Measurement of curium in marine samples
Schneider, D. L.; Livingston, H. D.
1984-06-01
Measurement of environmentally small but detectable amounts of curium requires reliable, accureate, and sensitive analytical methods. The radiochemical separation developed at Woods Hole is briefly reviewed with specific reference to radiochemical interferences in the alpha spectrometric measurement of curium nuclides and to the relative amounts of interferences expected in different oceanic regimes and sample types. Detection limits for 242 Cm and 244 Cm are ultimately limited by their presence in the 243Am used as curium yield monitor. Environmental standard reference materials are evaluated with regard to curium. The marine literature is reviewed and curium measurements are discussed in relation to their source of introduction to the environment. Sources include ocean dumping of low-level radioactive wastes and discharges from nuclear fuel reporcessing activities, In particular, the question of a detectable presence of 244Cm in global fallout from nuclear weapons testing is addressed and shown to be essentially negligible. Analyses of Scottish coastal sedimantes show traces of 242Cm and 244Cm activity which are believed to originate from transport from sources in the Irish Sea.
Biological transport of curium-243 in dairy animals
International Nuclear Information System (INIS)
Sutton, W.W.; Patzer, R.G.; Hahn, P.B.; Potter, G.D.
1979-04-01
Lactating cows and goats were used to examine the biological transport of curium-243 in dairy animals. After either single oral or intravenous nuclide doses were administered, samples of milk, urine, blood, and feces were taken over a 144-hr priod, and the curium concentrations were determined by gamma counting. Gastrointestinal uptake of curium was estimated to be 0.02 and 0.006% of the oral dose for cows and goats, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.6 x 10 -4 and 1.9 x 10 -3 , respectively, for a cow and 2.7 x 10 -4 and 1.6 x 10 -4 , respectively, for goats. Plasma concentrations of curium decreased rapidly following all intravenous injections. The average percentage of injected curium transferred to milk, urine, and feces was 2, 8, and 1, respectively, for a cow and 2, 5, and 5, respectively, for goats. All animals were sacrificed one week after dosing. Bovine bone retained the greatest fraction of the administered dose and the next highest was the liver. However, in all three intravenously dosed goats the liver contained the greatest amount of curium. Nuclide deposition in bone and liver was essentially equal for two of the three orally dosed goats while the skeleton contained the most curium in the other animal. Comparisons are presented between curium-243 and americium-241 transport in dairy cows
Infrared spectrum of curium-244
International Nuclear Information System (INIS)
Conway, J.G.; Blaise, J.; Verges, J.
1974-09-01
The spectrum of curium-244 has been observed on the high resolution Fourier-transform spectrometer at Laboratoire Aime Cotton. An electrodeless lamp containing 50 μg of CmI 3 was run for 12 hours and 800,000 points were taken. A total of 1743 lines have been ascribed to curium and 87 percent of the lines have been assigned to transitions between known energy levels
International Nuclear Information System (INIS)
Chuveleva, Eh.A.; Kharitonov, O.V.; Firsova, L.A.
1994-01-01
Certain heavy rare earths, curium and americium were separated by the method of displacement complexing chromatography using DTPA solutions and solutions containing DTPA and citric acid as eluents. Separation factors of rare earths and curium (americium) were calculated. Imitators for curium and americium separation were suggested: thulium for curium elution using 0.025 mol/l DTPA, holmium-for curium elution using 0.025 mol/l DTPA in the presence of 0.025 mol/l citric acid; terbium can serve as the imitator in both cases. 5 refs., 5 figs
PROCESS FOR SEPARATING AMERICIUM AND CURIUM FROM RARE EARTH ELEMENTS
Baybarz, R.D.; Lloyd, M.H.
1963-02-26
This invention relates to methods of separating americium and curium values from rare earth values. In accordance with the invention americium, curium, and rare earth values are sorbed on an anion exchange resin. A major portion of the rare earth values are selectively stripped from the resin with a concentrated aqueous solution of lithium chloride, and americium, curium, and a minor portion of rare earth values are then stripped from the resin with a dilute aqueous solution of lithium chloride. The americium and curium values are further purified by increasing the concentration of lithium chloride in the solution to at least 8 molar and selectively extracting rare earth values from the resulting solution with a monoalkylphosphoric acid. (AEC)
The curium tagging approach for enhanced safeguards for spent fuel handling and reprocessing
International Nuclear Information System (INIS)
Menlove, H.O.; Beddingfield, D.H.; Rinard, P.M.; Wenz, T.R.
1999-01-01
Because of the intense neutron emission rate from curium, it can be a useful signature to measure and track special nuclear material in spent fuel and waste. By measuring the concentration of curium as well as plutonium and uranium in spent fuel streams, the ratio of curium to plutonium, uranium or other actinides can be used for waste assay. The quantity of special nuclear material in the waste streams such as the leached hulls and vitrified high-level waste can be calculated from the ratio of the curium to the plutonium, etc. The quantity of curium can be measured from the neutron emission rate from the various waste streams in the presence of the high-level gamma-ray backgrounds from fission products. Examples of using the curium ratio technique for measuring plutonium in leached hulls and vitrified waste canisters are presented in this paper. (author)
A contribution to preparative micro-chemistry and structural chemistry of element 96, curium
International Nuclear Information System (INIS)
Kohl, R.
1984-01-01
Ternary oxides of curium are analyzed by preparing a spectrum of different phases and characterizing it by radiography. Physical and thermodynamic data are established on curium trihalogenides. Particular interest is taken in experiments for preparing curium of the higher valency stages IV, V, and VI. (orig./PW) [de
International Nuclear Information System (INIS)
Yaita, T.; Hirata, M.; Narita, H.; Tachimori, S.; Yamamoto, H.; Edelstein, N.M.; Bucher, J.J.; Shuh, D.K.; Rao, L.
2001-01-01
Co-ordination properties of diglycol-amide (DGA) to trivalent curium and to the trivalent lanthanides were studied by the EXAFS, the XRD and the XPS methods. The structural determinations by both the crystal XRD and the solution EXAFS methods showed that the DGA co-ordinated to the trivalent lanthanide ion in a tridentate fashion: co-ordination of three oxygen atoms of each ligand to the metal ion. The bond distances of Er-O (carbonyl) and Er-O (ether) in the Er-DGA complex were 2.35 Angstrom, and 2.46 Angstrom, respectively, while the atom distances of Cm-O (carbonyl) and Cm-O (ether) in the Cm-DGA complex were 2.42 Angstrom and 3.94 Angstrom, respectively from the EXAFS data for the Cm-DGA complex. Accordingly, the DGA would behave only as a semi-tridentate in the co-ordination to trivalent curium in solution. We determined the valence band structures of the Er-DGA complex by the XPS in order to clarify the bond properties of the complex, and assigned the XPS spectrum by using the DV-DS molecular orbital calculation method. (authors)
Analytical separation of americium and curium, using high performance liquid chromatography
International Nuclear Information System (INIS)
Billon, A.
1978-01-01
Americium and curium are separated on a column of cation exchange resin (Aminex) using hydroxyisobutyric acid (α HIBA) as eluent, at a temperature of 80 0 C. Americium and curium were detected in line using their α emission: the separation was performed in a shielded glove box whose setting-up is given. Finally, the time necessary for a separation is comprised between 30 min and 1 hr. The purity of separated fractions was assayed by mass-spectrometry. An application in the determination of isotopic composition of americium and curium in fuels is described
Sorption of curium by silica colloids: Effect of humic acid
International Nuclear Information System (INIS)
Kar, Aishwarya Soumitra; Kumar, Sumit; Tomar, B.S.; Manchanda, V.K.
2011-01-01
Sorption of curium by silica colloids has been studied as a function of pH and ionic strength using 244 Cm as a tracer. The sorption was found to increase with increasing pH and reach a saturation value of ∼95% at pH beyond 5.3. The effect of humic acid on the sorption of 244 Cm onto silica was studied by changing the order of addition of the metal ion and humic acid. In general, in the presence of humic acid (2 mg/L), the sorption increased at lower pH (<5) while it decreased in the pH range 6.5-8 and above pH 8, the sorption was found to increase again. As curium forms strong complex with humic acid, its presence results in the enhancement of curium sorption at lower pH. At higher pH the humic acid present in the solution competes with the surface sites for curium thus decreasing the sorption. The decrease in the Cm sorption in presence of humic acid was found to be less when humic acid was added after the addition of curium. Linear additive model qualitatively reproduced the profile of the Cm(III) sorption by silica in presence of humic acid at least in the lower pH region, however it failed to yield quantitative agreement with the experimental results. The results of the present study evidenced the incorporation of Cm into the silica matrix.
Process for the recovery of curium-244 from nuclear waste
International Nuclear Information System (INIS)
Posey, J.C.
1980-10-01
A process has been designed for the recovery of curium from purex waste. Curium and americium are separated from the lanthanides by a TALSPEAK extraction process using differential extraction. Equations were derived for the estimation of the economically optimum conditions for the extraction using laboratory batch extraction data. The preparation of feed for the extraction involves the removal of nitric acid from the Purex waste by vaporization under reduced pressure, the leaching of soluble nitrates from the resulting cake, and the oxalate precipitation of a pure lanthanide-actinide fraction. Final separation of the curium from americium is done by ion-exchange. The steps of the process, except ion-exchange, were tested on a laboratory scale and workable conditions were determined
Gut uptake factors for plutonium, americium and curium
International Nuclear Information System (INIS)
Harrison, J.D.
1982-01-01
Data on estimates of the absorption of plutonium, americium and curium from the human gut based on measurements of uptake in other mammalian species are reviewed. It is proposed that for all adult members of the public ingesting low concentrations of plutonium in food and water, 0.05% would be an appropriate value of absorption except when the conditions of exposure are known and a lower value can be justified. For dietary intakes of americium and curium, the available data do not warrant a change from the ICRP value of 0.05%. For newborn children ingesting americium, curium and soluble forms of plutonium, a value of 1% absorption is proposed for the first 3 months of life during which the infant is maintained on a milk diet. It is proposed that a value of 0.5% should be used for the first year of life to take account of the gradual maturation of the gut. In considering the ingestion of insoluble oxides of plutonium by infants, it is proposed that absorption is taken as 0.1% for the first 3 months and 0.05% for the first year. (author)
Study of Reaction of Curium Oxy-Compound Formation in Molten Chlorides
Energy Technology Data Exchange (ETDEWEB)
Osipenko, A.G.; Mayorshin, A.A.; Bychkov, A.V. [Dimitrovgrad-10, Ulyanovsk region, 433510 (Russian Federation)
2008-07-01
The method of potentiometric titration using oxygen sensors with solid electrolyte membrane was applied for the study of the interaction of curium cations with oxygen anions in the molten alkali metal chlorides in the temperature range of 450-850 C degrees depending on oxy-acidity of the environment. Assumptions were made concerning ion and phase composition of the obtained high-temperature compounds and chemical reactions taking place in the melts. This scheme assumes that as the basicity of the melt increases, initially the formation of soluble curium oxychlorides takes place in the melt (presumably CmO{sup -}) that is followed by formation of solid CmOCl and finally sesquioxide Cm{sub 2}O{sub 3}. Basic thermodynamic values were calculated for the resultant curium oxy-compounds.
The biokinetics and radiotoxicology of curium: A comparison with americium
Energy Technology Data Exchange (ETDEWEB)
Menetrier, F. [CEA, Fontenay-aux-Roses (France); Taylor, D.M. [School of Chemistry, Cardiff University, Cardiff CF10 3AT (United Kingdom)], E-mail: davtay@btinternet.com; Comte, A. [CEA, Fontenay-aux-Roses (France)
2008-05-15
The human and animal data on the biokinetics of {sup 242}Cm and {sup 244}Cm are reviewed and shown to be very similar to those for {sup 241}Am. Liver and skeleton are the main organs of deposition and the retention of curium in the skeleton is very prolonged in all the species examined. Retention of both curium and americium in the liver appears to be species-dependent, being relatively rapidly removed from the liver of rats, and probably humans, but being tenaciously retained in dogs and some other species. The radiotoxicity of curium is also reviewed and it is shown that, as with {sup 241}Am, lung and bone tumour induction are the major hazards from inhaled and systemically deposited {sup 244}Cm. The use of chelating agents for the treatment of accidental contamination of the human body with {sup 242,244}Cm is also discussed.
Plant uptake of americium, curium, and the chemical analog neodymium
International Nuclear Information System (INIS)
Weimer, W.C.; Laul, J.C.; Kutt, J.C.; Bondietti, E.A.
1977-01-01
The plant uptake from several bulk soils has been determined for neodymium, a chemical analog to the transuranium elements americium and curium, and several other native rare earth elements as well. These investigations have demonstrated that neodymium, which has very similar chemical properties to amercium and curium and should have a similar environmental behavior, does behave indistinguishably under both laboratory and field conditions. The uptake of the weathered or mobile forms of these elements from soils is expected to be governed primarily by their identical oxidation states and nearly identical ionic radii. This hypothesis is strongly supported by the chondritic (primordial) normalized rare earth element patterns in several plants. In these samples, the entire series of rare earth elements behaves as a smooth function of the REE ionic radii, as is also seen in the contiguous soils. This behavior suggests that the plant uptake of other ions with similar chemical properties (i.e., americium and curium) would also be governed by ionic size and charge
Americium/Curium Disposition Life Cycle Planning Study
International Nuclear Information System (INIS)
Jackson, W.N.; Krupa, J.; Stutts, P.; Nester, S.; Raimesch, R.
1998-01-01
At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS)
International Nuclear Information System (INIS)
Okuno, Hiroshi
2002-01-01
Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)
Estimation of 244Cm intake by bioassay measurements following a contamination incident
International Nuclear Information System (INIS)
Thein, M.; Bogard, J.S.; Eckerman, K.F.
1990-01-01
An employee was contaminated with radioactive material consisting primarily of 244 Cm and 246 Cm as a consequence of handling a curium nitrate solution at a reprocessing facility. In vivo gamma analysis and in vitro (urine and fecal) bioassay measurements were performed. A sample of the curium solution from the workplace was obtained to confirm that the nitrate was the chemical form and to identify the isotopes of curium present. The mass ratio of 244 Cm/ 246 Cm was determined to be 91 to 7. Observed excretion rates were consistent with available information on curium. The results of the in vivo and in vitro measurements are presented and intake estimates for the incident are developed. (author) 11 refs.; 3 figs.; 2 tabs
Energy Technology Data Exchange (ETDEWEB)
Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)
2002-10-01
Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)
Americium/curium bushing melter drain tests
International Nuclear Information System (INIS)
Smith, M.E.; Hardy, B.J.; Smith, M.E.
1997-01-01
Americium and curium were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. They have been stored in a nitric acid solution in an SRS reprocessing facility for a number of years. Vitrification of the americium/curium (Am/Cm) solution will allow the material to be safely stored or transported to the DOE Oak Ridge Reservation. Oak Ridge is responsible for marketing radionuclides for research and medical applications. The bushing melter technology being used in the Am/Cm vitrification research work is also under consideration for the stabilization of other actinides such as neptunium and plutonium. A series of melter drain tests were conducted at the Savannah River Technology Center to determine the relationship between the drain tube assembly operating variables and the resulting pour initiation times, glass flowrates, drain tube temperatures, and stop pour times. Performance criteria such as ability to start and stop pours in a controlled manner were also evaluated. The tests were also intended to provide support of oil modeling of drain tube performance predictions and thermal modeling of the drain tube and drain tube heater assembly. These drain tests were instrumental in the design of subsequent melter drain tube and drain tube heaters for the Am/Cm bushing melter, and therefore in the success of the Am/Cm vitrification and plutonium immobilization programs
International Nuclear Information System (INIS)
Yamagishi, Isao; Choi, Yong-Joon; Glatz, Jean-Paul; Hyland, Bronwyn; Uhlir, Jan; Baron, Pascal; Warin, Dominique; DE ANGELIS, Giorgio; LUCE, Alfredo; Inoue, Tadashi; Morita, Yasuji; Minato, Kazuo; Lee, Han Soo; Ignatiev, Victor V.; Kormilitsyn, Mikhail V.; Caravaca, Concepcion; Lewin, Robert g.; Taylor, Robin J.; Collins, Emory D.; Laidler, James J.
2012-01-01
Curium is closely associated with americium in irradiated fuels because of their chemical similarity with regard to potential separation requirements, and because americium also requires special shielding and handling requirements due to its gamma radiation emission. Americium is produced in greater mass than curium in irradiated nuclear fuels and the mass ratio can grow exponentially with decay time because of the simultaneous decay of 244 Cm and in-growth of 241 Am from decay of 241 Pu (half-life = 14.4 years). For these reasons, curium management is challenging. Countries that are now engaged in or planning future fuel recycle operations, are considering methods to manage the curium produced and minimise the shielding and handling requirements, as well as the reprocessing requirements for separation of curium from americium France, Japan, and the USA have begun curium management studies. Curium management methods under consideration include (1) separation of curium from americium and storage of curium for several decades to allow 244 Cm to decay substantially to 240 Pu, while moving ahead to recycle americium; (2) recycling of americium and curium without separation; and (3) waiting several decades to reprocess used nuclear fuels, allowing decay minimisation of curium emissions and the requirement for separation of curium from americium, and allowing an alteration of the subsequent transmutation path to reduce the production of curium in recycled used fuels. In this report, recent curium management studies in France, Japan, and the USA have been described. The French studies included scenarios that compared the recycle of ail minor actinides (neptunium, americium, and curium) with the recycle of only neptunium and americium in radial blankets of sodium-cooled fast reactors (SFR). In the latter scenario, curium is separated from americium during used fuel reprocessing and stored for 5000 years to allow 244 Cm to decay to 240 Pu which is then recycled. Even though
Calculation of prompt neutron spectra for curium isotopes
Energy Technology Data Exchange (ETDEWEB)
Ohsawa, Takaaki [Kinki Univ., Higashi-Osaka, Osaka (Japan). Atomic Energy Research Inst.
1997-03-01
With the aim of checking the existing evaluations contained in JENDL-3.2 and providing new evaluations based on a methodology proposed by the author, a series of calculations of prompt neutron spectra have been undertaken for curium isotopes. Some of the evaluations in JENDL-3.2 was found to be unphysically hard and should be revised. (author)
The rapid determination of americium curium, and uranium in urine by ultrafiltration
International Nuclear Information System (INIS)
Stradling, G.N.; Popplewell, D.S.; Ham, G.J.; Griffin, R.
1975-01-01
The rapid ultrafiltration method developed for the assay of plutonium has been extended to the determination of americium, curium and uranium in urine. The limits of detection for americium and curium, and uranium are 0.09 and 0.12 dm -1 l -1 respectively, and the analysis time excluding counting less than 2 hours. The method can therefor be effectively used as a rapid screening procedure. When the reference level for plutonium is exceeded, the α activity may require to be characterised. The single ultrafiltration technique must be modified for turbid urine samples. The method is inappropriate, except for uranium, when the urine contains DTPA. (author)
Thermodynamic systematics of oxides of americium, curium, and neighboring elements
International Nuclear Information System (INIS)
Morss, L.R.
1984-01-01
Recently-obtained calorimetric data on the sesquioxides and dioxides of americium and curium are summarized. These data are combined with other properties of the actinide elements to elucidate the stability relationships among these oxides and to predict the behavior of neighboring actinide oxides. 45 references, 4 figures, 5 tables
In vitro dissolution of curium oxide using a phagolysosomal simulant solvent system
International Nuclear Information System (INIS)
Helfinstine, S.Y.; Guilmette, R.A.; Schlapper, G.A.
1992-01-01
Detailed study of actinide oxide behavior in alveolar macrophages (AM) in vitro is limited because of the short life span of these cells in culture. We created an in vitro dissolution system that could mimic the acidic phagolysosomal environment for the actinide and be maintained for an indefinite period so that dissolution of more insoluble materials could be measured. The dissolution system for this investigation, consisting of nine different solutions of HCl and the chelating agent diethylenetriamine pentaacetate (DTPA) in distilled water, is called the phagolysosomal simulant solvent (PSS). In this system, both the pH and the amount of DTPA were varied. We could observe the effect of altering pH within a range of 4.0-6.0 (similar to that of the phagolysosome) and the effect of the molar ratio of DTPA to curium at 1000: 1, 100;1, or 10:1. We chose curium sesquioxide ( 244 Cm 2 O 3 ) to validate the PSS for actinide dissolution versus that occurring in AM in vitro because it dissolves significantly in less than 1 week. The polydisperse 244 Cm 2 O 3 aerosol was generated, collected on filters, resuspended, and added to the PSS solutions and to cultured canine AM. By comparing dissolution in the two systems directly, we hoped to arrive at an optimum PSS for future dissolution studies. PSS and cell culture samples were taken daily for 7 days after exposure and tested for the solubilized curium. The amount of soluble material was determined by ultracentrifugation to separate the insoluble CM 2 O 3 from the soluble curium in the PSS solutions and filtration for the cell-containing material. After separating the soluble and insoluble fractions, the samples were analyzed using alpha liquid scintillation counting. Time-dependent dissolution measurements from the PSS/AM showed that the CM 2 O 3 dissolution was similar for both the PSS solutions and the cultured AM. 13 refs., 4 tabs
Extraction separation of americium and curium. A review
International Nuclear Information System (INIS)
Petrzilova, H.
1976-11-01
A survey is given of extraction systems suitable for transplutonium element separation and preparation as well as for the practical application of their nuclear properties. Methods are discussed in detail of separating the actinide and the lanthanide fractions from fission and corrosion products and of separating americium from curium. The description is completed with flowsheets showing the separation of transplutonium elements from irradiated targets and waste solutions after spent fuel reprocessing. (L.K.)
International Nuclear Information System (INIS)
Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.
1983-01-01
Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed
International Nuclear Information System (INIS)
Rinard, P.M.; Menlove, H.O.
1996-03-01
In large-scale reprocessing plants for spent fuel assemblies, the quantity of plutonium in the waste streams each year is large enough to be important for nuclear safeguards. The wastes are drums of leached hulls and cylinders of vitrified high-level liquid waste. The plutonium amounts in these wastes cannot be measured directly by a nondestructive assay (NDA) technique because the gamma rays emitted by plutonium are obscured by gamma rays from fission products, and the neutrons from spontaneous fissions are obscured by those from curium. The most practical NDA signal from the waste is the neutron emission from curium. A diversion of waste for its plutonium would also take a detectable amount of curium, so if the amount of curium in a waste stream is reduced, it can be inferred that there is also a reduced amount of plutonium. This report studies the feasibility of tracking the curium through a reprocessing plant with neutron measurements at key locations: spent fuel assemblies prior to shearing, the accountability tank after dissolution, drums of leached hulls after dissolution, and canisters of vitrified high-level waste after separation. Existing pertinent measurement techniques are reviewed, improvements are suggested, and new measurements are proposed. The authors integrate these curium measurements into a safeguards system
Determination of plutonium, americium and curium in the marine environment
International Nuclear Information System (INIS)
Grenaut, CLaude; Germain, Pierre; Miramand, Pierre.
1982-01-01
The method used in the Laboratory for plutonium, americium and curium determination in marine samples (water, sediments, animals, plants) is presented. It is a modification of a procedure based on adsorption on ion exchange resins developed by other authors. The preliminary preparation of the samples, the radiochemical procedures and electrodeposition are described so as to be used as a practical handbook [fr
Final report on the decontamination of the Curium Source Fabrication Facility
International Nuclear Information System (INIS)
Schaich, R.W.
1983-12-01
The Curium Source Fabrication Facility (CSFF) at Oak Ridge National Laboratory (ORNL) was decontaminated to acceptable contamination levels for maintenance activities, using standard decontamination techniques. Solid and liquid waste volumes were controlled to minimize discharges to the ORNL waste systems. This program required two years of decontamination effort at a total cost of approximately $700K. 5 references, 7 figures, 2 tables
Pretreatment of americium/curium solutions for vitrification
International Nuclear Information System (INIS)
Rudisill, T.S.
1996-01-01
Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to the heavy isotope programs at Oak Ridge National Laboratory. Prior to vitrification, an in-tank oxalate precipitation and a series of oxalic/nitric acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Pretreatment development experiments were performed to understand the behavior of the lanthanides and the metal impurities during the oxalate precipitation and properties of the precipitate slurry. The results of these experiments will be used to refine the target glass composition allowing optimization of the primary processing parameters and design of the solution transfer equipment
Electrochemistry of oxygen-free curium compounds in fused NaCl-2CsCl eutectic
International Nuclear Information System (INIS)
Osipenko, A.; Maershin, A.; Smolenski, V.; Novoselova, A.; Kormilitsyn, M.; Bychkov, A.
2010-01-01
This work presents the electrochemical study of Cm(III) in fused NaCl-2CsCl eutectic in the temperature range 823-1023 K. Transient electrochemical techniques such as cyclic, differential pulse and square wave voltammetry, and chronopotentiometry have been used in order to investigate the reduction mechanism of curium ions up to the metal. The results obtained show that the reduction reaction takes place in a single step Cm(III)+3e-bar →Cm(0). The diffusion coefficient of [CmCl 6 ] 3- complex ions was determined by cyclic voltammetry at different temperatures by applying the Berzins-Delahay equation. The validity of the Arrhenius law was also verified and the activation energy for diffusion was found to be 44.46 kJ/mol. The apparent standard electrode potential of the redox couple Cm(III)/Cm(0) was found by chronopotentiometry at several temperatures. The thermodynamic properties of curium trichloride have also been calculated.
National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242
International Nuclear Information System (INIS)
Adams, J.P.
1995-08-01
This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 ( 242 Cm). This report also includes discussions about waste types and forms in which 242 Cm can be found and 242 Cm behavior in the environment and in the human body
National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242
Energy Technology Data Exchange (ETDEWEB)
Adams, J.P.
1995-08-01
This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 ({sup 242}Cm). This report also includes discussions about waste types and forms in which {sup 242}Cm can be found and {sup 242}Cm behavior in the environment and in the human body.
Americium/Curium Vitrification Pilot Tests - Part II
International Nuclear Information System (INIS)
Marra, J.E.; Baich, M.A.; Fellinger, A.P.; Hardy, B.J.; Herman, D.T.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T. K.; Stone, M.E.
1998-05-01
Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. A previous paper described operation results from the Am-Cm Melter 2A pilot system, a full-scale non-radioactive pilot facility. This paper presents the results from continued testing in the Pilot Facility and also describes efforts taken to look at alternative vitrification process operations and flowsheets designed to address the problems observed during melter 2A pilot testing
Energy Technology Data Exchange (ETDEWEB)
Salminen, S.
2009-07-01
In this work, separation methods have been developed for the analysis of anthropogenic transuranium elements plutonium, americium, curium and neptunium from environmental samples contaminated by global nuclear weapons testing and the Chernobyl accident. The analytical methods utilized in this study are based on extraction chromatography. Highly varying atmospheric plutonium isotope concentrations and activity ratios were found at both Kurchatov (Kazakhstan), near the former Semipalatinsk test site, and Sodankylae (Finland). The origin of plutonium is almost impossible to identify at Kurchatov, since hundreds of nuclear tests were performed at the Semipalatinsk test site. In Sodankylae, plutonium in the surface air originated from nuclear weapons testing, conducted mostly by USSR and USA before the sampling year 1963. The variation in americium, curium and neptunium concentrations was great as well in peat samples collected in southern and central Finland in 1986 immediately after the Chernobyl accident. The main source of transuranium contamination in peats was from global nuclear test fallout, although there are wide regional differences in the fraction of Chernobyl-originated activity (of the total activity) for americium, curium and neptunium. The separation methods developed in this study yielded good chemical recovery for the elements investigated and adequately pure fractions for radiometric activity determination. The extraction chromatographic methods were faster compared to older methods based on ion exchange chromatography. In addition, extraction chromatography is a more environmentally friendly separation method than ion exchange, because less acidic waste solutions are produced during the analytical procedures. (orig.)
Quantitative determination of americium and curium in solutions using potassium tungstophosphate
International Nuclear Information System (INIS)
Chistyakov, V.M.; Baranov, A.A.; Erin, E.A.; Timoaeev, G.A.
1990-01-01
Two methods of americium (4) and curium (4) titration-replacement and redox ones - have been considered. According to the replacement method thorium nitrate solution was used as a titrant and the final point of titration was determined spectophotometrically. Using the method developed, on the basis of experimental data, the composition of thorium (4) complex with potassium tungstophosphate was determined. In case of the redox titration sodium nitrite was used, and the final titration point was indicated either spectrophotometrically or potentiometrically
Vitrification of F-area americium/curium: feasibility study and preliminary process recommendation
International Nuclear Information System (INIS)
Ramsey, W.G.; Miller, D.; Minichan, R.; Coleman, L.; Schumacher, R.; Hardy, B.; Jones, R.
1994-01-01
Work was performed to identify a process to vitrify the contents of F- canyon Tank 17.1. Tank 17.1 contains the majority of americium (Am) and curium (Cm) contained in the DOE Complex. Oak Ridge National Laboratory (ORNL) has made a formal request for this material as fuel for production of Cf252 and other transplutonium actinides. The Am and Cm (and associated lanthanide fission products) are currently in nitric acid solution. Transportation of the intensely radioactive Am/Cm in liquid form is not considered possible. As a result, the material will either be solidified and shipped to ORNL or discarded to the Tank Farm. Nuclear Materials Processing Technology (NMPT), therefore, requested Defense Waste Processing Technology (DWPT) to determine if the Tank 17.1 material could be vitrified, and if it was vitrified could the americium and curium be successfully recovered. Research was performed to determine if the Tank 17.1 contents could indeed be mixed with glass formers and vitrified. Additional studies identified critical process parameters such as heat loading, melter requirements, off-gas evolution, etc. Discussions with NMPT personnel were initiated to determine existing facilities where this work could be accomplished safely. A process has been identified which will convert the Am/Cm material into approximately 300kg of glass
Remote micro-encapsulation of curium-gold cermets
International Nuclear Information System (INIS)
Coops, M.S.; Voegele, A.L.; Hayes, W.N.; Sisson, D.H.
1980-01-01
A technique is described for fabricating minature, high-density capsules of curium-244 oxide contained in three concentric jackets of metallic gold (or silver), with the outer surface being free of alpha contamination. The completed capsules are right circular cylinders 0.2500-inch diameter and 0.125-inch tall, with each level of containment soldered (or brazed) closed. A typical capsule would contain approx. 70 mg of 244 Cm (5.7 Ci) mixed with 120 mg of gold powder in the form of a cermet wafer clad in three concentric, 0.010-inch thick, liquid tight jackets. This method of fabrication eliminates voids between the jackets and produces a minimum size, maximum density capsule. Cermet densities of 11.5 g/cc were obtained, with an overall density of 17.3 g/cc for the finished capsule
Americium-curium vitrification process development
International Nuclear Information System (INIS)
Fellinger, A.P.; Baich, M.A.; Hardy, B.J
1999-01-01
The successful demonstration of sequentially drying, calcining and vitrifying an oxalate slurry in the Drain Tube Test Stand (DTTS) vessel provided the process basis for testing on a larger scale in a cylindrical induction heated melter. A single processing issue, that of batch volume expansion, was encountered during the initial stage of testing. The increase in batch volume centered on a sintered frit cap and high temperature bubble formation. The formation of a sintered frit cap expansion was eliminated with the use of cullet. Volume expansions due to high temperature bubble formation (oxygen liberation from cerium reduction) were mitigated in the DTTS melter vessel through a vessel temperature profile that effectively separated the softening point of the glass cullet and the evolving oxygen from cerium reduction. An increased processing temperature of 1,470 C and a two hour hold time to find any remaining bubbles successfully reduced bubbles in the poured glass to an acceptable level. The success of the preliminary process demonstrations provided a workable process basis that was directly applicable to the newly installed Cylindrical Induction Melter (CIM) system, making the batch flowsheet the preferred option for vitrification of the americium-curium surrogate feed stream
International Nuclear Information System (INIS)
Bigelow, J.E.; Collins, E.D.; King, L.J.
1979-01-01
At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK246 (Link to dictyBase) - - - Contig-U16440-1 VHK246P (Link to Original site) VHK2...46F 617 VHK246Z 760 VHK246P 1357 - - Show VHK246 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-B/VHK246Q.Seq.d/ Representative seq. ID VHK2...46P (Link to Original site) Representative DNA sequence >VHK246 (VHK246Q) /CSM/VH/VHK2-B/VHK2...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHK246 (VHK246Q) /CSM/VH/VHK2-B/VHK2
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 246.3 Section 246.3 Agriculture... § 246.3 Administration. (a) Delegation to FNS. Within the Department, FNS shall act on behalf of the Department in the administration of the Program. Within FNS, SFPD and the Regional Offices are responsible...
48 CFR 2453.246 - Quality Assurance.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Quality Assurance. 2453.246 Section 2453.246 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.246 Quality Assurance. ...
International Nuclear Information System (INIS)
Box, W.D.; Klima, B.B.; Seagren, R.D.; Shappert, L.B.; Aramayo, G.A.
1980-06-01
An analytical evaluation of the Oak Ridge National Laboratory Transuranium (TRU) Curium Shipping Container was made to demonstrate its compliance with the regulations governing offsite shipment of packages containing radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of the evaluation show that the container complies with the applicable regulations
7 CFR 246.11 - Nutrition education.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 246.11 Section 246.11 Agriculture... Participant Benefits § 246.11 Nutrition education. (a) General. (1) Nutrition education shall be considered a benefit of the Program, and shall be made available at no cost to the participant. Nutrition education...
7 CFR 246.13 - Financial management system.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 246.13 Section 246.13... State Agency Provisions § 246.13 Financial management system. (a) Disclosure of expenditures. The State agency shall maintain a financial management system which provides accurate, current and complete...
International Nuclear Information System (INIS)
Stumpf, Th.; Fanghaenel, Th.
2002-01-01
Cm(III) interaction with calcite was investigated in the trace concentration range. Two different Cm(III)/calcite sorption species were found. The first Cm(III) sorption species consists of a curium ion that is bonded onto the calcite surface. The second Cm(III) sorption species has lost its complete hydration sphere and is incorporated into the calcite bulk structure /1/. (orig.)
12 CFR 19.246 - Petition for reinstatement.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Petition for reinstatement. 19.246 Section 19.246 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Removal, Suspension, and Debarment of Accountants From Performing Audit Services § 19.246 Petition...
Americium/Curium Melter 2A Pilot Tests
International Nuclear Information System (INIS)
Smith, M.E.; Fellinger, A.P.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T.K.; Stone, M.E.; Witt, D.C.
1998-05-01
Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. To this end, the Am/Cm Melter 2A pilot system, a full-scale non- radioactive pilot plant of the system to be installed at the reprocessing facility, was designed, constructed and tested. The full- scale pilot system has a frit and aqueous feed delivery system, a dual zone bushing melter, and an off-gas treatment system. The main items which were tested included the dual zone bushing melter, the drain tube with dual heating and cooling zones, glass compositions, and the off-gas system which used for the first time a film cooler/lower melter plenum. Most of the process and equipment were proven to function properly, but several problems were found which will need further work. A system description and a discussion of test results will be given
48 CFR 52.246-14 - Inspection of Transportation.
2010-10-01
... Transportation. 52.246-14 Section 52.246-14 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....246-14 Inspection of Transportation. As prescribed in 46.314, insert the following clause in solicitations and contracts for freight transportation services (including local drayage) by rail, motor...
Decay study of {sup 246}Fm at SHIP
Energy Technology Data Exchange (ETDEWEB)
Venhart, M. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Slovak Academy of Sciences, Institute of Physics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Gray-Jones, C.; Herzberg, R.D.; Papadakis, P. [University of Liverpool, Department of Physics, Liverpool (United Kingdom); Greenlees, P.T.; Ketelhut, S.; Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Rostron, D. [Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Rudolph, D. [Lund University, Department of Physics, Lund (Sweden); Sulignano, B. [CEA Saclay, DAPNIA/SPhN, Gif/Yvette Cedex (France)
2011-02-15
The decay chain of {sup 246}Fm has been investigated employing the SHIP separator at GSI Darmstadt. The {sup 246}Fm nuclei were produced via the {sup 40}Ar({sup 208}Pb, 2n){sup 246}Fm fusion-evaporation reaction. Improved values of the half-life, T{sub 1/2} = 1.54(4) s, and of the spontaneous fission branching ratio, b{sub SF} = 0.068(6), of {sup 246}Fm were obtained. The {beta}{sup +} /electron capture branching ratio, b{sub EC} = 0.39(3), of {sup 242}Cf was deduced. Possible structures of high-K states in {sup 246}Fm are discussed within the framework of a model calculation based on the Woods-Saxon potential. (orig.)
Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986
International Nuclear Information System (INIS)
Love, G.L.; Butler, H.M.; Duncan, D.T.; Oakes, T.W.
1986-04-01
This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances
7 CFR 246.10 - Supplemental foods.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Supplemental foods. 246.10 Section 246.10 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... nutritional needs of the participant. The food packages are as follows: (1) Food Package I—Infants birth...
7 CFR 246.1 - General purpose and scope.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 246.1 Section 246.1... General § 246.1 General purpose and scope. This part announces regulations under which the Secretary of... health by reason of inadequate nutrition or health care, or both. The purpose of the Program is to...
Transmutation of americium and curium incorporated in zirconia-based host materials
International Nuclear Information System (INIS)
Raison, P.E.
2001-01-01
Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO 2 -ZrO 2 -Y 2 O 3 . It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO 2 content. The Cm 2 O 3 -ZrO 2 system was also investigated. It was found that at 25 mol% of CmO 1.5 , the Cm(III) stabilized zirconia in its cubic form (a = 5.21 ±0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO 1.5 , a pyrochlore oxide - Cm 2 Zr 2 O 7 - is formed (a = 10.63 ±0.02 Angstrom). (author)
Density of simulated americium/curium melter feed solution
International Nuclear Information System (INIS)
Rudisill, T.S.
1997-01-01
Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70 degrees C. The measured density decreased linearly at a rate of 0.0007 g/cm3/degree C from an average value of 1.2326 g/cm 3 at 20 degrees C to an average value of 1.1973g/cm 3 at 70 degrees C
Density of simulated americium/curium melter feed solution
Energy Technology Data Exchange (ETDEWEB)
Rudisill, T.S.
1997-09-22
Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70{degrees} C. The measured density decreased linearly at a rate of 0.0007 g/cm3/{degree} C from an average value of 1.2326 g/cm{sup 3} at 20{degrees} C to an average value of 1.1973g/cm{sup 3} at 70{degrees} C.
Neutron resonance parameters of CM isotopes
International Nuclear Information System (INIS)
Belanova, T.S.; Kolesov, A.G.; Poruchikov, V.A.
1977-01-01
The total neutron cross sections of isotopes 244, 245, 246, 248 Curium have been measured on reactor CM-2 using the time-of-flight method. Single-level Breit-Wigner resonance parameters: energy E 0 , neutron width 2g GITAn, total width GITA, total neutron cross section in resonance sigma 0 have been obtained by the shape and area methods
Marçalo, Joaquim; Gibson, John K.
2009-09-01
An assessment of the gas-phase energetics of neutral and singly and doubly charged cationic actinide monoxides and dioxides of thorium, protactinium, uranium, neptunium, plutonium, americium, and curium is presented. A consistent set of metal-oxygen bond dissociation enthalpies, ionization energies, and enthalpies of formation, including new or revised values, is proposed, mainly based on recent experimental data and on correlations with the electronic energetics of the atoms or cations and with condensed-phase thermochemistry.
Transmutation of americium and curium incorporated in zirconia-based host materials
Energy Technology Data Exchange (ETDEWEB)
Raison, P.E. [CEA Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. d' Etudes des Combustibles; Haire, R.G. [Oak Ridge National Lab., TN (United States)
2001-07-01
Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO{sub 2}-ZrO{sub 2}-Y{sub 2}O{sub 3}. It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO{sub 2} content. The Cm{sub 2}O{sub 3}-ZrO{sub 2} system was also investigated. It was found that at 25 mol% of CmO{sub 1.5}, the Cm(III) stabilized zirconia in its cubic form (a = 5.21 {+-}0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO{sub 1.5}, a pyrochlore oxide - Cm{sub 2}Zr{sub 2}O{sub 7} - is formed (a = 10.63 {+-}0.02 Angstrom). (author)
International Nuclear Information System (INIS)
Holm, E.; Fukai, R.
1976-01-01
While transplutonic elements are only slightly sorbed to anion exchangers from hydrochloric or nitric acid media, the presence of alcohol enhances the anionic exchange of these elements, especially in nitric and sulfuric solutions. In the present work a method has been developed for determining americium and curium in environmental samples, on the basis of the difference between the sorption characteristics to anion exchangers in the acid-methanol system of these transplutonic elements and those of plutonium, polonium and thorium. The method also permits us to perform sequential determination of plutonium, when necessary
40 CFR 246.200 - High-grade paper recovery.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false High-grade paper recovery. 246.200 Section 246.200 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES SOURCE... paper recovery. ...
The use of curium neutrons to verify plutonium in spent fuel and reprocessing wastes
International Nuclear Information System (INIS)
Miura, N.
1994-05-01
For safeguards verification of spent fuel, leached hulls, and reprocessing wastes, it is necessary to determine the plutonium content in these items. We have evaluated the use of passive neutron multiplicity counting to determine the plutonium content directly and also to measure the 240 Pu/ 244 Cm ratio for the indirect verification of the plutonium. Neutron multiplicity counting of the singles, doubles, and triples neutrons has been evaluated for measuring 240 Pu, 244 Cm, and 252 Cf. We have proposed a method to establish the plutonium to curium ratio using the hybrid k-edge densitometer x-ray fluorescence instrument plus a neutron coincidence counter for the reprocessing dissolver solution. This report presents the concepts, experimental results, and error estimates for typical spent fuel applications
40 CFR 246.201-6 - Recommended procedures: Transportation to market.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Transportation to market. 246.201-6 Section 246.201-6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Procedures § 246.201-6 Recommended procedures: Transportation to market. Transportation to market may be...
