiger, Stefan; Steiger, Rolf; Spichiger-Keller, Ursula E.

2006-01-01

Novel nanostructured materials, such as aluminum oxide (AlOOH), silicon oxide (SiO 2 ) or zirconium oxide (ZrO 2 ) embedded into PVA, were investigated as potential matrices to incorporate organometallic compounds (OMCs) for the development of optical oxygen-sensitive sensors which make use of the principle of luminescence quenching. In order to assess the benefits and drawbacks of the nanoporous material, the luminescence quantum yield and the Stern-Volmer constants were investigated and compared with the values shown for the same OMCs solubilized in polymer films (polystyrene). Referred to polymer films, the incorporation of the dyes into nanoporous membranes increased the Stern-Volmer constant by more than a factor of 100. Their response time was less than 1 s and the optode membranes were stable at room temperature for at least 9 months. Sterilization by autoclavation and gamma irradiation resulted in a marginal loss in activity. The photostability and sterilizability of the oxygen-sensitive membranes and the performance of the optodes with respect to of different types of metal oxides are discussed in the paper, as well as the influence of the total pore volume (TPV), the pore diameter (PD), the transparency of the film and the geometry of the pores. The OMCs used in this work were: ETH T -3003 (tris(4,7-bis(4-octylphenyl)-1,10-phenanthroline) ruthenium(II)), N-926 (bis(2-phenylpyridinyl)-N 4 ,N 4 ,N 4 ',N 4 '-tetramethyl-(4,4'-diamine-2,2'-bipyridine) iridium(III) chlorate), N-833 (tetrabutylammonium bis(isothiocyanate) bis(2-phenylpyridinyl)-iridium(III)) and N-837 (tetrabutylammonium bis(cyanate) bis(2-phenylpyridinyl)-iridium(III))

Theoretical Investigation of OCN(-) Charge Transfer Complexes in Condensed Phase Media: Spectroscopic Properties in Amorphous Ice

Science.gov (United States)

Park, Jin-Young; Woon, David E.

2004-01-01

Density functional theory (DFT) calculations of cyanate (OCN(-)) charge-transfer complexes were performed to model the "XCN" feature observed in interstellar icy grain mantles. OCN(-) charge-transfer complexes were formed from precursor combinations of HNCO or HOCN with either NH3 or H2O. Three different solvation strategies for realistically modeling the ice matrix environment were explored, including (1) continuum solvation, (2) pure DFT cluster calculations, and (3) an ONIOM DFT/PM3 cluster calculation. The model complexes were evaluated by their ability to reproduce seven spectroscopic measurements associated with XCN: the band origin of the OCN(-) asymmetric stretching mode, shifts in that frequency due to isotopic substitutions of C, N, O, and H, plus two weak features. The continuum solvent field method produced results consistent with some of the experimental data but failed to account for other behavior due to its limited capacity to describe molecular interactions with solvent. DFT cluster calculations successfully reproduced the available spectroscopic measurements very well. In particular, the deuterium shift showed excellent agreement in complexes where OCN(-) was fully solvated. Detailed studies of representative complexes including from two to twelve water molecules allowed the exploration of various possible solvation structures and provided insights into solvation trends. Moreover, complexes arising from cyanic or isocyanic acid in pure water suggested an alternative mechanism for the formation of OCN(-) charge-transfer complexes without the need for a strong base such as NH3 to be present. An extended ONIOM (B3LYP/PM3) cluster calculation was also performed to assess the impact of a more realistic environment on HNCO dissociation in pure water.

Design guidelines for high dimensional stability of CFRP optical bench

Science.gov (United States)

Desnoyers, Nichola; Boucher, Marc-André; Goyette, Philippe

2013-09-01

In carbon fiber reinforced plastic (CFRP) optomechanical structures, particularly when embodying reflective optics, angular stability is critical. Angular stability or warping stability is greatly affected by moisture absorption and thermal gradients. Unfortunately, it is impossible to achieve the perfect laminate and there will always be manufacturing errors in trying to reach a quasi-iso laminate. Some errors, such as those related to the angular position of each ply and the facesheet parallelism (for a bench) can be easily monitored in order to control the stability more adequately. This paper presents warping experiments and finite-element analyses (FEA) obtained from typical optomechanical sandwich structures. Experiments were done using a thermal vacuum chamber to cycle the structures from -40°C to 50°C. Moisture desorption tests were also performed for a number of specific configurations. The selected composite material for the study is the unidirectional prepreg from Tencate M55J/TC410. M55J is a high modulus fiber and TC410 is a new-generation cyanate ester designed for dimensionally stable optical benches. In the studied cases, the main contributors were found to be: the ply angular errors, laminate in-plane parallelism (between 0° ply direction of both facesheets), fiber volume fraction tolerance and joints. Final results show that some tested configurations demonstrated good warping stability. FEA and measurements are in good agreement despite the fact that some defects or fabrication errors remain unpredictable. Design guidelines to maximize the warping stability by taking into account the main dimensional stability contributors, the bench geometry and the optical mount interface are then proposed.

New Au-U deposit type in the weathering crust in tectonicmetasomatite zones of Pre-Cambrian shields

International Nuclear Information System (INIS)

Tarkhanov, A.

2014-01-01

Au-U mineralization is widely distributed in the tectonic-metasomatite zones of Pre-Cambrian shields (Aldan Shield, Ukraine Shield and others). The industrial ores are located only in several areas at depths of more than 150-300 m. Uranium mineralization is represented by uranotitnates and the gold mineralization by auriferous pyrite. The zone of weathering is present to the depth of 100-150 m. The feldspars are replaced by the clay minerals, carbonates are dissovled, sulfides are oxidized and the secondary minerals of uranium replace uranotitanates.The golden mineralization in the envelope of weathering is represented by the fine-grained native gold. The particle size is 40-50 nm. Uranium mineralization is in the form of relict brannerite, tuyamunite, torbernite, carnotite. The gold content is 1-2 g/t, and uranium content 0.01- 0.05% U. Ore bodies of gold and uranium are located inside the tectonic-metasomatite zones. The zones of maximum concentration of these metals may not coincide. The gold ore bodies have the length of hundreds meters and a thickness of 1-5 m. The vertical extent of the secondary Au-U mineralization is 100-150 m. 20 laboratory samples of ore from the weathered zone were tested by the method of heap leaching. The first stage is the uranium leach by diluted sulfuric acid. The second stage is the cyanation of gold and silver. The experimental data indicates leach rate of uranium 75%, gold 80-97%, silver 50-60%. Gold resources in the continous zone is estimated to be 80 t. Gold resources of the several other zones inside the area of 100 km 2 are estimated as 220 t. The heap leach process can be used for profitable development of the low-grade deposits. This method helps to increase the resources of gold and uranium. (author)