48 CFR 52.246-5 - Inspection of Services-Cost-Reimbursement.
2010-10-01
...-Cost-Reimbursement. 52.246-5 Section 52.246-5 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.246-5 Inspection of Services—Cost-Reimbursement. As prescribed in 46.305, insert... furnishing of services, when a cost-reimbursement contract is contemplated: Inspection of Services—Cost...
48 CFR 52.246-3 - Inspection of Supplies-Cost-Reimbursement.
2010-10-01
...-Cost-Reimbursement. 52.246-3 Section 52.246-3 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.246-3 Inspection of Supplies—Cost-Reimbursement. As prescribed in 46.303, insert... furnishing of supplies, when a cost-reimbursement contract is contemplated: Inspection of Supplies—Cost...
Preparation of curium-americium oxide microspheres by resin-bead loading
International Nuclear Information System (INIS)
Chattin, F.R.; Benker, D.E.; Lloyd, M.H.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.
1980-01-01
Resin-bead loading and calcination techniques have been used to produce all curium and americium oxide feed material (about 2.2 kg) for HFIR targets since 1971. The process based on Dowex 50W resin has progressed from a series of test runs, through special production runs, into routine production in permanent equipment beginning in 1975. Key attributes of this process are its reliability, high yields, and ease of operation. The process is suited for remote operation in hot cells. Yields approaching 95% are routinely obtained and only one unacceptable product has been generated during routine production operations. There have been no problems in fabricating targets from this oxide or in the subsequent irradiation of these targets. The present scale of production of 150 to 250 g/y supplies the present need and is comparable with the level of other chemical process operations at TRU. Since the annual production is accomplished in two 8 to 12 day periods, there has been no reason to consider further scale-up. However, the rate of production could easily be doubled by simply adding a second set of calcination equipment
7 CFR 246.6 - Agreements with local agencies.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Agreements with local agencies. 246.6 Section 246.6 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN...
48 CFR 852.246-72 - Frozen processed foods.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Frozen processed foods. 852.246-72 Section 852.246-72 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS... Frozen processed foods. As prescribed in 846.302-72, insert the following clause: Frozen Processed Foods...
7 CFR 246.5 - Selection of local agencies.
2010-01-01
... consider how much of the current need is being met at each priority level. The selection criteria cited in... 7 Agriculture 4 2010-01-01 2010-01-01 false Selection of local agencies. 246.5 Section 246.5 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF...
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; Tweed, C.J.; Yui, M.
1997-01-01
A study of the sorption of the radioelements technetium; uranium; neptunium; and curium onto geological materials has been carried out as part of the PNC program to increase confidence in the performance assessment for a high-level radioactive waste repository in Japan. Batch sorption experiments have been performed in order to study the sorption of the radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water under strongly-reducing conditions at both room temperature and at 60 C. Mathematical modelling using the geochemical speciation program HARPHRQ in conjunction with the HATCHES database has been undertaken in order to interpret the experimental results
International Nuclear Information System (INIS)
Casella, V.R.
2004-01-01
Co-60 was historically produced in the SRS reactors. Cobalt slugs were irradiated in the early 1970s. Post-production, remaining cobalt slugs (including slab form) were consolidated for storage. There are approximately nine hundred cobalt slugs currently stored awaiting final disposition. These slugs had historically incomplete documentation for activity rates; therefore, assaying was required in order to determine their activity levels. Since the gamma dose rate from these slugs is extremely high, the most cost effective way to shield a source of this magnitude from personnel and the radiation detector was to use the basin water in which the slugs are stored as the shield. A sodium iodide gamma detector was placed above a specially designed air collimator assembly, so that slug was at least eight feet from the detector and was shielded by the basin water. Using a sodium iodide detector and multichannel analyzer system and an underwater collimator assembly, Co-60 concentrations we re determined for Disassembly Basin cobalt slugs and slabs and 18 curium sampler slugs. The total activity of all of the assayed slugs summed to 31,783 curies. From the Co-60 concentrations of the curium sampler slugs, the irradiation flux was determined for the known irradiation time. The amounts of Pu-238, 239, 240, 241, 242; Am-241, 243; and Cm-242, 244 produced were then obtained based on the original amount of Pu-239 irradiated
Karpas, Zeev; Guamán, Ana V; Calvo, Daniel; Pardo, Antonio; Marco, Santiago
2012-05-15
The off-flavor of "tainted wine" is attributed mainly to the presence of 2,4,6-trichloroanisole (2,4,6-TCA) in the wine. In the present study the atmospheric pressure gas-phase ion chemistry, pertaining to ion mobility spectrometry, of 2,4,6-trichloroanisole was investigated. In positive ion mode the dominant species is a monomer ion with a lower intensity dimer species with reduced mobility values (K(0)) of 1.58 and 1.20 cm(2)V(-1) s(-1), respectively. In negative mode the ion with K(0) =1.64 cm(2)V(-1)s(-1) is ascribed to a trichlorophenoxide species while the ions with K(0) =1.48 and 1.13 cm(2)V(-1)s(-1) are attributed to chloride attachment adducts of a TCA monomer and dimer, respectively. The limit of detection of the system for 2,4,6-TCA dissolved in dichloromethane deposited on a filter paper was 2.1 μg and 1.7 ppm in the gas phase. In ethanol and in wine the limit of detection is higher implying that pre-concentration and pre-separation are required before IMS can be used to monitor the level of TCA in wine. Copyright © 2012 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Alekseev, V.A.; Klokman, V.R.; Morozova, Z.E.; Ziv, V.S.
1986-01-01
The authors consider the behavior of americium, curium, and certain fission products (europium, cerium, yttrium, and strontium) in fluoride and chlode-fluoride melts in the presence of nonisomorphous solid phases: calcium fluoride and lanthanum and zirconium oxides. It is shown that the trace components enter the solid calcium fluoride in a regular fashion only in the presence of an adequate amount of oxygen in the melt. The effect of oxygen on the coprecipitation with calcium fluoride occurs because oxygen compounds of the elements must be formed in the melt, and these are then coprecipitated with the calcium fluoride
48 CFR 52.246-8 - Inspection of Research and Development-Cost-Reimbursement.
2010-10-01
... Development-Cost-Reimbursement. 52.246-8 Section 52.246-8 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.246-8 Inspection of Research and Development—Cost-Reimbursement. As prescribed in... (b) a cost-reimbursement contract is contemplated; unless use of the clause is impractical and the...
48 CFR 52.246-17 - Warranty of Supplies of a Noncomplex Nature.
2010-10-01
... Noncomplex Nature. 52.246-17 Section 52.246-17 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.246-17 Warranty of Supplies of a Noncomplex Nature. As prescribed in 46.710(a)(1), insert a clause substantially as follows: Warranty of Supplies of a Noncomplex Nature (JUN 2003) (a) Definitions...
Energy Technology Data Exchange (ETDEWEB)
Moll, H.; Merroun, M.; Geipel, G.; Rossberg, A.; Hennig, C.; Selenska-Pobell , S.; Bernhard, G. [Forschungszentrum Dresden-Rossendorf e.V., Inst. fuer Radioc hemie, 01314 Dresden (Germany)]. e-mail: h.moll@fzd.de; Stumpf, Th. [Forschungszentru m Karlsruhe, Inst. fuer Nukleare Entsorgung, 76021 Karlsruhe (Germany)
2007-06-15
Sulfate-reducing bacteria (SRB) frequently occur in the deep granitic rock aquifers at the Aespoe Hard Rock Laboratory (Aespoe HRL), Sweden. The new SRB strain Desulfovibrio aespoeensis could be isolated. Results describing the basic interaction mechanisms of uranium, curium, and plutonium with cells of D. aespoeensis DSM 10631T will be presented. The interaction experiments with the actinides showed that the cells are able to remove all three actinides from the surrounding solution. The amount of removed actinide and the interaction mechanism varied among the different actinides. The main U(VI) removal occurred after the first 24 h. The contact time, pH and [U(VI)]initial influence the U removal efficiency. The presence of uranium caused a damaging of the cell membranes. TEM revealed an accumulation of U inside the bacterial cell. D. aespoeensis are able to form U(IV). A complex interaction mechanism takes place consisting of biosorption, bioreduction and bioaccumulation. In the case of {sup 242}Pu, solvent extractions, UV-vis- and XANES spectroscopy were used to determine the speciation of the Pu oxidation states. In the first step, the Pu(VI) and Pu(IV)-polymers are bound to the biomass. Solvent extractions showed that 97 % of the initially present Pu(VI) is reduced to Pu(V) due to the activity of the cells within the first 24 h. Most of the formed Pu(V) dissolves from the cell envelope back to the aqueous solution due to the weak complexing properties of this plutonium oxidation state. In the case of curium at a much lower metal concentration of 3x10{sup -7} M, a pure biosorption of Cm(III) on the cell envelope forming an inner-sphere surface complex most likely with organic phosphate groups was detected. To summarize, the strength of the interaction of D. aespoeensis with the selected actinides at pH 5 and actinide concentrations = 10 mg/L ([Cm] 0.07 mg/L) follows the pattern: Cm > U > Pu >> Np.
2010-07-01
... STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS § 246.1 Purpose. This part: (a) Establishes policy... the S&S newspapers. (c) Authorizes the establishment, management, operation, and oversight of the... mission, production, distribution authority, and business operations as mission-essential activities of...
48 CFR 52.246-18 - Warranty of Supplies of a Complex Nature.
2010-10-01
... Complex Nature. 52.246-18 Section 52.246-18 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.246-18 Warranty of Supplies of a Complex Nature. As prescribed in 46.710(b)(1), insert a clause substantially as follows: Warranty of Supplies of a Complex Nature (MAY 2001) (a) Definitions. As used in this...
Interaction of 2,4,6-trichlorophenol with high carbon iron filings: Reaction and sorption mechanisms
Energy Technology Data Exchange (ETDEWEB)
Sinha, Alok [Environmental Engineering and Management Programme, Department of Civil Engineering, Indian Institute of Technology Kanpur, Kanpur 208016 (India); Bose, Purnendu [Environmental Engineering and Management Programme, Department of Civil Engineering, Indian Institute of Technology Kanpur, Kanpur 208016 (India)], E-mail: pbose@iitk.ac.in
2009-05-15
Reductive dehalogenation of 2,4,6-trichlorophenol (2,4,6-TCP) by two types of high carbon iron filings (HCIF), HCIF-1 and HCIF-2 was studied in batch reactors. While the iron, copper, manganese and carbon content of the two types of HCIF was similar, the specific surface area of HCIF-1 and HCIF-2 were 1.944 and 3.418 m{sup 2} g{sup -1}, respectively. During interaction with HCIF-1, 2,4,6-TCP adsorbed on HCIF-1 surface resulting in rapid reduction of aqueous phase 2,4,6-TCP concentration. However, reductive dehalogenation of 2,4,6-TCP was negligible. During interaction between 2,4,6-TCP and HCIF-2, both 2,4,6-TCP adsorption on HCIF-2, and 2,4,6,-TCP dechlorination was observed. 2,4,6-TCP partitioning between solid and aqueous phase could be described by a Freundlich isotherm, while 2,4,6-TCP dechlorination could be described by an appropriate rate expression. A mathematical model was developed for describing the overall interaction of 2,4,6-TCP with HCIF-2, incorporating simultaneous adsorption/desorption and dechlorination reactions of 2,4,6-TCP with the HCIF surface. 2,4-Dichlorophenol (2,4-DCP), 2-chlorophenol (2-CP) and minor amounts of 4-chlorophenol (4-CP) evolved as 2,4,6-TCP dechlorination by-products. The evolved 2,4-DCP partitioned strongly to the HCIF surface. 4-CP and 2-CP accumulated in the aqueous phase. No transformation of 2-CP or 4-CP to phenol was observed.
Subcellular distribution of curium in beagle liver
International Nuclear Information System (INIS)
Bruenger, F.W.; Grube, B.J.; Atherton, D.R.; Taylor, G.N.; Stevens, W.
1976-01-01
The subcellular distribution of curium ( 243 244 Cm) was studied in canine liver from 2 hr to 47 days after injection of 3 μCi 243 244 Cm/kg of body weight. The pattern of distribution for Cm was similar to other trivalent actinide elements studied previously (Am, Cf). Initially (2 hr), most of the nuclide was found in the cytosol and at least 90 percent was protein bound. About 70 percent of the Cm was bound to ferritin, approximately 5 percent was associated with a protein of MW approximately 200,000, and approximately 25 percent was found in the low-molecular-weight region (approximately 5000). The decrease in the Cm content of cytosol, nuclei, and microsomes coincided with an increase in the amount associated with mitochondria and lysosomes. The concentration of the Cm in the mitochondrial fraction was higher than it was in the lysosomal fraction at each time studied. In the mitochondrial fraction approximately 30 percent of the Cm was bound to membranous or granular material, and 70 percent was found in the soluble fraction. The Cm concentration initially associated with cell nuclei was high but had diminished to 20 percent of the 2 hr concentration by 20 days post injection (PI). The subcellular distribution of Cm in the liver of a dog which had received the same dose and was terminated because of severe liver damage was studied at 384 days PI. The liver weighed 130 g and contained approximately 30 percent of the injected Cm. In contrast, a normal liver weighs 280 g and at 2 hr PI contains approximately 40 percent of the injected dose. The subcellular distribution of Cm in this severely damaged liver differed from the pattern observed at earlier times after injection. The relative concentration of Cm in the cytosol was doubled; it was higher in the nuclei-debris fraction; and it was lower in the mitochondrial and lysosomal fractions when compared to earlier times
12 CFR 24.6 - Examples of qualifying public welfare investments.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Examples of qualifying public welfare investments. 24.6 Section 24.6 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY... finance small businesses or small farms, including minority- and women-owned small businesses or small...
2010-07-01
... through newspaper sales, resale of commercial publications, authorized advertising, job printing, and... STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS § 246.4 Policy. It is DoD policy that: (a) The U.S... the Stars and Stripes editorial staffs the same help provided to commercial newspapers, in compliance...
2010-07-01
... costs and to increase the efficiency and effectiveness of these audits. Information copies of the audit... STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS § 246.6 Procedures. (a) General. (1) Authority to...) The Stars and Stripes and the S&S business operations shall conform to applicable regulations and laws...
International Nuclear Information System (INIS)
Miramand, P.
1984-06-01
The tranfer of transuranic elements -americium, curium and plutonium- from the sediments containing them to some marine benthic species (endofauna and epifauna) was studied with a twofold approach - laboratory and in-situ investigation. The experimental investigations, divided into three parts, made it possible to specify concentration factors (F.C.), transfer factors (F.T.) and to understand the process involved for 5 benthic species. The result were refined by an in-situ study that brought new data on the marine distribution of the transuranic elements released by the La Hague plant. Finally, the localization of americium and plutonium in the tissues and cells of these species was determined by autoradiography [fr
AKTİF KARBON ÜZERİNE 2,4,6-TRİKLOROFENOLÜN ADSORPSİYONU
Tümsek, Fatma; Bayındır, Zekiye; Bodur, Gökçen; Koyuncu, Zelal
2015-01-01
2,4,6-Trichlorophenol is a phenolic compound which is widely used in the production of pesticides, herbicides, wood, leather and glue preservatives. In addition, 2,4,6- trichlorophenol may form during the treatment of phenol containing industrial wastewater with hypochlorite or during the disinfection of drinking-water sources. The removal of 2,4,6-trichlorophenol is significant because of its high toxicity, carcinogenic properties and persistence [1].In this study, the adsorption of 2,4,6-tr...
Ren, Man; Zeng, Hao; Peng, Ping-An; Li, Hui-Ru; Tang, Cai-Ming; Hu, Jian-Fang
2017-07-01
Polybrominated dibenzo-p-dioxins (PBDDs) and hydroxylated polybrominated diphenyl ethers (OH-PBDEs) can be formed from bromophenols (BPs) by thermal degradation, biosynthesis or phototransformation. However, it is unknown whether PBDDs and OH-PBDEs can be formed during the chemical production processes that utilize BPs as raw materials. 2,4,6-tribromophenol (2,4,6-TBP) is an important raw material for the synthesis of 1,2-bis(2,4,6-tribromophenoxy)ethane (BTBPE), a novel brominated flame retardant. In this study, PBDDs, polybrominated dibenzofurans (PBDFs) and OH-PBDEs have been identified and quantified in commercially available BTBPE and 2,4,6-TBP. Furthermore, their formation as unintentional by-products during the laboratory synthesis of BTBPE from 2,4,6-TBP and 1,2-dibromoethane in the presence of sodium carbonate has also been investigated. 2,3,7,8-substituted PBDDs and PBDFs (2,3,7,8-PBDD/Fs) were undetectable in commercial samples of BTBPE and present in low levels (nanogram per gram) in 2,4,6-TBP. Two tetrabrominated dibenzo-p-dioxins (TeBDDs), namely 1,3,6,8- and 1,3,7,9-TeBDD, and three hydroxylated pentabrominated diphenyl ethers (OH-pentaBDEs), namely 4'-OH-BDE121, 2'-OH-BDE121, and 6'-OH-BDE100, were identified or tentatively identified, and quantitatively estimated to be at concentrations in the range of undetectable to several thousands of nanograms per gram in commercial BTBPE and 2,4,6-TBP. TeBDDs and OH-pentaBDEs were formed as by-products from 2,4,6-TBP during BTBPE synthesis. Further studies need to be conducted in order to determine whether PBDD/Fs and OH-PBDEs are also formed during the industrial synthesis of other chemical compounds that utilize BPs as raw materials or intermediates. Copyright © 2017 Elsevier Ltd. All rights reserved.
Environmental concentrations and toxicology of 2,4,6-tribromophenol (TBP).
Koch, Christoph; Sures, Bernd
2018-02-01
2,4,6-Tribromophenol is the most widely produced brominated phenol. In the present review, we summarize studies dealing with this substance from an environmental point of view. We cover concentrations in the abiotic and biotic environment including humans, toxicokinetics as well as toxicodynamics, and show gaps of the current knowledge about this chemical. 2,4,6-Tribomophenol occurs as an intermediate during the synthesis of brominated flame retardants and it similarly represents a degradation product of these substances. Moreover, it is used as a pesticide but also occurs as a natural product of some aquatic organisms. Due to its many sources, 2,4,6-tribromophenol is ubiquitously found in the environment. Nevertheless, not much is known about its toxicokinetics and toxicodynamics. It is also unclear which role the structural isomer 2,4,5-tribromophenol and several degradation products such as 2,4-dibromophenol play in the environment. Due to new flame retardants that enter the market and can degrade to 2,4,6-tribromophenol, this compound will remain relevant in future years - not only in aquatic matrices, but also in house dust and foodstuff, which are an important exposure route for humans. Copyright © 2017 Elsevier Ltd. All rights reserved.
Slamet, Raudina
2017-11-01
Industrial waters in coal pyrolysis process, synthetic chemicals and oil and gas process contain phenol derivatives that are dangerous to the environment and needs to be removed, one of them is 2,4,6-Trichlorophenol. Degradation of 2,4,6-Trichlorophenol and hydrogen production simultaneously have been investigated using TiNT/Graphene composite at various graphene loading and initial concentration of 2,4,6-Trichlorophenol. Optimal graphene loading of 0.6 wt% was obtained in the simultaneous system with 89% elimination of 2,4,6-Trichlorophenol and 986 µmol of hydrogen production. Test results showed that addition of 2,4,6-Trichlorophenol would subsequently increased 2,4,6-Trichlorophenol conversion and enhanced hydrogen production linearly. 2.7 times greater hydrogen production was found in addition of 50 ppm 2,4,6-Trichlorophenol.
48 CFR 552.246-77 - Additional Contract Warranty Provisions for Supplies of a Noncomplex Nature.
2010-10-01
... Warranty Provisions for Supplies of a Noncomplex Nature. 552.246-77 Section 552.246-77 Federal Acquisition... a Noncomplex Nature. As prescribed in 546.710(a), insert the following clause in solicitations and contracts that include FAR 52.246-17, Warranty of Supplies of a Noncomplex Nature. Additional Contract...
Total and spontaneous fission half-lives of the americium and curium nuclides
International Nuclear Information System (INIS)
Holden, N.E.
1984-01-01
The total half-life and the half-life for spontaneous fission are evaluated for the various long-lived nuclides of interest. Recommended values are presented for 241 Am, /sup 242m/Am, 243 Am, 242 Cm, 243 Cm, 244 Cm, 245 Cm, 246 Cm, 247 Cm, 248 Cm, and 250 Cm. The uncertainties are provided at the 95% confidence limit for each of the recommended values
Leonetti, Christopher; Butt, Craig M.; Hoffman, Kate; Miranda, Marie Lynn; Stapleton, Heather M.
2015-01-01
Legacy environmental contaminants such as polybrominated diphenyl ethers (PBDEs) are widely detected in human tissues. However, few studies have measured PBDEs in placental tissues, and there are no reported measurements of 2,4,6-tribromophenol (2,4,6-TBP) in placental tissues. Measurements of these contaminants are important for understanding potential fetal exposures, as these compounds have been shown to alter thyroid hormone regulation in vitro and in vivo. In this study, we measured a suite of PBDEs and 2,4,6-TBP in 102 human placental tissues collected between 2010–2011 in Durham County, North Carolina, USA. The most abundant PBDE congener detected was BDE-47, with a mean concentration of 5.09 ng/g lipid (range: 0.12–141 ng/g lipid; detection frequency 91%); however, 2,4,6-TBP was ubiquitously detected and present at higher concentrations with a mean concentration of 15.4 ng/g lipid (range:1.31–316 ng/g lipid; detection frequency 100%). BDE-209 was also detected in more than 50% of the samples, and was significantly associated with 2,4,6-TBP in placental tissues, suggesting they may have a similar source, or that 2,4,6-TBP may be a degradation product of BDE-209. Interestingly, BDE-209 and 2,4,6-TBP were negatively associated with age (rs=−0.16; p=0.10 and rs=−0.17; p=0.08, respectively). The results of this work indicate that PBDEs and 2,4,6-TBP bioaccumulate in human placenta tissue and likely contribute to prenatal exposures to these environmental contaminants. Future studies are needed to determine if these joint exposures are associated with any adverse health measures in infants and children. PMID:26700418
33 CFR 148.246 - When is a document considered filed and where should I file it?
2010-07-01
... filed and where should I file it? 148.246 Section 148.246 Navigation and Navigable Waters COAST GUARD... Formal Hearings § 148.246 When is a document considered filed and where should I file it? (a) If a document to be filed is submitted by mail, it is considered filed on the date it is postmarked. If a...
In vitro efficacy of ST246 against smallpox and monkeypox.
Smith, Scott K; Olson, Victoria A; Karem, Kevin L; Jordan, Robert; Hruby, Dennis E; Damon, Inger K
2009-03-01
Since the eradication of smallpox and the cessation of routine childhood vaccination for smallpox, the proportion of the world's population susceptible to infection with orthopoxviruses, such as variola virus (the causative agent of smallpox) and monkeypox virus, has grown substantially. In the United States, the only vaccines for smallpox licensed by the Food and Drug Administration (FDA) have been live virus vaccines. Unfortunately, a substantial number of people cannot receive live virus vaccines due to contraindications. Furthermore, no antiviral drugs have been fully approved by the FDA for the prevention or treatment of orthopoxvirus infection. Here, we show the inhibitory effect of one new antiviral compound, ST-246, on the in vitro growth properties of six variola virus strains and seven monkeypox virus strains. We performed multiple assays to monitor the cytopathic effect and to evaluate the reduction of viral progeny production and release in the presence of the compound. ST-246 had 50% effective concentrations of
21 CFR 520.246 - Butorphanol tartrate tablets.
2010-04-01
....246 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...) Conditions of use. The drug is used for the treatment of dogs as follows: (1) Amount. 0.25 milligram of... associated with inflammatory conditions of the upper respiratory tract. (3) Limitations. For oral use in dogs...
Bai, Xiuzhi; Zhang, Ting; Qu, Zhipeng; Li, Haipu; Yang, Zhaoguang
2017-09-01
In this study, the distribution of 2,4,6-trichloroanisole (2,4,6-TCA) in two water supply reservoirs and four associated drinking water treatment plants (DWTPs) were investigated. The 2,4,6-TCA concentrations were in the range of 1.53-2.36 ng L -1 in water supply reservoirs and 0.76-6.58 ng L -1 at DWTPs. To determine the contribution of filamentous fungi to 2,4,6-TCA in a full-scale treatment process, the concentrations of 2,4,6-TCA in raw water, settled water, post-filtration water, and finished water were measured. The results showed that 2,4,6-TCA levels continuously increased until chlorination, suggesting that 2,4,6-TCA could form without a chlorination reaction and fungi might be the major contributor to the 2,4,6-TCA formation. Meanwhile, twenty-nine fungal strains were isolated and identified by morphological and molecular biological methods. Of the seventeen isolated fungal species, eleven showed the capability to convert 2,4,6-trichlorophenol (2,4,6-TCP) to 2,4,6-TCA. The highest level of 2,4,6-TCA formation was carried out by Aspergillus versicolor voucher BJ1-3: 40.5% of the original 2,4,6-TCP was converted to 2,4,6-TCA. There was a significant variation in the capability of different species to generate 2,4,6-TCA. The results from the proportions of cell-free, cell-attached, and cell-bound 2,4,6-TCA suggested that 2,4,6-TCA generated by fungi was mainly distributed in their extracellular environment. In addition to 2,4,6-TCA, five putative volatile by-products were also identified by gas chromatography and mass spectrometry. These findings increase our understanding on the mechanisms involved in the formation of 2,4,6-TCA and provide insights into managing and controlling 2,4,6-TCA-related problems in drinking water. Copyright © 2017 Elsevier Ltd. All rights reserved.
48 CFR 246.370 - Material inspection and receiving report.
2010-10-01
... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT QUALITY ASSURANCE Contract Clauses 246.370... deliverable is a scientific or technical report; (5) Research and development contracts not requiring the...
Directory of Open Access Journals (Sweden)
Surawut Sangmanee
2016-06-01
Full Text Available Bacillus licheniformis RN-01 levansucrase Y246S (LsRN-Y246S was immobilized by covalently linking onto chitosan, Sepabead EC-EP, and Sepabead EC-HFA, beads. The stability of immobilized LsRN-Y246S was found to be the highest with chitosan beads, retaining more than 70% activity after 13 weeks storage at 4 oC, and 68% activity after 12 hours incubation at 40°C. LsRN-Y246S immobilized on chitosan beads withstands sucrose concentrations up to 70% (w/v, retaining over 85% of its activity, significantly better than LsRN-Y246S immobilized on others supporting matrices. LsRN-Y246S immobilized on chitosan showed a 2.4 fold increase in activity in the presence of Mn2+, and gave slight protection against deactivation by of Cu2+, Zn2+, Fe3+, SDS and EDTA. A maximum of 8.36 g and an average of 7.35 g LFOS yield at least up to DP 11 can be produced from 25 g of sucrose, during five production cycles. We have demonstrated that LFOS can be effectively produced by chitosan immobilized LsRN-Y246S and purified.
48 CFR 52.246-1 - Contractor Inspection Requirements.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor Inspection....246-1 Contractor Inspection Requirements. As prescribed in 46.301, insert the following clause: Contractor Inspection Requirements (APR 1984) The Contractor is responsible for performing or having...
APR-246/PRIMA-1Met Inhibits and Reverses Squamous Metaplasia in Human Conjunctival Epithelium.
Li, Jing; Li, Cheng; Wang, Guoliang; Liu, Zhen; Chen, Pei; Yang, Qichen; Dong, Nuo; Wu, Huping; Liu, Zuguo; Li, Wei
2016-02-01
Squamous metaplasia is a common pathologic condition in ocular surface diseases for which there is no therapeutic medication in clinic. In this study, we investigated the effect of a small molecule, APR-246/PRIMA-1(Met), on squamous metaplasia in human conjunctival epithelium. Human conjunctival explants were cultured for up to 12 days under airlifting conditions. Epithelial cell differentiation and proliferation were assessed by Cytokeratin 10 (K10), K14, K19, Pax6, MUC5AC, and p63 immunostaining patterns. β-catenin and TCF-4 immunofluorescent staining and real-time PCR characterized Wnt signaling pathway involvement. Pterygium clinical samples were cultured under airlifting conditions with or without APR-246 for 4 days. p63, K10, β-catenin, and TCF-4 expression in pterygial epithelium was determined by immunofluorescent staining and real-time PCR. Airlift conjunctival explants resulted in increased stratification and intrastromal epithelial invagination. Such pathology was accompanied by increases in K10, K14, and p63 expression, whereas K19 and Pax6 levels declined when compared to those in freshly isolated tissue. On the other hand, APR-246 reversed all of these declines in K10, K14, and p63 expression. Furthermore, K19 and Pax6 increased along with rises in goblet cell density. These effects of APR-246 were accompanied by near restoration of normal conjunctival epithelial histology. APR-246 also reversed squamous metaplasia in pterygial epithelium that had developed after 4 days in ex vivo culture. Reductions in squamous metaplasia induced by APR-246 suggest it may provide a novel therapeutic approach in different squamous metaplasia-associated ocular surface diseases.
International Nuclear Information System (INIS)
Frolova, L.M.; Frolov, A.A.; Vasil'ev, V.Ya.
1984-01-01
Radiation-chemical behaviour of neptunium ions in nitric acid solutions is studied under the action of intensive internal alpha-irradiation conditioned by curium nuclides. In 0.3-1.1 mol/l solutions of nitric acid radiation-chemical oxidation of neptunium (4) and reduction of neptunium (6) is obeyed to the first order law of reaction rate in respect to neptunium concentration. Effective constants of neptunium (4) oxidation rates and neptuniumi(6) reduction rates are not dependent on neptunium ion in1tial concentration and increase with a growth of a dose rate of alpha-irradiation of solution. In equilibrium only neptunium (5) and neptunium (6) are present in solutions with HNO 3 concentration less than 1 mol/l. In more concentrated solutions equilibrium between sexa-, penta- and tetravalent neptunium forms is established. Equilibrium concentrations of neptunium valent forms are not dependent on neptunium initial oxidation state under the same initial conditions (dose rate, neptunium concentration and acidity. It is shown form experimental data that under the action of alpha-irradiation neptunium (5) both is oxidated to neptunium (6) and is reduced to neptunium (4)
International Nuclear Information System (INIS)
Paviet, P.; Fanghaenel, T.; Klenze, R.; Kim, J.I.
1996-01-01
The formation of sulfate complexes of Curium in aqueous solutions is studied by time resolved laser fluorescence spectroscopy (TRLFS) at 25 C. The species Cm 3+ , Cm(SO 4 ) - , Cm(SO 4 ) - 2 and Cm(SO 4 ) 3- 3 are quantified spectroscopically in the trace concentration range by peak deconvolution of fluorescence emission spectra. The complex formation equilibria are measured in NaCl/ Na 2 SO 4 solutions of constant ionic strength (3 molal) as a function of the sulfate concentration. The stability constants of Cm(SO 4 ) + and Cm(SO 4 ) - 2 are determined to be log β 1 = 0.93±0.08 and log β 2 = 0.61±0.08, respectively. The complex Cm(SO 4 ) 3- 3 is found to be stable only at very high sulfate concentrations (above 1 molal) and therefore not considered for further evaluation. (orig.)
Transport of plutonium, americium, and curium from soils into plants by roots
International Nuclear Information System (INIS)
Pimpl, M.; Schuettelkopf, H.
1979-12-01
For assessing the dose from radionuclides in agricultural products by ingestion it is necessary to know the soil to plant transfer factors. The literature was entirely investigated, in order to judge the size of the soil to plant transfer factors. In total, 92 publications - from 1948 to 1978 -have been evaluated. As result, transfer factors from 10 -9 to 10 -3 have been found for Plutonium, and from 10 -6 to 1 for Americium. For Curium only few data are available in literature. The considerable variation of the measured transfer factors is based on the dependence of these transfer factors from the ion exchange capacity of soils, from the amount of organic materials, from the pH-value, and from the mode of contamination. There are, in any case, contradictory data, although there has been detected a dependence of the transfer factors from these parameters. Chelating agenst increase the transfer factors to approximately 1300. As well, fertilizers have an influence on the size of the transfer factors - however, the relationships have been scarcely investigated. The distribution of actinides within the individual parts of plants has been investigated. The highest concentrations are in the roots; in the plant parts above ground the concentration of actinides decreases considerably. The most inferior transfer factors were measured for the respective seed or fruits. The soil to plant transfer factors of actinides are more dependend on the age of the plants within one growing period. At the beginning of the period, the transfer factor is considerably higher than at the end of this period. With respect to plants with a growing period of several years, correlations are unknown. (orig.) [de
32 CFR Appendix E to Part 246 - Stars and Stripes (S&S) Board of Directors
2010-07-01
... of directors shall monitor planning and execution of the S&S business activities. 2. The S&S board of... DEFENSE (CONTINUED) MISCELLANEOUS STARS AND STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS Pt. 246, App. E Appendix E to Part 246—Stars and Stripes (S&S) Board of Directors A. Organization and Management...
International Nuclear Information System (INIS)
Zheng, Xiangli; Liu, Shan; Hua, Xiaoxia; Xia, Fangquan; Tian, Dong; Zhou, Changli
2015-01-01
Graphical abstract: Display Omitted -- Highlights: •A novel electrochemical sensing platform by self-assembling of HS-β-cyclodextrin/gold nanoparticles onto indium tin oxide electrode (HS-β-CD/AuNPs/SAM/ITO electrode) surface was constructed. •The proposed electrochemical sensor exhibited high sensitivity for the determination 2,4,6-trichlorophenol which electrochemical activity is very weak. •The newly developed method was successfully applied to quantitatively determine 2,4,6-trichlorophenol in tap water samples. -- ABSTRACT: A new electrochemical sensor for determination of 2,4,6-trichlorophenol (2,4,6-TCP) was fabricated. The characterization of the sensor was studied by scanning electron microscopy, electrochemical impedance spectroscopy and cyclic voltammetry techniques. The electrochemical behavior of 2,4,6-TCP was investigated using cyclic voltammetry and differential pulse voltammetry at the HS-β-cyclodextrin (HS-β-CD)/gold nanoparticles (AuNPs) composite modified indium tin oxide (ITO) electrode. The results showed that the current responses of 2,4,6-TCP greatly enhanced due to the high catalytic activity and enrichment capability of composites. The peak current of 2,4,6-TCP increases linearly with the increase of the 2,4,6-TCP concentration from 3.0 × 10 −9 to 2.8 × 10 −8 M, with the limit of detection of 1.0 × 10 −9 . Further more, the modified electrode was successfully applied to detect the level of 2,4,6-TCP in tap water samples with excellent sensitivity
Investigation of neutron resonances of 247Cm in the 0.5-20 eV energy range
International Nuclear Information System (INIS)
Belanova, T.S.; Kolesov, A.G.; Klinov, A.V.; Nikol'skij, S.N.; Poruchikov, V.A.; Nefedov, V.N.; Artamonov, V.S.; Ivanov, R.N.; Kalebin, S.M.
1979-01-01
The neutron resonance parameters of 247 Cm were calculated from the transmission of a curium sample measured by the time-of-flight method. The neutron resonance parameters were calculated by the shape method using the single-level Breit-Wigner formula. Since the neutron resonance parameters of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu are well known, it was possible to identify the neutron resonances of 247 Cm from the measured transmission and calculate their parameters. We identified only five neutron resonances of 247 Cm with high values of 2gGAMMAsub(n). This is due to the fact that the 247 Cm content of the sample is low (1.7mg) and the resonances of this isotope are identified against the background of a large number of resonances of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu situated in the energy range in question
Energy Technology Data Exchange (ETDEWEB)
Shi, Xiangli [Environment Research Institute, Shandong University, Jinan 250100 (China); Yu, Wanni [Environment Research Institute, Shandong University, Jinan 250100 (China); College of Resources and Environment, Linyi University, Linyi 276000 (China); Xu, Fei [Environment Research Institute, Shandong University, Jinan 250100 (China); Zhang, Qingzhu, E-mail: zqz@sdu.edu.cn [Environment Research Institute, Shandong University, Jinan 250100 (China); Hu, Jingtian; Wang, Wenxing [Environment Research Institute, Shandong University, Jinan 250100 (China)
2015-09-15
Highlights: • We studied the formation of PBCDD/Fs from the reaction of three CPRs with BPRs. • The substitution pattern of halogenated phenols determines those of PBCDD/Fs. • The substitution of halogenated phenols influence the coupling of phenoxy radicals. • The rate constants of the crucial elementary steps were evaluated. - Abstract: Quantum chemical calculations were carried out to investigate the homogeneous gas-phase formation of mixed polybrominated/chlorinated dibenzo-p-dioxins/benzofurans (PBCDD/Fs) from the cross-condensation of 2-chlorophenoxy radical (2-CPR) with 2-bromophenoxy radical (2-BPR), 2,4-dichlorophenoxy radical (2,4-DCPR) with 2,4-dibromophenoxy radical (2,4-DBPR), and 2,4,6-trichlorophenoxy radical (2,4,6-TCPR) with 2,4,6-tribromophenoxy radical (2,4,6-TBPR). The geometrical parameters and vibrational frequencies were calculated at the MPWB1K/6-31+G(d,p) level, and single-point energy calculations were performed at the MPWB1K/6-311+G(3df,2p) level of theory. The rate constants of the crucial elementary reactions were evaluated by the canonical variational transition-state (CVT) theory with the small curvature tunneling (SCT) correction over a wide temperature range of 600–1200 K. Studies show that the substitution pattern of halogenated phenols not only determines the substitution pattern of the resulting PBCDD/Fs, but also has a significant influence on the formation mechanism of PBCDD/Fs, especially on the coupling of the halogenated phenoxy radicals.
Pires, Mariana A; Rodrigues, Nathália F S; de Oliveira, Danilo B; de Assis, Felipe L; Costa, Galileu B; Kroon, Erna G; Mota, Bruno E F
2018-04-01
The Orthopoxvirus (OPV) genus of the Poxviridae family contains several human pathogens, including Vaccinia virus (VACV), which have been implicating in outbreaks of a zoonotic disease called Bovine Vaccinia in Brazil. So far, no approved treatment exists for OPV infections, but ST-246 and Cidofovir (CDV) are now in clinical development. Therefore, the objective of this work was to evaluate the susceptibility of five strains of Brazilian VACV (Br-VACV) to ST-246 and Cidofovir. The susceptibility of these strains to both drugs was evaluated by plaque reduction assay, extracellular virus's quantification in the presence of ST-246 and one-step growth curve in cells treated with CDV. Besides that, the ORFs F13L and E9L were sequenced for searching of polymorphisms associated with drug resistance. The effective concentration of 50% (EC 50 ) from both drugs varies significantly for different strains (from 0.0054 to 0.051 μM for ST-246 and from 27.14 to 61.23 μM for CDV). ST-246 strongly inhibits the production of extracellular virus for all isolates in concentrations as low as 0.1 μM and it was observed a relevant decrease of progeny production for all Br-VACV after CDV treatment. Sequencing of the F13L and E9L ORFs showed that Br-VACV do not present the polymorphism(s) associated with resistance to ST-246 and CDV. Taken together, our results showed that ST-246 and CDV are effective against diverse, wild VACV strains and that the susceptibility of Br-VACV to these drugs mirrored the phylogenetic split of these isolates into two groups. Thus, both ST-246 and CDV are of great interest as compounds to treat individuals during Bovine Vaccinia outbreaks in Brazil. Copyright © 2018 Elsevier B.V. All rights reserved.
Z dependence of the N=152 deformed shell gap: In-beam γ-ray spectroscopy of neutron-rich 245,246Pu
International Nuclear Information System (INIS)
Makii, H.; Ishii, T.; Asai, M.; Tsukada, K.; Toyoshima, A.; Ichikawa, S.; Matsuda, M.; Makishima, A.; Kaneko, J.; Toume, H.; Shigematsu, S.; Kohno, T.; Ogawa, M.
2007-01-01
We have measured in-beam γ rays in the neutron-rich 246 Pu 152 and 245 Pu 151 nuclei by means of 244 Pu( 18 O, 16 O) 246 Pu and 244 Pu( 18 O, 17 O) 245 Pu neutron transfer reactions, respectively. The γ rays emitted from 246 Pu ( 245 Pu) were identified by selecting the kinetic energy of scattered 16 O ( 17 O) detected by Si ΔE-E detectors. The ground-state band of 246 Pu was established up to the 12 + state. We have found that the shell gap of N=152 is reduced in energy with decreasing atomic number by extending the systematics of the one-quasiparticle energies in N=151 nuclei into those in 245 Pu. This reduction of the shell gap clearly affects the 2 + energy of the ground-state band of 246 Pu
Development of the small-molecule antiviral ST-246® as a smallpox therapeutic
Grosenbach, Douglas W; Jordan, Robert; Hruby, Dennis E
2011-01-01
Naturally occurring smallpox has been eradicated, yet it remains as one of the highest priority pathogens due to its potential as a biological weapon. The majority of the US population would be vulnerable in a smallpox outbreak. SIGA Technologies, Inc. has responded to the call of the US government to develop and supply to the Strategic National Stockpile a smallpox antiviral to be deployed in the event of a smallpox outbreak. ST-246® (tecovirimat) was initially identified via a high-throughput screen in 2002, and in the ensuing years, our drug-development activities have spanned in vitro analysis, preclinical safety, pharmacokinetics and efficacy testing (all according to the ‘animal rule’). Additionally, SIGA has conducted Phase I and II clinical trials to evaluate the safety, tolerability and pharmacokinetics of ST-246, bringing us to our current late stage of clinical development. This article reviews the need for a smallpox therapeutic and our experience in developing ST-246, and provides perspective on the role of a smallpox antiviral during a smallpox public health emergency. PMID:21837250
8 CFR 246.4 - Immigration judge's authority; withdrawal and substitution.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Immigration judge's authority; withdrawal... IMMIGRATION REGULATIONS RESCISSION OF ADJUSTMENT OF STATUS § 246.4 Immigration judge's authority; withdrawal and substitution. In any proceeding conducted under this part, the immigration judge shall have...
2010-04-01
... as possible in the construction process. If Tribal construction standards are consistent with or... 25 Indians 2 2010-04-01 2010-04-01 false Must an AFA that contains a construction project or activity incorporate provisions of Federal construction standards? 1000.246 Section 1000.246 Indians OFFICE...
Liu, Ruqin; Huang, Ming; Yao, Xiaolu; Chen, Shuang; Wang, Shucun; Suo, Zhirong
2018-06-01
2,4,6-Triamino-1,3,5-trinitrobenzene is the attractive insensitive high energetic material used extensively in the military and civil fields. Combined with the double-films theory, the global gas-liquid chemical reaction kinetics of 2,4,6-triamino-1,3,5-trinitrobenzene was developed by means of the infinitesimal material balance calculation. The raw material concentration and reactive temperature effects on the crystallization of 2,4,6-triamino-1,3,5-trinitrobenzene were investigated by the batch experiments. The reactive crystallization kinetics associated ammonia feeding rate of 2,4,6-triamino-1,3,5-trinitrobenzene, including nucleation as well as crystal growth, was systematically investigated in the heterogonous semi-batch procedure. The nucleation and crystal growth kinetic exponents were estimated by the linear least-squares method. The crystallization kinetic results indicated that nucleation rate strongly increased but liner growth rate decreased with the increasing of ammonia feeding rate. In terms of manufacturing coarse 2,4,6-triamino-1,3,5-trinitrobenzene, it was found that a slow ammonia feeding rate and a low raw material concentration were feasible under the present experimental conditions.
Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms
International Nuclear Information System (INIS)
Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z.; Gillow, J.B.; Francis, A.J.
2004-01-01
We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K d ) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N H 2 O ) and the degree of strength of ligand field (R E/M ) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K d of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K d , indicating that an exchange with Na + on the functional groups was involved in their sorption. The ΔN H 2 O (= 9 - N H 2 O ) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R E/M for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)
Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms
Energy Technology Data Exchange (ETDEWEB)
Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z. [Advanced Science Research Center, Japan Atomic Energy Research Inst., Ibaraki (Japan); Gillow, J.B.; Francis, A.J. [Environmental Sciences Dept., Brookhaven National Lab., Upton, NY (United States)
2004-07-01
We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K{sub d}) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N{sub H{sub 2}O}) and the degree of strength of ligand field (R{sub E/M}) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K{sub d} of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K{sub d}, indicating that an exchange with Na{sup +} on the functional groups was involved in their sorption. The {delta}N{sub H{sub 2}O} (= 9 - N{sub H{sub 2}O}) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R{sub E/M} for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)
1,3,5-Triazine-2,4,6-triyltrisulfamic acid (TTSA)
Indian Academy of Sciences (India)
Melamine reacted with chlorosufonic acid (ClSO3H) to form a new sulfamic-type acid, 1,3,5-triazine-2,4,6-triyltrisulfamic acid (TTSA). Both nitrosation of secondary amines and oxidation of urazoles were accomplished by using TTSA/NaNO2 system under mild and heterogeneous conditions with good to excellent yields.
Mitchell, Alexander R.; Pagoria, Philip F.; Schmidt, Robert D.
1996-01-01
The present invention relates to a process to produce 1,3-diamino-2,4,6-trinitrobenzene (DATB) or 1,3,5-triamino-2,4,6,-trinitrobenzene (TATB) by: (a) reacting at ambient pressure and a temperature of between about 0.degree. and 50.degree. C. for between about 0.1 and 24 hr, a trinitroaromatic compound of structure V: ##STR1## wherein X, Y, and Z are each independently selected from --H, or --NH.sub.2, with the proviso that at least 1 or 2 of X, Y, and Z are hydrogen, with an amount effective to produce DATB or TATB of 1,1,1-trialkylhydrazinium halide wherein alkyl is selected from methyl, ethyl, propyl or butyl and halide is selected from chloride, bromide or iodide. in the presence of a strong base selected from sodium butoxide, potassium butoxide, potassium propoxide, sodium propoxide, sodium ethoxide, potassium ethoxide, sodium methoxide, potassium methoxide, and combinations thereof; in a solvent selected from the group consisting of methanol, ethanol, propanol, butanol, dimethylsulphoxide, N-methylpyrrolidone, hexamethylphosphoramide, dimethylformide, dimethylacetamide and mixtures thereof, provided that when alcohols are present primarily DATB and picramide is formed; and (b) isolating the DATB or TATB produced. DATB and TATB are useful specialty explosives. TATB is also used for the preparation of benzenehexamine, a starting material for the synthesis of novel materials (optical imaging devices, liquid crystals, ferromagnetic compounds).
Guo, Jiehong; Stubbings, William A; Romanak, Kevin; Nguyen, Linh V; Jantunen, Liisa; Melymuk, Lisa; Arrandale, Victoria; Diamond, Miriam L; Venier, Marta
2018-03-20
A high molecular weight compound, 2,4,6-tris(2,4,6-tribromophenoxy)-1,3,5-triazine (TTBP-TAZ), was detected during the analysis of brominated flame retardants in dust samples collected from an electrical and electronic waste (e-waste) recycling facility in Ontario, Canada. Gas chromatography coupled with both high-resolution and low-resolution mass spectrometry (MS) was used to determine TTBP-TAZ's chemical structure and concentrations. To date, TTBP-TAZ has only been detected in plastic casings of electrical and electronic equipment and house dust from The Netherlands. Here we report on the concentrations of TTBP-TAZ in selected samples from North America: e-waste dust ( n = 7) and air ( n = 4), residential dust ( n = 30), and selected outdoor air ( n = 146), precipitation ( n = 19), sediment ( n = 11) and water ( n = 2) samples from the Great Lakes environment. TTBP-TAZ was detected in all the e-waste dust and air samples, and in 70% of residential dust samples. The median concentrations of TTBP-TAZ in these three types of samples were 5540 ng/g, 5.75 ng/m 3 and 6.76 ng/g, respectively. The flame retardants 2,4,6-tribromophenol, tris(2,3-dibromopropyl) isocyanurate, and 3,3',5,5'-tetrabromobisphenol A bis(2,3-dibromopropyl) ether, BDE-47 and BDE-209 were also measured for comparison. None of these other flame retardants concentrations was significantly correlated with those of TTBP-TAZ in any of the sample types suggesting different sources. TTBP-TAZ was not detected in any of the outdoor environmental samples, which may relate to its application history and physicochemical properties. This is the first report of TTBP-TAZ in North America.
Complete dissipation of 2,4,6-trinitrotoluene by in-vessel composting
Gümüscü, B.; Cekmecelioglu, Deniz; Tekinay, Turgay
2015-01-01
We demonstrate complete removal of 2,4,6-trinitrotoluene (TNT) in 15 days using an in-vessel composting system, which is amended with TNT-degrading bacteria strains. A mixture of TNT, food waste, manure, wood chips, soil and TNT-degrading bacteria consortium are co-composted for 15 days in an
Evaluation of neutron cross sections for 244Cm, 246Cm, and 248Cm
International Nuclear Information System (INIS)
Benjamin, R.W.; McCrosson, F.J.; Gettys, W.E.
1977-01-01
An evaluation of neutron cross sections for 244 246 248 Cm using the ENDF/B format is presented. Primary data input included differential measurements, integral measurements, nuclear model calculations, and reactor production experience
PNN NGC 246: A Complex Photometric Behaviour That Requires Wet
Directory of Open Access Journals (Sweden)
Pérez J. M. González
2003-03-01
Full Text Available We present a study over three single-site campaigns to investigate the photometric behaviour of the PNN NGC 246. We observed this object in 2000 and 2001. The analysis of the light curves indicates complex and variable temporal spectra. Using wavelet analysis we have found evidences for changes on time scales of hours in the 2000 dataset. The temporal spectra obtained during 2001 are quite different from the results of the previous year. The modulations in the light curve are more noticeable and the temporal spectra present a higher number of modulation frequencies. One peculiar characteristic is the presence of a variable harmonic structure related to one of these modulation frequencies. This complex photometric behaviour may be explained by a more complicated unresolved combination of modulation frequencies, but more likely due to a combination of pulsations of the star plus modulations related to interaction with a close companion, maybe indicating a disc. However, these characteristics cannot be confirmed from single site observations. The complex and variable behaviour of NGC 246 needs the WET co-operation in order to completely resolve its light curve.
Directory of Open Access Journals (Sweden)
Norbert Moszner
2010-03-01
Full Text Available Because of the poor solubility of the commercially available bisacylphosphine oxides in dental acidic aqueous primer formulations, bis(3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoyl(phenylphosphine oxide (WBAPO was synthesized starting from 3-(chloromethyl-2,4,6-trimethylbenzoic acid by the dichlorophosphine route. The substituent was introduced by etherification with 2-(allyloxyethanol. In the second step, 3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoic acid was chlorinated. The formed acid chloride showed an unexpected low thermal stability. Its thermal rearrangement at 180 °C resulted in a fast formation of 3-(chloromethyl-2,4,6-trimethylbenzoic acid 2-(allyloxyethyl ester. In the third step, the acid chloride was reacted with phenylphosphine dilithium with the formation of bis(3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoyl(phenylphosphine, which was oxidized to WBAPO. The structure of WBAPO was confirmed by 1H NMR, 13C NMR, 31P NMR, and IR spectroscopy, as well as elemental analysis. WBAPO, a yellow liquid, possesses improved solubility in polar solvents and shows UV–vis absorption, and a high photoreactivity comparable with the commercially available bisacylphosphine oxides. A sufficient storage stability was found in dental acidic aqueous primer formulations.
Barik, Arati J; Gogate, Parag R
2018-01-01
Utilization of hybrid treatment schemes involving advanced oxidation processes and hydrodynamic cavitation in the wastewater treatment forms the prime focus of the present work. The initial phase of the work includes analysis of recent literature relating to the performance of combined approach based on hydrodynamic cavitation (HC) for degradation of different pollutants followed by a detailed investigation into degradation of 2,4,6-trichlorophenol (2,4,6-TCP). The degradation of the priority pollutant, 2,4,6-TCP, using combination of HC based on slit-venturi used as the cavitating device, ozone and H 2 O 2 has been investigated. The effect of operating pressure (2-5bar) and initial pH (3-11) have been investigated for the degradation using only HC. The degradation using only ozone (100-400mg/h) and only H 2 O 2 has also been studied. The efficacy of the combined operation of HC+O 3 at different ozone flow rates (100-400mg/h) and the combined operation of HC+H 2 O 2 at different loadings of H 2 O 2 (2,4,6-TCP:H 2 O 2 as 1:1-1:7) have been subsequently investigated. The degradation efficacy has also been established for the combined treatment strategies of O 3 +H 2 O 2 and HC+O 3 +H 2 O 2 at the optimum conditions of temperature as 30°C, inlet pressure of 4bar and initial pH of 7. Extent of 2,4,6-TCP degradation, TOC and COD removal obtained for HC+O 3 process were 97.1%, 94.4% and 78.5% respectively whereas for O 3 +H 2 O 2 process, the values were 95.5%, 94.8% and 76.2% and for HC+O 3 +H 2 O 2 process the extent of reduction were 100%, 95.6% and 80.9% in the same order. The combined treatment approach as HC+O 3 +H 2 O 2 was established as the most efficient approach for complete removal of 2,4,6-TCP with near complete TOC removal. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Zhu, Xiaolin; Zhang, Kexin; Lu, Nan; Yuan, Xing
2016-01-01
Graphical abstract: A poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes composite film modified glassy carbon electrode (PRhB/GO/MWCNTs/GCE) was developed for the simultaneous determination of 2,4,6-trichlorophenol (2,4,6-TCP) and pentachlorophenol (PCP) without any pretreatment. - Highlights: • A poly(RhB)/graphene oxide/multiwalled carbon nanotubes composite was synthesized. • The composite film was characterized by SEM, XRD, EIS and Raman spectroscopy. • The simultaneous electrochemical determination of 2,4,6-TCP and PCP was realized. • The electrode showed high sensitivity, excellent reproducibility and good stability. • The electrode was used to determine 2,4,6-TCP and PCP in practical water samples. - Abstract: In the present study, a poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes nanocomposite modified glass carbon electrode (PRhB/GO/MWCNTs/GCE) was developed for the simultaneous determination of 2,4,6-trichlorophenol (2,4,6-TCP) and pentachlorophenol (PCP). The PRhB/GO/MWCNTs film was extensively characterized by emission scanning electron microscopy (SEM), X-ray diffraction (XRD), Raman spectroscopy and electrochemical impedance spectroscopy (EIS). The electrochemical behaviors of 2,4,6-TCP and PCP were investigated by cyclic voltammetry, linear sweep voltammetry and differential pulse voltammetry. Due to the synergistic effect, the PRhB/GO/MWCNTs/GCE significantly facilitated the simultaneous electro-oxidation of 2,4,6-TCP and PCP with peak potential difference of 160 mV and enhanced oxidation currents. Under optimum conditions, the oxidation current of 2,4,6-TCP was linear to its concentration in the ranges of 4.0 × 10"−"9 to 1.0 × 10"−"7 M and 1.0 × 10"−"7 to 1.0 × 10"−"4 M with the detection limit (S/N = 3) of 8.0 × 10"−"1"0 M. And the linear concentration ranges for PCP were 2.0 × 10"−"9 to 1.0 × 10"−"7 M and 1.0 × 10"−"7 to 9.0 × 10"−"5 M with the detection limit of 5.0 × 10"−"1"0 M
Energy Technology Data Exchange (ETDEWEB)
Zhu, Xiaolin; Zhang, Kexin; Lu, Nan; Yuan, Xing, E-mail: yuanx@nenu.edu.cn
2016-01-15
Graphical abstract: A poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes composite film modified glassy carbon electrode (PRhB/GO/MWCNTs/GCE) was developed for the simultaneous determination of 2,4,6-trichlorophenol (2,4,6-TCP) and pentachlorophenol (PCP) without any pretreatment. - Highlights: • A poly(RhB)/graphene oxide/multiwalled carbon nanotubes composite was synthesized. • The composite film was characterized by SEM, XRD, EIS and Raman spectroscopy. • The simultaneous electrochemical determination of 2,4,6-TCP and PCP was realized. • The electrode showed high sensitivity, excellent reproducibility and good stability. • The electrode was used to determine 2,4,6-TCP and PCP in practical water samples. - Abstract: In the present study, a poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes nanocomposite modified glass carbon electrode (PRhB/GO/MWCNTs/GCE) was developed for the simultaneous determination of 2,4,6-trichlorophenol (2,4,6-TCP) and pentachlorophenol (PCP). The PRhB/GO/MWCNTs film was extensively characterized by emission scanning electron microscopy (SEM), X-ray diffraction (XRD), Raman spectroscopy and electrochemical impedance spectroscopy (EIS). The electrochemical behaviors of 2,4,6-TCP and PCP were investigated by cyclic voltammetry, linear sweep voltammetry and differential pulse voltammetry. Due to the synergistic effect, the PRhB/GO/MWCNTs/GCE significantly facilitated the simultaneous electro-oxidation of 2,4,6-TCP and PCP with peak potential difference of 160 mV and enhanced oxidation currents. Under optimum conditions, the oxidation current of 2,4,6-TCP was linear to its concentration in the ranges of 4.0 × 10{sup −9} to 1.0 × 10{sup −7} M and 1.0 × 10{sup −7} to 1.0 × 10{sup −4} M with the detection limit (S/N = 3) of 8.0 × 10{sup −10} M. And the linear concentration ranges for PCP were 2.0 × 10{sup −9} to 1.0 × 10{sup −7} M and 1.0 × 10{sup −7} to 9.0 × 10{sup −5} M with the
48 CFR 1852.246-70 - Mission Critical Space System Personnel Reliability Program.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mission Critical Space... CONTRACT CLAUSES Texts of Provisions and Clauses 1852.246-70 Mission Critical Space System Personnel Reliability Program. As prescribed in 1846.370(a), insert the following clause: Mission Critical Space System...
Energy Technology Data Exchange (ETDEWEB)
Yu, Ping; Pan, Jianming; Yan, Yongsheng [Jiangsu University, Zhenjiang (China); Sun, Qilong; Li, Jianfeng; Tan, Zhenjiang [Jilin Normal University, Siping (China)
2015-04-15
Magnetic molecularly imprinted microspheres (MMIS) were successfully prepared by suspension polymerization, and then as-prepared MMIS were used as adsorbents for selective recognition of 2,4,6-trichlorophenol (2,4,6-TCP) from aqueous solutions. The results composites were characterized by Fourier transform infrared (FT-IR), X-ray diffraction (XRD), thermo gravimetric analysis (TGA), scanning electron microscope (SEM) and vibrating sample magnetometer (VSM). The results demonstrated that MMIS possesses porous spherical morphology, and exhibits good thermal stability and magnetic property (Ms=10.14 emu g{sup -1}). Then batch mode of binding experiments was used to determine the equilibrium, kinetics and selectivity recognition. The Langmuir isotherm model fitted the equilibrium data better than did the Freundlich model, and the maximum adsorption capacity on MMIS was about 1.7 times higher than that of MNIS. Kinetics behaviors of MMIS were well described by the pseudo-second-order model. MMIS possessed outstanding selectivity recognition for 2,4,6-TCP in the presence of other competitive phenols (such as sesamol, 3-CP, thymol, 2,4-DCP). Furthermore, the reusability performance of MMIS showed about 17.53% loss after five repeated cycles. Finally, the MMIS were successfully applied to the selective extraction of 2,4,6-TCP from the vegetable samples.
Peres, António M; Freitas, Patrícia; Dias, Luís G; Sousa, Mara E B C; Castro, Luís M; Veloso, Ana C A
2013-12-15
Chloroanisoles, namely 2,4,6-trichloroanisole, are pointed out as the primary responsible of the development of musty off-flavours in bottled wine, due to their migration from cork stoppers, which results in huge economical losses for wine industry. A prevention step is the detection of these compounds in cork planks before stoppers are produced. Mass spectrometry gas chromatography is the reference method used although it is far beyond economical possibilities of the majority of cork stoppers producers. In this work, a portable cyclic voltammetry approach was used to detect 2,4,6-trichloroanisole extracted from natural cork planks to the aqueous phase during the cork boiling industrial treatment process. Analyses were carried out under ambient conditions, in less than 15 min with a low use of solvent and without any sample pre-treatment. The proposed technique had detection (0.31±0.01 ng/L) and quantification (0.95±0.05 ng/L) limits lower than the human threshold detection level. For blank solutions, without 2,4,6-trichloroanisole addition, a concentration in the order of the quantification limit was estimated (1.0±0.2 ng/L), which confirms the satisfactory performance of the proposed methodology. For aqueous samples from the industrial cork planks boiling procedure, intra-day repeatabilities were lower than 3%, respectively. Also, 2,4,6-trichloroanisole contents in the aqueous samples determined by this novel approach were in good agreement with those obtained by GC-MS (correlation coefficient equal to 0.98), confirming the satisfactory accuracy of the proposed methodology. So, since this novel approach is a fast, low-cost, portable and user-friendly method, it can be an alternative and helpful tool for in-situ industrial applications, allowing accurate detection of releasable 2,4,6-trichloroanisole in an earlier phase of cork stoppers production, which may allow implementing more effective cork treatments to reduce or avoid future 2,4,6-trichloroanisole
48 CFR 52.246-9 - Inspection of Research and Development (Short Form).
2010-10-01
... Clauses 52.246-9 Inspection of Research and Development (Short Form). As prescribed in 46.309, insert the following clause: Inspection of Research and Development (Short Form) (APR 1984) The Government has the... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Inspection of Research and...
48 CFR 52.246-7 - Inspection of Research and Development-Fixed-Price.
2010-10-01
... Clauses 52.246-7 Inspection of Research and Development—Fixed-Price. As prescribed in 46.307(a), insert the following clause: Inspection of Research and Development—Fixed-Price (AUG 1996) (a) The Contractor... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Inspection of Research and...
Zhang, Ting; Wang, Lu; Gao, Congwei; Zhao, Chaoyue; Wang, Yang; Wang, Jianmin
2018-02-01
Hemin immobilized into copper-based metal-organic frameworks was successfully prepared and used as a new electrode material for sensitive electrochemical biosensing. X-ray diffraction patterns, Fourier transform infrared spectra, scanning electron microscopy, UV-vis absorption spectroscopy, and cyclic voltammetry were used to characterize the resultant composites. Due to the interaction between the copper atom groups and hemin, the constrained environment in Cu-MOF-74 acts as a matrix to avoid the dimerization of enzyme molecules and retain its biological activity. The hemin/Cu-MOF composites demonstrated enhanced electrocatalytical activity and high stability towards the oxidation of 2,4,6-trichlorophenol. Under optimum experimental conditions, the sensor showed a wide linear relationship over the range of 0.01-9 μmol L-1 with a detection limit (3σ) of 0.005 μmol L-1. The relative standard deviations were 4.6% and 3.5% for five repeated measurements of 0.5 and 5 μmol L-1 2,4,6-trichlorophenol, respectively. The detection platforms for 2,4,6-trichlorophenol developed here not only indicate that hemin/Cu-MOF-74 possesses intrinsic biological reactivity, but also enable further work to be conducted towards the application of enzyme-containing metal-organic frameworks in electrochemical biosensors.
International Nuclear Information System (INIS)
Pan Zhigang; Xu Mingcan; Cheung, Eugene Y.; Platts, James A.; Harris, Kenneth D.M.; Constable, Edwin C.; Housecroft, Catherine E.
2006-01-01
Structural properties of 2,4,6-trimethoxybenzaldehyde, 2,4,6-trimethoxybenzyl alcohol and 2,4,6-trimethoxyacetophenone have been determined directly from powder X-ray diffraction data, using the direct-space Genetic Algorithm (GA) technique for structure solution followed by Rietveld refinement. Structural similarities and contrasts within this family of materials are elucidated. The work illustrates the value of utilizing information from other sources, including spectroscopic data and computational techniques, as a means of augmenting the structural knowledge established from the powder X-ray diffraction data
International Nuclear Information System (INIS)
Geraldo, Bianca
2012-01-01
Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)
Energy Technology Data Exchange (ETDEWEB)
Gomez-De Jesus, A.; Romano-Baez, F.J.; Leyva-Amezcua, L.; Juarez-Ramirez, C.; Ruiz-Ordaz, N. [Departamento de Ingenieria Bioquimica, Escuela Nacional de Ciencias Biologicas, IPN. Prol. Carpio y Plan de Ayala, Colonia Santo Tomas, s/n. CP 11340, Mexico, D.F. (Mexico); Galindez-Mayer, J. [Departamento de Ingenieria Bioquimica, Escuela Nacional de Ciencias Biologicas, IPN. Prol. Carpio y Plan de Ayala, Colonia Santo Tomas, s/n. CP 11340, Mexico, D.F. (Mexico)], E-mail: cmayer@encb.ipn.mx
2009-01-30
For the aerobic biodegradation of the fungicide and defoliant 2,4,6-trichlorophenol (2,4,6-TCP), a bench-scale packed-bed bioreactor equipped with a net draft tube riser for liquid circulation and oxygenation (PB-ALR) was constructed. To obtain a high packed-bed volume relative to the whole bioreactor volume, a high A{sub D}/A{sub R} ratio was used. Reactor's downcomer was packed with a porous support of volcanic stone fragments. PB-ALR hydrodynamics and oxygen mass transfer behavior was evaluated and compared to the observed behavior of the unpacked reactor operating as an internal airlift reactor (ALR). Overall gas holdup values {epsilon}{sub G}, and zonal oxygen mass transfer coefficients determined at various airflow rates in the PB-ALR, were higher than those obtained with the ALR. When comparing mixing time values obtained in both cases, a slight increment in mixing time was observed when reactor was operated as a PB-ALR. By using a mixed microbial community, the biofilm reactor was used to evaluate the aerobic biodegradation of 2,4,6-TCP. Three bacterial strains identified as Burkholderia sp., Burkholderia kururiensis and Stenotrophomonas sp. constituted the microbial consortium able to cometabolically degrade the 2,4,6-TCP, using phenol as primary substrate. This consortium removed 100% of phenol and near 99% of 2,4,6-TCP. Mineralization and dehalogenation of 2,4,6-TCP was evidenced by high COD removal efficiencies ({approx}95%), and by the stoichiometric release of chloride ions from the halogenated compound ({approx}80%). Finally, it was observed that the microbial consortium was also capable to metabolize 2,4,6-TCP without phenol as primary substrate, with high removal efficiencies (near 100% for 2,4,6-TCP, 92% for COD and 88% for chloride ions)
Solubility of Plutonium (IV) Oxalate During Americium/Curium Pretreatment
International Nuclear Information System (INIS)
Rudisill, T.S.
1999-01-01
Approximately 15,000 L of solution containing isotopes of americium and curium (Am/Cm) will undergo stabilization by vitrification at the Savannah River Site (SRS). Prior to vitrification, an in-tank pretreatment will be used to remove metal impurities from the solution using an oxalate precipitation process. Material balance calculations for this process, based on solubility data in pure nitric acid, predict approximately 80 percent of the plutonium in the solution will be lost to waste. Due to the uncertainty associated with the plutonium losses during processing, solubility experiments were performed to measure the recovery of plutonium during pretreatment and a subsequent precipitation process to prepare a slurry feed for a batch melter. A good estimate of the plutonium content of the glass is required for planning the shipment of the vitrified Am/Cm product to Oak Ridge National Laboratory (ORNL).The plutonium solubility in the oxalate precipitation supernate during pretreatment was 10 mg/mL at 35 degrees C. In two subsequent washes with a 0.25M oxalic acid/0.5M nitric acid solution, the solubility dropped to less than 5 mg/mL. During the precipitation and washing steps, lanthanide fission products in the solution were mostly insoluble. Uranium, and alkali, alkaline earth, and transition metal impurities were soluble as expected. An elemental material balance for plutonium showed that greater than 94 percent of the plutonium was recovered in the dissolved precipitate. The recovery of the lanthanide elements was generally 94 percent or higher except for the more soluble lanthanum. The recovery of soluble metal impurities from the precipitate slurry ranged from 15 to 22 percent. Theoretically, 16 percent of the soluble oxalates should have been present in the dissolved slurry based on the dilution effects and volumes of supernate and wash solutions removed. A trace level material balance showed greater than 97 percent recovery of americium-241 (from the beta dec
International Nuclear Information System (INIS)
Luning Prak, Dianne J.; Breuer, James E.T.; Rios, Evelyn A.; Jedlicka, Erin E.; O'Sullivan, Daniel W.
2017-01-01
The influence of salinity, pH, temperature, and dissolved organic matter on the photolysis rate of 2,4,6-trinitrotoluene (TNT) in marine, estuary, and laboratory-prepared waters was studied using a Suntest CPS +® solar simulator equipped with optical filters. TNT degradation rates were determined using HPLC analysis, and products were identified using LC/MS. Minimal or no TNT photolysis occurred under a 395-nm long pass filter, but under a 295-nm filter, first-order TNT degradation rate constants and apparent quantum yields increased with increasing salinity in both natural and artificial seawater. TNT rate constants increased slightly with increasing temperature (10 to 32 °C) but did not change significantly with pH (6.4 to 8.1). The addition of dissolved organic matter (up to 5 mg/L) to ultrapure water, artificial seawater, and natural seawater increased the TNT photolysis rate constant. Products formed by TNT photolysis in natural seawater were determined to be 2,4,6-trinitrobenzaldehyde, 1,3,5-trinitrobenzene, 2,4,6-trinitrobenzoic acid, and 2-amino-4,6-dinitrobenzoic acid. - Highlights: • 2,4,6-trinitrotoluene (TNT) was photolyzed in marine, estuary, & laboratory waters. • TNT photolysis rates increased with increasing salinity & dissolved organic matter. • Temperature and pH had minimal impact on TNT photolysis in marine waters. • In seawater, TNT photolysis produced 1,3,5-trinitrobenzene & trinitrobenzaldehyde. • Polar products were 2,4,6-trinobenzoic acid & 2-amino-4,6-dinitrobenzoic acid.
2010-07-01
...-, compound with alpha-2,4,6-tris (1-phenylethyl)phenyl]-omega-hydroxypoly (oxy-1,2-ethanediyl) phosphate. 721...]-omega-hydroxypoly (oxy-1,2-ethanediyl) phosphate. (a) Chemical substance and significant new uses... alpha-[2,4,6-tris(1-phenylethyl)phenyl]-omega-hydroxypoly (oxy-1,2-ethanediyl) phosphate (PMN P-98-185...
International Nuclear Information System (INIS)
Hameed, B.H.; Tan, I.A.W.; Ahmad, A.L.
2009-01-01
The effects of three preparation variables: CO 2 activation temperature, CO 2 activation time and KOH:char impregnation ratio (IR) on the 2,4,6-trichlorophenol (2,4,6-TCP) uptake and carbon yield of the activated carbon prepared from oil palm empty fruit bunch (EFB) were investigated. Based on the central composite design, two quadratic models were developed to correlate the three preparation variables to the two responses. The activated carbon preparation conditions were optimized using response surface methodology by maximizing both the 2,4,6-TCP uptake and activated carbon yield within the ranges studied. The optimum conditions for preparing activated carbon from EFB for adsorption of 2,4,6-TCP were found as follows: CO 2 activation temperature of 814 deg. C, CO 2 activation time of 1.9 h and IR of 2.8, which resulted in 168.89 mg/g of 2,4,6-TCP uptake and 17.96% of activated carbon yield. The experimental results obtained agreed satisfactorily with the model predictions. The activated carbon prepared under optimum conditions was mesoporous with BET surface area of 1141 m 2 /g, total pore volume of 0.6 cm 3 /g and average pore diameter of 2.5 nm. The surface morphology and functional groups of the activated carbon were respectively determined from the scanning electron microscopy and Fourier transform infrared analysis.
SAGE ANALYSIS OF TRANSCRIPTOME RESPONSES IN ARABIDOPSIS ROOTS EXPOSED TO 2,4,6-TRINITROTOLUENE
Serial Analysis of Gene Expression (SAGE) was used to profile transcript levels in Arabidopsis thaliana roots and assess their responses to 2,4,6-trinitrotoluene (TNT) exposure. SAGE libraries representing control and TNT-exposed seedling root transcripts were constructed, and ea...
Institute of Scientific and Technical Information of China (English)
Zhongyu Wang; Zhiqiang Fu; Qi Yu; Jingwen Chen
2017-01-01
Alternative brominated flame retardants (BFRs) have become prevalent as a consequence of restrictions on the use of polybrominated diphenyl ethers (PBDEs).For risk assessment of these alternatives,knowledge of their metabolism via cytochrome P450 enzymes is needed.We have previously proved that density functional theory (DFT) is able to predict the metabolism of PBDEs by revealing the molecular mechanisms.In the current study,the reactivity of 1,2-bis(2,4,6-tribromophenoxy)ethane and structurally similar chemicals with the Compound I model representing the active site of P450 enzymes was investigated.The DFT calculations delineated reaction pathways which lead to reasonable explanations for products that were detected by wet experiments,meanwhile intermediates which cannot be determined were also proposed.Results showed that alkyl hydrogen abstraction will lead to bis(2,4,6-tribromophenoxy)ethanol,which may undergo hydrolysis yielding 2,4,6-tribromophenol,a neurotoxic compound.In addition,a general pattern of oxidation reactivity regarding the 2,4,6-tribromophenyl moiety was observed among several model compounds.Our study has provided insights for convenient evaluation of the metabolism of other structurally similar BFRs.
International Nuclear Information System (INIS)
Badgujar, D.M.; Talawar, M.B.; Asthana, S.N.; Venugopalan, S.; Rao, A. Subhananda; Mahulikar, P.P.
2008-01-01
1-(2-Nitroxyethylnitramino)-2,4,6-trinitrobenzene (3a), 1,3-bis(2-nitroxyethyl nitramino)-2,4,6-trinitrobenzene (3b) and 1,3,5-tris(2-nitroxyethylnitramino)-2,4,6-trinitrobenzene (3c) were prepared by the nitration of 1-(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2a) 1,3-bis(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2b) and 1,3,5-tris(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2c) using bismuth nitrate pentahydrate (eco-friendly nitrating agent) in tetrahydrofuran adsorbed on silica gel under microwave irradiation, respectively. Key intermediate compounds viz., 2a, 2b and 2c were synthesized by condensing picryl chloride, styphnyl chloride and 1,3,5-trichloro-2,4,6-trinitrobenzene with ethanol amine, respectively, based on the lines of the reported method. The synthesized compounds were characterized based on their physical constant, infrared (IR) spectroscopy and 1 H nuclear magnetic resonance (NMR) spectroscopy. The spectroscopic data obtained indicated the formation of nitrate esters (3a-3c). The nitration methodology adopted in the present study is of relevance in the context of green chemistry. The target compounds (3a-3c) synthesized using eco-friendly approach are of interest from the point of high energy materials (HEMs)
Oral exposure of adult zebrafish (Danio rerio) to 2,4,6-tribromophenol affects reproduction
DEFF Research Database (Denmark)
Halden, Anna Norman; Nyholm, Jenny Rattfelt; Andersson, Patrik L
2010-01-01
The bromophenol 2,4,6-tribromophenol (TBP) is widely used as an industrial chemical, formed by degradation of tetrabromobisphenol-A, and it occurs naturally in marine organisms. Concentrations of TBP in fish have been related to intake via feed, but little is known about effects on fish health...... after oral exposure. In this study, we exposed adult male and female zebrafish (Danio rerio) to TBP via feed in nominal concentrations of 33, 330, and 3300 mu g/g feed (or control feed) for 6 weeks to assess the effects of TBP on reproductive output, gonad morphology, circulatory vitellogenin levels......, and early embryo development. The aim was also to investigate the extent to which TBP was metabolised to 2,4,6-tribromoanisole (IBA) in dietary exposed zebrafish, and the amounts of TBP and TBA found in offspring. After 6 weeks of exposure, we found about 3% of the daily dose of TBP in adult fish...
International Nuclear Information System (INIS)
Beims, H.D.
1986-01-01
The starting point for the considerations and calculations given in this dissertation is the inevitable production of radioactive materials in the use of nuclear energy, which creates a considerable potential danger in a final store for a very long period. As one possibility of alleviating this problem, a concept for recycling the waste actinides neptunium, americium and curium was proposed. The waste actinides are separated in the reprocessing of burnt-up fuel elements and reach a further irradiation circuit. There they pass through the stages 'manufacture of irradiation elements', 'use in a fast power reactor' and reprocessing of irradiation elements' several times. In each irradiation and subsequent storage, about 17% of the waste actinides are removed by fission or by conversion into nuclides which can be reused as fuel, so that during the life of 40 years of the fast recycling reacor, the waste actinides can be reduced in mass by one half. In order to determine this mass reduction effect, a model calculation was developed, which includes the representation of the neutron physics and thermal properties of the reactor core and the storage and reprocessing of the irradiation elements. (orig./RB) [de
Concentrations of organochlorine pesticides and 2,4,6-trichloroanisole in cork bark.
Olivella, M Àngels; Caixach, Josep; Planas, Carles; Oliveras, Anna; Jové, Patrícia
2012-02-01
Organochlorine pesticides are persistent lipophilic organic pollutants and tend to accumulate in growing plants. During growth, cork is in contact with the open air for long periods (9-12 years). Owing to the previous widespread use of organochlorine pesticides and their high persistence in the environment, there is a risk that residues of such pesticides may be present in cork. In this study, the concentrations of 14 organochlorine pesticides-all of which are indicators of environmental pollution-were analyzed in cork bark samples from three regions in Spain and one in Portugal. In addition, the concentrations of 2,4,6-trichlorophenol (TCP) and 2,4,6-trichloroanisole (TCA) were also analyzed. Our results show only very low concentrations of lindane, γ-HCH (cork sample from Extremadura (0.1 ng g(-1)) and p,p'-DDE was present at a maximum concentration of 2.9 ng g(-1) in a cork sample from Castile-La Mancha. However, all concentrations were well below the legal limit established by Regulation (EC) No. 396/2005 (10 ng g(-1) in foodstuffs). We can conclude, therefore, that the cork samples we studied complied with food safety standards. Copyright © 2011 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Tzou, Y.-M.; Wang, S.-L.; Liu, J.-C.; Huang, Y.-Y.; Chen, J.-H.
2008-01-01
Humic acid (HA) is one of the major components of soil organic matter. It strongly affects the sorption behavior of organic and inorganic contaminants in soils. To obtain a better understanding of the interactions of contaminants with HA, a repeated extraction technique has been applied to a peat soil to obtain HA fractions with varying aliphaticity and aromaticity, which were subsequently correlated to the sorption properties of 2,4,6-trichlorophenol (TCP). HA fractions were extracted repeatedly using an alkaline solution and each HA fraction was separated into two portions with an air-drying or re-suspending (denoted as RSHAs) process. Solid-state 13 C NMR and elemental analysis demonstrated that the aromaticity and polarity of HAs decreased with extractions. Kinetic results indicated that air-dried HAs exhibited two-step first order sorption behavior with a rapid stage followed by a slower stage. The slower sorption is attributed to the diffusion of 2,4,6-TCP in the condensed aromatic domains of HAs. Conversely, sorption of 2,4,6-TCP on RSHAs was extremely rapid and could not be fitted with any kinetic model. For air-dried HAs the sorption capacity (K oc ) was weakly correlated with the chemical compositions of HAs. However, a positive trend between K oc and aromaticity was observed for RSHAs. Compared with the results of air-dried HAs with their counterparts of RSHAs, it is therefore concluded that air-drying may alter the structure of HAs through artificially creating a more condensed domain in HAs. The structural alternation may result in an incorrect interpretation of the relationship between sorption capacity and chemical composition of HAs and a misjudgment of the transport behavior of 2,4,6-TCP in soils and sediments
International Nuclear Information System (INIS)
Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.
2008-07-01
The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)
Computational investigation on 2,4,6-trinitrochlorobenzene crystal
Energy Technology Data Exchange (ETDEWEB)
Ju, Xue-Hai; Qiu, Ling; Xiao, He-Ming [Department of Chemistry, Nanjing University of Science and Technology, Nanjing 210094 (China)
2006-02-15
Density functional theory calculations at the B3LYP level were performed on crystalline 2,4,6-trinitrochlorobenzene. The carbon, oxygen, and chlorine atoms make up the narrow lower energy bands, while the nitrogen, carbon, and oxygen atoms make up the higher energy bands. Besides, the contributions of these atomic orbitals to the frontier bands are somewhat well-proportioned. The Mulliken populations obviously demonstrate that the C-N bonds are the weakest, indicating that the C-NO{sub 2} is prone to rupture upon stimuli. An anisotropic impact on the bulk makes the electron transfer from chlorine to its neighbor carbon atom and from nitrogen atoms to oxygen atoms. The crystal lattice energy is predicted to be -50.99 kJ/mol, after being corrected for basis set superposition error. (Abstract Copyright [2006], Wiley Periodicals, Inc.)
2,4,6-Triamino-1,3,5-triazine-1,3-diium aquapentafluoridoaluminate
Directory of Open Access Journals (Sweden)
V. Maisonneuve
2008-04-01
Full Text Available The title compound, (C3H8N6[AlF5(H2O], was obtained by solvothermal synthesis from the reaction of aluminium hydroxide, 1,3,5-triazine-2,4,6-triamine (melamine, aqueous HF and water at 323 K for 48 h. The structure consists of [AlF5(H2O]2− octahedra and diprotonated melaminium cations. Cohesion is ensured by a three-dimensional network of hydrogen bonds.
Spot test for 1,3,5-triamino-2,4,6-trinitrobenzene, TATB
Harris, B.W.
1984-11-29
A simple, sensitive and specific spot test for 1,3,5-triamino-2,4,6-trinitrobenzene, TATB, is described. Upon the application of the composition of matter of the subject invention to samples containing in excess of 0.1 mg of this explosive, a bright orange color results. Interfering species such as TNT and Tetryl can be removed by first treating the sample with a solvent which does not dissolve the TATB, but readily dissolves these interfering explosives.
Structural and spectroscopic parameters of 2,4,6-trimethylbenzamide, using DFT method
International Nuclear Information System (INIS)
Catikkas, B.; Karakaya, N.
2010-01-01
Conformational analysis of 2,4,6-Trimethylbenzamide was carried out. The geometric parameters (bond length, bond angle and tortion angle) of the most stable conformer were calculated and the Infrared and Raman frequencies of fundamental modes were determined. All calculations have been made by using the B3LYP / 6-311+G(d,p) method. Calculated values were compared with the experimental ones. All calculations were carried out with the Gaussian03 and GaussView3.0 programs.