Understanding Strategy of Nitrate and Urea Assimilation in a Chinese Strain of Aureococcus anophagefferens through RNA-Seq Analysis

Science.gov (United States)

Dong, Hong-Po; Huang, Kai-Xuan; Wang, Hua-Long; Lu, Song-Hui; Cen, Jing-Yi; Dong, Yue-Lei

2014-01-01

Aureococcus anophagefferens is a harmful alga that dominates plankton communities during brown tides in North America, Africa, and Asia. Here, RNA-seq technology was used to profile the transcriptome of a Chinese strain of A. anophagefferens that was grown on urea, nitrate, and a mixture of urea and nitrate, and that was under N-replete, limited and recovery conditions to understand the molecular mechanisms that underlie nitrate and urea utilization. The number of differentially expressed genes between urea-grown and mixture N-grown cells were much less than those between urea-grown and nitrate-grown cells. Compared with nitrate-grown cells, mixture N-grown cells contained much lower levels of transcripts encoding proteins that are involved in nitrate transport and assimilation. Together with profiles of nutrient changes in media, these results suggest that A. anophagefferens primarily feeds on urea instead of nitrate when urea and nitrate co-exist. Furthermore, we noted that transcripts upregulated by nitrate and N-limitation included those encoding proteins involved in amino acid and nucleotide transport, degradation of amides and cyanates, and nitrate assimilation pathway. The data suggest that A. anophagefferens possesses an ability to utilize a variety of dissolved organic nitrogen. Moreover, transcripts for synthesis of proteins, glutamate-derived amino acids, spermines and sterols were upregulated by urea. Transcripts encoding key enzymes that are involved in the ornithine-urea and TCA cycles were differentially regulated by urea and nitrogen concentration, which suggests that the OUC may be linked to the TCA cycle and involved in reallocation of intracellular carbon and nitrogen. These genes regulated by urea may be crucial for the rapid proliferation of A. anophagefferens when urea is provided as the N source. PMID:25338000

Simultaneous oxidation of cyanide and thiocyanate at high pressure and temperature

Energy Technology Data Exchange (ETDEWEB)

Oulego, Paula; Collado, Sergio; Laca, Adriana; Díaz, Mario, E-mail: mariodiaz@uniovi.es

2014-09-15

Graphical abstract: - Highlights: • The oxidation rate of SCN{sup −} was greatly enhanced by the presence of CN{sup −}. • The degradation of mixtures was significantly affected by temperature and pressure. • A free-radical pathway was proposed, CN{sup −} and CNO{sup −} being the reaction intermediates. • The principal reaction products were found to be HCOO{sup −}, NH{sub 3} and SO{sub 4}{sup 2−}. • One of the parallel routes gives the found products and the other N{sub 2}, CO{sub 2} and H{sub 2}. - Abstract: Thiocyanate and cyanide are important contaminants that frequently appear mixed in industrial effluents. In this work the wet oxidation of mixtures of both compounds, simulating real compositions, was carried out in a semi-batch reactor at temperature between 393 K and 483 K and pressure in the range of 2.0–8.0 MPa. The presence of cyanide (3.85 mM) increased the kinetic constant of thiocyanate degradation by a factor of 1.6, in comparison to the value obtained for the individual degradation of thiocyanate, (5.95 ± 0.05) × 10{sup −5} s{sup −1}. On the other hand, the addition of thiocyanate (0.98 mM) decreased the degradation rate of cyanide by 16%. This revealed the existence of synergistic and inhibitory phenomena between these two species. Additionally, cyanide was identified as an intermediate in the oxidation of thiocyanate, and formate, ammonia and sulfate were found to be the main reaction products. Taking into account the experimental data, a reaction pathway for the simultaneous wet oxidation of both pollutants was proposed. Two parallel reactions beginning from cyanate as intermediate were considered, one yielding ammonia and formate and the other giving carbon dioxide and nitrogen as final products.

DNA microarray analysis of the cyanotroph Pseudomonas pseudoalcaligenes CECT5344 in response to nitrogen starvation, cyanide and a jewelry wastewater.

Science.gov (United States)

Luque-Almagro, V M; Escribano, M P; Manso, I; Sáez, L P; Cabello, P; Moreno-Vivián, C; Roldán, M D

2015-11-20

Pseudomonas pseudoalcaligenes CECT5344 is an alkaliphilic bacterium that can use cyanide as nitrogen source for growth, becoming a suitable candidate to be applied in biological treatment of cyanide-containing wastewaters. The assessment of the whole genome sequence of the strain CECT5344 has allowed the generation of DNA microarrays to analyze the response to different nitrogen sources. The mRNA of P. pseudoalcaligenes CECT5344 cells grown under nitrogen limiting conditions showed considerable changes when compared against the transcripts from cells grown with ammonium; up-regulated genes were, among others, the glnK gene encoding the nitrogen regulatory protein PII, the two-component ntrBC system involved in global nitrogen regulation, and the ammonium transporter-encoding amtB gene. The protein coding transcripts of P. pseudoalcaligenes CECT5344 cells grown with sodium cyanide or an industrial jewelry wastewater that contains high concentration of cyanide and metals like iron, copper and zinc, were also compared against the transcripts of cells grown with ammonium as nitrogen source. This analysis revealed the induction by cyanide and the cyanide-rich wastewater of four nitrilase-encoding genes, including the nitC gene that is essential for cyanide assimilation, the cyanase cynS gene involved in cyanate assimilation, the cioAB genes required for the cyanide-insensitive respiration, and the ahpC gene coding for an alkyl-hydroperoxide reductase that could be related with iron homeostasis and oxidative stress. The nitC and cynS genes were also induced in cells grown under nitrogen starvation conditions. In cells grown with the jewelry wastewater, a malate quinone:oxidoreductase mqoB gene and several genes coding for metal extrusion systems were specifically induced. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.

Synthesis and study of nano-structured cellulose acetate based materials for energy applications

International Nuclear Information System (INIS)

Fischer, F.