Energy Technology Data Exchange (ETDEWEB)
Boyle, A.W.; Phelps, C.D.; Young, L.Y. [Rutgers-The State Univ. of New Jersey, New Brunswick, NJ (United States). Biotechnology Center for Agriculture and the Environment
1999-03-01
Strain TBP-1, an anaerobic bacterium capable of reductively dehalogenating 2,4,6-tribromophenol to phenol, was isolated from estuarine sediments of the Arthur Kill in the New York/New Jersey harbor. It is a gram-negative, motile, vibrio-shaped, obligate anaerobe which grows on lactate, pyruvate, hydrogen, and fumarate when provided sulfate as an electron acceptor. The organism accumulates acetate when grown on lactate and sulfate, contains desulfoviridin, and will not grow in the absence of NaCl. It will not utilize acetate, succinate, propionate, or butyrate for growth via sulfate reduction. When supplied with lactate as an electron donor, strain TBP-1 will utilize sulfate, sulfite, sulfur, and thiosulfate for growth but not nitrate, fumarate, or acrylate. This organism debrominates 2-, 4-, 2,4-, 2,6-, and 2,4,6-bromophenol but not 3- or 2,3-bromophenol or monobrominated benzoates. It will not dehalogenate monochlorinated, fluorinated, or iodinated phenols or chlorinated benzoates. Together with its physiological characteristics, its 16S rRNA gene sequence places it in the genus Desulfovibrio. The average growth yield of strain TBP-1 grown on a defined medium supplemented with lactate and 2,4,6-bromophenol is 3.71 mg of protein/mmol of phenol produced, and the yield was 1.42 mg of protein/mmol of phenol produced when 40bromophenol was the electron acceptor. Average growth yields for Desulfovibrio sp. strain TBP-1 grown with 2,4,6-bromophenol, 4-bromophenol, or sulfate are 0.62, 0.71, and 1.07, respectively. Growth did not occur when either lactate or 2,4,6-bromophenol was omitted from the growth medium. These results indicate that Desulfovibrio sp. strain TBP-1 is capable of growth via halorespiration.
Separation and recovery of Cm from Cm-Pu mixed oxide samples containing Am impurity
International Nuclear Information System (INIS)
Hirokazu Hayashi; Hiromichi Hagiya; Mitsuo Akabori; Yasuji Morita; Kazuo Minato
2013-01-01
Curium was separated and recovered as an oxalate from a Cm-Pu mixed oxide which had been a 244 Cm oxide sample prepared more than 40 years ago and the ratio of 244 Cm to 240 Pu was estimated to 0.2:0.8. Radiochemical analyses of the solution prepared by dissolving the Cm-Pu mixed oxide in nitric acid revealed that the oxide contained about 1 at% of 243 Am impurity. To obtain high purity curium solution, plutonium and americium were removed from the solution by an anion exchange method and by chromatographic separation using tertiary pyridine resin embedded in silica beads with nitric acid/methanol mixed solution, respectively. Curium oxalate, a precursor compound of curium oxide, was prepared from the purified curium solution. 11.9 mg of Cm oxalate having some amounts of impurities, which are 243 Am (5.4 at%) and 240 Pu (0.3 at%) was obtained without Am removal procedure. Meanwhile, 12.0 mg of Cm oxalate (99.8 at% over actinides) was obtained with the procedure including Am removals. Both of the obtained Cm oxalate sample were supplied for the syntheses and measurements of the thermochemical properties of curium compounds. (author)
Monoklonale Antikörper zum Nachweis von 2,4,6-Trichloranisol in Kork
Lausterer, Ralph
2005-01-01
Die Verbindung 2,4,6-Trichloranisol (TCA) kann in Kork und Wein vorkommen. TCA entsteht durch mikrobielle Umsetzung von Chlorphenolen. In den betroffenen Industrien führt TCA zu jährlichen Verlusten von mehr als einer Milliarde . Zur Bestimmung von TCA sollten enzymkoppelte Immunabsorptionstest (ELISAs) mit monoklonalen Antikörpern (mAk) entwickelt werden. Es wurden drei TCA-spezifische mAk-produzierende Zelllinien gewonnen. Mit diesen mAk wurden hochsensitive ELISAs hergstellt, die eine Nac...
National Research Council Canada - National Science Library
Nalca, Aysegul; Hatkin, Josh M; Garza, Nicole L; Nichols, Donald K; Norris, Sarah W; Hruby, Dennis E; Jordan, Robert
2008-01-01
...) to treat smallpox or monkeypox infection. In this study, we showed that administration of the antiviral compound ST-246 to rabbits by oral gavage, once daily for 14 days beginning 1h postexposure (p.e.), resulted in 100...
Muthu, C; Anandarao, BG; Pottasch, [No Value
Spatio-Kinematic observations were made on NGC 246 in the [OIII] 5007 Angstrom line using an Imaging Fabry-Perot Spectrometer. Evidence for the deceleration effect was found in the leading edge of the nebular shell, possibly due to its interaction with the interstellar medium. Further, we show that
Synthesis of 2,4,6-Trisubstituted Pyridines by Oxidative Eosin Y Photoredox Catalysis.
Rohokale, Rajendra S; Koenig, Burkhard; Dhavale, Dilip D
2016-08-19
Eosin Y, an organic dye, was activated as a photoredox catalyst in the presence of molecular oxygen using visible light and, when it was used in the reaction of aryl ketones and benzyl amines, afforded good yields (52-87%) of 2,4,6-triarylpyridines (21 examples) at ambient temperature. The aryl groups at the 2- and 6-positions are derived from ketones, while benzyl amine plays the dual role of providing an aryl functionality at the 4-position of pyridine as well as being a nitrogen donor.
WE-A-18A-01: TG246 On Patient Dose From Diagnostic Radiation
Energy Technology Data Exchange (ETDEWEB)
Supanich, M [Rush University Medical Center, Chicago, IL (United States); Dong, F [The Cleveland Clinic, Solon, OH (United States); Andersson, J [Umea University, Umea (Sweden); Pavlicek, W [Mayo Clinic Arizona, Scottsdale, AZ (United States); Bolch, W [University Florida, Gainesville, FL (United States); Fetterly, K [Mayo Clinic, Rochester, MN (United States)
2014-06-15
Radiation dose from diagnostic and interventional radiations continues to be a focus of the regulatory, accreditation and standards organizations in the US and Europe. A Joint AAPM/EFOMP effort has been underway in the past year — having the goal to assist the clinical medical physicist with communicating optional and varied approaches in estimating (and validating) patient dose. In particular, the tools provided by DICOM Radiation Dose Structured Reports, either by themselves or as part of a networked data repository of dose related information are a rich source of actionable information. The tools of the medical physicist have evolved to include using DICOM data in meaningful ways to look at patient dose with respect to imaging practices. In addition to how accurate or reproducible a dose value is (totally necessary and our traditional workspace) it is now being asked how reproducible (patient to patient, device to device) are the delivered doses (new tasking)? Clinical medical physicists are best equipped to assist our radiology and technologist colleagues with this effort. The purpose of this session is to review the efforts of TG246 - bringing forward a summary content of the TG246 Report including specific dose descriptors for CT and Fluoroscopy — particularly in a focus of leveraging the RDSR as a means for monitoring good practices ALARA. Additionally, rapidly evolving technologies for more refined dose estimates are now in use. These will be presented as they look to having highly patient specific dose estimates in automated use.
(N,N,N′,N′-Tetramethylethylenediamine-κNbis(2,4,6-trimethylphenolato-κOgermanium(II
Directory of Open Access Journals (Sweden)
Eduard Rusanov
2012-03-01
Full Text Available In the title compound, [Ge(C9H11O2(C6H16N2], the GeII atom is coordinated in a distorted trigonal–pyramidal geometry by two O atoms belonging to two 2,4,6-trimethylphenolate ligands and one N atom of a tetramethylethylenediamine ligand. Comparing the structure with published data of similar compounds shows that the Ge—O bonds are covalent and the Ge—N bond is coordinated.
International Nuclear Information System (INIS)
Reis Junior, Aluisio S.; Temba, Eliane S.C.; Kastner, Geraldo F.; Monteiro, Roberto P.G.
2013-01-01
Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241 Am, 242 Cm and 24 3 ,244 Cm isotopes is possible using the 243 Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238 Pu, 243 Am, 244 Cm and 232 U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241 Am it was (1,040 ± 160 mBqKg -1 ), relative standard deviation 15.38%, and for 239+240 Pu it was (551 +- 44 mBqKg -1 ), relative standard deviation 7.98%. In addition, for the 242 Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg -1 ), with the relative standard deviation 30.67% higher than for 241 Am and 239+240 Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg -1 . (author)
International Nuclear Information System (INIS)
Louwrier, K.P.; Richter, K.
1976-01-01
During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239 Pu containing 8-12% 240 Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241 Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241 Am, 243 Am and 244 Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241 Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)
1,1´,1´´-(2,4,6-Trihydroxybenzene-1,3,5-triyl)triethanone tautomerism revisited
DEFF Research Database (Denmark)
Hansen, Poul Erik; Kamounah, Fadhil S.; Zhiryakova, Diana
2014-01-01
It has recently been suggested that 1,1′,1′′-(2,4,6-trihydroxybenzene-1,3,5-triyl)triethanone may be tautomeric. Using 13C NMR chemical shifts and deuterium isotope effects on 13C chemical shifts, it is demonstrated that this is not the case. This compound occurs as a strongly hydrogen bonded ben...
The (p→,t) reaction on 58Ni and 56Fe at 24.6 MeV
International Nuclear Information System (INIS)
Polane, J.H.; Feix, W.F.; Hall, P.J. van; Klein, S.S.; Nijgh, G.J.; Poppema, O.J.; Wassenaar, S.D.
1989-01-01
The (p, t) reactions on 56 Fe and 58 Ni initiated by 24.6 MeV polarised protons has been investigated. The reaction process is described in terms of simultaneous and sequential neutron transfer. For all five final states studied the sequential process competes strongly with simultaneous transfer of a neutron pair. Theoretical values for the spectroscopic amplitudes were derived from shell-model wavefunctions; these seem to give a reliable description of the reaction process. (author)
International Nuclear Information System (INIS)
Schenkel, R.
1977-03-01
The temperature dependence of the electrical resistivity of thin films of bulk 241 Am metal were measured between 300 and 4.5 K. The room temperature resistivity was found to be 68.90μΩcm. At room temperature the electrical resistivity of americium increases with pressure (3% up to 13 kbar). The application of 13 kbar pressure did not change the low temperature power law in the electrical resistivity. The resistivity vs temperature curve can be explained by assuming s-d scattering of conduction electrons. The localized 5f electrons are considered to be about 5eV below the Fermi level. Americium therefore should be the first lanthanide-like element in the actinide series. The defect production due to self-irradiation damage was studied by measuring the increase of the resistivity at 4.2 K over a period of 738 h. A saturation resistivity of 16.036 μΩcm was found corresponding to a defect concentration of about 0.22 a/o. After isochronal annealing two recovery stages were observed at about 65 and 145 K. The two stages shift with increasing initial defect concentration to lower temperatures. Estimates of the activation energies and the reaction order were made and possible defect reactions suggested. The magnetic contribution to the electrical resistivity of curium, which shows an antiferromagnetic transition at 52.5 k, was obtained by subtracting the resistivity of americium (to be considered as phonon part). Comparison with theoretical models were made. At low temperatures the measurements are strongly affected by self-irradiation damage [drho/dt(t=0)=9.8μΩcm/h
Tsunekawa, Ryuji; Hanaya, Kengo; Higashibayashi, Shuhei; Sugai, Takeshi
2018-04-26
Fisetin and 2',4',6'-trihydroxydihyrochalcone 4'-O-β-neohesperidoside were synthesized from commercially available quercetin and naringin in five steps. The key steps are site-selective deacetylation and subsequent deoxygenation. The target molecules were obtained in 37% and 23% yields from the starting materials, respectively.
Energy Technology Data Exchange (ETDEWEB)
Gerasimenko, B.F. [V.G. Khlopin Radium Inst., Saint Peterburg (Russian Federation)
1997-03-01
The calculations of integral spectra of prompt neutrons of spontaneous fission of {sup 244}Cm and {sup 246}Cm were carried out. The calculations were done by the Statistical Computer Code Complex SCOFIN applying the Hauser-Feschbach method as applied to the description of the de-excitation of excited fission fragments by means of neutron emission. The emission of dipole gamma-quanta from these fragments was considered as a competing process. The average excitation energy of a fragment was calculated by two-spheroidal model of tangent fragments. The density of levels in an excited fragment was calculated by the Fermi-gas model. The quite satisfactory agreement was reached between theoretical and experimental results obtained in frames of Project measurements. The calculated values of average multiplicities of neutron number were 2,746 for {sup 244}Cm and 2,927 for {sup 246}Cm that was in a good accordance with published experimental figures. (author)
Directory of Open Access Journals (Sweden)
Liang Y
2018-03-01
Full Text Available Yayun Liang,1 Benford Mafuvadze,1 Cynthia Besch-Williford,2 Salman M Hyder1 1Deparment of Biomedical Sciences and Dalton Cardiovascular Research Center, Columbia, MO, USA; 2IDEXX BioResearch, Columbia, MO, USA Background: Between 30 and 40% of human breast cancers express a defective tumor suppressor p53 gene. Wild-type p53 tumor suppressor protein promotes cell-cycle arrest and apoptosis and inhibits vascular endothelial growth factor–dependent angiogenesis, whereas mutant p53 protein (mtp53 lacks these functions, resulting in tumor cell survival and metastasis. Restoration of p53 function is therefore a promising drug-targeted strategy for combating mtp53-expressing breast cancer. Methods: In this study, we sought to determine whether administration of APR-246, a small-molecule drug that restores p53 function, in combination with 2aG4, an antibody that targets phosphatidylserine residues on tumor blood vessels and disrupts tumor vasculature, effectively inhibits advanced hormone-dependent breast cancer tumor growth. Results: APR-246 reduced cell viability in mtp53-expressing BT-474 and T47-D human breast cancer cells in vitro, and significantly induced apoptosis in a dose-dependent manner. However, APR-246 did not reduce cell viability in MCF-7 breast cancer cells, which express wild-type p53. We next examined APR-246’s anti-tumor effects in vivo using BT-474 and T47-D tumor xenografts established in female nude mice. Tumor-bearing mice were treated with APR-246 and/or 2aG4 and tumor volume followed over time. Tumor growth was more effectively suppressed by combination treatment than by either agent alone, and combination therapy completely eradicated some tumors. Immunohistochemistry analysis of tumor tissue sections demonstrated that combination therapy more effectively induced apoptosis and reduced cell proliferation in tumor xenografts than either agent alone. Importantly, combination therapy dramatically reduced the density of blood
Uranium and transuranium analysis
International Nuclear Information System (INIS)
Regnaud, F.
1989-01-01
Analytical chemistry of uranium, neptunium, plutonium, americium and curium is reviewed. Uranium and neptunium are mainly treated and curium is only briefly evoked. Analysis methods include coulometry, titration, mass spectrometry, absorption spectrometry, spectrofluorometry, X-ray spectrometry, nuclear methods and radiation spectrometry [fr
Khan, Khalid Mohammed; Shah, Zarbad; Ahmad, Viqar Uddin; Khan, Momin; Taha, Muhammad; Rahim, Fazal; Jahan, Humera; Perveen, Shahnaz; Choudhary, M Iqbal
2011-11-01
2,4,6-Trichlorophenyl hydrazones 1-35 were synthesized and their in vitro antiglycation potential was evaluated. Compounds 14 (IC50 = 27.2 ± 0.00 μM), and 18 (IC50 = 55.7 ± 0.00 μM) showed an excellent activity against glycation of protein, better than the standard (rutin, IC50 = 70 ± 0.50 μM). This study thus identified a novel series of antiglycation agents. A structure-activity relationship has been studied, and all the compounds were characterized by spectroscopic techniques.
Adsorption of 2,4,6-trinitrotoluene on carboxylated porous polystyrene microspheres
International Nuclear Information System (INIS)
Ye Zhengfang; Meng Qingqiang; Lu Shengtao
2012-01-01
Large-pore-size (150 nm) polystyrene (PSt) microspheres were carboxylated with phthalic anhydride (PA) through Friedel-Crafts acetylation to study the adsorption of 2,4,6-trinitrotoluene (TNT) on this material from aqueous solution. The scanning electron microscope (SEM) images and mercury porosimetry measurements (MPM) of the microspheres showed that the pore structure was unchanged during the reaction. High adsorption capacity (11.2 mg g -1 of suction-dried adsorbent) and adsorption rate (33.9 mg g -1 h -1 ) for TNT were observed during the study. As shown by the adsorption isotherm, the adsorption of TNT on PA-PSt can be described by the Freundlich adsorption equation, indicating heterogeneous adsorption process. On-column adsorption of TNT on PA-PSt and elution indicated that TNT can be completely removed from aqueous solution and condensed into acetone.
Reliability of optical fibres and components final report of COST 246
Griffioen, Willem; Gadonna, Michel; Limberger, Hans; Heens, Bernard; Knuuttila, Hanna; Kurkjian, Charles; Mirza, Shehzad; Opacic, Aleksandar; Regio, Paola; Semjonov, Sergei
1999-01-01
Reliability of Optical Fibres and Components reports the findings of COST 246 (1993-1998) - European research initiative in the field of optical telecommunications. Experts in the materials and reliability field of optical fibres and components have contributed to this unique study programme. The results, conclusions and achievements of their work have been obtained through joint experimentation and discussion with representatives from manufacturing and research groups. Topics covered include: Lifetime estimation; Failure mechanisms; Ageing test methods; Field data and service environments for components. For the first time the reader can explore the reliability of products and examine the results and conclusions in published form. This comprehensive volume is intended to provide a deeper understanding of the reliability of optical fibres and components. The book will be extremely useful to all scientists and practitioners involved in the industry.
van Gelder, K.B.; Damhof, J.K.; Kroijenga, P.J.; Westerterp, K.R.
1990-01-01
In this paper we present experimental data on the three-phase hydrogenation of 2,4,6-trinitrotoluene (TNT) to triaminotoluene. The experiments are performed in a cocurrent upflow packed bed reactor. Methanol is used as an evaporating solvent. The influence of the main operating parameters, the
Hexaaquabis[3,5-bis(hydroxyimino-1-methyl-2,4,6-trioxocyclohexanido-κ2N3,O4]barium tetrahydrate
Directory of Open Access Journals (Sweden)
Nguyen Dinh Do
2013-11-01
Full Text Available In the title compound, [Ba(C7H5N2O52(H2O6]·4H2O, the Ba2+ cation lies on a twofold rotation axis and is ten-coordinated by two 3,5-bis(hydroxyimino-1-methyl-2,4,6-trioxocyclohexanide oxo O atoms [Ba—O = 2.8715 (17 Å], two hydroxyimino N atoms [Ba—N = 3.036 (2 Å], and six water molecules [Ba—O = 2.847 (2, 2.848 (2, and 2.880 (2 Å]. The 3,5-bis(hydroxyimino-1-methyl-2,4,6-trioxocyclohexanide monoanions act in a bidentate chelating manner, coordinating through an N atom of the non-deprotonated hydroxyimino group and an O atom of the neighboring oxo group. Two lattice water molecules are located in the cavities of the framework and are involved in hydrogen bonding to O atoms of one of the coordinating water molecules and the O atom of a keto group of the ligand. As a result, a three-dimensional network is formed.
Impedance spectroscopy of tripolar concentric ring electrodes with Ten20 and TD246 pastes.
Nasrollaholhosseini, Seyed Hadi; Herrera, Daniel Salazar; Besio, Walter G
2017-07-01
Electrodes are used to transform ionic currents to electrical currents in biological systems. Modeling the electrode-electrolyte interface could help to optimize the performance of the electrode interface to achieve higher signal to noise ratios. There are previous reports of accurate models for single-element biomedical electrodes. In this paper, we measured the impedance on both tripolar concentric ring electrodes and standard cup electrodes by electrochemical impedance spectroscopy (EIS) using both Ten20 and TD246 electrode paste. Furthermore, we applied the model to prove that the model can predict the performance of the electrode-electrolyte interface for tripolar concentric ring electrodes (TCRE) that are used to record brain signals.
International Nuclear Information System (INIS)
1997-08-01
On July 2, 1997 at approximately 6:00 A.M., two operators (Workers 1 and 2), wearing approved personal protective equipment (PPE), began a shredding operation of HEPA filters for volume reduction in Building 513 (B-513) at Lawrence Livermore National Laboratory (LLNL). The waste requisitions indicated they were shredding filters containing ≤ 1 μCi of americium-241 (Am-241). A third operator (Worker 3) provided support to the shredder operators in the shredding area (hot area) from a room that was adjacent to the shredding area (cold area). At Approximately 8:00 A.M., a fourth operator (Worker 4) relieved Worker 2 in the shredding operation. Sometime between 8:30 A.M. and 9:00 A.M., Worker 3 left the cold area to make a phone call and set off a hand and foot counter in Building 514. Upon discovering the contamination, the shredding operation was stopped and surveys were conducted in the shredder area. Surveys conducted on the workers found significant levels of contamination on their PPE and the exterior of their respirator cartridges. An exit survey of Worker 1 was conducted at approximately 10:05 A.M., and found contamination on his PPE, as well as on the exterior and interior of his respirator. Contamination was also found on his face, chest, back of neck, hair, knees, and mustache. A nose blow indicated significant contamination, which was later determined to be curium-244
Gümüscü, B.; Erdogan, Zeynep; Guler, Mustafa O.; Tekinay, Turgay
2016-01-01
In this work, a new detection method for complete separation of 2,4,6-trinitrotoluene (TNT); 2,4-dinitrotoluene (2,4-DNT); 2,6-dinitrotoluene (2,6-DNT); 2-aminodinitrotoluene (2-ADNT) and 4-aminodinitrotoluene (4-ADNT) molecules in high-performance liquid-chromatography (HPLC) with UV sensor has
Two improved germplasm lines of wild watermelon (Citrullus lanatus var. citroides) designated USVL246-FR2 and USVL252-FR2 were released in 2012 by the Agricultural Research Service of the U.S. Department of Agriculture (Wechter et al. 2012). These lines are each highly uniform for growth characteri...
Wang, Lu; Chen, Xiurong; Wang, Hualin; Zhang, Yuying; Tang, Qingjie; Li, Jiahui
2017-02-01
Chlorella vulgaris was cultivated in different proportions of activated sludge extracts, which was from the treatment of the synthetic wastewater containing 2,4,6-trichlorophenol (2,4,6-TCP). The nutrients, total nitrogen (TN) and total phosphorus (TP), were removed over 45% and 90%, respectively. The maximum reduction amount of ecotoxicity and total organic carbon (TOC) occurred in the 100% sludge group on the 8th day (68%; 86.2 mg L -1 ). The variations of Excitation-emission matrix spectra (EEMs) and TOC indicated that extracellular organic matters (EOM) produced by algae led to TOC increase in the medium. The cell density was close to each other for groups with sludge extract proportion below 50%; sludge extracts (below 75% addition) had a stimulating effect on the accumulation of chlorophyll-a in per unit algal cell. Superoxide dismutase (SOD) variation demonstrated that C. vulgaris response positively to sludge extracts addition. Lipid content in C. vulgaris was up to its maximum value on the 8th day. Considering the performance on nutrients removal, toxicity reduction and algal growth, the optimal cultivation period for C. vulgaris before harvesting was around 8 days with sludge extracts proportion below 50%. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Jeo, Kih-Soo; Song, Byung-Chul; Kim, Young-Bok; Han, Sun-Ho; Jeon, Young-Shin; Jung, Euo-Chang; Jee, Kwang-Yong
2007-01-01
Determination of actinide elements and fission products in spent nuclear fuels is of importance for a burnup determination and source term evaluation. Especially, the amounts of uranium and plutonium isotopes are used for the evaluation of a burnup credit in spent nuclear fuels. Additionally, other actinides such as Np, Am and Cm in spent nuclear fuel samples is also required for the purposes mentioned above. In this study, 237 Np, 241 Am and 244 Cm were determined by an alpha spectrometry for the source term data for high burnup spent nuclear fuels ranging from 37 to 62.9 GWD/MtU as a burnup. Generally, mass spectrometry has been known as the most powerful method for isotope determinations such as high concentrations of uranium and plutonium. However, in the case of minor actinides such as Np, Am and Cm, alpha spectrometry would be recommended instead. Determination of the transuranic elements in spent nuclear fuel samples is different from that for environmental samples because the amount of each nuclide in the spent fuel samples is higher and the relative ratios between each nuclide are also different from those for environmental samples. So, it is important to select an appropriate tracer and an optimum sample size depending on the nuclides and analytical method. In this study 237 Np was determined by an isotope dilution alpha(gamma) spectrometry using 239 Np as a spike, and 241 Am and curium isotopes were determined by alpha spectrometry using 243 Am as a tracer. The content of each nuclide was compared with that by the Origen-2 code
Recovery of trans-plutonium elements; Recuperation des elements transplutoniens
Energy Technology Data Exchange (ETDEWEB)
Espie, J Y; Poncet, B; Simon, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1970-07-01
The object of this work is to study the recovery of americium and curium from the fission-product solution obtained from the processing of irradiated fuel elements made of natural metallic uranium alloyed with aluminium, iron and silicon; these elements have been subjected to an average irradiation of 4000 MW days/ton in a gas-graphite type reactor having a thermal power of 3.7 MW/ton of uranium. The process used consists of 3 extraction cycles and one americium-curium separation: - 1) extraction cycle in 40 per cent TBP: extraction of actinides and lanthanides; elimination of fission products; - 2) extraction cycle in 8 per cent D2EHPA: decontamination from the fission products, decontamination of actinides from lanthanides; - 3) extraction cycle in 40 per cent TBP: separation of the complexing agent and concentration of the actinides; - 4) americium-curium separation by precipitation. (authors) [French] Cette etude a pour objet, la recuperation de l'americium et du curium de la solution de produits de fission provenant du traitement de combustibles irradies a base d'uranium naturel metallique allie a l'aluminium, le fer, et le silicium, et ayant subi une irradiation moyenne de 4000 MWj/t dans une pile du type graphite-gaz, dont la puissance thermique est de 3.7 MW/t d'uranium. Le procede utilise comprend 3 cycles d'extraction et une separation americium-curium: - 1. cycle d'extraction dans le TBP a 40 pour cent: extraction des actinides et des lanthanides, elimination des produits de fission; - 2. cycle d'extraction dans le D2EHPA a 8 pour cent: decontamination en produits de fission, decontamination des actinides en lanthanides; - 3. cycle d'extraction dans le TBP a 40 pour cent: separation du complexant et concentration des actinides; - 4. separation americium-curium par precipitation. (auteurs)
Determination of 241Am and 244Cm in environmental samples
International Nuclear Information System (INIS)
Bonino, N.O.; Grinman, A.D.R.; Serdeiro, N.H.
1998-01-01
The present technique describes a method to separate, purify and measure low levels of americium and curium in different environmental samples such as sediments, soils, water, vegetables, and air filters. The determination of radionuclides in theses environmental matrices have analytical problems, since a simple method doesn't exist for the purification, which is indispensable for its later measuring alpha spectrometry. The developed technique consist on taking an aliquot of the sample to analyze, to add tracer as americium 243 and curium 242, and to dissolve the matrix in a such way to have a clear solution. For the isolation of the americium and curium of the other actinides ar used as separation techniques: precipitation with Fe 3+ , anionic and cationic exchange, and extraction with a appropriate organic solvent. The purification of the americium and curium is followed by the electrodeposition habitually used. The measurement is carried out by alpha spectrometry with a detector of implanted ion. The detection limit for this techniques is of 0,002 Bq/l or 0,2 mBq in the case of filters. (author)
Directory of Open Access Journals (Sweden)
Pramuko Ilmu Purboputro
2017-10-01
Full Text Available Ikatan interfacal bonding pada komposit serat alam sangat tergantung dari kekasaran permukaan serat. Permukaan serat dapat ditingkatkan daya ikatan permukaannya dengan cara mencelupkan pada larutan alkali. Pencelupan ini akan mengurangi lapisan lignin yang mengurangi kekuatan ikat pada permukaan serat. Pada penelitian ini proses yang digunakan adalah perlakuan alkali terhadap permukaan serat dengan cara merendam serat rami selama 2,4,6, dan 8 jam. Larutah alkali yang digunakan adalah larutan NaOH dengan konsentrasi 10% pada pelarut air. Serat rami Boehmeria nivea (L Goud direndam pada larutan NaOH selama 2,4,6, dan 8 jam perendaman, untuk menghilangkan zat ligninnya agar kekuatan ikatan permukaan bisa diperbaiki. Pengujian yang dilakukan adalah pengujian tarik dan pengujian impak. Hasil yang didapat adalah kekuatan tarik terbesar didapat pada perendaman 8 jam yaitu sebesar 41,9 MPa. Modulus young terbesar didapat pada perendaman 2 jam, yaitu 2743,15 Mpa, dan kekuatan impak terbesar adalah 0,0725 Joule/mm2 terjadi pada perendaman 4 jam Kata kunci : komposit serat, kekuatan tarik, kekuatan impak, perendaman alkali
International Nuclear Information System (INIS)
Nawrot, I.; Machura, B.; Kruszynski, R.
2014-01-01
Two new thiocyanate cadmium(II) complexes of 2,4,6-tri(2-pyridyl)-1,3,5-triazine were synthesized and characterized. The resulted complexes [Cd(SCN)(NO 3 )(tptz)(H 2 O)] (1) and [Cd(SCN) 2 (tptz)(MeOH)] (2) were studied by IR, UV–vis spectroscopy and single crystal X-ray analysis. The luminescent properties of 1 and 2 were studied in solution and solid state and compared with the free ligand. To get detailed insight into the electronic structure and spectroscopic properties of [Cd(SCN)(NO 3 )(tptz)(H 2 O)] and [Cd(SCN) 2 (tptz)(MeOH)], the density functional theory (DFT) and time-dependent DFT (TD-DFT) calculations were performed. - Highlights: • Two novel thiocyanate cadmium(II) compounds of 2,4,6-tri(2-pyridyl)-1,3,5-triazine were synthesized. • The compounds were identified by IR, UV–vis spectroscopy and X-ray analysis. • The fluorescence properties of the complexes were examined and compared with the free ligand. • The electronic spectra were investigated at the TD-DFT level employing B3LYP/LANL2DZ
Grosenbach, Douglas W.; Jordan, Robert; King, David S.; Berhanu, Aklile; Warren, Travis K.; Kirkwood-Watts, Dana L.; Tyavanagimatt, Shanthakumar; Tan, Ying; Wilson, Rebecca L.; Jones, Kevin F.; Hruby, Dennis E.
2007-01-01
The re-emerging threat of smallpox and the emerging threat of monkeypox highlight the need for effective poxvirus countermeasures. Currently approved smallpox vaccines have unacceptable safety profiles and, consequently, the general populace is no longer vaccinated, leading to an increasingly susceptible population. ST-246, a small-molecule inhibitor of poxvirus dissemination, has been demonstrated in various animal models to be safe and effective in preventing poxviral disease. This suggests...
Some basic advantages of accelerator-driven transmutation of minor actinides and iodine-129
Energy Technology Data Exchange (ETDEWEB)
Shmelev, A.N.; Apse, V.A.; Kulikov, G.G. [Moscow Engineering Physics Institute (Russian Federation)
1995-10-01
The blanket of accelerator-driven facility designed for I-129 transmutation doesn`t contain fissile and fertile materials. So the overheating of iodine compounds transmuted is practically excluded. The efficacy of I-129 transmutation is estimated. Curium being accumulated in nuclear reactors can be incinerated in blanket of accelerator-driven facility. The deep depletion of curium diluted with inert material can be achieved.
Qureshi, Asifa; Kapley, Atya; Purohit, Hemant J.
2012-01-01
Arthrobacter sp. HPC1223 (Genebank Accession No. AY948280) isolated from activated biomass of effluent treatment plant was capable of utilizing 2,4,6 trinitrophenol (TNP) under aerobic condition at 30 °C and pH 7 as nitrogen source. It was observed that the isolated bacteria utilized TNP up to 70 % (1 mM) in R2A media with nitrite release. The culture growth media changed into orange-red color hydride-meisenheimer complex at 24 h as detected by HPLC. Oxygen uptake of Arthrobacter HPC1223 towa...
Chemically catalyzed uptake of 2,4,6-trinitrotoluene by Vetiveria zizanioides
International Nuclear Information System (INIS)
Makris, Konstantinos C.; Shakya, Kabindra M.; Datta, Rupali; Sarkar, Dibyendu; Pachanoor, Devanand
2007-01-01
The efficiency of vetiver grass (Vetiveria zizanioides) in removing 2,4,6-trinitrotoluene (TNT) from aqueous media was explored in the presence of a common agrochemical, urea, used as a chaotropic agent. Chaotropic agents disrupt water structure, increasing solubilization of hydrophobic compounds (TNT), thus, enhancing plant TNT uptake. The primary objectives of this study were to: (i) characterize TNT absorption by vetiver in hydroponic media, and (ii) determine the effect of urea on chemically catalyzing TNT uptake by vetiver grass in hydroponic media. Results showed that vetiver exhibited a high TNT uptake capacity (1.026 mg g -1 ), but kinetics were slow. Uptake was considerably enhanced in the presence of urea, which significantly (p<0.001) increased the 2nd-order reaction rate constant over that of the untreated (no urea) control. Three major TNT metabolites were detected in the roots, but not in the shoot, namely 1,3,5-trinitrobenzene, 4-amino 2,6-dinitrotoluene, and 2-amino 4,6-dinitrotoluene, indicating TNT degradation by vetiver grass. - A common agrochemical, urea catalyzes TNT removal by vetiver grass in aqueous media
Chemically catalyzed uptake of 2,4,6-trinitrotoluene by Vetiveria zizanioides
Energy Technology Data Exchange (ETDEWEB)
Makris, Konstantinos C. [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Shakya, Kabindra M. [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Datta, Rupali [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Sarkar, Dibyendu [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States)]. E-mail: dibyendu.sarkar@utsa.edu; Pachanoor, Devanand [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States)
2007-07-15
The efficiency of vetiver grass (Vetiveria zizanioides) in removing 2,4,6-trinitrotoluene (TNT) from aqueous media was explored in the presence of a common agrochemical, urea, used as a chaotropic agent. Chaotropic agents disrupt water structure, increasing solubilization of hydrophobic compounds (TNT), thus, enhancing plant TNT uptake. The primary objectives of this study were to: (i) characterize TNT absorption by vetiver in hydroponic media, and (ii) determine the effect of urea on chemically catalyzing TNT uptake by vetiver grass in hydroponic media. Results showed that vetiver exhibited a high TNT uptake capacity (1.026 mg g{sup -1}), but kinetics were slow. Uptake was considerably enhanced in the presence of urea, which significantly (p<0.001) increased the 2nd-order reaction rate constant over that of the untreated (no urea) control. Three major TNT metabolites were detected in the roots, but not in the shoot, namely 1,3,5-trinitrobenzene, 4-amino 2,6-dinitrotoluene, and 2-amino 4,6-dinitrotoluene, indicating TNT degradation by vetiver grass. - A common agrochemical, urea catalyzes TNT removal by vetiver grass in aqueous media.
Towards the island of superheavy stability - Prompt spectroscopy of 246Fm and 256Rf nuclei
International Nuclear Information System (INIS)
Piot, J.
2010-10-01
The region of trans-fermium nuclei (Z = 100 to 104) is the last region of the nuclides chart to be accessible to spectroscopic measurements. It therefore provides the ultimate anchor points for nuclear models. This region also lies on the path of the alpha-decay chains of the super-heavy elements. This region represents the limit of today's spectroscopic capabilities. It therefore requires technological developments in order to overcome these limits. My thesis focuses on various aspects of the spectroscopy of trans-fermium nuclei. I took part in the development of the TNT2D digital acquisition cards for germanium detectors. I validated their use on the gamma-ray spectrometer JUROGAM during an in-beam experiment and demonstrated the gain compared to an analogue acquisition system. These tests were part of the developments needed to secure a study of the prompt spectroscopy of 256 Rf. The preparation of this experiment also lead me to work on the development of a 50 Ti beam. For that purpose, I studied and tested the use of titanium organo-metallic compounds compatible with the MIVOC technique. In parallel, I studied the use of metallic and oxide titanium pellets with an inductive oven newly developed at the University of Jyvaeskylae. In addition to these developments, I had the opportunity to study the in-beam prompt spectroscopy of 246 Fm at the University of Jyvaeskylae. The measurements yielded a rotational band built on the ground state of 246 Fm. This band has been observed up to the level 16 + and shows a behaviour quite similar to the neighbouring even-even isotopes, except for the top of the band for which a wider statistics is necessary in order to conclude. (author)
Marton, Annamária; Kúsz, Erzsébet; Kolozsi, Csongor; Tubak, Vilmos; Zagotto, Giuseppe; Buzás, Krisztina; Quintieri, Luigi; Vizler, Csaba
2016-11-01
Constitutive activation of nuclear factor kappa-B (NFĸB) is a hallmark of various cancer types, including melanoma. Chemotherapy may further increase tumour NFĸB activity, a phenomenon that, in turn, exacerbates drug resistance. This study aimed at preliminary screening of a panel of aromatic aldehydes, including vanillin, for cytotoxicity and suppression of tumour cell NFĸB activity. The cytotoxic and NFĸB-inhibitory effects of 10 aromatic aldehydes, including vanillin, were investigated in cultured A375 human melanoma cells. Each compound was assayed alone and in combination with the model NFĸB-activating drug doxorubicin. The most promising analogues were then tested alone and in combination with 4-hydroperoxycyclophosphamide in vitro, and with cyclophosphamide in mice bearing A375 xenografts. The vanillin analogues o-vanillin and 2,4,6-trihydroxybenzaldehyde exhibited cytotoxicity against cultured A375 cells, and inhibited doxorubicin- and 4-hydroperoxycyclophosphamide-induced NFĸB activation. They also suppressed A375 cell growth in mice. o-vanillin and 2,4,6-trihydroxybenzaldehyde deserve further evaluation as potential anticancer drugs. Copyright© 2016 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.
Prak, Sina; Gunata, Ziya; Guiraud, Joseph-Pierre; Schorr-Galindo, Sabine
2007-05-01
Cork taint is mainly due to 2,4,6-trichloroanisole (TCA) produced through the activity of undesirable fungal strains. We observed that CFU mould number in TCA-containing stoppers was not quantitatively different to that of the stoppers not containing TCA (ca. 10(5)CFU/g). In contrast more fungi diversity was observed in TCA-containing stoppers. Penicillium spp (Penicillium chrysogenum, Penicillium glabrum), Aspergillus spp (Aspergillus niger and Aspergillus oryzae), Chrysonilia sitophila, Mucor racemosus, Paecilomyces sp. and Trichoderma viride were found in TCA-containing stoppers, while C. sitophila and Penicillium sp. were the main fungi in the stoppers devoid of TCA. Conidia were numerous close to the lenticels and present from the lateral surface through to the centre of the stoppers. Strains of Aspergillus, Mucor, Paecilomyces, Penicillium and Trichoderma isolated from TCA-containing stoppers were able to convert 2,4,6-trichlorophenol (TCP) in TCA in resting cell or growing conditions. The best yields of conversion were obtained by green fungi Paecilomyces sp. and P. chrysogenum, 17% and 20%, respectively. Chysonilia sitophila and Penicillium sp. did not produce TCA from TCP in our conditions.
Density functional theory investigation of the magnetism of 1,3,5-trithia-2,4,6-triazapentalenyl
International Nuclear Information System (INIS)
Zou Weidong; Liu Zuli; Wu Minghu; Yao Kailun
2004-01-01
An accurate full-potential density-functional method is used to study the mechanism of the origin of magnetism and of the magnetic interactions in 1,3,5-trithia-2,4,6-triazapentalenyl (TTTA). The results shown that because of the spin polarization effect and the spin exchange coupling interactions of these atoms, the net spin magnetic moment is formed in the molecule and the spontaneous magnetic moments for the TTTA mainly come from N 1 , S 1 , S 2 atoms and the N 2 , N 3 and S 3 atoms give a little contribution to the magnetism. Our results also revealed that there exists ferromagnetic interaction in the intramolecular of TTTA
Directory of Open Access Journals (Sweden)
Esthela Ramos-Ramírez
2017-01-01
Full Text Available Currently, interest has grown in finding effective solutions for the treatment of water pollution by toxic compounds. Some of the latter that have acquired importance are phenols and chlorophenols, due to their employment in the manufacture of pesticides, insecticides, cords of wood, paper industry, among others. The problem is rooted in that these compounds are very persistent in the environment because they are partially biodegradable and cannot be photodegraded directly by sunlight. Chlorophenols are extremely toxic, especially 2,4,6-trichlorophenol, which is potentially carcinogenic. In this work, Mg/Al-mixed oxide catalysts were obtained from the thermal treatment of hydrotalcite-type materials, synthesized by sol-gel method with different Mg/Al ratios. Hydrotalcites and Mg/Al-mixed oxides were physicochemically characterized by X-ray diffraction, thermal analysis (DTA and TGA, and N2 physisorption. The results were obtained on having proven the photocatalytic degradation of 2,4,6-trichlorophenol as a pollutant model by water. The catalysts obtained present the hydrotalcite phase with thermal evolution until achieving Mg/Al-mixed oxides at 500°C. The catalysts are of mesoporous materials and exhibiting large surface areas. The catalysts demonstrated good photocatalytic activity with good efficiency, reaching degradation percentages with Mg/Al = 1, 2, 4, 5, and 7 ratios of 94.2, 92.5, 86.2, 84.2, and 63.9%, respectively, until achieving mineralization.
High uptake of 2,4,6-trinitrotoluene by vetiver grass - Potential for phytoremediation?
International Nuclear Information System (INIS)
Makris, Konstantinos C.; Shakya, Kabindra M.; Datta, Rupali; Sarkar, Dibyendu; Pachanoor, Devanand
2007-01-01
2,4,6-Trinitrotoluene (TNT) is a potent mutagen, and a Group C human carcinogen that has been widely used to produce munitions and explosives. Vast areas that have been previously used as ranges, munition burning, and open detonation sites are heavily contaminated with TNT. Conventional remediation activities in such sites are expensive and damaging to the ecosystem. Phytoremediation offers a cost-effective, environment-friendly solution, utilizing plants to extract TNT from contaminated soil. We investigated the potential use of vetiver grass (Vetiveria zizanioides) to effectively remove TNT from contaminated solutions. Vetiver grass plants were grown in hydroponic systems containing 40 mg TNT L -1 for 8 d. Aqueous concentrations of TNT reached the method detection limit (∼1 μg L -1 ) within the 8-d period, demonstrating high affinity of vetiver for TNT, without any visible toxic effects. Results from this preliminary hydroponic study are encouraging, but in need of verification using TNT-contaminated soils. - Vetiver grass demonstrates ability to absorb TNT in aqueous media
International Nuclear Information System (INIS)
CASELLA, VITO
2004-01-01
Co-60 was produced in the Savannah River Site (SRS) reactors in the 1970s, and the irradiated cobalt reactor slugs were stored in a reactor basin at SRS. Since the activity rates of these slugs were not accurately known, assaying was required. A sodium iodide gamma detector was placed above a specially designed air collimator assembly, so that the slug was eight to nine feet from the detector and was shielded by the basin water. Also, 18 curium sampler slugs, used to produce Cm-244 from Pu-239, were to be disposed of with the cobalt slugs. The curium slugs were also analyzed with a High Purity Germanium (HPGE) detector in an attempt to identify any additional radionuclides produced from the irradiation. Co-60 concentrations were determined for reactor disassembly basin cobalt slugs and the 18 curium sampler slugs. The total Co-60 activity of all of the assayed slugs in this work summed to 31,783 curies on 9/15/03. From the Co-60 concentrations of the curium sampler slugs, the irradiation flux was determined for the known irradiation time. The amounts of Pu-238,-239,-240,-241,-242; Am-241,-243; and Cm-242,-244 produced were then obtained based on the original amount of Pu-239 irradiated
Consistent evaluation of neutron cross sections for the 242-244Cm isotopes
International Nuclear Information System (INIS)
Ignatyuk, A.V.; Maslov, V.M.
1989-01-01
The knowledge of neutron cross-sections for Curium isotopes is necessary for solving the problems of the external fuel cycle. Experimental information on the cross-sections is very meager and does not satisfy requirements and existing evaluations in different libraries differ substantially for fission and (n,2n) reaction cross-sections. This situation requires a critical review of the entire set of evaluations of the neutron cross-sections for Curium. 17 refs, 3 figs
Directory of Open Access Journals (Sweden)
Ayesha Imtiaz
2013-01-01
Full Text Available Calcium oxide (CaO nanoparticles are known to exhibit unique property due to their high adsorption capacity and good catalytic activity. In this work the CaO nanocatalysts were prepared by hydrothermal method using anionic surfactant, sodium dodecyl sulphate (SDS, as a templating agent. The as-synthesized nanocatalysts were further used as substrate for the synthesis of alumina doped calcium oxide (Al2O3·CaO nanocatalysts via deposition-precipitation method at the isoelectric point of CaO. The Al2O3·CaO nanocatalysts were characterized by FTIR, XRD, TGA, TEM, and FESEM techniques. The catalytic efficiencies of these nanocatalysts were studied for the photodegradation of 2,4,6-trinitrophenol (2,4,6-TNP, which is an industrial pollutant, spectrophotometrically. The effect of surfactant and temperature on size of nanocatalysts was also studied. The smallest particle size and highest percentage of degradation were observed at critical micelle concentration of the surfactant. The direct optical band gap of the Al2O3·CaO nanocatalyst was found as 3.3 eV.
Visual detection of 2,4,6-trinitrotolune by molecularly imprinted colloidal array photonic crystal
International Nuclear Information System (INIS)
Lu, Wei; Asher, Sanford A.; Meng, Zihui; Yan, Zequn; Xue, Min; Qiu, Lili; Yi, Da
2016-01-01
Graphical abstract: Molecularly imprinted colloidal array (MICA) was explored for the selective visual detection of TNT with color changing from green to red. And molecularly imprinted colloidal particles (MICs) were evaluated for the adsorption capacity and the imprinting efficiency. The MICA had excellent flexibility, reversibility and stability. It promised high potential for the visual semi-quantitative detection of other explosives. - Highlights: • Molecularly imprinted colloidal array (MICA) was used to visually detect TNT. • The relationship of particle size, diffracted wavelength and color was discussed. • The adsorption capacity and imprinting efficiency of MICs were calculated. • MICA had short response time, high selectivity, good reversibility and stability. • MICA had high potential to be used in other customed visual explosive detection. - Abstract: We developed a photonic crystal (PhC) sensor for the quantification of 2,4,6-trinitrotoluene (TNT) in solution. Monodisperse (210 nm in diameter) molecularly imprinted colloidal particles (MICs) for TNT were prepared by the emulsion polymerization of methyl methacrylate and acrylamide in the presence of TNT as a template. The MICs were then self-assembled into close-packed opal PhC films. The adsorption capacity of the MICs for TNT was 64 mg TNT/g. The diffraction from the PhC depended on the TNT concentration in a methanol/water (3/2, v/v) potassium dihydrogen phosphate buffer solution (pH = 7.0, 30 mM). The limit of detection (LOD) of the sensor was 1.03 μg. The color of the molecularly imprinted colloidal array (MICA) changed from green to red with an 84 nm diffraction red shift when the TNT concentration increased to 20 mM. The sensor response time was 3 min. The PhC sensor was selective for TNT compared to similar compounds such as 2,4,6-trinitrophenol, 2,4-dinitrotoluene, 2,6-dinitrotoluene, 2-nitromesitylene, 4-nitrotoluene, 2-nitrotoluene, 1,3-dinitrobenzene, methylbenzene, 4-nitrophenol
Visual detection of 2,4,6-trinitrotolune by molecularly imprinted colloidal array photonic crystal
Energy Technology Data Exchange (ETDEWEB)
Lu, Wei [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Asher, Sanford A., E-mail: asher@pitt.edu [Department of Chemistry, University of Pittsburgh, Pittsburgh, PA 15260 (United States); Meng, Zihui, E-mail: m_zihui@yahoo.com [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Yan, Zequn [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Xue, Min, E-mail: minxue@bit.edu.cn [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Qiu, Lili, E-mail: qiulili@bit.edu.cn [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Yi, Da [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China)
2016-10-05
Graphical abstract: Molecularly imprinted colloidal array (MICA) was explored for the selective visual detection of TNT with color changing from green to red. And molecularly imprinted colloidal particles (MICs) were evaluated for the adsorption capacity and the imprinting efficiency. The MICA had excellent flexibility, reversibility and stability. It promised high potential for the visual semi-quantitative detection of other explosives. - Highlights: • Molecularly imprinted colloidal array (MICA) was used to visually detect TNT. • The relationship of particle size, diffracted wavelength and color was discussed. • The adsorption capacity and imprinting efficiency of MICs were calculated. • MICA had short response time, high selectivity, good reversibility and stability. • MICA had high potential to be used in other customed visual explosive detection. - Abstract: We developed a photonic crystal (PhC) sensor for the quantification of 2,4,6-trinitrotoluene (TNT) in solution. Monodisperse (210 nm in diameter) molecularly imprinted colloidal particles (MICs) for TNT were prepared by the emulsion polymerization of methyl methacrylate and acrylamide in the presence of TNT as a template. The MICs were then self-assembled into close-packed opal PhC films. The adsorption capacity of the MICs for TNT was 64 mg TNT/g. The diffraction from the PhC depended on the TNT concentration in a methanol/water (3/2, v/v) potassium dihydrogen phosphate buffer solution (pH = 7.0, 30 mM). The limit of detection (LOD) of the sensor was 1.03 μg. The color of the molecularly imprinted colloidal array (MICA) changed from green to red with an 84 nm diffraction red shift when the TNT concentration increased to 20 mM. The sensor response time was 3 min. The PhC sensor was selective for TNT compared to similar compounds such as 2,4,6-trinitrophenol, 2,4-dinitrotoluene, 2,6-dinitrotoluene, 2-nitromesitylene, 4-nitrotoluene, 2-nitrotoluene, 1,3-dinitrobenzene, methylbenzene, 4-nitrophenol
Vennes, Stephane; Dupuis, Jean; Rumph, Todd; Drake, Jeremy; Bowyer, Stuart; Chayer, Pierre; Fontaine, Gilles
1993-01-01
We report observations of the extreme ultraviolet spectrum of the hot degenerate star GD 246 obtained with the EUVE. Our initial attempt at modeling the photospheric emission from the white dwarf reveals a relatively uncontaminated pure H spectrum in the range above 200 A, allowing a study of interstellar continuum absorption features in the line of sight of GD 246. Modeling of the He I autoionization transition discussed by Rumph et al. (1993), and the EUV continuum using the white dwarf as a source of background radiation provides measurements of both neutral and, for the first time, singly ionized He column densities in the local ISM (LISM). We estimate the He ionization fraction He II/(He I + He II) at roughly 25 percent with a total He column of 1.40-1.65 x 10 exp 18/sq cm. We have measured and compared H I column densities from the saturated Ly-alpha ISM absorption in IUE high-dispersion spectroscopy and from EUV continuum absorption: the two measurements are in good agreement with a total H column of 1.2-1.6 x 10 exp 19/sq cm. We discuss some implications for the nature of the LISM, particularly in the context of current models of the EUV radiation field.
Sigida, Elena N; Fedonenko, Yuliya P; Shashkov, Alexander S; Grinev, Vyacheslav S; Zdorovenko, Evelina L; Konnova, Svetlana A; Ignatov, Vladimir V; Knirel, Yuriy A
2014-10-29
Lipopolysaccharides from closely related Azospirillum brasilense strains, Sp246 and SpBr14, were obtained by phenol-water extraction. Mild acid hydrolysis of the lipopolysaccharides followed by GPC on Sephadex G-50 resulted in polysaccharide mixtures. On the basis of sugar and methylation analyses, Smith degradation and (1)H and (13)C NMR spectroscopy data, it was concluded that both bacteria possess the same two distinct polysaccharides having structures 1 and 2: [structure: see text]. Structure 1 has been reported earlier for a polysaccharide of A. brasilense 54 [Fedonenko et al., 2011] whereas to our knowledge structure 2 has not been hitherto found in bacterial polysaccharides. Copyright © 2014 Elsevier Ltd. All rights reserved.
Evaluation of the cardiovascular system by digital subtraction angiography in 246 patients
Energy Technology Data Exchange (ETDEWEB)
Higuma, Kikuhiko; Ohta, Takashi; Hiroto, Seiji
1987-07-01
Usefulness of intravenous digital subtraction angiography (DSA) was examined in 246 patients with cardiovascular disorders. This examination was done by centrally intravenous DSA (CIVDSA) in all patients to reduce the risks and discomforts by peripheral intravenous DSA. 1) CIVDSA could be done safely in patients aged 18 to 81 years. 2) The good diagnostic quality by CIVDSA was obtained in 81.3% of patients. These images were classified into 7 groups according to the cardiovascular system, that is, the jugular arteries, the upper extremity arteries, the thoracic aorta, the left ventricle, the abnominal aorta, the renal arteries, and the lower extremity arteries, whose rate of good diagnostic quality were 100%, 70%, 67.7%, 79.5%, 84.8%, 87%, and 71.4% respectively. 3) The poor diagnostic quality was obtained in 18.7%. 4) The severe complications were not found in any case during this examination. Our results indicate that DSA is the safe, simple and useful method to obtain the diagnostic quality image of the cardiovascular system, especially, of the occulsive arterial disease, the aortic aneurisma, the renovascular stenosis and the cardiac function of postmyocardial infarction, even in aged patients.
Evaluation of the cardiovascular system by digital subtraction angiography in 246 patients
International Nuclear Information System (INIS)
Higuma, Kikuhiko; Ohta, Takashi; Hiroto, Seiji
1987-01-01
Usefulness of intravenous digital subtraction angiography (DSA) was examined in 246 patients with cardiovascular disorders. This examination was done by centrally intravenous DSA (CIVDSA) in all patients to reduce the risks and discomforts by peripheral intravenous DSA. 1) CIVDSA could be done safely in patients aged 18 to 81 years. 2) The good diagnostic quality by CIVDSA was obtained in 81.3 % of patients. These images were classified into 7 groups according to the cardiovascular system, that is, the jugular arteries, the upper extremity arteries, the thoracic aorta, the left ventricle, the abnominal aorta, the renal arteries, and the lower extremity arteries, whose rate of good diagnostic quality were 100 %, 70 %, 67.7 %, 79.5 %, 84.8 %, 87 %, and 71.4 % respectively. 3) The poor diagnostic quality was obtained in 18.7 %. 4) The severe complications were not found in any case during this examination. Our results indicate that DSA is the safe, simple and useful method to obtain the diagnostic quality image of the cardiovascular system, especially, of the occulsive arterial disease, the aortic aneurisma, the renovascular stenosis and the cardiac function of postmyocardial infarction, even in aged patients. (author)
CSIR Research Space (South Africa)
Mostert, FJ
2011-10-01
Full Text Available and configuration. In this study, the emission characteristics at wavelengths between 650 and 940 nm were experimentally investigated for cylindrical bare Composition B, 2,4,6-trinitrotoluene [C7H5(NO2)3], and PE4 plastic explosive charges in the mass (M) range of 0...
Degradation of 2,4,6-trinitrotoluene by P. aeruginosa and characterization of some metabolites
Directory of Open Access Journals (Sweden)
Hatice Aysun Mercimek
2015-03-01
Full Text Available Degradation of 2,4,6-trinitrotoluene (TNT, a nitroaromatic explosive found in the soil and ground water, was investigated using Pseudomonas aeruginosa in in vitroexperiments. Biodegradable abilitiy of this bacteria was performed with 50 and 75 mg L−1 TNT concentrations in a defined liquid medium for 96 h time period. Treatment of TNT in supernatant samples taken at 0, 6, 12, 24, 48, 72 and 96 h from agitated vessels was followed by reverse-phase high-performance liquid chromatography (HPLC. In cultures supplemented with 50 and 75 mgL−1 TNT, after 96 h of incubation 46% and 59% reduction were detected respectively. Two metabolites as degradation intermediates with nitrite release into the medium, 2,4-dinitrotoluene (2,4-DNT and 4-aminodinitrotoluene (4-ADNT, were elucidated by thin layer chromatography (TLC and gas chromatography-mass spectrometry (GC-MS. These findings clearly indicate that Pseudomonas aeruginosa can be used in bioremediation of TNT contaminated sites.
DEFF Research Database (Denmark)
Zandi, Roza; Selivanova, Galina; Christensen, Camilla Laulund
2011-01-01
Small cell lung cancer (SCLC) is a highly malignant disease with poor prognosis, necessitating the need to develop new and efficient treatment modalities. PRIMA-1(Met) (p53-dependent reactivation of massive apoptosis), also known as APR-246, is a small molecule, which restores tumor suppressor...... function to mutant p53 and induces cancer cell death in various cancer types. Since p53 is mutated in more than 90% of SCLC, we investigated the ability of PRIMA-1(Met) to induce apoptosis and inhibit tumor growth in SCLC with different p53 mutations....
International Nuclear Information System (INIS)
Mitu, L.ITU; Imran, M.
2011-01-01
The complexes of Cu(II), Ni(II), Co(II), Mn(II), and Zn(II) with isonicotinoyl-hydrazone -2,4,6-trimethylbenzaldehyde (INHTB) are reported. The complexes have been characterized by analytical data, IR, UV-Vis, NMR spectra, magnetic susceptibility, thermal analysis and for the Cu(II) complex the ESR spectrum has been recorded. The anti-bacterial activity of these complexes were investigated against Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Salmonella enteritidis, Shigella flexneri bacteria. The INHTB ligand is coordinated at the metallic ions by oxygen amide (O=C) and the azomethine nitrogen. (author)
JPRS Report, Science & Technology, USSR: Space.
1988-08-17
Half-life, years Specific Heat Release W/hr Plutonium-238 87.5 0.46 Curium-244 18.4 2.8 Curium-242 0.45 120 Polonium - 210 0.38 144 Polonium - 210 ...begun train- ing a year before the flight. The prospective space travelers had to be trained to stay in a special capsule and to use nozzles for food ...conditions of extended weight- lessness. On command, the animals are given food and water, waste is removed, and day/night conditions are regulated
Root uptake of transuranic elements
International Nuclear Information System (INIS)
Schulz, R.K.
1977-01-01
The uptake of elements by plant roots is one of the important pathways of entry of many elements into the food chain of man. Data are cited showing plutonium concentration ratios, plant/soil, ranging from 10 -10 to 10 -3 . Concentration ratios for americium range from 10 -7 to 10 +1 . Limited experiments with curium and neptunium indicate that root uptake of curium is similar to that of americium and that plant uptake of neptunium is substantially larger than that of curium and americium. The extreme ranges of concentration ratios cited for plutonium and americium are due to a number of causes. Experimental conditions such as very intensive cropping will lead to abnormally high concentration ratios. In some experiments, addition of chelating agents markedly increased plant root uptake of transuranic elements. Particle size and composition of the source material influenced uptake of the transuranics by plants. Translocation within the plant, and soil factors such as pH and organic matter content, all affect concentration ratios
International Nuclear Information System (INIS)
Haire, R.G.; Young, J.P.; Peterson, J.R.; Tennessee Univ., Knoxville; Benedict, U.
1987-01-01
The anhydrous tri-iodides of plutonium, americium and curium under pressure have been investigated using absorption spectrophotometry. These initial studies on plutonium and curium tri-iodides together with the published data for americium tri-iodide show that the rhombohedral form of these compounds (BiI 3 -type structure) can be converted to the orthorhombic form (PuBr 3 -type structure) by applying pressure at room temperature. Absorption spectrophotometry can often differentiate between two crystallographic forms of a material and has been used in the present high-pressure studies to monitor the effects of pressure on the tri-iodides. A complication in these studies of the tri-iodides is a significant shift of their absorption edges with pressure from the near UV to the visible spectral region. With curium tri-iodide this shift causes interference with the major f-f absorption peaks and precludes identification by absorption spectrophotometry of the high pressure phase of CmI 3 . (orig.)
Criticality and thermal analyses of separated actinides
International Nuclear Information System (INIS)
Bakker, E.
2004-01-01
Curium and americium pose special problems in the chemical preparation of spent fuel for transmutation. Once separated from the other actinides, the isotopes can lead to nuclear fission with the subsequent release of a large amount of radiation. A neutron criticality code was used to determine k eff for varying quantities of Cm 2 O 3 and Am 2 O 3 held within spherical or cylindrical containers. These geometries were investigated both in air and in water. Recommendations are made on the maximum amount of Cm 2 O 3 and Am 2 O 3 that can be safely stored or handled before encountering criticality. Several isotopes of curium and americium also generate a significant amount of heat by radioactive decay. If kilogram quantities are stored in a container, for example, the material may heat to an equilibrium temperature that exceeds its melting temperature. The heat generation of curium and americium present even more restriction on the mass of that can safely be contained in one location. (author)
International Nuclear Information System (INIS)
Apps, J.A.; Benson, L.V.; Lucas, J.; Mathur, A.K.; Tsao, L.
1977-09-01
During fiscal year 1977, the following subtasks were performed. (1) Thermodynamic data were tabulated for those aqueous complexes and solid phases of plutonium, neptunium, americium, and curium likely to form in the environment. (2) Eh-pH diagrams were computed and drafted for plutonium, neptunium, americium and curium at 25 0 C and one atmosphere. (3) The literature on distribution coefficients of plutonium, neptunium, americium, and curium was reviewed. (4) Preliminary considerations were determined for an experimental method of measuring radionuclide transport in water-saturated rocks. (5) The transport mechanisms of radionuclides in water-saturated rocks were reviewed. (6) A computer simulation was attempted of mass transfer involving actinides in water-saturated rocks. Progress in these tasks is reported. Subtasks 1, 2, 3, and 4 are complete. The progress made in subtask 5 is represented by an initial theoretical survey to define the conditions needed to characterize the transport of radionuclides in rocks. Subtask 6 has begun but is not complete
Directory of Open Access Journals (Sweden)
Ellen R. Goldman
2005-01-01
Full Text Available A homogeneous assay was used to detect 2,4,6-trinitrotoluene (TNT spiked into environmental water samples. This assay is based on changes in fluorescence emission intensity when TNT competitively displaces a fluorescently labeled, TNT analog bound to an anti-TNT antibody. The effectiveness of the assay was highly dependent on the source of the sample being tested. As no correlation between pH and assay performance was observed, ionic strength was assumed to be the reason for variation in assay results. Addition of 10x phosphate-buffered saline to samples to increase their ionic strength to that of our standard laboratory buffer (about 0.17 M significantly improved the range over which the assay functioned in several river water samples.
Energy Technology Data Exchange (ETDEWEB)
Skerencak, Andrej
2010-05-11
The subject of the present investigation is the complexation of trivalent actinides at elevated temperatures. The objective of this work is to broaden the comprehension of the geochemical processes relevant for the migration of radionuclides in the near-field of a nuclear waste repository. Depending on the disposed nuclear waste, the temperature in the direct vicinity of a nuclear waste repository may reach up to 200 C. The result is a distinct change of the geochemistry of the actinides. Many of these processes have already been studied in detail at room temperature. Yet, data at elevated temperature are rare. However, a comprehensive long term safety analysis of a nuclear waste repository requires the precise thermodynamic description of the relevant geochemical processes at room as well as at elevated temperatures. The present work is focused on the investigation of the complexation of trivalent curium (Cm(III)) with different inorganic ligands at elevated temperatures. Due to its outstanding spectroscopic properties, Cm(III) is chosen as a representative for trivalent actinides. The studied ligand systems are nitrate (NO{sub 3}{sup -}), fluoride (F{sup -}), sulphate (SO{sub 4}{sup 2-}) and chloride (Cl{sup -}). The main analytical method employed is the ''time resolved laser fluorescence spectroscopy'' (TRLFS). The experiments with nitrate, sulphate and chloride were carried out in a custom-built high temperature cell, enabling spectroscopic studies at temperatures up to 200 C. The Cm(III)-fluoride-system was studied in a cuvette (quartz glass) in the temperature range from 20 to 90 C. Supplementary structural studies were performed using EXAFS (Extended X-Ray Absorption Fine Structure) spectroscopy and supported by quantum chemical calculations at DFT (Density Functional Theory) level. The results of the TRLFS studies show a general shift of the chemical equilibrium towards the complexed species with increasing temperature. For instance
International Nuclear Information System (INIS)
Alekseev, A.A.; Bergman, A.A.; Berlev, A.I.; Koptelov, E.A.; Samylin, B.F.; Trufanov, A.M.; Fursov, B.I.; Shorin, V.S.
2009-12-01
This report contains brief description of the Lead Slowing Down Spectrometer and results of measurements of neutron-induced fission cross sections for 236 U, 242m Am, 243 Cm, 244 Cm, 245 Cm and 246 Cm done at this spectrometer. The work was partially supported through the IAEA research contract RC-14485-RD in the framework of the IAEA Coordinated Research Project 'Minor Actinide Neutron Reaction Data (MANREAD)'. The detailed description of the experimental set up, measurements procedure and data treatment can be found in the JIA-1182 (2007) and JIA-1212 (2009) reports from the Institute of Nuclear Research of the Russian Academy of Science published in Russian. Part 1 contains the first year report of the research contract and part 2 the second year report. (author)
Luo, Congwei; Jiang, Jin; Ma, Jun; Pang, Suyan; Liu, Yongze; Song, Yang; Guan, Chaoting; Li, Juan; Jin, Yixin; Wu, Daoji
2016-06-01
The transformation efficiency and products of an odorous compound 2,4,6-trichloroanisole (TCA) at the wavelength of 254 nm in the presence of persulfate were investigated for the first time. The effects of water matrix (i.e., natural organic matter (NOM), pH, carbonate/bicarbonate (HCO3(-)/CO3(2-)), and chloride ions (Cl(-))) were evaluated. The second order rate constant of TCA reacting with sulfate radical (SO4(-)) was determined to be (3.72 ± 0.10) × 10(9) M(-1) s(-1). Increasing dosage of persulfate increased the observed pseudo-first-order rate constant for TCA degradation (kobs), and the contribution of SO4(-) to TCA degradation was much higher than that of HO at each experimental condition. Degradation rate of TCA decreased with pH increasing from 4.0 to 9.0, which could be explained by the lower radical scavenging effect of dihydrogen phosphate than hydrogen phosphate in acidic condition (pH kinetic results could be described by a steady-state kinetic model. Furthermore, liquid chromatography/electrospray ionization-triple quadrupole mass spectrometry at powerful precursor ion scan approach was used to selectively detect oxidation products of TCA. It was found that 2,4,6-trichorophenol (TCP) was the major oxidation product (i.e., the initial yield of TCP was above 90%). The second order rate constant between TCP and SO4(-) was estimated to be (4.16 ± 0.20) × 10(9) M(-1) s(-1). In addition, three products (i.e., 2,6-dichloro-1,4-benzoquinone and two aromatic ring-opening products) were detected in the reaction of TCP with SO4(-), which also appeared in the oxidation of TCA in the UV/persulfate process. A tentative pathway was proposed, where the initial one-electron oxidation of TCA by SO4(-) and further reactions (e.g., ipso-hydroxylation and aromatic ring-cleavage) of the formed cation intermediate TCA were involved. Copyright © 2016. Published by Elsevier Ltd.
(E-N-[2-(9-Fluorenylidene-3a,5,7-trimethyl-3,3a-dihydro-2H-indol-3-ylidene]-2,4,6-trimethylaniline
Directory of Open Access Journals (Sweden)
Norihiro Tokitoh
2008-02-01
Full Text Available The title compound, C33H30N2, has an E configuration at the imine double bond. The angle between the least-squares planes of the imine C=N—C group and the benzene ring of the 2,4,6-trimethylphenyl substituent is 85.38 (11°. The crystal structure is sustained mainly by intermolecular π–π interactions (3.510 Å between the two fluorene rings and some C—H...π interactions.
A study of anti-inflammatory and analgesic activity of new 2,4,6-trisubstituted pyrimidines.
Yejella, Rajendra Prasad; Atla, Srinivasa Rao
2011-01-01
Chalcone derivatives (3a-m) were prepared by condensing 4-aminoacetophenone with various substituted aromatic and hetero aromatic aldehydes according to Claisen-Schmidt condensation. These chalcones, on reaction with guanidine hydrochloride under basic alcoholic conditions gave 2,4,6-trisubstituted pyrimidines (5a-m) in quantitative yields. All the newly synthesized pyrimidines were characterized by means of IR, ¹H- and ¹³C-NMR, Electron Ionization (EI)-mass and elemental analyses and screened for anti-inflammatory and analgesic activities by in vivo. 2-amino-4-(4-aminophenyl)-6-(2,4-dichlorophenyl)pyrimidine (5b) and 2-amino-4-(4-aminophenyl)-6-(3-bromophenyl) pyrimidine (5d) were found to be the most potent anti-inflammatory and analgesic activity compared with ibuprofen, reference standard. And also it was found that compound 5b identified as lead structure among all in both the activities. Pyrimidines which showed good anti-inflammatory activity also displayed better analgesic activity.
Low-level determination of transuranic elements in marine environment samples
International Nuclear Information System (INIS)
Ballestra, S.; Holm, E.; Fukai, R.
1978-01-01
The procedures developed and currently employed in the Monaco Laboratory for determining transuranic elements in seawater, marine sediments and organisms are described and discussed. While the standard anion-exchange procedure from the hydrochloric acid medium is used for the separation of plutonium isotopes from americium, purification of americium and curium is achieved by an ion-exchange sorption from the methanol-nitric acid medium, followed by an elution with the methanol-hydrochloric acid mixture. Satisfactory clean-up of plutonium as well as americium and curium can be achieved by applying the described procedures. (author)
2,4,6-Trichlorophenylhydrazine Schiff bases as DPPH radical and super oxide anion scavengers.
Khan, Khalid Mohammed; Shah, Zarbad; Ahmad, Viqar Uddin; Khan, Momin; Taha, Muhammad; Rahim, Fazal; Ali, Sajjad; Ambreen, Nida; Perveen, Shahnaz; Choudhary, M Iqbal; Voelter, Wolfgang
2012-05-01
Syntheses of thirty 2,4,6-trichlorophenylhydrazine Schiff bases 1-30 were carried out and evaluated for their in vitro DPPH radical and super oxide anion scavenging activities. Compounds 1-30 have shown a varying degree of DPPH radical scavenging activity and their IC50 values range between 4.05-369.30 µM. The compounds 17, 28, 18, 14, 8, 15, 12, 2, 29, and 7 exhibited IC50 values ranging between 4.05±0.06-24.42±0.86 µM which are superior to standard n-propylgallate (IC50=30.12±0.27 µM). Selected compounds have shown a varying degree of superoxide anion radical scavenger activity and their IC50 values range between 91.23-406.90 µM. The compounds 28, 8, 17, 15, and 14, showed IC50 values between 91.23±1.2-105.31±2.29 µM which are superior to standard n-propylgallate (IC50=106.34±1.6 µM).
Energy Technology Data Exchange (ETDEWEB)
Sanchez, M.; Hadasch, A.; Meunier, B. (Centre National de la Recherche Scientifique (CNRS), 31 - Toulouse (France). Laboratoire de Chimie de Coordination); Rabion, A. (Elf-Atochem, 64 - Artix (France). Centre de Recherche)
1999-04-01
The degradation of recalcitrant pollutants remains a high priority in order to preserve our environment. For example, chlorinated aromatic compounds are extremely persistent in the environment because of their slow biodegradation by microorganisms. One of the most notable toxic offenders is 2,4,6-tri-chlorophenol (TCP) which is produced by paper mills and also used as a biocide. Thus TCP is an obvious benchmark for research on the decontamination of waste waters. In this work, the covalent attachment of an iron phthalocyanine with chloro-sulfonyl substituents (FePcSO[sub 2]Cl) onto a functionalized 3-amino-propyl-silica has been achieved. This supported catalyst FePcSO[sub 2]Cl-silica is able to degrade a recalcitrant pollutant like TCP with hydrogen peroxide as oxidant. In order to improve the catalytic efficiency of the grafted iron phthalocyanine complex, modifications of the macrocycle substituents, passivation of the silica surface, variation of the loading of the carrier and addition of an organic co solvent to the reaction mixture were carried out. (authors) 21 refs.
Effects of actinide burning on waste disposal at Yucca Mountain
International Nuclear Information System (INIS)
Hirschfelder, J.
1992-01-01
Release rates of 15 radionuclides from waste packages expected to result from partitioning and transmutation of Light-Water Reactor (LWR) and Actinide-Burning Liquid-Metal Reactor (ALMR) spent fuel are calculated and compared to release rates from standard LWR spent fuel packages. The release rates are input to a model for radionuclide transport from the proposed geologic repository at Yucca Mountain to the water table. Discharge rates at the water table are calculated and used in a model for transport to the accessible environment, defined to be five kilometers from the repository edge. Concentrations and dose rates at the accessible environment from spent fuel and wastes from reprocessing, with partitioning and transmutation, are calculated. Partitioning and transmutation of LWR and ALMR spent fuel reduces the inventories of uranium, neptunium, plutonium, americium and curium in the high-level waste by factors of 40 to 500. However, because release rates of all of the actinides except curium are limited by solubility and are independent of package inventory, they are not reduced correspondingly. Only for curium is the repository release rate much lower for reprocessing wastes
International Nuclear Information System (INIS)
Karalova, Z.K.; Bukina, T.I.; Myasoedov, B.F.; Fedorov, L.A.; Sokolovskij, S.A.
1987-01-01
Extraction of trivalent americium, curium, californium and europium by technical mixture of mono- and didecylpyrocatechin (TAP) in various diluents from carbonate solutions is investigated. Effect of many factors (pH, K 2 CO 3 concentration, TAP, metal; the time of phase contact) on the completeness of element isolation and separation is clarified. It is ascertained that the elements listed are quantitatively extracted by TAP solution in toluene and cyclohexane in the range of K 2 CO 3 concentrations from 0.25 to 1.5 mol/l. The difference in americium and curium distribution coefficient during their extraction by TAP from 0.25 mol/l of K 2 CO 3 solution is detected. Separation coefficients of the pair increase with the increase of carbonate solution pH. The separation can be improved at the stage of element reextraction by the mixture of K 2 CO 3 and DTPA or EDTA from alkylpyrocatechin, sunce rate constants of americium and curium reextraction differ greatly. Using 13 C NMR the composition of compounds in organic phase on the basis of 4-(α, α-dioctylethyl)pyrocatechin is investigated
Proliferation resistance of the lithium reduction process
International Nuclear Information System (INIS)
Ko, W. I.; Ha, J. H.; Lee, S. Y.; Song, D. Y.; Kim, H. D.; Park, S. W.
2002-01-01
This paper addresses the characteristics of proliferation resistance of the lithium reduction process and international domestic safeguarding methods. In addition to dealing with qualitative features of the proliferation resistance, this study is emphasizing on the quantitative analysis of radiation barrier, which could be a significant accessibility barrier if the field is high enough to force a theft to shield the object during a theft. From the radiation barrier analysis, it is indicated that whole-body radiation dose is about 20 rem/hr at one meter of smelt and ingot metal of 40 kgHM, which could be considered to be a significant reduction in risk of theft. For safeguarding of this process, we propose a NDA concept for nuclear material accounting which is to measure the amount of curium in the reduction metal and associated process samples using a neutron coincidence counter and then to convert the curium mass into special nuclear material with predetermined curium ratios. For this, a well-type neutron coincidence counter with substantial shielding to protect the system from high gamma radiation is conceptually designed
International Nuclear Information System (INIS)
Erger, M.; Hollatz, R.; Tempel, K.
1977-01-01
The phenobarbital-induced activity of aniline-p-hydroxylase in livers of mice was enhanced additionally when the animals were X-irradiated 4-16 hours before the administration of the inducer. The same effect could be demonstrated after repeated irradiation with low doses. 2,4,6-triethyleneimino-1,3,5-triazine (tretamine) inhibited the induction of aniline-p-hydroxylase only when administered in extremely high doses. Lower doses resulted in 'superinduciton'. (orig.) [de
Karimi, Ali Reza; Tarighatjoo, Mahsa; Nikravesh, Golara
2017-12-01
In this work, 1,3,5-triazine-2,4,6-tribenzaldehyde was synthesized and chosen as the cross-linking agent for preparation of novel thermo- and pH-responsive hydrogels based on chitosan. The cross-linking proceeds through formation of imine bond by reaction of amino groups of chitosan with aldehyde groups of the cross-linker. The various amounts (6, 10, 14% w/w) of the cross-linker were used with respect to chitosan to produce three 1,3,5-triazine-2,4,6-tribenzaldehyde cross-linked chitosans. Then, their hydrogel nanocomposites were prepared by crosslinking of chitosan with 1,3,5-triazine-2,4,6-tribenzaldehyde in the presence of 0.1% and 0.3% (w/w) multi-walled carbon nanotubes (MWCNTs). The structure and properties of the hydrogels and their nanocomposites were characterized by FT-IR, 1 H NMR and scanning electron microscopy (SEM). The swelling behavior of prepared hydrogels and their nanocomposites at different pHs and temperatures was investigated. The results showed that they exhibit a pH and temperature-responsive swelling ratio. The swelling behavior of the prepared chitosan hydrogels was strongly dependent on the amounts of cross-linker and MWCNTs. In vitro controlled release behavior of metronidazole model drug was studied with prepared hydrogels and nanocomposite hydrogels. The pH, temperature and wt% of MWCNTs were found to strongly influence the drug release behavior of the hydrogels. Copyright © 2017 Elsevier B.V. All rights reserved.
Identification of colloids in nuclear waste glass reactions
International Nuclear Information System (INIS)
Cunnane, J.C.; Bates, J.K.
1991-01-01
Characterization data for particulates formed under a variety of laboratory leaching conditions that simulate glass reaction in a repository environment are presented. Data on the particle size distributions and filterable fractions for neptunium, plutonium, americium, and curium were obtained by filtrations through a series of filters with pore sizes ranging from 1 μm to 3.8 nm. The neptunium was found to be largely nonfilterable. Americium and plutonium were associated with filterable particles. The particles with which the americium, plutonium, and curium were associated were characterized using transmission electron microscopy (TEM) examination techniques. 8 refs., 1 fig., 2 tabs
Biodegradation of TNT (2,4,6-Trinitrotoluene) by Phanerochaete chrysosporium
International Nuclear Information System (INIS)
Fernando, T.; Bumpus, J.A.; Aust, S.D.
1990-01-01
Extensive biodegradation of TNT (2,4,6-trinitrotoluene) by the white rot fungus Phanerochaete chrysosporium was observed. At an initial concentration of 1.3 mg/liter, 35.4 ± 3.6% of the [ 14 C]TNT was degraded to 14 CO 2 in 18 days. The addition of glucose 12 days after the addition of TNT did not stimulate mineralization, and, after 18 days of incubation with TNT only, about 3.3% of the initial TNT could be recovered. Mineralization of [ 14 C]TNT absorbed on soil was also examined. Ground corncobs served as the nutrient for slow but sustained degradation of [ 14 C]TNT to 14 CO 2 such that 6.3 ± 0.6% of the [ 14 C]TNT initially present was converted to 14 CO 2 during the 30-day incubation period. Mass balance analysis of liquid cultures and of soil-corncob cultures revealed that polar [ 14 C]TNT metabolites are formed in both systems, and high-performance liquid chromatography analyses revealed that less then 5% of the radioactivity remained as undegraded [ 14 C]TNT following incubation with the fungus in soil and liquid cultures. When the concentration of TNT in cultures (both liquid and soil) was adjusted to contamination levels that might be found in the environment, i.e., 10,000 mg/kg in soil and 100 mg/liter in water, mineralization studies showed that 18.4 ± 2.9% and 19.6 ± 3.5% of the initial TNT was converted to 14 CO 2 in 90 days in soil and liquid cultures, respectively. In both cases (90 days in water at 100 mg/liter and in soil at 10,000 mg/kg) approximately 85% of the TNT was degraded. These results suggest that this fungus may be useful for the decontamination of sites in the environment contaminated with TNT
International Nuclear Information System (INIS)
Yang Xin; Zhao Xueheng; Hwang, H.-M.
2007-01-01
Riboflavin-sensitized phototransformation of 2,4,6-trinitrotoluene (TNT) under natural sunlight was investigated with reverse-phase high performance liquid chromatography/mass spectrometry (HPLC/MS) and gas chromatography/mass spectrometry (GC/MS). The effect of different spectral region of sunlight on TNT phototransformation in the absence or presence of riboflavin was also investigated by using optical filters with cut-off at 400 or 455 nm. The concentration of riboflavin in the phototransformation of TNT was optimized. Concentration of riboflavin and TNT was 1.0 and 50 μM, respectively. The rates of phototransformation of TNT under natural sunlight in the presence or absence of riboflavin were conformed to initial pseudo-first-order rate equation. The photolysis half life of TNT in the presence of riboflavin was 21.87 min, compared to 39 min in the absence of riboflavin under natural sunlight. Two major phototransformation products of TNT, 3,5-dinitroaniline (3,5-DNA) and 1,3,5-trinitrobenzene (1,3,5-TNB), were detected in the samples in the presence of riboflavin receiving irradiation at full wavelength or wavelength >400 nm. The results indicate that riboflavin mediates TNT sensitized-phototransfomation under natural sunlight or near-UV-vis light
Energy Technology Data Exchange (ETDEWEB)
Geraldo, Bianca
2012-07-01
Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)
Results of Am isotopic ratio analysis in irradiated MOX fuels
Energy Technology Data Exchange (ETDEWEB)
Koyama, Shin-ichi; Osaka, Masahiko; Mitsugashira, Toshiaki; Konno, Koichi [Power Reactor and Nuclear Fuel Development Corp., Oarai, Ibaraki (Japan). Oarai Engineering Center; Kajitani, Mikio
1997-04-01
For analysis of a small quantity of americium, it is necessary to separate from curium which has similar chemical property. As a chemical separation method for americium and curium, the oxidation of americium with pentavalent bismuth and subsequent co-precipitation of trivalent curium with BIP O{sub 4} were applied to analyze americium in irradiated MOX fuels which contained about 30wt% plutonium and 0.9wt% {sup 241}Am before irradiation and were irradiated up to 26.2GWd/t in the experimental fast reactor Joyo. The purpose of this study is to measure isotopic ratio of americium and to evaluate the change of isotopic ratio with irradiation. Following results are obtained in this study. (1) The isotopic ratio of americium ({sup 241}Am, {sup 242m}Am and {sup 243}Am) can be analyzed in the MOX fuels by isolating americium. The isotopic ratio of {sup 242m}Am and {sup 243}Am increases up to 0.62at% and 0.82at% at maximum burnup, respectively, (2) The results of isotopic analysis indicates that the contents of {sup 241}Am decreases, whereas {sup 242m}Am, {sup 243}Am increase linearly with increasing burnup. (author)
Alpha self irradiation effects in nuclear borosilicate glass
International Nuclear Information System (INIS)
Peuget, S.; Roudil, D.; Deschanels, X.; Jegou, C.; Broudic, V.; Bart, J.M.
2004-01-01
The properties of actinide glasses are studied in the context of high-level waste management programs. Reprocessing high burnup fuels in particular will increase the minor actinide content in the glass package, resulting in higher cumulative alpha decay doses in the glass, and raising the question of the glass matrix behavior and especially its containment properties. The effect of alpha self-irradiation on the glass behavior is evaluated by doping the glass with a short-lived actinide ( 244 Cm) to reach in several years the alpha dose received by the future glass packages over several thousand years. 'R7T7' borosilicate glasses were doped with 3 different curium contents (0.04, 0.4 and 1.2 wt% 244 CmO 2 ). The density and mechanical properties of the curium-doped glasses were characterized up to 2. 10 18 α/g, revealing only a slight evolution of the macroscopic behavior of R7T7 glass in this range. The leaching behavior of curium-doped glass was also studied by Soxhlet tests. The results do not show any significant evolution of the initial alteration rate with the alpha dose. (authors)
International Nuclear Information System (INIS)
Ageyev, V.A.; Sajeniouk, A.D.