2006-12-01

Nano-structured materials have unique properties (high exchange areas, containment effect) because of their very low characteristic dimensions. The elaboration way set up in this PhD work consists in applying the classical processes for the preparation of aerogel-like materials (combining sol-gel synthesis and CO 2 supercritical extraction) to cellulosic polymers. This work is divided in four parts: a literature review, the presentation and the study of the chemical synthesis that leads to cellulose acetate-based aerogel, the characterizations (chemical, structural and thermal) of the elaborated nano-materials, and finally the study of the first carbons that were obtained after pyrolysis of the organic matrix. The formulations and the sol-gel protocol lead to chemical gels by crosslinking cellulose acetate using a poly-functional iso-cyanate. The dry materials obtained after solvent extraction with supercritical CO 2 are nano-structured and mainly meso-porous. Correlations between chemical synthesis parameters (reagent concentrations, crosslinking rate and degree of polymerisation) and porous properties (density, porosity, pore size distribution) were highlighted thanks to structural characterizations. An ultra-porous reference aerogel, with a density equals to 0,245 g.cm -3 together with a meso-porous volume of 3,40 cm 3 .g -1 was elaborated. Once in granular shape, this material has a thermal conductivity of 0,029 W.m -1 .K -1 . In addition, carbon materials produced after pyrolysis of the organic matrix and after grinding are nano-structured and nano-porous, even if important structural modifications have occurred during the carbonization process. The elaborated materials are evaluated for applications in relation with energy such as thermal insulation (organic aerogels) but also for energy conversion and storage through electrochemical way (carbon aerogels). (author)

Identification of homemade inorganic explosives by ion chromatographic analysis of post-blast residues.

Science.gov (United States)

Johns, Cameron; Shellie, Robert A; Potter, Oscar G; O'Reilly, John W; Hutchinson, Joseph P; Guijt, Rosanne M; Breadmore, Michael C; Hilder, Emily F; Dicinoski, Greg W; Haddad, Paul R

2008-02-29

Anions and cations of interest for the post-blast identification of homemade inorganic explosives were separated and detected by ion chromatographic (IC) methods. The ionic analytes used for identification of explosives in this study comprised 18 anions (acetate, benzoate, bromate, carbonate, chlorate, chloride, chlorite, chromate, cyanate, fluoride, formate, nitrate, nitrite, perchlorate, phosphate, sulfate, thiocyanate and thiosulfate) and 12 cations (ammonium, barium(II), calcium(II), chromium(III), ethylammonium, magnesium(II), manganese(II), methylammonium, potassium(I), sodium(I), strontium(II), and zinc(II)). Two IC separations are presented, using suppressed IC on a Dionex AS20 column with potassium hydroxide as eluent for anions, and non-suppressed IC for cations using a Dionex SCS 1 column with oxalic acid/acetonitrile as eluent. Conductivity detection was used in both cases. Detection limits for anions were in the range 2-27.4ppb, and for cations were in the range 13-115ppb. These methods allowed the explosive residue ions to be identified and separated from background ions likely to be present in the environment. Linearity (over a calibration range of 0.05-50ppm) was evaluated for both methods, with r(2) values ranging from 0.9889 to 1.000. Reproducibility over 10 consecutive injections of a 5ppm standard ranged from 0.01 to 0.22% relative standard deviation (RSD) for retention time and 0.29 to 2.16%RSD for peak area. The anion and cation separations were performed simultaneously by using two Dionex ICS-2000 chromatographs served by a single autoinjector. The efficacy of the developed methods was demonstrated by analysis of residue samples taken from witness plates and soils collected following the controlled detonation of a series of different inorganic homemade explosives. The results obtained were also confirmed by parallel analysis of the same samples by capillary electrophoresis (CE) with excellent agreement being obtained.

Synthesis and study of nano-structured cellulose acetate based materials for energy applications; Synthese et etude de materiaux nanostructures a base d'acetate de cellulose pour applications energetiques

Energy Technology Data Exchange (ETDEWEB)

Fischer, F

2006-12-15

Nano-structured materials have unique properties (high exchange areas, containment effect) because of their very low characteristic dimensions. The elaboration way set up in this PhD work consists in applying the classical processes for the preparation of aerogel-like materials (combining sol-gel synthesis and CO{sub 2} supercritical extraction) to cellulosic polymers. This work is divided in four parts: a literature review, the presentation and the study of the chemical synthesis that leads to cellulose acetate-based aerogel, the characterizations (chemical, structural and thermal) of the elaborated nano-materials, and finally the study of the first carbons that were obtained after pyrolysis of the organic matrix. The formulations and the sol-gel protocol lead to chemical gels by crosslinking cellulose acetate using a poly-functional iso-cyanate. The dry materials obtained after solvent extraction with supercritical CO{sub 2} are nano-structured and mainly meso-porous. Correlations between chemical synthesis parameters (reagent concentrations, crosslinking rate and degree of polymerisation) and porous properties (density, porosity, pore size distribution) were highlighted thanks to structural characterizations. An ultra-porous reference aerogel, with a density equals to 0,245 g.cm{sup -3} together with a meso-porous volume of 3,40 cm{sup 3}.g{sup -1} was elaborated. Once in granular shape, this material has a thermal conductivity of 0,029 W.m{sup -1}.K{sup -1}. In addition, carbon materials produced after pyrolysis of the organic matrix and after grinding are nano-structured and nano-porous, even if important structural modifications have occurred during the carbonization process. The elaborated materials are evaluated for applications in relation with energy such as thermal insulation (organic aerogels) but also for energy conversion and storage through electrochemical way (carbon aerogels). (author)

Ames Infusion Stories for NASA Annual Technology Report: Development of an Ablative 3D Quartz / Cyanate Ester Composite Multi-Functional Material for the Orion Spacecraft Compression Pad

Science.gov (United States)

Smith, Brandon; Jan, Darrell Leslie; Venkatapathy, Ethiraj

2015-01-01

Vehicles re-entering Earth's atmosphere require protection from the heat of atmospheric friction. The Orion Multi-Purpose Crew Vehicle (MPCV) has more demanding thermal protection system (TPS) requirements than the Low Earth Orbit (LEO) missions, especially in regions where the structural load passes through. The use of 2-dimensional laminate materials along with a metal insert, used in EFT1 flight test for the compression pad region, are deemed adequate but cannot be extended for Lunar return missions.

Chemical structure of carbamoylating groups and their relationship to bone marrow toxicity and antiglioma activity of bifunctionally alkylating and carbamoylating nitrosoureas.