2005-01-01
Routine analytical procedures have been developed for the reliable simultaneous determination of 90 Sr, 238 Pu, 239+240 Pu, 241 Am and 242-244 Cm, Chernobyl derived radioisotopes and fallout after nuclear weapon tests in a wide range of environmental samples: soil (100-200 g), sediments, aerosols, water and vegetation. This procedure has been applied to thousands of soil and sediment samples and hundreds of biological and water samples taken in the exclusive zone of Chernobyl NPP and different regions of Ukraine from 1989 to the present. After the sample has been properly prepared and isotopic tracers added, plutonium, americium and curium are precipitated with calcium oxalate and then lanthanum fluoride. Plutonium is separated from americium and curium by anion-exchange. Americium and curium are separated from rare earths by cation-exchange with gradient elute α-hydroxy-iso-butyric acid. During projects by AQCS IAEA 'Evaluation of Methods for 90 Sr in a Mineral Matrix' and 'Proficiency Test for 239 Pu, 241 Pu and 241 Am Measurement in a Mineral Matrix' accuracy and precision for 90 Sr, 239 Pu and 241 Am by present procedure was evaluated. Advantages, difficulties and limitations of the method are discussed. (author)
Wang, Yong; Cao, Wei; Wang, Luyao; Zhuang, Qianfen; Ni, Yongnian
2018-06-04
A metal organic framework (MOF) of the type copper(II)-1,3,5-benzenetricarboxylic acid (Cu-BTC) was electrodeposited on electroreduced graphene oxide (ERGO) placed on a glassy carbon electrode (GCE). The modified GCE was used for highly sensitive electrochemical determination of 2,4,6-trinitrophenol (TNP). The fabrication process of the modified electrode was characterized by scanning electron microscopy and electrochemical impedance spectroscopy. Differential pulse voltammetry (DPV) demonstrates that the Cu-BTC/ERGO/GCE gives stronger signals for TNP reduction than Cu-BTC/GCE or ERGO/GCE alone. DPV also shows TNP to exhibit three reduction peaks, the first at a potential of -0.42 V (vs. SCE). This potential was selected because the other three similarly-structured compounds (2-nitrophenol, 4-nitrophenol, 2,4-dinitrophenol) do not give a signal at this potential. Response is linear in the 0.2 to 10 μM TNP concentration range, with a 0.1 μM detection limit (at S/N = 3) and a 15.98 μA∙μM -1 ∙cm -2 sensitivity under optimal conditions. The applicability of the sensor was evaluated by detecting TNP in spiked tap water and lake water samples. Recoveries ranged between 95 and 101%. Graphical abstract Schematic presentation of an electrochemical sensor that was fabricated by electrodeposition of the metal-organic framework (MOF) of copper(II)-1,3,5-benzenetricarboxylic acid (Cu-BTC) onto the surface of electroreduced graphene oxide (ERGO) modified glassy carbon electrode (GCE). It was applied to sensitive and selective detection of 2,4,6-trinitrophenol (TNP).
International Nuclear Information System (INIS)
Ali, Shaista; Farrukh, Muhammad Akhyar; Khaleeq-ur-Rahman, Muhammad
2013-01-01
Synthesis of Magnesium oxide (MgO) nanoparticles and zinc deposited magnesium oxide (Zn/MgO) nanoparticles was carried out using hydrothermal and deposition-precipitation method with the variation of 1-Propanol (organic solvent) concentration, sodium hydroxide and urea concentration. The nanoparticles were characterized by using FTIR, TGA, SEM-EDX, TEM and XRD. The photocatalytic efficiency of MgO and Zn/MgO nanoparticles was studied by degradation of 2,4,6-trinitrophenol (TNP), which is highly acute and toxic and causes skin and eyes diseases, liver malfunction and tumor formation. Photodegradation of TNP was carried out under UV irradiation and confirmed by using HPLC and GC-MS. MgO and Zn/MgO nanoparticles that were synthesized by using urea showed higher first-order rate constant (k) value and percentage degradation as compared to nanoparticles that were synthesized using NaOH. It was observed that the concentration of solvent has direct relation with the k value of degradation of TNP
Energy Technology Data Exchange (ETDEWEB)
Ali, Shaista; Farrukh, Muhammad Akhyar; Khaleeq-ur-Rahman, Muhammad [GC University Lahore, Lahore (Pakistan)
2013-11-15
Synthesis of Magnesium oxide (MgO) nanoparticles and zinc deposited magnesium oxide (Zn/MgO) nanoparticles was carried out using hydrothermal and deposition-precipitation method with the variation of 1-Propanol (organic solvent) concentration, sodium hydroxide and urea concentration. The nanoparticles were characterized by using FTIR, TGA, SEM-EDX, TEM and XRD. The photocatalytic efficiency of MgO and Zn/MgO nanoparticles was studied by degradation of 2,4,6-trinitrophenol (TNP), which is highly acute and toxic and causes skin and eyes diseases, liver malfunction and tumor formation. Photodegradation of TNP was carried out under UV irradiation and confirmed by using HPLC and GC-MS. MgO and Zn/MgO nanoparticles that were synthesized by using urea showed higher first-order rate constant (k) value and percentage degradation as compared to nanoparticles that were synthesized using NaOH. It was observed that the concentration of solvent has direct relation with the k value of degradation of TNP.
International Nuclear Information System (INIS)
Frische, Tobias
2003-01-01
The luminescent bacteria assay, using soil leachates, was the most sensitive toxicity indicator. - To evaluate the environmental relevance of in situ bioremediation of contaminated soils, effective and reliable monitoring approaches are of special importance. The presented study was conducted as part of a research project investigating in situ bioremediation of topsoils contaminated by the explosive 2,4,6-trinitrotoluene (TNT). Changes in soil toxicity within different experimental fields at a former ordnance factory were evaluated using a battery of five bioassays (plant growth, Collembola reproduction, soil respiration, luminescent bacteria acute toxicity and mutagenicity test) in combination to chemical contaminant analysis. Resulting data reveal clear differences in sensitivities between methods with the luminescent bacteria assay performed with soil leachates as most sensitive toxicity indicator. Complete test battery results are presented in so-called soil toxicity profiles to visualise and facilitate the interpretation of data. Both biological and chemical monitoring results indicate a reduction of soil toxicity within 17 months of remediation
2017-11-06
substances early in the RDT&E process to avoid unnecessary costs, conserve physical resources, and sustain the health of those potentially exposed. The SERDP...pyrazinediamine 3,5-dinitro 1 –oxide (LLM-105) and 2,4,6-trinitro-3-bromoanisole (TNBA) Prepared by: Emily Reinke, Ph.D. Health Effects Division...Toxicology Directorate Army Public Health Center ARIMS designation: 500c Use of trademarked name(s) does not imply endorsement by the U.S
International Nuclear Information System (INIS)
Koc, Ziya Erdem; Bingol, Haluk; Saf, Ahmet O.; Torlak, Emrah; Coskun, Ahmet
2010-01-01
Four new tripodal-benzimidazole derivatives were synthesized by Schiff base reaction between 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine (TRIPOD) and different diamine derivatives. The structures of the obtained compounds were identified by FT-IR, 1 H NMR, 13 C NMR and UV-vis spectral data, thermal analysis and elemental analysis. Electrochemical behaviors of the compounds were studied by cyclic voltammetry in DMF including 0.1 M [NBu 4 ] [PF 6 ]. The voltammograms showed peaks having similar characteristics except tripodal-benzimidazole including -NO 2 derivative. In addition, their antimicrobial activities were evaluated by using the standard disk diffusion method in dimethylformamide media. The activities were determined against 4 bacteria cultures by comparing to those of gentamycin.
Wang, Jin
2018-06-01
A near infrared (NIR) optical biosensor based on peptide functionalized single-walled carbon nanotubes (SWCNTs) hybrids for 2,4,6-trinitrotoluene (TNT) explosive detection was developed. The TNT binding peptide was directly anchored on the sidewall of the SWCNTs using the π-π interaction between the aromatic amino acids and SWCNTs, forming the peptide-SWCNTs hybrids for near infrared absorption spectra measurement. The evidence of the morphology of peptide-SWCNTs hybrids was obtained using atomic force microscopy (AFM). The results demonstrated that peptide-SWCNTs hybrids based NIR optical biosensor exhibited sensitive and highly selective for TNT explosive determination, addressing a promising optical biosensor for security application. Copyright © 2018. Published by Elsevier Inc.
Bao, Zhi Yong; Liu, Xin; Chen, Y; Wu, Yucheng; Chan, Helen L W; Dai, Jiyan; Lei, Dang Yuan
2014-09-15
This paper reports a simple label-free high-sensitive method for detecting low-concentration persistent organic pollutants and explosive materials. The proposed method combines surface-enhanced Raman spectroscopy (SERS) and magnetomotive enrichment of the target molecules on the surface of Ag nanoparticles (NPs). This structure can be achieved through self-assembling integration of Ag NPs with ferromagnetic Fe3O4 microspheres, forming a hybrid SERS nanoprobe with both optical and magnetic properties. Moreover, the magnetic response of ferromagnetic Fe3O4 microspheres can be used to dynamically modulate the optical property of Ag NPs through controlling their geometric arrangement on the substrate by applying an external magnetic field. It is also demonstrated from the full-wave numerical simulation results that the maximum electromagnetic field enhancement can be greatly increased by shortening the distance of neighboring Ag NPs and therefore resulting in an improved SERS detecting limit. More importantly, by using the prepared substrate, the SERS signals from organic pollution substances, i.e. aromatic polychlorinated biphenyl-77 and 2,4,6-trinitrotoluene, were quantitatively analyzed. Copyright © 2014 Elsevier B.V. All rights reserved.
Magnetic susceptibility of curium pnictides
International Nuclear Information System (INIS)
Nave, S.E.; Huray, P.G.; Peterson, J.R.; Damien, D.A.; Haire, R.G.
1981-09-01
The magnetic susceptibility of microgram quantities of 248 CmP and 248 CmSb has been determined with the use of a SQUID micromagnetic susceptometer over the temperature range 4.2 to 340 K and in the applied magnetic field range of 0.45 to 1600 G. The fcc (NaCl-type) samples yield magnetic transitions at 73K and 162 K for the phosphide and antimonide, respectively. Together with published magnetic data for CmN and CmAs, these results indicate spatially extended exchange interactions between the relatively localized 5f electrons of the metallic actinide atoms
International Nuclear Information System (INIS)
Cho, Bong Rae; Pyun, Sang Yong
2010-01-01
We have studied the nitrile-forming elimination reactions from 1 promoted by R 2 NH in MeCN. The reaction proceeded by (E1cb) irr mechanism. Change of the β-aryl group from 2,4-dinitrophenyl to a more strongly electron-withdrawing 2,4,6-trinitrophenyl increased the reaction rate by 470-fold, shifted the transition state toward more reactant-like, and changed the reaction mechanism from E2 to (E1cb) irr . To the best of our knowledge, this is the first example of nitrile-forming elimination reaction that proceeds by the (E1cb) irr mechanism in MeCN. Noteworthy is the carbanion stabilizing ability of the 2,4,6-trinitrophenyl group in aprotic solvent. Nitrile-forming elimination reactions of (E)-benzaldoxime derivatives have been extensively investigated under various conditions. The reactions proceeded by the E2 mechanism in MeCN despite the fact that the reactants have syn stereochemistry, poor leaving, and sp 2 hybridized β-carbon atom, all of which favor E1cb- or E1cb-like transition state. Moreover, the transition state structures were relatively insensitive to the variation of the reactant structures. The results have been attributed to the poor anion solvating ability of MeCN, which favors E2 transition state with maximum charge dispersal. For eliminations from strongly activated (E)-2,4-(NO 2 ) 2 C 6 H 3 CH=NOC(O)C 6 H 4 X, a change in the reaction mechanism from E2 to (E1cb) irr was observed as the base-solvent was changed from R 2 NH in MeCN to R 2 NH/R 2 NH 2 + in 70 mol % MeCN(aq). A combination of a strong electron-withdrawing β-aryl group and anion-solvating protic solvent was required for the mechanistic change
Energy Technology Data Exchange (ETDEWEB)
Koc, Ziya Erdem, E-mail: zerdemkoc@gmail.com [Department of Chemistry, Faculty of Science, Selcuk University, 42031 Konya (Turkey); Bingol, Haluk; Saf, Ahmet O. [Department of Chemistry, Faculty of Science, Selcuk University, 42031 Konya (Turkey); Torlak, Emrah [Provincial Control Laboratory, Konya (Turkey); Coskun, Ahmet [Department of Chemistry, Faculty of Science, Selcuk University, 42031 Konya (Turkey)
2010-11-15
Four new tripodal-benzimidazole derivatives were synthesized by Schiff base reaction between 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine (TRIPOD) and different diamine derivatives. The structures of the obtained compounds were identified by FT-IR, {sup 1}H NMR, {sup 13}C NMR and UV-vis spectral data, thermal analysis and elemental analysis. Electrochemical behaviors of the compounds were studied by cyclic voltammetry in DMF including 0.1 M [NBu{sub 4}] [PF{sub 6}]. The voltammograms showed peaks having similar characteristics except tripodal-benzimidazole including -NO{sub 2} derivative. In addition, their antimicrobial activities were evaluated by using the standard disk diffusion method in dimethylformamide media. The activities were determined against 4 bacteria cultures by comparing to those of gentamycin.
Managing radioactive wastes of nuclear power plants in operation and site decommissioning phases
International Nuclear Information System (INIS)
Ardalani, E.; Khadivi, S.
2008-01-01
A large nuclear reactor annually produces about 25-50 tons consumed Uranium. These consumed materials consist of Uranium and also Plutonium and Curium. In total, about three percent of these materials are remained from fission. Existing actinides (Uranium, Plutonium, and Curium) cause long-term and short-term radiation that could have harmful effects on the environment. In order to reduce the diverse effects of radioactive wastes in Nuclear Power Plants, different procedures are employed such as compaction, chemical treatment, vitrification, canning and sealing with concrete and safe storage. In this paper, the harmful effects of nuclear wastes on the environment are introduced and a management procedure is presented to minimize its diverse effects
Directory of Open Access Journals (Sweden)
Chean Hui Ng
2014-08-01
Full Text Available The natural product molecule 2,4,6-trihydroxy-3-geranyl-acetophenone (tHGA isolated from the medicinal plant Melicope ptelefolia was shown to exhibit potent lipoxygenase (LOX inhibitory activity. It is known that LOX plays an important role in inflammatory response as it catalyzes the oxidation of unsaturated fatty acids, such as linoleic acid to form hydroperoxides. The search for selective LOX inhibitors may provide new therapeutic approach for inflammatory diseases. Herein, we report the synthesis of tHGA analogs using simple Friedel-Craft acylation and alkylation reactions with the aim of obtaining a better insight into the structure-activity relationships of the compounds. All the synthesized analogs showed potent soybean 15-LOX inhibitory activity in a dose-dependent manner (IC50 = 10.31–27.61 μM where compound 3e was two-fold more active than tHGA. Molecular docking was then applied to reveal the important binding interactions of compound 3e in soybean 15-LOX binding site. The findings suggest that the presence of longer acyl bearing aliphatic chain (5Cs and aromatic groups could significantly affect the enzymatic activity.
Lasri, Jamal; Ismail, Ali I.; Haukka, Matti; Soliman, Saied M.
2015-02-01
New N-methyl-C-2,4,6-trimethylphenylnitrone 1 has been synthesized starting from N-methylhydroxylamine and mesitaldehyde. The product was fully characterized using different spectroscopic techniques; FTIR, NMR, UV-Vis, high resolution mass spectrometry and X-ray diffraction. The relative stability and percent of population of its two possible isomers (E and Z) were calculated using the B3LYP/6-311++G(d,p) method in gas phase and in solution. In agreement with the X-ray results, it was found that Z-isomer is the most stable one in both gas phase and solution. The molecular geometry, vibrational frequencies, gauge-including atomic orbital (GIAO), and chemical shift values were also calculated using the same level of theory. The TD-DFT results of the studied nitrone predicted a π-π∗ transition band at 285.1 nm (fosc = 0.3543) in the gas phase. The rest of the spectral bands undergo either hyperchromic or hypsochromic shifts in the presence of solvent. Polarizability and HOMO-LUMO gap values were used to predict the nonlinear optical properties (NLO) of the studied compound. NBO analysis has been used to determine the most accurate Lewis structure of the studied molecule.
Crystal structure of 4,4′,4′′-(1,3,5-triazine-2,4,6-triyltripyridinium trichloride 2.5-hydrate
Directory of Open Access Journals (Sweden)
Bo-Kai Ling
2015-11-01
Full Text Available The asymmetric unit of the title compound, C18H15N63+·3Cl−·2.5H2O, contains two independent (1,3,5-triazine-2,4,6-triyltripyridinium cations. Both cations are approximately planar, the r.m.s. deviations of fitted non-H atoms being 0.045 and 0.051 Å. In the crystal, extensive O—H...Cl, O—H...O, N—H...Cl and N—H...O hydrogen bonds and weak C—H...Cl and C—H...O interactions link the organic cations, Cl− anions and water molecules into a three-dimensional supramolecular architecture. π–π stacking between the pyridine rings of adjacent cations is also observed, the centroid-to-centroid distance being 3.7578 (8 Å.
Sangeetha, V; Kanagathara, N; Chakkaravarthi, G; Marchewka, M K; Anbalagan, G
2013-05-01
The asymmetric unit of the title salt, C3H7N6 (+)·C6H7O4 (-)·C3H4O2·H2O, contains a 2,4,6-tri-amino-1,3,5-triazin-1-ium cation, a 3-(prop-2-eno-yloxy)propano-ate anion and acrylic acid and water solvent mol-ecules in a 1:1:1:1 ratio and with each species in a general position. In the crystal, the components are linked into a supra-molecular layer in the bc plane via a combination of O-H⋯O, N-H⋯N and N-H⋯O hydrogen bonding. The crystal studied was a non-merohedral twin, the minor component contribution being approximately 26%.
Directory of Open Access Journals (Sweden)
Limei Huang
2017-04-01
Full Text Available The environmental pollution of 2,4,6-tribromophenol (TBP has attracted attention. Based on an urgent need for the better provision of clean water, in situ determination of TBP is of great importance. Here, a facile and effective approach for detecting TBP is developed, based on coupling molecular imprinting technique with electrodeposition of chitosan (CS on the gold electrode. The TBP imprinting CS film was fabricated by using CS as functional material and TBP as template molecule. The experiments show that the morphologies and electrochemical properties of the imprinted film sensor was different from non-imprinted film electrode. The current of the imprinted film was linearly proportional to the TBP concentration, with a wide linear range of 1.0 × 10−7 mol•L−1 to 1.0 × 10−3 mol•L−1. By selecting drop-coating method as a reference for controlled trials with the same functional material, the results illustrated that the electrodeposition enjoyed a widely linear range advantage.
International Nuclear Information System (INIS)
Choi, Ok Ja; Hong, Young Don; Gwon, Hui Jeong; Choi, Sang Mu; Choi, Sun Ju
2005-01-01
N-(3-bromo-2,4,6-trimethylacetanilide) iminodiacetic acid (BrTIDA) was synthesized using nitrilotriacetic anhydride prepared in situ, and lyophilized vials were prepared which contained 20 mg of BrTIDA and 0.4 mg of SnCl 2 . To evaluate the clinical efficacy of the in-house prepared lyophilized kit, a technetium-99m complex of BrTIDA was prepared; its in vivo pharmacokinetic behavior was evaluated via animal studies to assess the hepatocytic function and the functional status of the cystic duct and the gallbladder. Serial static image scans of rabbits and the biodistribution in mice injected with 99m Tc-BrTIDA revealed that none of the tissues except for the hepatobiliary system showed radioactivity concentrations, and a rapid clearance from the organs was observed. In conclusion, a lyophilized kit and its prepared 99m Tc-BrTIDA can be applied as a hepatobiliary imaging agent for the evaluation of the functional status of the hepatocytes and the patency of the biliary duct
Chemistry of pyroprocessing for nuclear waste transmutation
Energy Technology Data Exchange (ETDEWEB)
Ackerman, J.P. [Argonne National Laboratory, IL (United States)
1995-10-01
Pyrochemical treatment of spent nuclear fuel is an attractive approach for separating the transuranium (TRU) elements neptunium, plutonium, americium, and curium because of its simplicity, diversion resistance, and potentially low cost.
Organic pollutants removal from 2,4,6-trinitrotoluene (TNT) red water using low cost activated coke
Institute of Scientific and Technical Information of China (English)
Mohe Zhang; Quanlin Zhao; Zhengfang Ye
2011-01-01
We treated 2,4,6-trinitrotoluene (TNT) red water from the Chinese explosive industry with activated coke (AC) from lignite.Since the composition of TNT red water was very complicated,chemical oxygen demand (COD) was used as the index for evaluating treatment efficiency.This study focused on sorption kinetics and equilibrium sorption isotherms of AC for the removal of COD from TNT red water,and the changes of water quality before and after adsorption were evaluated using high performance liquid chromatography,UV-Vis spectra and gas chromatography/mass spectroscopy.The results showed that the sorption kinetics of COD removal from TNT red water onto AC fitted well with the pseudo second-order model.The adsorption process was an exothermic and physical process.The sorption isotherm was in good agreement with Redlich-Peterson isotherm.At the conditions of initial pH =6.28,20°C and 3 hr of agitation,under 160 g/L AC,64.8% of COD was removed.The removal efficiencies of 2,4-dinitrotoluene-3-sulfonate (2,4-DNT-3-SO3-) and 2,4-dinitrotoluene-5-sulfonate (2,4-DNT-5-SO3-) were 80.5% and 84.3%,respectively.After adsorption,the acute toxicity of TNT red water reduced greatly,compared with that of unprocessed TNT red water.
Report on the scientifical feasibility of advanced separation
International Nuclear Information System (INIS)
2001-01-01
The advanced separation process Purex has been retained for the recovery of neptunium, technetium and iodine from high level and long lived radioactive wastes. Complementary solvent extraction processes will be used for the recovery of americium, curium and cesium from the high activity effluents of the spent fuel reprocessing treatment. This document presents the researches carried out to demonstrate the scientifical feasibility of the advanced separation processes: the adaptation of the Purex process would allow the recovery of 99% of the neptunium, while the association of the Diamex and Sanex (low acidity variant) processes, or the Paladin concept (single cycle with selective de-extraction of actinides) make it possible the recovery of 99.8% of the actinides III (americium and curium) with a high lanthanides decontamination factor (greater than 150). The feasibility of the americium/curium separation is demonstrated with the Sesame process (extraction of americium IV after electrolytic oxidation). Iodine is today recovered at about 99% with the Purex process and the dissolved fraction of technetium is also recovered at 99% using an adaptation of the Purex process. The non-dissolved fraction is retained by intermetallic compounds in dissolution residues. Cesium is separable from other fission products with recovery levels greater than 99.9% thanks to the use of functionalized calixarenes. The scientifical feasibility of advanced separation is thus demonstrated. (J.S.)
Tetraphenylphosphonium iodide–1,3,5-trifluoro-2,4,6-triiodobenzene–methanol (3/4/1
Directory of Open Access Journals (Sweden)
Gabriella Cavallo
2013-06-01
Full Text Available The crystallization of a 1:1 molar solution of 1,3,5-trifluoro-2,4,6-diiodobenzene (TFTIB and tetraphenylphosponium iodide (TPPI from methanol produced tetragonal needles of pure TPPI and tabular pseudo-hexagonal truncated bipyramids of the title compound, 3C24H20P+·3I−·4C6F3I3·CH4O or (TPPI3(TFTIB4·MeOH. The asymmetric unit is composed of six TPPI molecules, eight TFTIB molecules and two methanol molecules, overall 16 constituents. The formation of the architecture is essentially guided by a number of C—I...I− halogen bonds (XB, whose lengths are in the range 3.276 (1–3.625 (1 Å. Layers of supramolecular polyanions are formed parallel to (10-1 wherein iodide anions function as penta-, tetra- or bidentate XB acceptors. The structure is not far from being P21/n, but the centrosymmetry is lost due to a different conformation of a single couple of cations and the small asymmetry in the formed supramolecular anion. One methanol molecule is hydrogen bonded to an iodide anion, while the second is linked to the first one via an O—H...O contact. This second methanol molecule is more loosely pinned in its position than the first and presents very high anisotropic displacement parameters and a seeming shortening of the C—O bond length. The crystal studied was refined as a perfect inversion twin.
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
International Nuclear Information System (INIS)
Montgomery, Michael T.; Coffin, Richard B.; Boyd, Thomas J.; Smith, Joseph P.; Walker, Shelby E.; Osburn, Christopher L.
2011-01-01
The nitrogenous energetic constituent, 2,4,6-Trinitrotoluene (TNT), is widely reported to be resistant to bacterial mineralization (conversion to CO 2 ); however, these studies primarily involve bacterial isolates from freshwater where bacterial production is typically limited by phosphorus. This study involved six surveys of coastal waters adjacent to three biome types: temperate broadleaf, northern coniferous, and tropical. Capacity to catabolize and mineralize TNT ring carbon to CO 2 was a common feature of natural sediment assemblages from these coastal environments (ranging to 270+/-38 μg C kg -1 d -1 ). More importantly, these mineralization rates comprised a significant proportion of total heterotrophic production. The finding that most natural assemblages surveyed from these ecosystems can mineralize TNT ring carbon to CO 2 is consistent with recent reports that assemblage components can incorporate TNT ring carbon into bacterial biomass. These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - Highlights: → TNT mineralization is a common feature of natural bacterial assemblages in coastal sediments. → TNT mineralization rates comprised a significant proportion of total heterotrophic production. → These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - The capacity to mineralize TNT ring carbon to CO 2 is a common feature of natural bacterial assemblages in coastal sediment.
Ahmed, M. F.; Hussain, A.; Malik, A. Q.
2016-08-01
Use of energetic materials has long been considered for only military purposes. However, it is very recent that their practical applications in wide range of commercial fields such as mining, road building, under water blasting and rocket propulsion system have been considered. About 5mg of 2,4,6-trinitrotoluene (TNT) in serviceable (Svc) as well as unserviceable (Unsvc) form were used for their thermal decomposition and kinetic parameters investigation. Thermogravimetric/ differential thermal analysis (TG/DTA), X-ray diffraction (XRD) and Scanning electron microscope (SEM) were used to characterize two types of TNT. Arrhenius kinetic parameters like activation energy (E) and enthalpy (AH) of both TNT samples were determined using TG curves with the help of Horowitz and Metzger method. Simultaneously, thermal decomposition range was evaluated from DTA curves. Distinct diffraction peaks showing crystalline nature were obtained from XRD analysis. SEM results indicated that Unsvc TNT contained a variety of defects like cracks and porosity. Similarly, it is observed that thermal as well as kinetic behavior of both TNT samples vary to a great extent. Likewise, a prominent change in the activation energies (E) of both samples is observed. This in-depth study provides a way forward in finding solutions for the safe reutilization of decanted TNT.
Sakai, Hiroyasu; Sato, Ken; Sato, Fumiaki; Kai, Yuki; Mandokoro, Kazutaka; Matsumoto, Kenjiro; Kato, Shinichi; Yumoto, Tetsuro; Narita, Minoru; Chiba, Yoshihiko
2017-08-01
Contact dermatitis model involving repeated application of hapten is used as a tool to assess dermatitis, as characterized by thickening. Involvement of cell proliferation, elicited by repeated hapten-stimulation, in this swelling has been unclear. Curcumin is reported to reduce inflammation. We examined involvement of cell proliferation and the role of extracellular regulated kinase (ERK) in 2,4,6-trinitrochlorobenzene (TNCB) challenge-induced ear swelling. We also examined the effects of curcumin in this model. Mice were sensitized with TNCB to the abdominal skin. Then, they were challenged with TNCB to the ear three times. The ERK activation inhibitor U0126 or curcumin was applied 30 min before each TNCB challenge. TNCB challenge-induced increased epidermal cell number and dermal thickening. Gene expressions of epithelial mitogen (EPGN), amphiregulin (AREG) and heparin-binding-epidermal growth factor (HB-EGF) were increased in the ears after the last TNCB challenge. Ki-67 immunoreactivity was increased in the dermis in TNCB-challenged ears. TNCB-induced swelling was inhibited by U0126 and curcumin. Curcumin also attenuated TNCB-induced ERK phosphorylation and expression of EPGN and AREG genes. Ear swelling induced by TNCB challenge might be mediated, in part, by the EPGN- and AREG-ERK proliferation pathway and was inhibited by curcumin.
Divya, R.; Nair, Lekshmi P.; Bijini, B. R.; Nair, C. M. K.; Babu, K. Rajendra
2018-05-01
Good quality prismatic crystals of industrially applicable corrosion inhibiting barium complex of 1,3,5-triazinane-2,4,6-trione have been grown by conventional gel method. The crystal structure, packing, and nature of bonds are revealed in the single crystal X-ray diffraction analysis. The crystal has a three-dimensional polymeric structure having a triclinic crystal system with the space group P-1. The powder X-ray diffraction analysis confirms its crystalline nature. The functional groups present in the crystal are identified by Fourier transform infrared spectroscopy. Elemental analysis confirms the stoichiometry of the elements present in the complex. Thermogravimetric analysis and differential thermal analysis reveal its good thermal stability. The optical properties like band gap, refractive index and extinction coefficient are evaluated from the UV-visible spectral analysis. The singular property of the material, corrosion inhibition efficiency achieved by the adsorption of the sample molecules is determined by the weight loss method.
International Nuclear Information System (INIS)
Tan, I.A.W.; Ahmad, A.L.; Hameed, B.H.
2009-01-01
The adsorption characteristics of 2,4,6-trichlorophenol (TCP) on activated carbon prepared from oil palm empty fruit bunch (EFB) were evaluated. The effects of TCP initial concentration, agitation time, solution pH and temperature on TCP adsorption were investigated. TCP adsorption uptake was found to increase with increase in initial concentration, agitation time and solution temperature whereas adsorption of TCP was more favourable at acidic pH. The adsorption equilibrium data were best represented by the Freundlich and Redlich-Peterson isotherms. The adsorption kinetics was found to follow the pseudo-second-order kinetic model. The mechanism of the adsorption process was determined from the intraparticle diffusion model. Boyd plot revealed that the adsorption of TCP on the activated carbon was mainly governed by particle diffusion. Thermodynamic parameters such as standard enthalpy (ΔH o ), standard entropy (ΔS o ), standard free energy (ΔG o ) and activation energy were determined. The regeneration efficiency of the spent activated carbon was high, with TCP desorption of 99.6%.
Energy Technology Data Exchange (ETDEWEB)
Timothy A. Hyde
2012-06-01
The United States Department of Energy, seeks to develop and demonstrate the technologies needed to transmute the long-lived transuranic actinide isotopes contained in spent nuclear fuel into shorter lived fission products, thereby decreasing the volume of material requiring disposal and reducing the long-term radiotoxicity and heat load of high-level waste sent to a geologic repository. This transmutation of the long lived actinides plutonium, neptunium, americium and curium can be accomplished by first separating them from spent Light Water Reactor fuel using a pyro-metalurgical process, then reprocessing them into new fuel with fresh uranium additions, and then transmuted to short lived nuclides in a liquid metal cooled fast reactor. An important component of the technology is developing actinide-bearing fuel forms containing plutonium, neptunium, americium and curium isotopes that meet the stringent requirements of reactor fuels and materials.
On possibility of transuranium element by the method of transport reactions
International Nuclear Information System (INIS)
Sinitsyna, G.S.; Krashenitsyn, G.N.; Shestakov, B.I.
1983-01-01
A possibility to use chemical transport reaction for separation of uranium, plutonium and some transplutonium elements is shown. The method is based on the use of the known plutonium property to form tetrachloride existing only in the gaseous phase in chlorine atmosphere, which is transported ever the temperature gradiept. Two ways of transport reaction realization - the method of flow and the method of diffusion in closed volume are tested. The experiments are made using specially synthesized plutonium dioxide, containing uranium, americium, curium, lanthanum, terbium, barium. Chlorination is realized by the mixture of chlorine and carbon tetrachloride at temperatures 723-953 K. Plutonium trichloride is deposited in the range 613-653 K, uranium - in the range 473-523 K, curium, americium, lanthanum, terbium, barium remain in the start zone if its temperature does not exceed 873 K
Kanagathara, N.; Marchewka, M. K.; Drozd, M.; Renganathan, N. G.; Gunasekaran, S.; Anbalagan, G.
2013-10-01
An organic-organic salt, bis (4-nitrophenol) 2,4,6-triamino 1,3,5-triazine monohydrate (BNPM) has been prepared by slow evaporation technique at room temperature. Single crystal X-ray diffraction analysis reveals that the compound crystallizes in triclinic system with centrosymmetric space group P-1. IR and Raman spectra of BNPM have been recorded and analyzed. The study has been extended to confocal Raman spectral analysis. Band assignments have been made for the melamine and p-nitrophenol molecules. Vibrational spectra have also been discussed on the basis of quantum chemical density functional theory calculations using Firefly (PC GAMESS) Version 7.1 G. Vibrational frequencies are calculated and scaled values are compared with the experimental one. The Mulliken charges, HOMO-LUMO orbital energies are calculated and analyzed. The chemical structure of the compound was established by 1H NMR and 13C NMR spectra.
Goh, Madeline Shuhua; Pumera, Martin
2011-01-01
The detection of explosives in seawater is of great interest. We compared response single-, few-, and multilayer graphene nanoribbons and graphite microparticle-based electrodes toward the electrochemical reduction of 2,4,6-trinitrotoluene (TNT). We optimized parameters such as accumulation time, accumulation potential, and pH. We found that few-layer graphene exhibits about 20% enhanced signal for TNT after accumulation when compared to multilayer graphene nanoribbons. However, graphite microparticle-modified electrode provides higher sensitivity, and there was no significant difference in the performance of single-, few-, and multilayer graphene nanoribbons and graphite microparticles for the electrochemical detection of TNT. We established the limit of detection of TNT in untreated seawater at 1 μg/mL.
Liang, Shih-Hsiung; Hsu, Duen-Wei; Lin, Chia-Ying; Kao, Chih-Ming; Huang, Da-Ji; Chien, Chih-Ching; Chen, Ssu-Ching; Tsai, Isheng Jason; Chen, Chien-Cheng
2017-04-01
In this study, the bacterial strain Citrobacter youngae strain E4 was isolated from 2,4,6-trinitrotoluene (TNT)-contaminated soil and used to assess the capacity of TNT transformation with/without exogenous nutrient amendments. C. youngae E4 poorly degraded TNT without an exogenous amino nitrogen source, whereas the addition of an amino nitrogen source considerably increased the efficacy of TNT transformation in a dose-dependent manner. The enhanced TNT transformation of C. youngae E4 was mediated by increased cell growth and up-regulation of TNT nitroreductases, including NemA, NfsA and NfsB. This result indicates that the increase in TNT transformation by C. youngae E4 via nitrogen nutrient stimulation is a cometabolism process. Consistently, TNT transformation was effectively enhanced when C. youngae E4 was subjected to a TNT-contaminated soil slurry in the presence of an exogenous amino nitrogen amendment. Thus, effective enhancement of TNT transformation via the coordinated inoculation of the nutrient-responsive C. youngae E4 and an exogenous nitrogen amendment might be applicable for the remediation of TNT-contaminated soil. Although the TNT transformation was significantly enhanced by C. youngae E4 in concert with biostimulation, the 96-h LC50 value of the TNT transformation product mixture on the aquatic invertebrate Tigriopus japonicas was higher than the LC50 value of TNT alone. Our results suggest that exogenous nutrient amendment can enhance microbial TNT transformation; however, additional detoxification processes may be needed due to the increased toxicity after reduced TNT transformation. Copyright © 2016 Elsevier Inc. All rights reserved.
Lee, Sang Kil; Kim, Hyo Jong; Chi, Sung Gil
2010-01-01
Saccharomyces boulardii has been reported to be beneficial in the treatment of inflammatory bowel disease. The aim of this work was to evaluate the effect of S. boulardii in a mice model of 2,4,6-trinitrobencene sulfonic acid (TNBS) induced colitis and analyze the expression of genes in S. boulardii treated mice by microarray. BALB/c mice received TNBS or TNBS and S. boulardii treatment for 4 days. Microarray was performed on total mRNA form colon, and histologic evaluation was also performed. In mice treated with S. boulardii, the histological appearance and mortality rate were significantly restored compared with rats receiving only TNBS. Among 330 genes which were altered by both S. boulardii and TNBS (>2 folds), 193 genes were down-regulated by S. boulardii in microarray. Most of genes which were down-regulated by S. bouardii were functionally classified as inflammatory and immune response related genes. S. boulardii may reduce colonic inflammation along with regulation of inflammatory and immune responsive genes in TNBS-induced colitis.
Energy Technology Data Exchange (ETDEWEB)
Montgomery, Michael T., E-mail: michael.montgomery@nrl.navy.mil [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Coffin, Richard B., E-mail: richard.coffin@nrl.navy.mil [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Boyd, Thomas J., E-mail: thomas.boyd@nrl.navy.mil [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Smith, Joseph P., E-mail: joseph.smith@nrl.navy.mil [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Walker, Shelby E., E-mail: Shelby.Walker@noaa.gov [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Osburn, Christopher L., E-mail: chris_osburn@ncsu.edu [Marine, Earth and Atmospheric Sciences, North Carolina State University, Raleigh, NC 27695 (United States)
2011-12-15
The nitrogenous energetic constituent, 2,4,6-Trinitrotoluene (TNT), is widely reported to be resistant to bacterial mineralization (conversion to CO{sub 2}); however, these studies primarily involve bacterial isolates from freshwater where bacterial production is typically limited by phosphorus. This study involved six surveys of coastal waters adjacent to three biome types: temperate broadleaf, northern coniferous, and tropical. Capacity to catabolize and mineralize TNT ring carbon to CO{sub 2} was a common feature of natural sediment assemblages from these coastal environments (ranging to 270+/-38 {mu}g C kg{sup -1} d{sup -1}). More importantly, these mineralization rates comprised a significant proportion of total heterotrophic production. The finding that most natural assemblages surveyed from these ecosystems can mineralize TNT ring carbon to CO{sub 2} is consistent with recent reports that assemblage components can incorporate TNT ring carbon into bacterial biomass. These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - Highlights: > TNT mineralization is a common feature of natural bacterial assemblages in coastal sediments. > TNT mineralization rates comprised a significant proportion of total heterotrophic production. > These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - The capacity to mineralize TNT ring carbon to CO{sub 2} is a common feature of natural bacterial assemblages in coastal sediment.
Apostolou, Theofylaktos; Pascual, Nuria; Marco, M-Pilar; Moschos, Anastassios; Petropoulos, Anastassios; Kaltsas, Grigoris; Kintzios, Spyridon
2014-07-01
2,4,6-trichloroanisole (TCA), the cork taint molecule, has been the target of several analytical approaches over the few past years. In spite of the development of highly efficient and sensitive tools for its detection, ranging from advanced chromatography to biosensor-based techniques, a practical breakthrough for routine cork screening purposes has not yet been realized, in part due to the requirement of a lengthy extraction of TCA in organic solvents, mostly 12% ethanol and the high detectability required. In the present report, we present a modification of a previously reported biosensor system based on the measurement of the electric response of cultured fibroblast cells membrane-engineered with the pAb78 TCA-specific antibody. Samples were prepared by macerating cork tissue and mixing it directly with the cellular biorecognition elements, without any intervening extraction process. By using this novel approach, we were able to detect TCA in just five minutes at extremely low concentrations (down to 0.2 ppt). The novel biosensor offers a number of practical benefits, including a very considerable reduction in the total assay time by one day, and a full portability, enabling its direct employment for on-site, high throughput screening of cork in the field and production facilities, without requiring any type of supporting infrastructure. Copyright © 2014 Elsevier B.V. All rights reserved.
Development of a cellular biosensor for the detection of 2,4,6-trichloroanisole (TCA).
Varelas, Vassileios; Sanvicens, Nuria; M-Pilar-Marco; Kintzios, Spiridon
2011-05-15
2,4,6-trichloroanisole (TCA) is a microbial metabolite formed from chlorophenols through the activity of several natural fungal strains present on the cork oak bark. TCA is the primary compound responsible for the mousty/mould off-odour known as "cork taint" present in cork stoppers, wine, water and alcoholic beverages. Chromatographic and electrochemical methods are currently used for the determination of TCA, however its detection at low concentrations remains a technical challenge. The aim of this study was the development of a rapid novel biosensor system based on the Bioelectric Recognition Assay (BERA). The sensor measured the electric response of cultured membrane-engineered fibroblast cells suspended in an alginate gel matrix due to the change of their membrane potential in the presence of the analyte. Membrane-engineered cells were prepared by osmotic insertion of 0.5 μg/l of specific TCA antibodies into the membrane of the cells. The BERA-based sensor was able to detect TCA in a few minutes (3-5 min) at extremely low concentrations (10(-1)ppt), thus demonstrating higher sensitivity than the human sensory threshold. In addition, the assay was quite selective against other haloanisoles and halophenols structurally related to or co-occurring with TCA. Finally the sensor was tested against real white wine samples from cork soaks. At this real test, the BERA sensor was able to detect TCA from cork soaks rapidly (3-5 min) at very low concentrations (1.02-12 ng/l), covering the whole range for the detection threshold for wines (1.4-10 ng/l). Therefore, this novel biosensor offers new perspectives for ultra-rapid, ultra-sensitive and low-cost monitoring of TCA presence in cork and wine and possibly also other food commodities. Copyright © 2011 Elsevier B.V. All rights reserved.
Efficacy of tecovirimat (ST-246) in nonhuman primates infected with variola virus (Smallpox).
Mucker, Eric M; Goff, Arthur J; Shamblin, Joshua D; Grosenbach, Douglas W; Damon, Inger K; Mehal, Jason M; Holman, Robert C; Carroll, Darin; Gallardo, Nadia; Olson, Victoria A; Clemmons, Cody J; Hudson, Paul; Hruby, Dennis E
2013-12-01
Naturally occurring smallpox has been eradicated but remains a considerable threat as a biowarfare/bioterrorist weapon (F. Fleck, Bull. World Health Organ. 81:917-918, 2003). While effective, the smallpox vaccine is currently not recommended for routine use in the general public due to safety concerns (http://www.bt.cdc.gov/agent/smallpox/vaccination). Safe and effective countermeasures, particularly those effective after exposure to smallpox, are needed. Currently, SIGA Technologies is developing the small-molecule oral drug, tecovirimat (previously known as ST-246), as a postexposure therapeutic treatment of orthopoxvirus disease, including smallpox. Tecovirimat has been shown to be efficacious in preventing lethal orthopoxviral disease in numerous animal models (G. Yang, D. C. Pevear, M. H. Davies, M. S. Collett, T. Bailey, et al., J. Virol. 79:13139-13149, 2005; D. C. Quenelle, R. M. Buller, S. Parker, K. A. Keith, D. E. Hruby, et al., Antimicrob. Agents Chemother., 51:689-695, 2007; E. Sbrana, R. Jordan, D. E. Hruby, R. I. Mateo, S. Y. Xiao, et al., Am. J. Trop. Med. Hyg. 76:768-773, 2007). Furthermore, in clinical trials thus far, the drug appears to be safe, with a good pharmacokinetic profile. In this study, the efficacy of tecovirimat was evaluated in both a prelesional and postlesional setting in nonhuman primates challenged intravenously with 1 × 10(8) PFU of Variola virus (VARV; the causative agent of smallpox), a model for smallpox disease in humans. Following challenge, 50% of placebo-treated controls succumbed to infection, while all tecovirimat-treated animals survived regardless of whether treatment was started at 2 or 4 days postinfection. In addition, tecovirimat treatment resulted in dramatic reductions in dermal lesion counts, oropharyngeal virus shedding, and viral DNA circulating in the blood. Although clinical disease was evident in tecovirimat-treated animals, it was generally very mild and appeared to resolve earlier than in placebo
Sangeetha, V.; Kanagathara, N.; Chakkaravarthi, G.; Marchewka, M. K.; Anbalagan, G.
2013-01-01
The asymmetric unit of the title salt, C3H7N6 +·C6H7O4 −·C3H4O2·H2O, contains a 2,4,6-triamino-1,3,5-triazin-1-ium cation, a 3-(prop-2-enoyloxy)propanoate anion and acrylic acid and water solvent molecules in a 1:1:1:1 ratio and with each species in a general position. In the crystal, the components are linked into a supramolecular layer in the bc plane via a combination of O—H⋯O, N—H⋯N and N—H⋯O hydrogen bonding. The crystal studied was a non-merohedral twin, the minor component contribution being approximately 26%. PMID:23723892
Quantum-chemical consideration of extermal valent forms of actinides
International Nuclear Information System (INIS)
Ionova, G.V.; Pershina, V.G.; Spitsyn, V.I.
1982-01-01
Stability of valent forms of actinides that has not yet studied experimentally, is considered within the framework of quantum-chemical considerations. Oxidizing potentials E 0 for actinide elements are determined theoretically. A dependence of the definite valent state stability on relativistic effect is shown. A conclusion is made that oxidizing potential E 0 (4-5) for americium should be higher than E 0 (4-5) for plutonium. A relatively small oxidizing potential E 0 (4-5) for curium speaks about principle possibility of production of five-valent curium in solution, though it is less stable than the six-valent one. Oxidizing potential corresponding to transition of three-valent californium into the four-valent state should be less than the value adopted in literature. A relatively small oxidizing potential of californium E 0 (4-5) speaks about possible existence of five-valent californium in solution
International Nuclear Information System (INIS)
Günay, Tuğçe; Çimen, Yasemin
2017-01-01
Degradation of 2,4,6-trichloropenol (TCP) with peroxymonosulfate (PMS) catalyzed by iron porphyrin tetrasulfonate ([FePTS)] was investigated in an 8-to-1 (v/v) CH 3 OH-H 2 O mixture. Typical reaction medium contained a 4.00 mL methanol solution of TCP (0.100 mmol), a 0.50 mL aqueous solution of catalyst (5.0 × 10 −4 mmol), and 0.100 mmol PMS (as 0.031 g of Oxone). The reaction was performed at ambient temperature. The conversion of TCP was 74% in 30 min and 80% in 6 h when the catalyst was [FePTS]. Amberlite IRA-900 supported [FePTS] catalyst was also prepared. In the recycling experiments the homogeneous [FePTS] lost its activity after the first cycle, while [FePTS]-Amberlite IRA 900 maintained its activity for the first 2 cycles. After the second cycle, the conversion of TCP dropped to <10% for Amberlite IRA-900 supported [FePTS] catalyst. The degradation of TCP with PMS was also attempted using cobalt, copper, nickel and palladium porphyrin tetrasulfonate catalysts, however, no catalytic activity was observed with these structures. - Highlights: • The method presents an effective oxidation of TCP. • This research provided persistence, less harmful, self-degradable and more environmental oxidation products. • About seventy percent conversions of TCP in 30 min was achieved at room temperature. - This research provided non-persistent, less harmful, self-degradable and more environmentally friendly oxidation products. About 70% conversions of TCP in 30 min was achieved at room temperature.
Gas phase detection of explosives such as 2,4,6-trinitrotoluene by molecularly imprinted polymers.
Bunte, Gudrun; Hürttlen, Jürgen; Pontius, Heike; Hartlieb, Kerstin; Krause, Horst
2007-05-15
Fast, reliable and inexpensive analytical techniques for trace detection of explosive components are in high demand. Our approach is to develop specific sensor coating materials based on molecularly imprinted polymers (MIPs). Despite the known inhibition of radical polymerisations by nitro groups and the known shrinkage of the polymer lattice during/after drying we were able to synthesize particulate MIPs by suspension polymerisation as well as thin MIP coatings by direct surface polymerisation on quartz crystal microbalances (QCM). The best method to purify the porous beads was Soxhlet extraction followed by supercritical carbon dioxide extraction (SFE with sc-CO2) at mild conditions (150 bar, 50 degrees C). At least a removal of >99.7% of the template was achieved. Performance tests of TNT imprinted polymer beads showed that acrylamide (AA) and more pronounced also methacrylic acid (MAA) possessed an enhanced adsorption tendency for gaseous TNT. An adsorption of 2,4-DNT, dinitrotoluene, by these MIPs was not detected. Using 2,4-DNT as template and methacrylamide, MAAM, a positive imprint effect for gaseous 2,4-DNT was achieved with no measurable cross-sensitivity for 2,4,6-TNT. The thin MIP coatings directly synthesized on the QCMs showed thicknesses of 20 to up to 500 nm. Preliminary screening experiments were performed for five different monomers and three different solvents (acetonitrile, chloroform and dimethylformamide). Best adsorption properties for TNT vapour until now showed a PAA-MIP synthesized with chloroform. Direct measurements of the mass attachment, respectively frequency decrease of the coated QCMs during vapour treatment showed a TNT-uptake of about 150 pg per microg MIP per hour. Results look worthy for further studies.
Cylindrical Induction Melter Modicon Control System
International Nuclear Information System (INIS)
Weeks, G.E.
1998-04-01
In the last several years an extensive R ampersand D program has been underway to develop a vitrification system to stabilize Americium (Am) and Curium (Cm) inventories at SRS. This report documents the Modicon control system designed for the 3 inch Cylindrical Induction Melter (CIM)
Analysis of large soil samples for actinides
Maxwell, III; Sherrod, L [Aiken, SC
2009-03-24
A method of analyzing relatively large soil samples for actinides by employing a separation process that includes cerium fluoride precipitation for removing the soil matrix and precipitates plutonium, americium, and curium with cerium and hydrofluoric acid followed by separating these actinides using chromatography cartridges.
Directory of Open Access Journals (Sweden)
Heinz Berke
2011-01-01
Full Text Available In the title paramagnetic 19-electron neutral complex, [W(BH4(C21H24N22(NO2], the W(0 atom is coordinated by two 1,3-bis(2,4,6-trimethylphenylimidazol-2-ylidene (IMes carbene ligands, two NO groups and two H atoms of an η2-tetrahydroborate ligand. Depending on the number of coordination sites (n assigned to the BH4− ligand, the coordination geometry of the W atom may either be described as approximately trigonal–bipyramidal (n = 1 or as very distorted octahedral with the bridging H atoms filling two coordination positions (n = 2. In the latter case, the coplanar NO groups and bridging H atoms (r.m.s. deviation = 0.032 Å form one octahedral plane, with mutually trans-oriented carbene ligands. In the crystal, molecules are connected via C—H...O interactions.
Directory of Open Access Journals (Sweden)
Juneyong Eum
2016-11-01
Full Text Available Environmental contamination by trinitrotoluene is of global concern due to its widespread use in military ordnance and commercial explosives. Despite known long-term persistence in groundwater and soil, the toxicological profile of trinitrotoluene and other explosive wastes have not been systematically measured using in vivo biological assays. Zebrafish embryos are ideal model vertebrates for high-throughput toxicity screening and live in vivo imaging due to their small size and transparency during embryogenesis. Here, we used Single Plane Illumination Microscopy (SPIM/light sheet microscopy to assess the developmental toxicity of explosive-contaminated water in zebrafish embryos and report 2,4,6-trinitrotoluene-associated developmental abnormalities, including defects in heart formation and circulation, in 3D. Levels of apoptotic cell death were higher in the actively developing tissues of trinitrotoluene-treated embryos than controls. Live 3D imaging of heart tube development at cellular resolution by light-sheet microscopy revealed trinitrotoluene-associated cardiac toxicity, including hypoplastic heart chamber formation and cardiac looping defects, while the real time PCR (polymerase chain reaction quantitatively measured the molecular changes in the heart and blood development supporting the developmental defects at the molecular level. Identification of cellular toxicity in zebrafish using the state-of-the-art 3D imaging system could form the basis of a sensitive biosensor for environmental contaminants and be further valued by combining it with molecular analysis.
International Nuclear Information System (INIS)
Saturnin, A.; Sarrat, P.; Hancok, H.; Milot, J.-F.; Duret, B.; Jasserand, F.; Fillastre, E.; Giffard, F.-X.; Chabert, C.; Van Den Durpel, L.; Caron-Charles, M.; Lefevre, J.C.; Carlier, B.; Arslan, M.; Favet, D.; Garzenne, C.; Barbrault, P.
2013-01-01
Conclusions: First detailed assessment of plants and transportation in various transmutation scenarios. In case of curium transmutation: large difficulties and uncertainties requiring whole new technology development (more pronounced for ADS option). For Am transmutation: more feasible, still to be demonstrated on specific points for industrial extrapolation
Removal of actinides from high-level wastes generated in the reprocessing of commercial fuels
International Nuclear Information System (INIS)
Bond, W.D.; Leuze, R.E.
1975-09-01
Progress is reported on a technical feasibility study of removing the very long-lived actinides (uranium, neptunium, plutonium, americium, and curium) from high-level wastes generated in the commercial reprocessing of spent nuclear fuels. The study was directed primarily at wastes from the reprocessing of light water reactor (LWR) fuels and specifically to developing satisfactory methods for reducing the actinide content of these wastes to values that would make 1000-year-decayed waste comparable in radiological toxicity to natural uranium ore deposits. Although studies are not complete, results thus far indicate the most promising concept for actinide removal includes both improved recovery of actinides in conventional fuel reprocessing and secondary processing of the high-level wastes. Secondary processing will be necessary for the removal of americium and curium and perhaps some residual plutonium. Laboratory-scale studies of separations methods that appear most promising are reported and conceptual flowsheets are discussed. (U.S.)
International Nuclear Information System (INIS)
Ashwood, T.L.; Marsh, J.D. Jr.
1994-04-01
This report presents a compilation of groundwater monitoring data from Solid Waste Storage Area (SWSA) 5 North at Oak Ridge National Laboratory (ORNL) between November 1989 and September 1993. Monitoring data were collected as part of the Active Sites Environmental Monitoring Program that was implemented in 1989 in response to DOE Order 5820.2A. SWSA 5 North was established for the retrievable storage of transuranic (TRU) wastes in 1970. Four types of storage have been used within SWSA 5 North: bunkers, vaults, wells, and trenches. The fenced portion of SWSA 5 North covers about 3.7 ha (9 acres) in the White Oak Creek watershed south of ORNL. The area is bounded by White Oak Creek and two ephemeral tributaries of White Oak Creek. Since 1989, groundwater has been monitored in wells around SWSA 5 North. During that time, elevated gross alpha contamination (reaching as high as 210 Bq/L) has consistently been detected in well 516. This well is adjacent to burial trenches in the southwest corner of the area. Water level measurements in wells 516 and 518 suggest that water periodically inundates the bottom of some of those trenches. Virtually all of the gross alpha contamination is generated by Curium 244 and Americium 241. A special geochemical investigation of well 516 suggests that nearly all of the Curium 44 and Americium 241 is dissolved or associated with dissolved organic matter. These are being transported at the rate of about 2 m/year from the burial trenches, through well 516, to White Oak Creek, where Curium 244 has been detected in a few bank seeps. Concentrations at these seeps are near detection levels (<1 Bq/L)
Energy Technology Data Exchange (ETDEWEB)
Ashwood, T.L.; Marsh, J.D. Jr.
1994-04-01
This report presents a compilation of groundwater monitoring data from Solid Waste Storage Area (SWSA) 5 North at Oak Ridge National Laboratory (ORNL) between November 1989 and September 1993. Monitoring data were collected as part of the Active Sites Environmental Monitoring Program that was implemented in 1989 in response to DOE Order 5820.2A. SWSA 5 North was established for the retrievable storage of transuranic (TRU) wastes in 1970. Four types of storage have been used within SWSA 5 North: bunkers, vaults, wells, and trenches. The fenced portion of SWSA 5 North covers about 3.7 ha (9 acres) in the White Oak Creek watershed south of ORNL. The area is bounded by White Oak Creek and two ephemeral tributaries of White Oak Creek. Since 1989, groundwater has been monitored in wells around SWSA 5 North. During that time, elevated gross alpha contamination (reaching as high as 210 Bq/L) has consistently been detected in well 516. This well is adjacent to burial trenches in the southwest corner of the area. Water level measurements in wells 516 and 518 suggest that water periodically inundates the bottom of some of those trenches. Virtually all of the gross alpha contamination is generated by Curium 244 and Americium 241. A special geochemical investigation of well 516 suggests that nearly all of the Curium 44 and Americium 241 is dissolved or associated with dissolved organic matter. These are being transported at the rate of about 2 m/year from the burial trenches, through well 516, to White Oak Creek, where Curium 244 has been detected in a few bank seeps. Concentrations at these seeps are near detection levels (<1 Bq/L).
International Nuclear Information System (INIS)
Assefa, Zerihun; Haire, Richard G.; Sykora, Richard E.
2008-01-01
We have prepared Cm[Au(CN) 2 ] 3 .3H 2 O and Cm[Ag(CN) 2 ] 3 .3H 2 O as a part of our continuing investigations into the chemistry of the 5f-elements' dicyanometallates. Single crystals of Cm[Au(CN) 2 ] 3 .3H 2 O were obtained from the reaction of CmCl 3 and KAu(CN) 2 under mild hydrothermal conditions. Due to similarities in size, the related praseodymium compounds were also synthesized and characterized for comparison with the actinide systems. The compounds crystallize in the hexagonal space group P6 3 /mcm, where the curium and the transition metals interconnect through cyanide bridging. Crystallographic data (Mo Kα, λ=0.71073 A): Cm[Au(CN) 2 ] 3 .3H 2 O (1), a=6.6614(5) A, c=18.3135(13) A, V=703.77(9), Z=2; Pr[Au(CN) 2 ] 3 .3H 2 O (3), a=6.6662(8) A, c=18.497(3) A, V=711.83(17), Z=2; Pr[Ag(CN) 2 ] 3 .3H 2 O (4), a=6.7186(8) A, c=18.678(2) A, V=730.18(14), Z=2. The Cm 3+ and/or Pr 3+ ions are coordinated to six N-bound CN - groups resulting in a trigonal prismatic arrangement. Three oxygen atoms of coordinated water molecules tricap the trigonal prismatic arrangement providing a coordination number of nine for the f-elements. The curium ions in both compounds exhibit a strong red emission corresponding to the 6 D 7/2 → 8 S 7/2 transition. This transition is observed at 16,780 cm -1 , with shoulders at 17,080 and 16,840 cm -1 for the Ag complex, while the emission is red shifted by ∼100 cm -1 in the corresponding gold complex. The Pr systems also provide well-resolved emissions upon f-f excitation. - Graphical abstract: Coordination polymeric compounds between a trans-plutonium element, curium and transition metal ions, gold(I) and silver(I), were prepared using the hydrothermal synthetic procedure. The curium ion and the transition metals are interconnected through cyanide bridging. The Cm ion has a tricapped trigonal prismatic coordination environment with coordination number of nine. Detail photoluminescence studies of the complexes are also reported
Dhamodharan, P.; Sathya, K.; Dhandapani, M.
2018-02-01
A new proton transfer compound, 1H-imidazole-3-ium-3-hydroxy-2,4,6-trinitrophenolate (IMHTP), was crystallized by slow evaporation-solution growth technique. 1H and 13C NMR spectral studies confirm the molecular structure of the grown crystal. Single crystal X-ray diffraction study confirms that IMHTP crystallizes in monoclinic system with space group P21/c. Thermal curves (TG/DTA) show that the material is thermally stable up to 198 °C. The crystal emits fluorescence at 510 nm, proving its utility in making green light emitting materials in optical applications. The stable molecular structure was optimized by Gaussian 09 program with B3LYP/6-311++G(d,p) level of basis set. The frontier molecular orbital study shows that the charge transfer interaction occurs within the complex. The calculated first-order hyperpolarizability value of IMHTP is 44 times higher than that the reference material, urea. The electrostatic potential map was used to probe into electrophilic and nucleophilic reactive sites present in the molecule.
International Nuclear Information System (INIS)
Kovalchukova, O. V.; Stash, A. I.; Strashnova, S. B.; Romashkina, E. P.; Zaitsev, B. E.
2010-01-01
The complex compounds (H 3 L . Cl)[CoCl 4 ] (I) and H 2 L[CuBr 4 ] (II), where L is 2,4,6-tri(N,N-dimethylamino)methylphenol, were isolated in the crystalline state and studied by X-ray diffraction. The organic cations were found to be outer-sphere ligands. All three nitrogen atoms of the tertiary amino groups are protonated. In compound I, the H 3 L 3+ cation exists as the cis tautomer. In compound II, the H 2 L 2+ dication exists as the trans isomer. In the crystal structure, the dications are arranged in layers via hydrogen bonds.
Directory of Open Access Journals (Sweden)
Rui eYatabe
2014-04-01
Full Text Available We fabricated a surface plasmon resonance (SPR sensor using a hydrophilic polymer for the highly sensitive detection of 2,4,6-trinitrotoluene (TNT. The hydrophilic polymer was made from mono-2-(methacryloyloxyethylsuccinate (MES and 2-hydroxyethylmethacrylate (HEMA by surface-initiated atom transfer radical polymerization (SI-ATRP. The detection of TNT was carried out by displacement assay with the SPR measurement. In displacement assay, the affinity between anti-TNT antibody and the sensor surface, affects to the sensitivity. In the SPR measurement, nonspecific adsorption should be controlled because SPR sensor cannot discriminate between specific and nonspecific adsorption. Therefore, the affinity and nonspecific adsorption were controlled by changing the ratio of HEMA to MES. A detection limit of 0.4 ng/ml (ppb for TNT was achieved using a sensor surface with the lowest affinity without nonspecific adsorption.
International Nuclear Information System (INIS)
Devi, I.; Memon, S. A.; Khuhawar, M.Y.
2004-01-01
Vitamin E (tocopherols and tocotrienols) antioxidants are determined by reducing Cu(II) to Cu(I) or Fe(III) to Fe(II) in presence of vitamin E and subsequent complexation of Cu(I) with bathocuproine and/or Fe(II) with 2,4,6-tris-(2'-pyridyl)-s-triazine (TPTZ). Both the reactions are monitored separately, Cu(I)-bathocuproine at 479 nm where as, Fe(II)-(TPTZ) at 595 nm spectrophotometrically. Linear calibration curves are achieved for both complexes between I to 5mu g ml-1 for vitamin E. The methods were applied for the determination of vitamin E in pharmaceutical preparations and edible oils. Vitamin E, from edible oils, was solvent extracted into n-hexane prior to saponification. Furthermore, a single lined flow was also examined. A larger excess of Cu(II) or Fe =(II) with different concentrations of vitamin E in buffer pH 4 was run on the line and constant amounts of reagent bathocuproine or TPTZ in each case was injected through the injector. The peak height shows a linear relationship for vitamin E between 0.5 to 2.5 mu g ml-1 for both complexes. (author)
Energy Technology Data Exchange (ETDEWEB)
Sundberg, A.; Brunstroem, B.; Brandt, I. [Uppsala Univ. (Sweden). Dept. of Environmental Toxicology; Cantillana, T.; Bergman, Aa. [Stockholm Univ. (Sweden). Dept. of Environmental Chemistry
2004-09-15
Bisphenol A (BPA) is an intermediate in the production of epoxy resins, while its brominated derivative tetrabromobishenol A (TBBPA) and its photolysis degradation product 2,4,6-tribromophenol (TBP) are widely used flame retardants. These brominated compounds have been identified in human blood. TBBPA, TBP and a number of 4-hydroxy-PCBs (e.g. 4-OH-CB107) are high affinity ligands for the thyroxin (T4) transporter transthyretin (TTR) in rodents and other species. Displacement of T4 from the TTR binding site has been proposed as an important mechanism of endocrine disruption by certain halogenated phenolic environmental pollutants. BPA is a fairly potent environmental estrogen receptor agonist that can induce an array of estrogenic effects in several species including mammals, birds and fish. Although the estrogenic activity of TBBPA is less obvious, this brominated BPA analog has been reported to interact with the estrogen receptor and induce estrogenic effects in some in vitro test systems. While the reproductive and developmental toxicity of BPA is well documented, there is evidence that also halogenated phenolic compounds can pass the placental barrier and induce such toxicity. Within the objectives of the COMPARE EU project we study the fetal and maternal kinetics and transplacental transport of phenolic environmental pollutants in pregnant mice. To explore the role of TTR in the placental and blood-brain barrier transport, we employ TTR-deficient mice. For comparative reasons, we also explore the transfer to bird embryos following injection into the yolk or administration to the egg-laying bird. In the present communication, we report on the disposition of BPA, TBBPA and TBP in the fetoplacental unit in pregnant wild-type mice.
Visceral hypersensitivity is provoked by 2,4,6-trinitrobenzene sulfonic acid-induced ileitis in rats
Directory of Open Access Journals (Sweden)
Manoj Kumar Shah
2016-07-01
Full Text Available Background and Aims: Crohn’s Disease (CD, a chronic Inflammatory Bowel Disease, can occur in any part of the gastrointestinal tract, but most frequently in the ileum. Visceral hypersensitivity contributes for development of chronic abdominal pain in this disease. Currently, the understanding of the mechanism underlying hypersensitivity of Crohn’s ileitis has been hindered by a lack of specific animal model. The present study is undertaken to investigate the visceral hypersensitivity provoked by 2,4,6-trinitrobenzene sulfonic (TNBS-induced ileitis rats.Methods: Male Sprague-Dawley rats were anaesthetized and laparotomized for intraileal injection of TNBS (0.6 ml, 80 mg/kg body weight in 30% ethanol, n = 48, an equal volume of 30% Ethanol (n = 24 and Saline (n = 24, respectively. Visceral hypersensitivity was assessed by visceromotor responses (VMR to 20, 40, 60, 80 and 100 mmHg colorectal distension pressure (CRD at day 1, 3, 7, 14, 21 and 28. Immediately after CRD test, the rats were euthanized for collecting the terminal ileal segment for histopathological examinations and ELISA of myleoperoxidase and cytokines (TNF-α, IL-1β, IL-6, and dorsal root ganglia (T11 for determination of calcitonin gene-related peptide by immunohistochemistry, respectively. Results: Among all groups, TNBS-treatment showed transmural inflammation initially at 3 days, reached maximum at 7 days and persisted up to 21 days. The rats with ileitis exhibited (P < 0.05 VMR to CRD at day 7 to day 21. The calcitonin gene-related peptide-immunoreactive positive cells increased (P < 0.05 in dorsal root ganglia at day 7 to 21, which was persistently consistent with visceral hypersensitivity in TNBS-treated rats.Conclusions: TNBS injection into the ileum induced transmural ileitis including granuloma and visceral hypersensitivity. As this model mimics clinical manifestations of CD, it may provide a road map to probe the pathogenesis of gut inflammation and visceral
Zou, Wen-Sheng; Wang, Ya-Qin; Wang, Feng; Shao, Qun; Zhang, Jun; Liu, Jin
2013-05-01
Despite the rapid development of nanomaterials and nanotechnology, it is still desirable to develop novel nanoparticle-based techniques which are cost-effective, timesaving, and environment-friendly, and with ease of operation and procedural simplicity, for assay of target analytes. In the work discussed in this paper, the dye fluorescein isothiocyanate (FITC) was conjugated to 1,6-hexanediamine (HDA)-capped iron oxide magnetic nanoparticles (FITC-HDA Fe3O4 MNPs), and the product was characterized. HDA ligands on the surface of Fe3O4 MNPs can bind 2,4,6-trinitrotoluene (TNT) to form TNT anions by acid-base pairing interaction. Formation of TNT anions, and captured TNT substantially affect the emission of FITC on the surface of the Fe3O4 MNPs, resulting in quenching of the fluorescence at 519 nm. A novel FITC-HDA Fe3O4 MNPs-based probe featuring chemosensing and magnetic separation has therefore been constructed. i.e. FITC-HDA Fe3O4 MNPs had a highly selective fluorescence response and enabled magnetic separation of TNT from other nitroaromatic compounds by quenching of the emission of FITC and capture of TNT in aqueous solution. Very good linearity was observed for TNT concentrations in the range 0.05-1.5 μmol L(-1), with a detection limit of 37.2 nmol L(-1) and RSD of 4.7 % (n = 7). Approximately 12 % of the total amount of TNT was captured. The proposed methods are well-suited to trace detection and capture of TNT in aqueous solution.
Directory of Open Access Journals (Sweden)
Kiyoshi Toko
2013-07-01
Full Text Available In this study, we modified a surface plasmon resonance immunosensor chip with a polymer using surface-initiated atom transfer polymerization (SI-ATRP for the highly sensitive detection of 2,4,6-trinitrotoluene (TNT. To immobilize a TNT analogue on the polymer, mono-2-(methacryloyloxyethylsuccinate (MES, which has a carboxyl group, was used in this study. However, the anti-TNT antibody may adsorb non-specifically on the polymer surface by an electrostatic interaction because MES is negatively charged. Therefore, a mixed monomer with MES and diethylaminoethylmethacrylate (DEAEM, which has a tertiary amino group and is positively charged, was prepared to obtain electroneutrality for suppressing the nonspecific adsorption. The detection of TNT was performed by inhibition assay using the polymer surface. To ensure high sensitivity to TNT, the affinity between the surface and the antibody was optimized by controlling the density of the initiator for ATRP by mixing two types of self-assembled monolayer reagents. As a result, a limit of detection of 5.7 pg/mL (ppt for TNT was achieved using the optimized surface.
Iwamoto, Y; Nakamura, T; Nakashima, H; Mares, V; Itoga, T; Matsumoto, T; Nakane, Y; Feldbaumer, E; Jaegerhofer, L; Pioch, C; Tamii, A; Satoh, D; Masuda, A; Sato, T; Iwase, H; Yashima, H; Nishiyama, J; Hagiwara, M; Hatanaka, K; Sakamoto, Y
2011-01-01
The authors measured the neutron energy spectra of a quasi-monoenergetic (7)Li(p,n) neutron source with 246 and 389 MeV protons set at seven angles (0 degrees, 2.5 degrees, 5 degrees, 10 degrees, 15 degrees, 20 degrees and 30 degrees), using a time-of-flight (TOF) method employing organic scintillators NE213 at the Research Center for Nuclear Physics (RCNP) of Osaka University. The energy spectra of the source neutrons were precisely deduced down to 2 MeV at 0 degrees and 10 MeV at other angles. The cross-sections of the peak neutron production reaction at 0 degrees were on the 35-40 mb line of other experimental data, and the peak neutron angular distribution agreed well with the Taddeucci formula. Neutron energy spectra below 100 MeV at all angles were comparable, but the shapes of the continuum above 150 MeV changed considerably with the angle. In order to consider the correction required to derive the response in the peak region from the measured total response for high-energy neutron monitors such as DAR...
Crystal structure of diaquabis(N,N-diethylnicotinamide-κN1bis(2,4,6-trimethylbenzoato-κO1cobalt(II
Directory of Open Access Journals (Sweden)
Gülçin Şefiye Aşkın
2016-04-01
Full Text Available The centrosymmetric molecule in the monomeric title cobalt complex, [Co(C10H11O22(C10H14N2O2(H2O2], contains two water molecules, two 2,4,6-trimethylbenzoate (TMB ligands and two diethylnicotinamide (DENA ligands. All ligands coordinate to the CoII atom in a monodentate fashion. The four O atoms around the CoII atom form a slightly distorted square-planar arrangement, with the distorted octahedral coordination sphere completed by two pyridine N atoms of the DENA ligands. The dihedral angle between the planar carboxylate group and the adjacent benzene ring is 84.2 (4°, while the benzene and pyridine rings are oriented at a dihedral angle of 38.87 (10°. The water molecules exhibit both intramolecular (to the non-coordinating carboxylate O atom and intermolecular (to the amide carbonyl O atom O—H...O hydrogen bonds. The latter lead to the formation of layers parallel to (100, enclosing R44(32 ring motifs. These layers are further linked via weak C—H...O hydrogen bonds, resulting in a three-dimensional network. One of the two ethyl groups of the DENA ligand is disordered over two sets of sites with an occupancy ratio of 0.490 (13:0.510 (13.
International Nuclear Information System (INIS)
Cotchim, Suparat; Thavarungkul, Panote; Kanatharana, Proespichaya; Limbut, Warakorn
2015-01-01
Highlights: • A new fabrication strategy of a poly(melamine)/graphene oxide (PM/GO) modified glassy carbon electrode (GCE) (PM/GO/GCE) for the detection of ultra-traces of TNT is proposed. • The PM/GO/GCE exhibits excellent adsorption and electrochemical reduction of TNT via the AdCSV technique. • The PM/GO/GCE provides for a high sensitivity, good repeatability and selectivity. • This strategy opens new opportunities for the sensitive detection of TNT aiming at protection of the environmental and homeland securities. - Abstract: A poly(melamine)/graphene oxide (PM/GO) layer modified on a glassy carbon electrode (GCE) was used for the adsorption and electrochemical detection of 2,4,6 trinitrotoluene (TNT). The surface morphology and electrochemical behaviour of the PM/GO/GCE were characterized by scanning electron microscopy (SEM), fourier transform infrared spectroscopy (FT-IR), cyclic voltammetry (CV) and adsorptive cathodic stripping voltammetry (AdCSV). The PM/GO/GCE exhibited excellent adsorption and electrochemical reduction of TNT via the AdCSV technique with two linear ranges, 1–90 μg L −1 and 100–1000 μg L −1 , a detection limit of 0.34 μg L −1 and a quantitation limit of 1.14 μg L −1 . The PM/GO/GCE provided for a high sensitivity, good repeatability and selectivity. This modified electrode was successfully applied to detect TNT in soil samples with good recoveries that ranged from 93 to 99%.
Directory of Open Access Journals (Sweden)
Maryam Iman
2017-08-01
Full Text Available Microbial remediation of nitroaromatic compounds (NACs is a promising environmentally friendly and cost-effective approach to the removal of these life-threating agents. Escherichia coli (E. coli has shown remarkable capability for the biotransformation of 2,4,6-trinitro-toluene (TNT. Efforts to develop E. coli as an efficient TNT degrading biocatalyst will benefit from holistic flux-level description of interactions between multiple TNT transforming pathways operating in the strain. To gain such an insight, we extended the genome-scale constraint-based model of E. coli to account for a curated version of major TNT transformation pathways known or evidently hypothesized to be active in E. coli in present of TNT. Using constraint-based analysis (CBA methods, we then performed several series of in silico experiments to elucidate the contribution of these pathways individually or in combination to the E. coli TNT transformation capacity. Results of our analyses were validated by replicating several experimentally observed TNT degradation phenotypes in E. coli cultures. We further used the extended model to explore the influence of process parameters, including aeration regime, TNT concentration, cell density, and carbon source on TNT degradation efficiency. We also conducted an in silico metabolic engineering study to design a series of E. coli mutants capable of degrading TNT at higher yield compared with the wild-type strain. Our study, therefore, extends the application of CBA to bioremediation of nitroaromatics and demonstrates the usefulness of this approach to inform bioremediation research.
International Nuclear Information System (INIS)
Lee, Byungjin; Jeong, Seung-Woo
2009-01-01
The effects of additives (i.e., methanol, EDTA, mannitol, thiourea, nitrous oxide, oxygen and ozone) on gamma irradiation of 2,4,6-trinitrotoluene (TNT) were investigated to elucidate the initial reaction mechanism of TNT degradation and suggest an practical method for complete by-product removal. All additives, except thiourea, significantly increased the TNT removal efficiency by gamma irradiation. The overall results of the additive experiments implied that the TNT decomposition would be initiated by ·OH, e aq - , and HO 2 ·/O 2 · - , and also implied that ·H did not have any direct effect on the TNT decomposition. Additions of methanol and nitrous oxide were more effective in TNT removal than the other additives, achieving complete removal of TNT at doses below 20 kGy. Total organic carbon (TOC) of the irradiated solution was analyzed to evaluate the degree of TNT mineralization under the additive conditions. TOC under the nitrous oxide addition was removed rapidly, and complete TNT mineralization was thus achieved at 50 kGy. Methanol addition was very effective in the TNT removal, but it was not effective in reduction in TOC. Trinitrobenzene (TNB), oxalic acid and glyoxalic acid were detected as radiolytic organic by-products, while ammonia and nitrate were detected as radiolytic inorganic by-products. The most efficient TNT removal and its mineralization by gamma irradiation would be achieved by supersaturating the solution with nitrous oxide before irradiation.
Transuranium analysis methodologies for biological and environmental samples
International Nuclear Information System (INIS)
Wessman, R.A.; Lee, K.D.; Curry, B.; Leventhal, L.
1978-01-01
Analytical procedures for the most abundant transuranium nuclides in the environment (i.e., plutonium and, to a lesser extent, americium) are available. There is a lack of procedures for doing sequential analysis for Np, Pu, Am, and Cm in environmental samples, primarily because of current emphasis on Pu and Am. Reprocessing requirements and waste disposal connected with the fuel cycle indicate that neptunium and curium must be considered in environmental radioactive assessments. Therefore it was necessary to develop procedures that determine all four of these radionuclides in the environment. The state of the art of transuranium analysis methodology as applied to environmental samples is discussed relative to different sample sources, such as soil, vegetation, air, water, and animals. Isotope-dilution analysis with 243 Am ( 239 Np) and 236 Pu or 242 Pu radionuclide tracers is used. Americium and curium are analyzed as a group, with 243 Am as the tracer. Sequential extraction procedures employing bis(2-ethyl-hexyl)orthophosphoric acid (HDEHP) were found to result in lower yields and higher Am--Cm fractionation than ion-exchange methods
Multiple recycling of plutonium in advanced PWRs
International Nuclear Information System (INIS)
Kloosterman, J.L.
1998-04-01
The influence of the moderator-to-fuel ratio in MOX fueled PWRs on the moderator void coefficient, the fuel temperature coefficient, the moderator temperature coefficient, the boron reactivity worth, the critical boron concentration, the mean neutron generation time and the effective delayed neutron fraction has been assessed. Increasing the moderator-to-fuel ratio to values larger than three, gives a moderator void coefficient sufficiently large to recycle the plutonium at least four times. Scenario studies show that four times recycling of plutonium in PWRs reduces the plutonium mass produced with a factor of three compared with a reference once-through reactor park, but that the americium and curium production triple. If the minor actinides and the remaining plutonium after four times recycling are disposed of, the reduction of the radiotoxicity reaches only a factor of two. This factor increases to five at the maximum when the plutonium is further recycled. Recycling of americium and curium is needed to further reduce the radiotoxicity of the spent fuel. 4 refs
Energy Technology Data Exchange (ETDEWEB)
Raison, Ph.; Albiot, T
2000-07-01
This paper deals with the minor actinides transmutation and the scientific contribution of the ORNL and the JAERI. It presents researches on the Am-Zr-Y-O system in the framework of the heterogeneous reprocessing, the curium and pyrochlore structures, with the ORNL contribution and phase diagrams, data of Thermodynamics, actinides nitrides, with the JAERI. (A.L.B.)
International Nuclear Information System (INIS)
Raison, Ph.; Albiot, T.
2000-01-01
This paper deals with the minor actinides transmutation and the scientific contribution of the ORNL and the JAERI. It presents researches on the Am-Zr-Y-O system in the framework of the heterogeneous reprocessing, the curium and pyrochlore structures, with the ORNL contribution and phase diagrams, data of Thermodynamics, actinides nitrides, with the JAERI. (A.L.B.)
Historical review of californium-252 discovery and development
International Nuclear Information System (INIS)
Stoddard, D.H.
1985-01-01
This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed
International Nuclear Information System (INIS)
Madrakian, Tayyebeh; Afkhami, Abbas; Zolfigol, Mohammad Ali; Solgi, Mohammad
2006-01-01
A new modified silica gel using 2,4,6-trimorpholino-1,3,5-triazin was used for separation, preconcentration and determination of silver ion in natural water by atomic absorption spectrometry (AAS). This new bonded silica gel was used as an effective sorbent for the solid-phase extraction (SPE) of silver ion from aqueous solutions. Experimental conditions for effective adsorption of trace levels of silver ion were optimized with respect to different experimental parameters in column process. Common coexisting ions did not interfere with the separation and determination of silver at pH 3.5 so that silver ion completely adsorbed on the column. The preconcentration factor is 130 (1 mL elution volume for a 130 mL sample volume). The relative standard deviation (R.S.D.) under optimum conditions is 3.03% (n = 5). The accuracy of the method was estimated by using spring and tap water samples that were spiked with different amounts of silver ion. The adsorption isotherm of silver ion was obtained. The capacity of the sorbent at optimum conditions has been found to be 384 μg of silver per gram of sorbent
Interaction of europium and curium with alpha-amylase
Energy Technology Data Exchange (ETDEWEB)
Barkleit, Astrid [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Div. Chemistry of the F-Elements; Heller, Anne [Technische Univ. Dresden (Germany). Inst. for Zoology, Molecular Cell Physiology and Endocrinology; Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Div. Biogeochemistry
2016-07-01
Time-resolved laser-induced fluorescence spectroscopy (TRLFS) revealed that Eu(III) and Cm(III) form two dominant species with the protein α-amylase (Amy): one with the coordination of a single carboxylate group of the protein and the other with three coordinating carboxylate groups.
Gastrointestinal absorption of neptunium and curium in humans
International Nuclear Information System (INIS)
Popplewell, D.S.; Harrison, J.D.; Ham, G.J.
1991-01-01
The gastrointestinal absorption of Np and Cm has been determined in five male adult volunteers. The Np and Cm, which were in citrate solution, were taken with food. An initial experiment with each individual determined the fraction of each element excreted in the urine following intravenous administration. Subsequently, the results for urinary excretion for the two routes of administration were used to calculate the fractional absorption (f1) of ingested Np and Cm. The mean f1 values were: Np (2.0 +/- 0.2) X 10 - 4 , range (1.2-2.9) X 10 - 4 , and Cm (1.7 +/- 0.3) X 10 - 4 , range (0.95-3.0) X 10 - 4 , the quoted uncertainties being the standard error of the means. Currently, the International Commission on Radiological Protection recommends a value of 10 - 3 for both elements. Cumulative urinary excretion over 1 wk after intravenous injection accounted for about 20%-40% of administered Np and 7%-10% of Cm. At the conclusion of the experiment, the total committed effective dose equivalent for each volunteer was calculated to be in the range 130-250 microSv, based on the individual f1 values, and, in some cases, a knowledge of the rate of clearance of 239 Np through the gut as measured by whole-body counting
Actinide production from xenon bombardments of curium-248
International Nuclear Information System (INIS)
Welch, R.B.
1985-01-01
Production cross sections for many actinide nuclides formed in the reaction of 129 Xe and 132 Xe with 248 Cm at bombarding energies slightly above the coulomb barrier were determined using radiochemical techniques to isolate these products. These results are compared with cross sections from a 136 Xe + 248 Cm reaction at a similar energy. When compared to the reaction with 136 Xe, the maxima in the production cross section distributions from the more neutron deficient projectiles are shifted to smaller mass numbers, and the total cross section increases for the production of elements with atomic numbers greater than that of the target, and decreases for lighter elements. These results can be explained by use of a potential energy surface (PES) which illustrates the effect of the available energy on the transfer of nucleons and describes the evolution of the di-nuclear complex, an essential feature of deep-inelastic reactions (DIR), during the interaction. The other principal reaction mechanism is the quasi-elastic transfer (QE). Analysis of data from a similar set of reactions, 129 Xe, 132 Xe, and 136 Xe with 197 Au, aids in explaining the features of the Xe + Cm product distributions, which are additionally affected by the depletion of actinide product yields due to deexcitation by fission. The PES is shown to be a useful tool to predict the general features of product distributions from heavy ion reactions
Verma, Chandrabhan; Olasunkanmi, Lukman O.; Ebenso, Eno E.; Quraishi, M. A.