Science.gov (United States)

Ali-Osman, F; Giblin, J; Berger, M; Murphy, M J; Rosenblum, M L

1985-09-01

Although the antitumor effects of chloroethylnitrosoureas have been shown to be due primarily to DNA-DNA cross-linking by the alkylating moieties of these agents, the basis of the often accompanying bone marrow toxicity has been more controversial. We report on the relative bone marrow toxicity of four model nitrosoureas with different alkylating and carbamoylating activities: 1,3-bis(2-chloroethyl)-1-nitrosourea; 1,3-bis(trans-4-hydroxycyclohexyl)-1-nitrosourea; chlorozotozin, (2-[3-(2-chloroethyl)-3 -nitrosoureido]-2-deoxy-D-glucopyranose); and -3-(beta-D-glucopyranosyl)-1-nitrosourea. Inhibitions of DNA, RNA, and protein synthesis in murine bone marrow cells and of colony growth of myeloid precursor cells (granulocyte-macrophage colony-forming units) were used as in vitro end points of myelotoxicity. Further, we determined the antiglioma activity of the four nitrosoureas on two human gliomas in a clonogenic tumor cell assay and studied the effect of the non-nitrosourea carbamoylators potassium cyanate, chloroethyl isocyanate, cyclohexyl isocyanate, ethyl isocyanate, and ethyl isothiocyanate on granulocyte-macrophage colony-forming units. The results show that, at equivalent drug exposures, clonogenic glioma cell kill was significant and comparative for 1,3-bis(2-chloroethyl)-1-nitrosourea, 1-(2-chloroethyl)-3-(beta-D-glucopyranosyl)-1-nitrosourea, and chlorozotocin; 1,3-bis(trans-4-hydroxycyclohexyl)-1-nitrosourea showed little activity. In contrast, granulocyte-macrophage colony-forming unit toxicity was low with chlorozotocin and 1-(2-chloroethyl)-3-(beta-D-glucopyranosyl)-1-nitrosourea and very high with 1,3-bis(2-chloroethyl)-1-nitrosourea and 1,3-bis(trans-4-hydroxycyclohexyl)-1-nitrosourea. Of the isocyanates, bone marrow toxicity was highest with chloroethyl isocyanate and cyclohexyl isocyanate, intermediate with ethyl isocyanate, and lowest with KOCN and ethyl isothiocyanate. Our results indicate that (a) bifunctional alkylation is essential for

Direct approaches to nitriles via highly efficient nitrogenation strategy through C-H or C-C bond cleavage.

Science.gov (United States)

Wang, Teng; Jiao, Ning

2014-04-15

Because of the importance of nitrogen-containing compounds in chemistry and biology, organic chemists have long focused on the development of novel methodologies for their synthesis. For example, nitrogen-containing compounds show up within functional materials, as top-selling drugs, and as bioactive molecules. To synthesize these compounds in a green and sustainable way, researchers have focused on the direct functionalization of hydrocarbons via C-H or C-C bond cleavage. Although researchers have made significant progress in the direct functionalization of simple hydrocarbons, direct C-N bond formation via C-H or C-C bond cleavage remains challenging, in part because of the unstable character of some N-nucleophiles under oxidative conditions. The nitriles are versatile building blocks and precursors in organic synthesis. Recently, chemists have achieved the direct C-H cyanation with toxic cyanide salts in the presence of stoichiometric metal oxidants. In this Account, we describe recent progress made by our group in nitrile synthesis. C-H or C-C bond cleavage is a key process in our strategy, and azides or DMF serve as the nitrogen source. In these reactions, we successfully realized direct nitrile synthesis using a variety of hydrocarbon groups as nitrile precursors, including methyl, alkenyl, and alkynyl groups. We could carry out C(sp(3))-H functionalization on benzylic, allylic, and propargylic C-H bonds to produce diverse valuable synthetic nitriles. Mild oxidation of C═C double-bonds and C≡C triple-bonds also produced nitriles. The incorporation of nitrogen within the carbon skeleton typically involved the participation of azide reagents. Although some mechanistic details remain unclear, studies of these nitrogenation reactions implicate the involvement of a cation or radical intermediate, and an oxidative rearrangement of azide intermediate produced the nitrile. We also explored environmentally friendly oxidants, such as molecular oxygen, to make our

Nitrogen reduction and functionalization by a multimetallic uranium nitride complex

Science.gov (United States)

Falcone, Marta; Chatelain, Lucile; Scopelliti, Rosario; Živković, Ivica; Mazzanti, Marinella

2017-07-01

Molecular nitrogen (N2) is cheap and widely available, but its unreactive nature is a challenge when attempting to functionalize it under mild conditions with other widely available substrates (such as carbon monoxide, CO) to produce value-added compounds. Biological N2 fixation can do this, but the industrial Haber-Bosch process for ammonia production operates under harsh conditions (450 degrees Celsius and 300 bar), even though both processes are thought to involve multimetallic catalytic sites. And although molecular complexes capable of binding and even reducing N2 under mild conditions are known, with co-operativity between metal centres considered crucial for the N2 reduction step, the multimetallic species involved are usually not well defined, and further transformation of N2-binding complexes to achieve N-H or N-C bond formation is rare. Haber noted, before an iron-based catalyst was adopted for the industrial Haber-Bosch process, that uranium and uranium nitride materials are very effective heterogeneous catalysts for ammonia production from N2. However, few examples of uranium complexes binding N2 are known, and soluble uranium complexes capable of transforming N2 into ammonia or organonitrogen compounds have not yet been identified. Here we report the four-electron reduction of N2 under ambient conditions by a fully characterized complex with two UIII ions and three K+ centres held together by a nitride group and a flexible metalloligand framework. The addition of H2 and/or protons, or CO to the resulting complex results in the complete cleavage of N2 with concomitant N2 functionalization through N-H or N-C bond-forming reactions. These observations establish that a molecular uranium complex can promote the stoichiometric transformation of N2 into NH3 or cyanate, and that a flexible, electron-rich, multimetallic, nitride-bridged core unit is a promising starting point for the design of molecular complexes capable of cleaving and functionalizing N2 under

Effect of substituting arginine and lysine with alanine on antimicrobial activity and the mechanism of action of a cationic dodecapeptide (CL(14-25)), a partial sequence of cyanate lyase from rice.

Science.gov (United States)

Taniguchi, Masayuki; Takahashi, Nobuteru; Takayanagi, Tomohiro; Ikeda, Atsuo; Ishiyama, Yohei; Saitoh, Eiichi; Kato, Tetsuo; Ochiai, Akihito; Tanaka, Takaaki

2014-01-01

The antimicrobial activity of analogs obtained by substituting arginine and lysine in CL(14-25), a cationic α-helical dodecapeptide, with alanine against Porphyromonas gingivalis, a periodontal pathogen, varied significantly depending on the number and position of cationic amino acids. The alanine-substituted analogs had no hemolytic activity, even at a concentration of 1 mM. The antimicrobial activities of CL(K20A) and CL(K20A, K25A) were 3.8-fold and 9.1-fold higher, respectively, than that of CL(14-25). The antimicrobial activity of CL(R15A) was slightly lower than that of CL(14-25), suggesting that arginine at position 15 is not essential but is important for the antimicrobial activity. The experiments in which the alanine-substituted analogs bearing the replacement of arginine at position 24 and/or lysine at position 25 were used showed that arginine at position 24 was crucial for the antimicrobial activity whenever lysine at position 25 was substituted with alanine. Helical wheel projections of the alanine-substituted analogs indicate that the hydrophobicity in the vicinity of leucine at position 16 and alanines at positions 18 and/or 21 increased by substituting lysine at positions 20 and 25 with alanine, respectively. The degrees of diSC3 -5 release from P. gingivalis cells and disruption of GUVs induced by the alanine-substituted analogs with different positive charges were not closely related to their antimicrobial activities. The enhanced antimicrobial activities of the alanine-substituted analogs appear to be mainly attributable to the changes in properties such as hydrophobicity and amphipathic propensity due to alanine substitution and not to their extents of positive charge (cationicity). Copyright © 2013 Wiley Periodicals, Inc.

Pseudomonas pseudoalcaligenes CECT5344, a cyanide-degrading bacterium with by-product (polyhydroxyalkanoates) formation capacity.

Science.gov (United States)

Manso Cobos, Isabel; Ibáñez García, María Isabel; de la Peña Moreno, Fernando; Sáez Melero, Lara Paloma; Luque-Almagro, Víctor Manuel; Castillo Rodríguez, Francisco; Roldán Ruiz, María Dolores; Prieto Jiménez, María Auxiliadora; Moreno Vivián, Conrado

2015-06-10

Cyanide is one of the most toxic chemicals produced by anthropogenic activities like mining and jewelry industries, which generate wastewater residues with high concentrations of this compound. Pseudomonas pseudoalcaligenes CECT5344 is a model microorganism to be used in detoxification of industrial wastewaters containing not only free cyanide (CN(-)) but also cyano-derivatives, such as cyanate, nitriles and metal-cyanide complexes. Previous in silico analyses suggested the existence of genes putatively involved in metabolism of short chain length (scl-) and medium chain length (mcl-) polyhydroxyalkanoates (PHAs) located in three different clusters in the genome of this bacterium. PHAs are polyesters considered as an alternative of petroleum-based plastics. Strategies to optimize the bioremediation process in terms of reducing the cost of the production medium are required. In this work, a biological treatment of the jewelry industry cyanide-rich wastewater coupled to PHAs production as by-product has been considered. The functionality of the pha genes from P. pseudoalcaligenes CECT5344 has been demonstrated. Mutant strains defective in each proposed PHA synthases coding genes (Mpha(-), deleted in putative mcl-PHA synthases; Spha(-), deleted in the putative scl-PHA synthase) were generated. The accumulation and monomer composition of scl- or mcl-PHAs in wild type and mutant strains were confirmed by gas chromatography-mass spectrometry (GC-MS). The production of PHAs as by-product while degrading cyanide from the jewelry industry wastewater was analyzed in batch reactor in each strain. The wild type and the mutant strains grew at similar rates when using octanoate as the carbon source and cyanide as the sole nitrogen source. When cyanide was depleted from the medium, both scl-PHAs and mcl-PHAs were detected in the wild-type strain, whereas scl-PHAs or mcl-PHAs were accumulated in Mpha(-) and Spha(-), respectively. The scl-PHAs were identified as homopolymers of 3

Avaliação dos produtos de emissão a partir da pirólise de assentos automotivos feitos de fibra de coco e de espuma de poliuretano Evaluation of emission products from pyrolysis of car seats made of coir fiber and of polyurethane foam

Directory of Open Access Journals (Sweden)

Vera Lúcia Pimentel Salazar

2005-06-01

Full Text Available O presente trabalho visa comparar assentos automobilísticos feitos de manta de fibra de coco com látex (MFCL em relação à espuma de poliuretano (EPU, avaliando a possibilidade do primeiro substituir o segundo, devido ao fato da fibra natural ser biodegradável e renovável. Esses materiais foram submetidos à análise termogravimétrica (TGA, pirólise e análise dos produtos de pirólise por cromatografia gasosa acoplada ao espectrômetro de massa. Verificou-se que a pirólise a 800ºC apresentou grande número de gases tóxicos, e comparando os materiais observou-se que a EPU emitiu gases mais tóxicos na combustão que aqueles produzidos pelos outros materiais sob as mesmas condições, tais como o cianeto de hidrogênio e compostos de nitrila. Quanto às análises de TGA, verificou-se que acima de 270ºC inicia-se a degradação térmica de todos materiais.The objective of this work is to compare automobile seats made of coconut fiber mats with latex (MFCL versus polyurethane foam (EPU, evaluating the possibility of the first replace the second due to the fact of the renewability and biodegradability of the natural fiber. These materials were submitted to analysis of the pyrolysis by-products was made, using the gas chromatography coupled with mass spectrometer. Also, it was made thermogravimetric analysis. It was observed that at 800ºC the materials presented a higher number of toxic vapors, and it was noticed that all components that were present in this pyrolysis of coir fiber and of MFCL were also found in the EPU, and even other components as hydrogen cyanate and nitrile compound were found in EPU pyrolysis. Therefore, it can be stated that pyrolysis by-products at 800ºC of EPU are much more hazardous than those produced by the natural materials at the same conditions. Regarding the thermal analysis, it was observed that above 270ºC begins the thermal decomposition of all the studied materials.

Synthesis, structure, spectroscopy and redox energetics of a series of uranium(4) mixed-ligand metallocene complexes

Energy Technology Data Exchange (ETDEWEB)

Thomson, R.K.; Scott, B.L.; Morris, D.E.; Kiplinger, J.L. [Los Alamos National Laboratory, Los Alamos, NM (United States)

2010-06-15

A series of uranium(IV) mixed-ligand amide-halide/pseudo-halide complexes (C{sub 5}Me{sub 5}){sub 2}U[N(SiMe{sub 3}){sub 2}](X) (X = F (1), Cl (2), Br (3), I (4), N{sub 3} (5), NCO (6)), (C{sub 5}Me{sub 5}){sub 2}U(NPh{sub 2})(X) (X = Cl (7), N{sub 3} (8)), and (C{sub 5}Me{sub 5}){sub 2}U[N(Ph)(SiMe{sub 3})](X) (X Cl (9), N{sub 3} (10)) have been prepared by one electron oxidation of the corresponding uranium(III) amide precursors using either copper halides, silver iso-cyanate, or triphenylphosphine gold(I)azide. Agostic U---H-C interactions and {eta}{sub 3}-(N,C,C') coordination are observed for these complexes in both the solid-state and solution. There is a linear correlation between the chemical shift values of the C{sub 5}Me{sub 5} ligand protons in the {sup 1}H NMR spectra and the U(IV)/U(III) reduction potentials of the (C{sub 5}Me{sub 5}){sub 2}U[N(SiMe{sub 3}){sub 2}](X) complexes, suggesting that there is a common origin, that is overall {sigma}-/{pi}-donation from the ancillary (X) ligand to the metal, contributing to both observables. Optical spectroscopy of the series of complexes 1-6 is dominated by the (C{sub 5}Me{sub 5}){sub 2}U[N(SiMe{sub 3}){sub 2}] core, with small variations derived from the identity of the halide/pseudo-halide. The considerable {pi}-donating ability of the fluoride ligand is reflected in both the electrochemistry and UV-visible-NIR spectroscopic behavior of the fluoride complex (C{sub 5}Me{sub 5}){sub 2}U[N(SiMe{sub 3}){sub 2}](F) (1). The syntheses of the new trivalent uranium amide complex, (C{sub 5}Me{sub 5}){sub 2}U[N(Ph)(SiMe{sub 3})](THF), and the two new weakly-coordinating electrolytes, [Pr{sub 4}N][B{l_brace}3,5-(CF{sub 3}){sub 2}C{sub 6}H{sub 3{r_brace}4}] and [Pr{sub 4}N][B(C{sub 6}F{sub 5}){sub 4}], are also reported. (authors)

Highly specific and rapid immuno-fluorescent visualization and detection of E. coli O104:H4 with protein-A coated magnetic beads based LST-MUG assay.

Science.gov (United States)

Barizuddin, Syed; Balakrishnan, Baskar; Stringer, R Cody; Dweik, Majed

2015-08-01

A method combining immunomagnetic separation and fluorescent sensing was developed to detect Escherichia coli (E. coli) O104:H4. The antibody specific to E. coli O104:H4 was immobilized on protein A-coated magnetic beads. This protein-A-anti E. coli O104:H4 complex was used to bind Fluorescein IsoThioCyanate (FITC) labeled E. coli O104:H4 antigen (whole cell) on it. The goal was to achieve a fluorescently detectable protein-A-anti E. coli O104:H4-E. coli O104:H4 complex on the magnetic beads. Fluorescent microscopy was used to image the magnetic beads. The resulting fluorescence on the beads was due to the FITC labeled antigen binding on the protein-A-anti E. coli O104:H4 immobilized magnetic beads. This visually proves the antigen-antibody binding. The fluorescent imaging results were obtained in 2 h if the minimum available bacteria in the sample were at least 10(5) CFU/ml. If no fluorescence was observed on the magnetic beads during fluorescent imaging, it indicates the bacterial concentration in the sample to be too low for it to have bound to the magnetic beads and hence no detection was possible. To detect bacterial concentration less than 10(5) CFU/ml in the sample, an additional step was required for detection. The magnetic bead complex was added to the LST-MUG (lauryl sulfate tryptose-4-methylumbelliferyl-β-D-glucuronide), a signaling reporter. The E. coli O104:H4 grows in LST-MUG and releases β-glucuronidase enzyme. This enzyme cleaves the MUG substrate that produces 4-methylumbelliferone, a highly fluorescent species. This fluorescence was detected using a spectrofluorometer. The emission peak in the fluorescent spectrum was found to be at 450 nm. The lower and upper detection range for this LST-MUG assay was found to be 2.05×10(5)-4.09×10(8) CFU/ml. The results for the LST-MUG assay for concentrations below 10(5) CFU/ml were ascertained in 8h. The advantages of this technique include the specific detection of bacteria without an enrichment step and

Identification of inorganic improvised explosive devices by analysis of postblast residues using portable capillary electrophoresis instrumentation and indirect photometric detection with a light-emitting diode.

Science.gov (United States)

Hutchinson, Joseph P; Evenhuis, Christopher J; Johns, Cameron; Kazarian, Artaches A; Breadmore, Michael C; Macka, Miroslav; Hilder, Emily F; Guijt, Rosanne M; Dicinoski, Greg W; Haddad, Paul R

2007-09-15

A commercial portable capillary electrophoresis (CE) instrument has been used to separate inorganic anions and cations found in postblast residues from improvised explosive devices (IEDs) of the type used frequently in terrorism attacks. The purpose of this analysis was to identify the type of explosive used. The CE instrument was modified for use with an in-house miniaturized light-emitting diode (LED) detector to enable sensitive indirect photometric detection to be employed for the detection of 15 anions (acetate, benzoate, carbonate, chlorate, chloride, chlorite, cyanate, fluoride, nitrate, nitrite, perchlorate, phosphate, sulfate, thiocyanate, thiosulfate) and 12 cations (ammonium, monomethylammonium, ethylammonium, potassium, sodium, barium, strontium, magnesium, manganese, calcium, zinc, lead) as the target analytes. These ions are known to be present in postblast residues from inorganic IEDs constructed from ammonium nitrate/fuel oil mixtures, black powder, and chlorate/perchlorate/sugar mixtures. For the analysis of cations, a blue LED (470 nm) was used in conjunction with the highly absorbing cationic dye, chrysoidine (absorption maximum at 453 nm). A nonaqueous background electrolyte comprising 10 mM chrysoidine in methanol was found to give greatly improved baseline stability in comparison to aqueous electrolytes due to the increased solubility of chrysoidine and its decreased adsorption onto the capillary wall. Glacial acetic acid (0.7% v/v) was added to ensure chrysoidine was protonated and to enhance separation selectivity by means of complexation with transition metal ions. The 12 target cations were separated in less than 9.5 min with detection limits of 0.11-2.30 mg/L (calculated at a signal-to-noise ratio of 3). The anions separation system utilized a UV LED (370 nm) in conjunction with an aqueous chromate electrolyte (absorption maximum at 371 nm) consisting of 10 mM chromium(VI) oxide and 10 mM sodium chromate, buffered with 40 mM tris

Chemistry and the iron - only hydrogenase

International Nuclear Information System (INIS)

Tard, C.; Razavet, M.; Liu, X.; Ibrahim, S.; Pickett, Ch.

2005-01-01

Complete text of publication follows: Chemistry related to the hydrogenases is developing very rapidly and providing some informative insights into how the biological systems might function. Although still very much at a blue skies stage, there is some prospect for the design of artificial assemblies, materials and devices with technological application for hydrogen production/uptake provided robust system can be designed with low over potentials for hydrogen/proton interconversion (1). The iron-only hydrogenase possesses a peculiar di-iron unit coordinated by CO and CN, ligands which are normally associated with poisoning biological function. This sub-site unit is attached to a [4Fe4S] cubane center to form the catalytic site of the hydrogenase which is known as the 'H-cluster'. The synthesis of artificial sub-sites will first be described together with how their structures, spectroscopy and reactivity provides some key insights into the natural system viz. unprecedented bridging carbonyl and Fe(I) motifs in biology (2-4). How we have approached putting together the entire iron-sulfur framework of the H-cluster will then be described together with its electron-transfer and electrocatalytic properties (4). Finally, I will describe some early work on how we are beginning to incorporate structural motifs of the active-site into conducting polymer matrices, how they function as (albeit poor) electrocatalysts for hydrogen evolution, and where we see the way ahead. (1)The Chemistry and the Hydrogenases. D.J. Evans and C.J. Pickett, Chem. Soc. Rev., 32, 268-275, 2003; (2)Electron-Transfer at a Di-thiolate-Bridged Di-Iron Assembly; Electrocatalytic Hydrogen Evolution. S.J. Borg, T. Behrsing and S.P. Best, M. Ravazet, X. Liu and C.J. Pickett, J Amer. Chem. Soc., 2004, 126, 509-533; (3) Dissecting the intimate mechanism of cyanation of [Fe2S3] complexes related to the active site of all-iron hydrogenases by DFT analysis of energetics, transition states, intermediates and

The fate of cyanide in leach wastes at gold mines: An environmental perspective

International Nuclear Information System (INIS)

Johnson, Craig A.

2015-01-01

Highlights: • This paper reviews the fate of cyanide in mineral processing wastes at gold mines. • Ore leaching produces numerous cyanide-containing species besides the gold complex. • Many cyanide species are eliminated or sequestered naturally over time. • Sequestered cyanide can be remobilized if conditions change. • Toxicity of released solutions can be reduced by photolytic reactions or offgassing. - Abstract: This paper reviews the basic chemistry of cyanide, methods by which cyanide can be analyzed, and aspects of cyanide behavior that are most relevant to environmental considerations at mineral processing operations associated with gold mines. The emphasis is on research results reported since 1999 and on data gathered for a series of U.S. Geological Survey studies that began in the late 1990s. Cyanide is added to process solutions as the CN − anion, but ore leaching produces numerous other cyanide-containing and cyanide-related species in addition to the desired cyanocomplex of gold. These can include hydrogen cyanide (HCN); cyanometallic complexes of iron, copper, zinc, nickel, and many other metals; cyanate (CNO − ); and thiocyanate (SCN − ). The fate of these species in solid wastes and residual process solutions that remain once gold recovery activities are terminated and in any water that moves beyond the ore processing facility dictates the degree to which cyanide poses a risk to aquatic organisms and aquatic-dependent organisms in the local environment. Cyanide-containing and cyanide-related species are subject to attenuation mechanisms that lead to dispersal to the atmosphere, chemical transformation to other carbon and nitrogen species, or sequestration as cyanometallic precipitates or adsorbed species on mineral surfaces. Dispersal to the atmosphere and chemical transformation amount to permanent elimination of cyanide, whereas sequestration amounts to storage of cyanide in locations from which it can potentially be remobilized by

Characterization of the radiation resistance of ITER-relevant and innovative fiber composites for the ITER magnet system

International Nuclear Information System (INIS)

Bittner-Rohrhofer, K.

2003-06-01

. The combination of high quality cyanate ester resins with poliymides- and bismaleinimides led to materials with a higher radiation-resistance, material strength and low swelling as required by the ITER design criteria. A significant damage of these materials is expected only at a neutron fluence of 5x1022 m-2 (E620.1 MeV). Alternative ceramic and hybrid systems would simplify the insulation procedure due to their good high temperature resistance. The nature of the inorganic/organic matrix compositions leads to a systematic decrease of the interlaminar shear behavior with increasing dose level, while the results on their ultimate tensile strength meet the requirements. In particular, the strength of pure ceramics remains almost constant in the range from 1x1021 to 5x1022 m-2 (E620.1 MeV), but the materials are not relevant for the ITER fusion device for various reasons. (author)

Decarbonylative Cross-Couplings: Nickel Catalyzed Functional Group Interconversion Strategies for the Construction of Complex Organic Molecules

KAUST Repository

Guo, Lin; Rueping, Magnus

2018-01-01

The utilization of carboxylic acid esters as electrophiles in metal-catalyzed cross-coupling reactions is increasingly popular, as environmentally friendly and readily available ester derivatives can be powerful alternatives to the commonly used organohalides. However, key challenges associated with the use of these chemicals remain to be addressed, including the stability of ester substrates and the high energy barrier associated with their oxidative addition to low-valent metal species. Due to recent developments in nickel catalysis that make it easier to perform oxidative additions, chemists have become interested in applying less reactive electrophiles as coupling counterparts in nickel-catalyzed transformations. Hence, our group and others have independently investigated various ester group substitutions and functionalizations enabled by nickel catalysis. Such methods are of great interest as they enable the exchange of ester groups, which can be used as directing groups in metal-catalyzed C-H functionalizations prior to their replacement. Here, we summarize our recent efforts toward the development of nickel-catalyzed decarbonylative cross-coupling reactions of carboxylic esters. Achievements accomplished by other groups in this area are also included. To this day, a number of new transformations have been successfully developed, including decarbonylative arylations, alkylations, cyanations, silylations, borylations, aminations, thioetherifications, stannylations, and hydrogenolysis reactions. These transformations proceed via a nickel-catalyzed decarbonylative pathway and have shown a high degree of reactivity and chemoselectivity, as well as several other unique advantages in terms of substrate availability, due to the use of esters as coupling partners. Although the mechanisms of these reactions have not yet been fully understood, chemists have already provided some important insights. For example, Yamamoto explored the stoichiometric nickel

Decarbonylative Cross-Couplings: Nickel Catalyzed Functional Group Interconversion Strategies for the Construction of Complex Organic Molecules.

Science.gov (United States)

Guo, Lin; Rueping, Magnus

2018-05-15

The utilization of carboxylic acid esters as electrophiles in metal-catalyzed cross-coupling reactions is increasingly popular, as environmentally friendly and readily available ester derivatives can be powerful alternatives to the commonly used organohalides. However, key challenges associated with the use of these chemicals remain to be addressed, including the stability of ester substrates and the high energy barrier associated with their oxidative addition to low-valent metal species. Due to recent developments in nickel catalysis that make it easier to perform oxidative additions, chemists have become interested in applying less reactive electrophiles as coupling counterparts in nickel-catalyzed transformations. Hence, our group and others have independently investigated various ester group substitutions and functionalizations enabled by nickel catalysis. Such methods are of great interest as they enable the exchange of ester groups, which can be used as directing groups in metal-catalyzed C-H functionalizations prior to their replacement. Here, we summarize our recent efforts toward the development of nickel-catalyzed decarbonylative cross-coupling reactions of carboxylic esters. Achievements accomplished by other groups in this area are also included. To this day, a number of new transformations have been successfully developed, including decarbonylative arylations, alkylations, cyanations, silylations, borylations, aminations, thioetherifications, stannylations, and hydrogenolysis reactions. These transformations proceed via a nickel-catalyzed decarbonylative pathway and have shown a high degree of reactivity and chemoselectivity, as well as several other unique advantages in terms of substrate availability, due to the use of esters as coupling partners. Although the mechanisms of these reactions have not yet been fully understood, chemists have already provided some important insights. For example, Yamamoto explored the stoichiometric nickel

Decarbonylative Cross-Couplings: Nickel Catalyzed Functional Group Interconversion Strategies for the Construction of Complex Organic Molecules

KAUST Repository

Guo, Lin

2018-04-13

The utilization of carboxylic acid esters as electrophiles in metal-catalyzed cross-coupling reactions is increasingly popular, as environmentally friendly and readily available ester derivatives can be powerful alternatives to the commonly used organohalides. However, key challenges associated with the use of these chemicals remain to be addressed, including the stability of ester substrates and the high energy barrier associated with their oxidative addition to low-valent metal species. Due to recent developments in nickel catalysis that make it easier to perform oxidative additions, chemists have become interested in applying less reactive electrophiles as coupling counterparts in nickel-catalyzed transformations. Hence, our group and others have independently investigated various ester group substitutions and functionalizations enabled by nickel catalysis. Such methods are of great interest as they enable the exchange of ester groups, which can be used as directing groups in metal-catalyzed C-H functionalizations prior to their replacement. Here, we summarize our recent efforts toward the development of nickel-catalyzed decarbonylative cross-coupling reactions of carboxylic esters. Achievements accomplished by other groups in this area are also included. To this day, a number of new transformations have been successfully developed, including decarbonylative arylations, alkylations, cyanations, silylations, borylations, aminations, thioetherifications, stannylations, and hydrogenolysis reactions. These transformations proceed via a nickel-catalyzed decarbonylative pathway and have shown a high degree of reactivity and chemoselectivity, as well as several other unique advantages in terms of substrate availability, due to the use of esters as coupling partners. Although the mechanisms of these reactions have not yet been fully understood, chemists have already provided some important insights. For example, Yamamoto explored the stoichiometric nickel

Durability of polymer matrix composites for infrastructure: The role of the interphase

Science.gov (United States)

Verghese, Kandathil Nikhil Eapen

1999-12-01

As fiber reinforced polymer matrix composites find greater use in markets such as civil infrastructure and ground transportation, the expectations placed on these materials are ever increasing. The overall cost and reliability have become the drivers of these high performance materials and have led to the disappearance of resins such as bismaleimides (BMI). cyanate esters and other high performance polyimides and epoxys. In their place polymers, such polyester and vinylester have arisen. The reinforcing fiber scenario has also undergone changes from the high quality and performance assured IM7 and AS4 to cheaper and hybrid systems consisting of both glass and low cost carbon. Manufacturing processes have had their share of changes too with processes such as pultrusion and other mass production techniques replacing hand lay-up and resin transfer molding. All of this has however come with little or no concession on material performance. The motivation of the present research has therefore been to try to improve the properties of these low cost composites by better understanding the constituent materials (fiber and matrix) and the region that lies in-between them namely the interphase. In order to achieve this. working with controls is necessary and the present discourse therefore deals with the AS4 fiber system from Hexcel Corporation and the vinyl ester resin, Derakane 441-400 from The Dow Chemical Company. The following eight chapters sum up the work done thus far on composites made with sized fibers and the above mentioned resin and fiber systems. They are in the form of publications that have either been accepted. submitted or going to be submitted to various peer reviewed journals. The sizings used have been poly(vinylpyrrolidone) PVP and Polyhydroxyether (Phenoxy) thermoplastic polymers and G' an industrial sizing material supplied by Hexcel. A number of issues have been addressed ranging from viscoelastic relaxation to enviro-mechanical durability. Chapter 1

Surface water pollution and water quality studies at Prestea Goldfields Limited (P. G. L.) Prestea, Ghana

International Nuclear Information System (INIS)

Ampong, Charles Horace

1993-11-01

, which is also the W.R.O standards and other standards available, results were observed to show high amounts of Sulphate resulting from Sulphur dioxide (So2) emissions, from the stack of the nearby processing plant where roasting of the ore takes place. Total Suspended Solids was also high. This was attributed firstly to the tailings being washed by heavy rainfall into the nearby streams and rivers, and secondly to the activities of illegal gold panning by the inhabitants along the river and stream beds. Cyanide from the treatment plant and Mercury used during gold winning by illegal miners also presents pollution problems. Even though the mine is reputed to be using lime in their processing activities which aids the precipitation of metals and settling of suspended solids, yet the fact that most of the streams and rivers subjected to effluent have high suspended solids presupposes that this control measure of lime usage is not enough. From the discussion on the experimental study, it was suggested that, the effluent is impregnated with FeSO4 and retained in a pond before discharge. This will promote the formation of Fe (CN) 2 (that is Fe reacting with CN) which is less toxic and can dissociate easily into Fe, CO2 and CNO (Cyanate) on exposure to air. The FeSO4 will also enhance potency of lime in causing the settling of suspended solids as the effluent flows into the rivers and streams. ‘1n addition, an Environmental Action Plan was suggested with particular reference to groundwater pollution studies in the tailings area This is because, a well near to the current tailings site gave a very low pH (about 5) value, hence the possibility of groundwater pollution in the area. (au)