2018-03-01
The effect of electron withdrawing nitro (-NO2) and electron releasing hydroxyl (-OH) groups on corrosion inhibition potentials of 5-arylaminomethylenepyrimidine-2,4,6-trione (AMP) had been studied. Four AMPs tagged AMP-1, AMP-2, AMP-3 and AMP-4 were studied for their ability to inhibit mild steel corrosion in 1 M HCl using experimental and theoretical methods. Gravimetric results showed that inhibition efficiency of the studied inhibitors increases with increasing concentration. The results further revealed that that electron withdrawing nitro (-NO2) group decreases the inhibition efficiency of AMP, while electron donating hydroxyl (-OH) group increases the inhibition efficiency of AMP. SEM and AFM studies showed that the studied compounds inhibit mild steel corrosion by adsorbing at the metal/electrolyte interface and their adsorption obeyed the Temkin adsorption isotherm. Potentiodynamic polarization study revealed that studied inhibitors act as mixed type inhibitors with predominant effect on cathodic reaction. The inhibitive strength of the compounds might have direct relationship electron donating ability of the molecules as revealed by quantum chemical parameters. The order of interaction energies derived from Monte Carlo simulations is AMP-4 > AMP-3 > AMP-2 > AMP-1, which is in agreement with the order of inhibition efficiencies obtained from experimental measurements.
Directory of Open Access Journals (Sweden)
Anne Perdrix
2017-12-01
Full Text Available p53 protects cells from genetic assaults by triggering cell-cycle arrest and apoptosis. Inactivation of p53 pathway is found in the vast majority of human cancers often due to somatic missense mutations in TP53 or to an excessive degradation of the protein. Accordingly, reactivation of p53 appears as a quite promising pharmacological approach and, effectively, several attempts have been made in that sense. The most widely investigated compounds for this purpose are PRIMA-1 (p53 reactivation and induction of massive apoptosis and PRIMA-1Met (APR-246, that are at an advanced stage of development, with several clinical trials in progress. Based on publications referenced in PubMed since 2002, here we review the reported effects of these compounds on cancer cells, with a specific focus on their ability of p53 reactivation, an overview of their unexpected anti-cancer effects, and a presentation of the investigated drug combinations.
Directory of Open Access Journals (Sweden)
Lejla Klepo
2016-01-01
Full Text Available Ascorbic acid (AA is a water-soluble vitamin which shows no fluorescence. However, in reaction with iron(III, AA is oxidised to dehydroascorbic acid and iron(III is reduced to iron(II which forms a complex with 2,4,6-tripyridyl-S-triazine (TPTZ in buffered medium. The relative fluorescence intensity of the resulting Fe(TPTZ22+ complex can be measured at excitation and emission wavelengths of 393 and 790 nm, respectively. Based on this data, a new indirect spectrofluorimetric method for the determination of AA in pharmaceutical samples was proposed. Influence of the reaction conditions, such as acidity of acetic buffer, concentration of TPTZ and iron(III, reaction time and instrumental parameters were investigated in detail. The linear range was from 5.4 × 10−4 to 5.4 × 10−6 mol·L−1 (R = 0.9971. The LOD was 7.7 × 10−7 mol·L−1 and LOQ was 2.3 × 10−4 mol·L−1. Fourteen pharmaceutical samples containing various amounts of AA were analysed. Influences of potential interfering substances were also examined. Analysis of commercial pharmaceutical formulations showed good correlation with the nominal values given by the manufacturers and with the results obtained by a titration method. The proposed method can be applied in routine quality control in the pharmaceutical industry due to its sensitivity, simplicity, selectivity and low cost.
Shalom-Feuerstein, Ruby; Serror, Laura; Aberdam, Edith; Müller, Franz-Josef; van Bokhoven, Hans; Wiman, Klas G; Zhou, Huiqing; Aberdam, Daniel; Petit, Isabelle
2013-02-05
Ectodermal dysplasia is a group of congenital syndromes affecting a variety of ectodermal derivatives. Among them, ectrodactyly, ectodermal dysplasia, and cleft lip/palate (EEC) syndrome is caused by single point mutations in the p63 gene, which controls epidermal development and homeostasis. Phenotypic defects of the EEC syndrome include skin defects and limbal stem-cell deficiency. In this study, we designed a unique cellular model that recapitulated major embryonic defects related to EEC. Fibroblasts from healthy donors and EEC patients carrying two different point mutations in the DNA binding domain of p63 were reprogrammed into induced pluripotent stem cell (iPSC) lines. EEC-iPSC from both patients showed early ectodermal commitment into K18(+) cells but failed to further differentiate into K14(+) cells (epidermis/limbus) or K3/K12(+) cells (corneal epithelium). APR-246 (PRIMA-1(MET)), a small compound that restores functionality of mutant p53 in human tumor cells, could revert corneal epithelial lineage commitment and reinstate a normal p63-related signaling pathway. This study illustrates the relevance of iPSC for p63 related disorders and paves the way for future therapy of EEC.
Fuel selection for radioisotope thermoelectric generators
International Nuclear Information System (INIS)
Menezes, A.
1988-06-01
The availability of Radioisotope Thermoeletric Generator fuels is evaluated based on the amount of fuel discharged from selected power reactors. In general, the best alternatives are either to use Plutonium-238 produced by irradiation of Neptunium-237 generated in typical thermal reactors or to use Curium-244 directly separated from the discharged fuels of fast or thermal reactors. (author) [pt
Rapid column extraction method for actinides and strontium in fish and other animal tissue samples
International Nuclear Information System (INIS)
Maxwell III, S.L.; Faison, D.M.
2008-01-01
The analysis of actinides and radiostrontium in animal tissue samples is very important for environmental monitoring. There is a need to measure actinide isotopes and strontium with very low detection limits in animal tissue samples, including fish, deer, hogs, beef and shellfish. A new, rapid separation method has been developed that allows the measurement of plutonium, neptunium, uranium, americium, curium and strontium isotopes in large animal tissue samples (100-200 g) with high chemical recoveries and effective removal of matrix interferences. This method uses stacked TEVA Resin R , TRU Resin R and DGA Resin R cartridges from Eichrom Technologies (Darien, IL, USA) that allows the rapid separation of plutonium (Pu), neptunium (Np), uranium (U), americium (Am), and curium (Cm) using a single multi-stage column combined with alphaspectrometry. Strontium is collected on Sr Resin R from Eichrom Technologies (Darien, IL, USA). After acid digestion and furnace heating of the animal tissue samples, the actinides and 89/90 Sr are separated using column extraction chromatography. This method has been shown to be effective over a wide range of animal tissue matrices. Vacuum box cartridge technology with rapid flow rates is used to minimize sample preparation time. (author)
International Nuclear Information System (INIS)
Daniel, W.E.; Best, D.R.
1995-01-01
Vitrification has been identified as one potential option for the e materials such as Americium (Am), Curium (Cm), Neptunium (Np), and Plutonium (Pu). A process is being developed at the Savannah River Site to safely vitrify all of the highly radioactive Am/Cm material and a portion of the fissile (Pu) actinide materials stored on site. Vitrification of the Am/Cm will allow the material to be transported and easily stored at the Oak Ridge National Laboratory. The Am/Cm glass has been specifically designed to be (1) highly durable in aqueous environments and (2) selectively attacked by nitric acid to allow recovery of the valuable Am and Cm isotopes. A similar glass composition will allow for safe storage of surplus plutonium. This paper will address the composition, relative durability, and dissolution rate characteristics of the actinide glass, Loeffler Target, that will be used in the Americium/Curium Vitrification Project at Westinghouse Savannah River Company near Aiken, South Carolina. The first part discusses the tests performed on the Loeffler Target Glass concerning instantaneous dissolution rates. The second part presents information concerning pseudo-activation energy for the one week glass dissolution process
Sangeetha, V.; Govindarajan, M.; Kanagathara, N.; Marchewka, M. K.; Gunasekaran, S.; Anbalagan, G.
2014-01-01
A new organic-organic salt, 3-nitrophenol-1,3,5-triazine-2,4,6-triamine (2/1) (3-NPM) has been synthesized by slow evaporation technique at room temperature. Single crystal X-ray diffraction analysis reveals that 3-NPM crystallizes in orthorhombic system with centrosymmetric space group Pbca and the lattice parameters are a = 15.5150(6) Å, b = 12.9137(6) Å, c = 17.8323(6) Å, α = β = γ = 90° and V = 3572.8(2) (Å)3. The geometry, fundamental vibrational frequencies are interpreted with the aid of structure optimization and normal coordinate force field calculations based on density functional theory (DFT) B3LYP/6-311G(d,p) method. IR and Raman spectra of 3-NPM have been recorded and analyzed. The complete vibrational assignments are made on the basis of potential energy distribution (PED). The electric dipole moment, polarizability and the first order hyperpolarizability values of the 3-NPM have been calculated. 1H and 13C NMR chemical shifts are calculated by using the gauge independent atomic orbital (GIAO) method with B3LYP method with 6-311G (d,p) basis set. Moreover, molecular electrostatic potential (MEP) and thermodynamic properties are performed. Mulliken and Natural charges of the title molecule are also calculated and interpreted. Thermal decomposition behavior of 3-NPM has been studied by means of thermogravimetric analysis. The dielectric measurements on the powdered sample have been carried out and the variation of dielectric constant and dielectric loss at different frequencies of the applied field has been studied and the results are discussed in detail.
International Nuclear Information System (INIS)
Von Baeckmann, A.; Neuber, J.
1975-01-01
In analyzing fissile and/or fertile materials in the thorium, uranium, neptunium, plutonium, americium and curium group, time and accuracy are significant factors. An automated system for rapidly analyzing these materials includes: sample preparation device in which aliquots of sample are weighed and mixed with known amounts of solution; x-ray fluorescence spectrometer; and, a central control system for controlling the operation and analyzing the data. (auth)
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
Shi, Jingjing; Zhao, Guanguan; Wang, Xiaowei; Xu, H Eric; Yi, Wei
2014-09-21
A new and efficient method for the direct regioselective C2-amidation of various functionalized indoles with several N-(2,4,6-trichlorobenzoyloxy)amides via Rh(iii)-catalyzed C-H activation/N-O cleavage/C-N formation using the pyrimidyl group as a readily installable and removable directing group has been developed. With this method, a variety of valuable 2-amido indoles can be easily prepared under mild conditions with broad functional group tolerance and excellent region-/site-specificities. Application of this strategy to the synthesis of target compound as a novel PPARγ modulator was also demonstrated. The results from biological evaluation showed that compound had a partial PPARγ agonistic activity and a strong PPARγ binding affinity with an IC50 value of 120.0 nM, along with a less pronounced adipocyte differentiation ability compared to the currently marketed anti-diabetic drug rosiglitazone, suggesting that further development of such a compound might be of great interest.
Radioactivity studies. Progress report. Volume II
International Nuclear Information System (INIS)
Cohen, N.
1981-09-01
The metabolism of 243 244 Cm in nine adult female baboons following intravenous injection was studied. Curium-243,244 was administered as a single injection of curium citrate in dosages of 0.053 to 0.220 μCi/kg. The behavior of 243 244 Cm at these low dosages was quantitated by external whole-body and partial-body counting, bioassay of blood, urine and feces samples, liver biopsies, and post-mortem tissues analysis. Curium-243,244 rapidly passed from the blood to other tissues. At 1 and 24 h after injection, the amounts circulating were 10% and 1%, respectively. At 24 h after injection 70% of the 243 244 Cm was located within soft tissues, probably associated with extracellular fluid; the liver alone contained 32% of the injected activity. During the first weeks the content of 243 244 Cm in soft tissues decreased sharply. As time progressed, significant deposition was noted in the liver and the skeleton. Approximately 20% of the injected activity was in the liver at 1 month with a 40 day half-time. The skeleton reached a maximum burden of 57% by 100 days; the half-time observed in bone was 4 to 16 y. During the first 24 h, 10% of the injected activity appeared in the urine decreasing to 0.1%/day at 30 days and 0.01%/day at 200 days. Fecal excretion increased reaching a maximum level at four weeks. The amount of 243 244 Cm excreted in the feces during the initial 4 to 5 months (approx. 20%) and the rate of elimination in the feces after the first month paralleled the retention in the liver indicating an hepatic-biliary-fecal pathway. A model illustrating the interaction of seven internal compartments with respect to the translocation kinetics of 243 244 Cm was derived based upon this data. Solutions of the model were derived for two specific time-related exposures
New Developments in Actinides Burning with Symbiotic LWR-HTR-GCFR Fuel Cycles
International Nuclear Information System (INIS)
Bomboni, Eleonora
2008-01-01
The long-term radiotoxicity of the final waste is currently the main drawback of nuclear power production. Particularly, isotopes of Neptunium and Plutonium along with some long-lived fission products are dangerous for more than 100000 years. 96% of spent Light Water Reactor (LWR) fuel consists of actinides, hence it is able to produce a lot of energy by fission if recycled. Goals of Generation IV Initiative are reduction of long-term radiotoxicity of waste to be stored in geological repositories, a better exploitation of nuclear fuel resources and proliferation resistance. Actually, all these issues are intrinsically connected with each other. It is quite clear that these goals can be achieved only by combining different concepts of Gen. IV nuclear cores in a 'symbiotic' way. Light-Water Reactor - (Very) High Temperature Reactor ((V)HTR) - Fast Reactor (FR) symbiotic cycles have good capabilities from the viewpoints mentioned above. Particularly, HTR fuelled by Plutonium oxide is able to reach an ultra-high burn-up and to burn Neptunium and Plutonium effectively. In contrast, not negligible amounts of Americium and Curium build up in this core, although the total mass of Heavy Metals (HM) is reduced. Americium and Curium are characterised by an high radiological hazard as well. Nevertheless, at least Plutonium from HTR (rich in non-fissile nuclides) and, if appropriate, Americium can be used as fuel for Fast Reactors. If necessary, dedicated assemblies for Minor Actinides (MA) burning can be inserted in Fast Reactors cores. This presentation focuses on combining HTR and Gas Cooled Fast Reactor (GCFR) concepts, fuelled by spent LWR fuel and depleted uranium if need be, to obtain a net reduction of total mass and radiotoxicity of final waste. The intrinsic proliferation resistance of this cycle is highlighted as well. Additionally, some hints about possible Curium management strategies are supplied. Besides, a preliminary assessment of different chemical forms of
Epinette, J-A; Mertl, P; Combourieu, B; Goncalves, H; Blairon, A; Ehlinger, M; Tabutin, J
2015-10-01
The outcome of revision total hip arthroplasty (THA) for intra-pelvic cup protrusion is unclear. Hence, we conducted a large retrospective study to clarify the surgical strategy (hip lever arm and cup mechanical fixation) and the outcomes of reconstruction for severe intra-pelvic cup protrusion. We hypothesized that restoration of the anatomic hip centre in such acetabular revisions decreased the risk of recurrent loosening. The study included 246 THA procedures (in 220 patients), with a follow-up of 5.2 ± 4.9 years (1-24.2) after the index surgery. Bone loss was estimated using the SOFCOT classification (grade III or IV in 80% of cases) and the Paprosky classification (IIIA or IIIB in 58% of cases). Quality of the reconstruction was assessed on X-rays according to the correction of the protrusion and position of the hip centre of rotation. After a clinical follow-up of at least 5 years, with a mean of 9.9 ± 4.1 years (5-24 years), the mean Postel-Merle d'Aubigné score was 14.2 ± 3.1 and the mean Harris Hip Score was 78.0 ± 18.7. Cup protrusion was partially or completely corrected in every case and cup position was normal in 27 (11%) cases. The centre of rotation was within 10mm of the physiological position in 158 (64.2%) cases, acceptable in 77 (31.3%) cases, ascended in 9 (3.7%) cases, and worsened in 1 (0.4%) case. Revision for cup or cup and femoral failures was required in 24 (9.8%) cases. Cumulative survival rates with cup loosening as the endpoint were 88.5% after 5 years, 79.9% after 10 years, and 63.9% at last follow-up at 13.6 years. Our hypothesis that restoration of anatomic hip centre decreased the risk of recurrent loosening was not verified: success or failure in restoring the normal centre of rotation did not correlate significantly with final cup status. Recurrent aseptic loosening was the cause of failure in 9.8% of cases. Ensuring long-term effective mechanical stability had a greater impact on global outcomes than restoring an ideal
Directory of Open Access Journals (Sweden)
Dong Shao
2017-12-01
Full Text Available We herein reported the syntheses, crystal structures, and magnetic properties of a two-dimensional coordination polymer {[CoII(TPT2/3(H2O4][CH3COO]2·(H2O4}n (1 and a chain compound {[CoII(TPT2(CHOO2(H2O2]}n (2 based on the 2,4,6-Tris(4-pyridyl-1,3,5-triazine (TPT ligand. Structure analyses showed that complex 1 had a cationic hexagonal framework structure, while 2 was a neutral zig-zag chain structure with different distorted octahedral coordination environments. Magnetic measurements revealed that both complexes exhibit large easy-plane magnetic anisotropy with the zero-field splitting parameter D = 47.7 and 62.1 cm−1 for 1 and 2, respectively. This magnetic anisotropy leads to the field-induced slow magnetic relaxation behaviour. However, their magnetic dynamics are quite different; while complex 1 experienced a dominating thermally activated Orbach relaxation at the whole measured temperature region, 2 exhibited multiple relaxation pathways involving direct, Raman, and quantum tunneling (QTM processes at low temperatures and Orbach relaxation at high temperatures. The present complexes enlarge the family of framework-based single-ion magnets (SIMs and highlight the significance of the structural dimensionality to the final magnetic properties.
Smith, Richard W.; Vlahos, Penny; Böhlke, John Karl; Ariyarathna, Thivanka; Ballentine, Mark; Cooper, Christopher; Fallis, Stephen; Groshens, Thomas J.; Tobias, Craig
2015-01-01
2,4,6-Trinitrotoluene (TNT) has been used as a military explosive for over a hundred years. Contamination concerns have arisen as a result of manufacturing and use on a large scale; however, despite decades of work addressing TNT contamination in the environment, its fate in marine ecosystems is not fully resolved. Here we examine the cycling and fate of TNT in the coastal marine systems by spiking a marine mesocosm containing seawater, sediments, and macrobiota with isotopically labeled TNT (15N-[TNT]), simultaneously monitoring removal, transformation, mineralization, sorption, and biological uptake over a period of 16 days. TNT degradation was rapid, and we observed accumulation of reduced transformation products dissolved in the water column and in pore waters, sorbed to sediments and suspended particulate matter (SPM), and in the tissues of macrobiota. Bulk δ15N analysis of sediments, SPM, and tissues revealed large quantities of 15N beyond that accounted for in identifiable derivatives. TNT-derived N was also found in the dissolved inorganic N (DIN) pool. Using multivariate statistical analysis and a 15N mass balance approach, we identify the major transformation pathways of TNT, including the deamination of reduced TNT derivatives, potentially promoted by sorption to SPM and oxic surface sediments.
Directory of Open Access Journals (Sweden)
TAYYEBEH MADRAKIAN
2010-05-01
Full Text Available A preconcentration method was developed for the determination of trace amounts of Co, Ni, Cd and Zn by atomic absorption spectrometry. The method is based on the retention of the metal cations by naphthalene–2,4,6-trimorpholino-1,3,5-triazin adsorbent in a column. The adsorbed metals were then eluted from the column with hydrochloric acid and the Co, Ni, Cd and Zn were determined by flame atomic absorption spectrometry. The optimal extraction and elution conditions were studied. The effects of diverse ions on the preconcentration were also investigated. A preconcentration factor of 250 for Co(II, Ni(II and Zn(II, and 400 for Cd(II can easily be achieved. Calibration graphs were obtained and the detection limits of the method for Co(II, Ni(II, Cd(II and Zn(II were 0.51, 0.49, 0.17 and 0.10 ng mL-1, respectively. The relative standard deviations (RSD of 0.37–2.31 % for Co, 0.37–3.73 % for Ni, 2.20–2.40 % for Cd and 1.50–2.56 % for Zn were obtained. The method was also used for the simultaneous preconcentration of these elements and the method was successfully applied to their preconcentration and determination. The method was applied to the determination of Co, Ni, Cd and Zn in several real samples.
Removal of americium and curium from high-level wastes
International Nuclear Information System (INIS)
Bond, W.D.; Leuze, R.E.
1979-01-01
The DHDECMP process was demonstrated to give a 99.5% removal of actinides from actual HLLW in small-scale, batch extraction tests. Results from cold tests indicate that it may be possible to carry out the oxalate precipitation step of the OPIX process continuously. About 90% recovery of the trivalent actinides and lanthanides can be achieved in the continuous precipitation. the presence of zirconium impurity in feed solutions to Talspeak process at concentrations of 10 -4 M (0.5% of the Zr in the original waste) affected phase separations but equipment could be operated satisfactory in cold tests. Zirconium concentrations of 10 -3 M seriously affected phase separations and substantial quantities of interfacial cruds were formed. Modest concentrations (0.006 M or less) of H 2 MEHP, a suspected degradation product of HDEHP, did not effect separation factors. The presence of impurities derived from the thermal degradation of DHDECMP did not inhibit the loading of the trivalent actinide and lanthanide elements in the cation exchange chromatographic process for their separation. It appears that the biodentate (DHDECMP) solvent extraction process and the OPIX process are the leading candidate process for the co-removal of trivalent actinide and lanthanide elements from HLLW. The cation exchange chromatography and the Talspeak processes, are the leading candidate processes for the subsequent separation of actinides and lanthanides. The bidentate and cation exchange processes are further along in their development than the other processes and are currently considered the reference processes for the partitioning of Am-Cm from HLLW. 4 figures, 4 tables
A bioassay method for americium and curium in feces
International Nuclear Information System (INIS)
Alexandre Gagne; Dominic Lariviere; Joel Surette; Sheila Kramer-Tremblay; Xiongxin Dai; Candice Didychuk
2013-01-01
Fecal radiobioassay is an essential and sensitive tool to estimate the internal intake of actinides after a radiological incident. A new fecal analysis method, based on lithium metaborate fusion of fecal ash for complete sample dissolution followed by sequential column chromatography separation of actinides, has been developed for the determination of low-level Am and Cm in a large size sample. Spiked synthetic fecal samples were analyzed to evaluate method performance against the acceptance criteria for radiobioassay as defined by ANSI N13.30; both satisfactory accuracy and repeatability were achieved. This method is a promising candidate for reliable dose assessment of low level actinide exposure to meet the regulatory requirements of routine radiobioassay for nuclear workers and the public. (author)
Ceco, Ema; Önnerud, Hans; Menning, Dennis; Gilljam, John L.; Bââth, Petra; Östmark, Henric
2014-05-01
The following paper presents a realistic forensic capability test of an imaging Raman spectroscopy based demonstrator system, developed at FOI, the Swedish Defence Research Agency. The system uses a 532 nm laser to irradiate a surface of 25×25mm. The backscattered radiation from the surface is collected by an 8" telescope with subsequent optical system, and is finally imaged onto an ICCD camera. We present here an explosives trace analysis study of samples collected from a realistic scenario after a detonation. A left-behind 5 kg IED, based on ammonium nitrate with a TNT (2,4,6-trinitrotoluene) booster, was detonated in a plastic garbage bin. Aluminum sample plates were mounted vertically on a holder approximately 6 m from the point of detonation. Minutes after the detonation, the samples were analyzed with stand-off imaging Raman spectroscopy from a distance of 10 m. Trace amounts could be detected from the secondary explosive (ammonium nitrate with an analysis time of 1 min. Measurement results also indicated detection of residues from the booster (TNT). The sample plates were subsequently swabbed and analyzed with HPLC and GC-MS analyses to confirm the results from the stand-off imaging Raman system. The presented findings indicate that it is possible to determine the type of explosive used in an IED from a distance, within minutes after the attack, and without tampering with physical evidence at the crime scene.
Directory of Open Access Journals (Sweden)
Qiao Yu
Full Text Available Sinomenine, a pure alkaloid isolated in Chinese medicine from the root of Sinomenium acutum, has been demonstrated to have anti-inflammatory and immunosuppressive effects. MicroRNAs (miRNAs are gradually being recognized as critical mediators of disease pathogenesis via coordinated regulation of molecular effector pathways.After colitis was induced in mice by instillation of 5% (w/v 2,4,6-trinitrobenzenesulfonic acid (TNBS, sinomenine at a dose of 100 or 200 mg/kg was orally administered once daily for 7 days. We evaluated body weight, survival rate, diarrhea score, histological score and myeloperoxidase (MPO activity. The mRNA and protein expression levels of miR-155, c-Maf, TNF-α and IFN-γ were determined by quantitative RT-PCR and immunohistochemistry, respectively. Sinomenine (100 or 200 mg/kg-treated mice with TNBS-induced colitis were significantly improved in terms of body weight, survival rate, diarrhea score, histological score and MPO activity compared with untreated mice. Both dosages of sinomenine significantly decreased the mRNA and protein expression levels of c-Maf, TNF-α and IFN-γ, which elevated in TNBS-induced colitis. Furthermore, sinomenine at a dose of 200 mg/kg significantly decreased the level of miR-155 expression by 71% (p = 0.025 compared with untreated TNBS-induced colitis in mice.Our study evaluated the effects and potential mechanisms of sinomenine in the anti-inflammatory response via miRNA-155 in mice with TNBS-induced colitis. Our findings suggest that sinomenine has anti-inflammatory effects on TNBS-induced colitis by down-regulating the levels of miR-155 and several related inflammatory cytokines.
International Nuclear Information System (INIS)
Zhu, Qingwei; Zhang, Yihe; Lv, Fengzhu; Chu, Paul K.; Ye, Zhengfan; Zhou, Fengshan
2012-01-01
Highlights: ► Cu 2 O crystals were firstly created on the natural sepiolite fibers. ► The structures of the sepiolite are altered when acidized, benefiting the immobility of cuprous oxide crystals. ► The carrier sepiolite improves efficiently the photocatalytic activity of cuprous oxide crystals. ► Cu 2 O/sepiolite composites show superior photocatalytic activity for the degradation of red water. - Abstract: Cuprous oxide is firstly created on acidized sepiolite (AS) by a simple deposition method for photocatalytic degradation of the red water produced from 2,4,6-trinitrotoluene (TNT) manufacturing. X-ray diffraction (XRD), field-emission scanning electron microscopy (FE-SEM), ultraviolet-visible diffuse reflection absorptive spectroscopy (UV–vis/DRS), and Fourier transform infrared (FT-IR) spectroscopy are used to characterize the photocatalyst composites. Gas chromatography/mass spectrometry (GC/MS) is employed to determine the organic constituents in the red water. The results show that the cuprous oxide particles can be immobilized on the surface of the AS fibers and the structure of the AS is altered when cuprous oxide interacts with AS via chemical reactions besides physical adsorption. The AS improves the optical properties of cuprous oxide and red-shifts the band gap thereby enhancing the utilization of visible light. The Cu 2 O/AS composites demonstrate excellent photocatalytic performance in the degradation of red water. 87.0% of red water can be photocatalytically degraded by Cu 2 O/AS after illumined for 5 h and a majority of organic components of red water except 1,3,5-trinitrobenzene were degraded according to GC–MS analysis.
Gumuscu, Burcu; Erdogan, Zeynep; Guler, Mustafa O; Tekinay, Turgay
2014-01-01
In this work, a new detection method for complete separation of 2,4,6-trinitrotoluene (TNT); 2,4-dinitrotoluene (2,4-DNT); 2,6-dinitrotoluene (2,6-DNT); 2-aminodinitrotoluene (2-ADNT) and 4-aminodinitrotoluene (4-ADNT) molecules in high-performance liquid-chromatography (HPLC) with UV sensor has been developed using diol column. This approach improves on cost, time, and sensitivity over the existing methods, providing a simple and effective alternative. Total analysis time was less than 13 minutes including column re-equilibration between runs, in which water and acetonitrile were used as gradient elution solvents. Under optimized conditions, the minimum resolution between 2,4-DNT and 2,6-DNT peaks was 2.06. The recovery rates for spiked environmental samples were between 95-98%. The detection limits for diol column ranged from 0.78 to 1.17 µg/L for TNT and its byproducts. While the solvent consumption was 26.4 mL/min for two-phase EPA and 30 mL/min for EPA 8330 methods, it was only 8.8 mL/min for diol column. The resolution was improved up to 49% respect to two-phase EPA and EPA 8330 methods. When compared to C-18 and phenyl-3 columns, solvent usage was reduced up to 64% using diol column and resolution was enhanced approximately two-fold. The sensitivity of diol column was afforded by the hydroxyl groups on polyol layer, joining the formation of charge-transfer complexes with nitroaromatic compounds according to acceptor-donor interactions. Having compliance with current requirements, the proposed method demonstrates sensitive and robust separation.
Computation of actinide pourbaix diagrams at 298 K and 550 K (U,Np,Pu,Am,Cm - H{sub 2}O)
Energy Technology Data Exchange (ETDEWEB)
Piro, M.H.; Bruni, G.M.F.; Lewis, B.J.; Thompson, W.T., E-mail: thompson-w@rmc.ca [Royal Military College of Canada, Dept. of Chemistry and Chemical Engineering, Kingston, Ontario (Canada); Iglesias, F.C. [Candesco Corp., Toronto, Ontario (Canada); Guoping, M.A.; Nashiem, R. [Bruce Power Limited., Tiverton, Ontario (Canada); Roberts, J.G. [Cantech Associates Limited, Burlington, Ontario (Canada)
2011-07-01
Pourbaix diagrams for the actinides ranging from uranium to curium have been developed from the enthalpy of formation, entropy and heat capacity (or estimates thereof) for the phases and aqueous species. Emphasis has been given to the region between hydrogen and oxygen gas saturation.Additional thermodynamic computations illustrate how the data may be employed in better understanding the chemical behaviour of fuel debris circulating in CANDU reactor coolant. (author)
Analog elements for transuranic chemistries
International Nuclear Information System (INIS)
Weimer, W.C.
1982-01-01
The analytical technique for measuring trace concentrations of the analog rare earth elements has been refined for optimal detection. The technique has been used to determine the rare earth concentrations in a series of geological and biological materials, including samples harvested from controlled lysimeter investigations. These studies have demonstrated that any of the trivalent rare earth elements may be used as analog elements for the trivalent transuranics, americium and curium
International Nuclear Information System (INIS)
Holden, N.E.; Zucker, M.S.
1984-01-01
In response to a need of the safeguards community, we have begun an evaluation effort to upgrade the recommended values of the prompt neutron emission multiplicity distribution, P/sub nu/ and its average value, nubar. This paper will report on progress achieved thus far. The evaluation of the uranium, plutonium, americium and curium nuclide's nubar values will be presented. The recommended values will be given and discussed. 61 references
The uptake of radionuclides by plants
International Nuclear Information System (INIS)
Cawse, P.A.; Turner, G.S.
1982-02-01
A review of the literature, since 1970, on the research into the uptake of radionuclides by plants, with references to earlier soil and plant studies on the fate of nuclear weapons fallout. Experimental data on the uptake of plutonium isotopes, americium 241, cesium 137, radium 226, curium 244 and neptunium 237 and details of the chemical form of the radionuclide, soil type and plant growth period are tabulated. (U.K.)
Polunin, Ruslan A; Burkovskaya, Nataliya P; Satska, Juliya A; Kolotilov, Sergey V; Kiskin, Mikhail A; Aleksandrov, Grigory G; Cador, Olivier; Ouahab, Lahcène; Eremenko, Igor L; Pavlishchuk, Vitaly V
2015-06-01
One-dimensional coordination polymer [Co(Piv)2(4-ptz)(C2H5OH)2]n (compound 1, Piv(-) = pivalate, 4-ptz = 2,4,6-tris(4-pyridyl)-1,3,5-triazine) was synthesized by interaction of Co(II) pivalate with 4-ptz. Desolvation of 1 led to formation of [Co(Piv)2(4-ptz)]n (compound 2), which adsorbed N2 and H2 at 78 K as a typical microporous sorbent. In contrast, absorption of methanol and ethanol by 2 at 295 K led to structural transformation probably connected with coordination of these alcohols to Co(II). Formation of 2 from 1 was accompanied by change of color of sample from orange to brown and more than 2-fold decrease of molar magnetic susceptibility (χM) in the temperature range from 2 to 300 K. Resolvation of 2 by ethanol or water resulted in restoration of spectral characteristics and χM values almost to the level of that of 1. χMT versus T curves for 1 and samples, obtained by resolvation of 2 by H2O or C2H5OH, were fitted using a model for Co(II) complex with zero-field splitting of this ion.
Directory of Open Access Journals (Sweden)
Nagula
2015-10-01
Full Text Available INTRODUCTION: Post - operative restlessness is observed commonly among children following Ear Nose Throat surgeries. This post anesthetic problem is also termed as Emergence Agitation (EA which interferes with patient’s recovery, presenting a challenging task to the ane sthetist in terms of assessment and convincing the parents. Many factors play a role singly or in combination in producing EA. EA consist of restlessness, excessive crying and spells of breath holding, head banging and incoherent speech. In this prospectiv e clinical study the incidence of post - operative recovery restlessness EA in children aged between 3 to 12 years, enumeration of the causes, and prediction of EA in Indian population. MATERIALS AND METHODS: 246 Children undergoing elective surgeries of Ear Nose and throat are selected and their demographic data, socio - economic back ground and emotional attachment with parents were elicited. Parents of the children were interviewed prior to surgery using a questionnaire enquiring of their children’s personal ity, and emotional attachment and meekness. Their preoperative clinical data are documented. Their post - operative general condition, behavior, time taken for awakening, period of total recovery and treatment factors are recorded and analyzed. RESULTS: The incidence of EA was found in 23.6% of the children. EA lasted between 21 minutes to 52 minutes with a mean period of 28.4±9.5 minutes. 67% of the children required medication with sedatives, analgesics and anti - emetics. Post - operative stay in the Surgical ICU ranged between Hrs . 3.12±0.36mts to Hrs . 8.39±2.10mts in the children showing restlessness, compared to those not showing agitation. CONCLUSIONS: The factors associated with EA were, age, emotional attachment, meekness, adaptability, previous surgery, analgesics, sedatives, dose of pentothal sodium for induction, time taken for awakening and duration of surgery. Shorter was the time of awakening
NEW METHOD FOR DETERMINATION OF ACTINIDES AND STRONTIUM IN ANIMAL TISSUE
Energy Technology Data Exchange (ETDEWEB)
Maxwell, S; Jay Hutchison, J; Don Faison, D
2007-05-07
The analysis of actinides in animal tissue samples is very important for environmental monitoring. There is a need to measure actinide isotopes with very low detection limits in animal tissue samples, including fish, deer, hogs, beef and shellfish. A new, rapid actinide separation method has been developed and implemented that allows the measurement of plutonium, neptunium, uranium, americium, curium and strontium isotopes in large animal tissue samples (100-200 g) with high chemical recoveries and effective removal of matrix interferences. This method uses stacked TEVA Resin{reg_sign}, TRU Resin{reg_sign} and DGA-Resin{reg_sign} cartridges from Eichrom Technologies (Darien, IL, USA) that allows the rapid separation of plutonium (Pu), neptunium (Np), uranium (U), americium (Am), and curium (Cm) using a single multi-stage column combined with alpha spectrometry. Sr-90 is collected on Sr Resin{reg_sign} from Eichrom Technologies (Darien, IL, USA). After acid digestion and furnace heating of the animal tissue samples, the actinides and Sr-89/90 are separated using column extraction chromatography. This method has been shown to be effective over a wide range of animal tissue matrices. By using vacuum box cartridge technology with rapid flow rates, sample preparation time is minimized.
First calorimetric determination of heat of extraction of 248Cm in a bi-phasic system
International Nuclear Information System (INIS)
Martin, Leigh R.; Zalupski, Peter R.
2011-01-01
This report presents a summary of the work performed to meet FCR and D level 2 milestone M21SW050201, 'Complete the first calorimetric determination of heat of extraction of 248Cm in a bi-phasic system'. This work was carried out under the auspices of the Thermodynamics and Kinetics FCR and D work package. To complement previous work undertaken under this work package we have extended out heat of extraction studies by di-2-ethyl-hexyl-phosphoric acid to curium. This report also details the heat of extraction of samarium in the same system. This work was performed to not only test the methodology but also to check for consistency with the heats of extraction obtained with those in the prior literature. The heat of extraction for samarium that was obtained in this study was -9.6 kJ mol-1, which is in reasonable agreement with the previously obtained value of -10.9 kJ mol-1. The curium heat of extraction was performed under two sets of conditions and the obtained heats of extraction were in reasonable agreement with each other at -16.0 ± 1.1 and -16.8 ± 1.5 kJ mol-1.
Garcia, Ana R; Lopes, Luís F; Brito de Barros, Ricardo; Ilharco, Laura M
2015-01-14
Attenuated total reflection infrared spectroscopy (ATR-IR) proved to be a promising detection technique for 2,4,6-trichloroanisole (TCA), which confers organoleptic defects to bottled alcoholic beverages, allowing the proposal of a criterion for cork plank acceptance when meant for stopper production. By analysis of a significant number of samples, it was proved that the presence of TCA, even in very low concentrations, imparts subtle changes to the cork spectra, namely, the growth of two new bands at ∼1417 (νC═C of TCA ring) and 1314 cm–1 (a shifted νCC of TCA) and an increase in the relative intensities of the bands at ∼1039 cm–1 (δCO of polysaccharides) and ∼813 cm–1 (τCH of suberin), the latter by overlapping with intense bands of TCA. These relative intensities were evaluated in comparison to a fingerprint of suberin (νasC–O–C), at 1161 cm–1. On the basis of those spectral variables, a multivariate statistics linear analysis (LDA) was performed to obtain a discriminant function that allows classifying the samples according to whether they contain or not TCA. The methodology proposed consists of a demanding acceptance criterion for cork planks destined for stopper production (with the guarantee of nonexistence of TCA) that results from combining the quantitative results with the absence of the two TCA correlated bands. ATR infrared spectroscopy is a nondestructive and easy to apply technique, both on cork planks and on stoppers, and has proven more restrictive than other techniques used in the cork industry that analyze the cleaning solutions. At the level of proof of concept, the method here proposed is appealing for high-value stopper applications.
State-of-art technology of fuels for burning minor actinides. An OECD/NEA study
International Nuclear Information System (INIS)
Ogawa, Toru; Konings, R.J.M.; Pillon, S.; Schram, R.P.C.; Verwerft, M.; Wallenius, J.
2005-01-01
At OECD/NEA, Working Party on Scientific Issues in Partitioning and Transmutation was formed for 2000-2004, which studied the status and trends of scientific issues in Partitioning and Transmutation (P and T). The study included the scientific and technical issues of fuels and materials, which are related to dedicated systems for transmutation. This paper summarizes the state-of-art technology of the fuels for burning minor actinides (neptunium, americium and curium). (author)
Gumuscu, Burcu; Erdogan, Zeynep; Guler, Mustafa O.; Tekinay, Turgay
2014-01-01
In this work, a new detection method for complete separation of 2,4,6-trinitrotoluene (TNT); 2,4-dinitrotoluene (2,4-DNT); 2,6-dinitrotoluene (2,6-DNT); 2-aminodinitrotoluene (2-ADNT) and 4-aminodinitrotoluene (4-ADNT) molecules in high-performance liquid-chromatography (HPLC) with UV sensor has been developed using diol column. This approach improves on cost, time, and sensitivity over the existing methods, providing a simple and effective alternative. Total analysis time was less than 13 minutes including column re-equilibration between runs, in which water and acetonitrile were used as gradient elution solvents. Under optimized conditions, the minimum resolution between 2,4-DNT and 2,6-DNT peaks was 2.06. The recovery rates for spiked environmental samples were between 95–98%. The detection limits for diol column ranged from 0.78 to 1.17 µg/L for TNT and its byproducts. While the solvent consumption was 26.4 mL/min for two-phase EPA and 30 mL/min for EPA 8330 methods, it was only 8.8 mL/min for diol column. The resolution was improved up to 49% respect to two-phase EPA and EPA 8330 methods. When compared to C-18 and phenyl-3 columns, solvent usage was reduced up to 64% using diol column and resolution was enhanced approximately two-fold. The sensitivity of diol column was afforded by the hydroxyl groups on polyol layer, joining the formation of charge-transfer complexes with nitroaromatic compounds according to acceptor-donor interactions. Having compliance with current requirements, the proposed method demonstrates sensitive and robust separation. PMID:24905826
Directory of Open Access Journals (Sweden)
Burcu Gumuscu
Full Text Available In this work, a new detection method for complete separation of 2,4,6-trinitrotoluene (TNT; 2,4-dinitrotoluene (2,4-DNT; 2,6-dinitrotoluene (2,6-DNT; 2-aminodinitrotoluene (2-ADNT and 4-aminodinitrotoluene (4-ADNT molecules in high-performance liquid-chromatography (HPLC with UV sensor has been developed using diol column. This approach improves on cost, time, and sensitivity over the existing methods, providing a simple and effective alternative. Total analysis time was less than 13 minutes including column re-equilibration between runs, in which water and acetonitrile were used as gradient elution solvents. Under optimized conditions, the minimum resolution between 2,4-DNT and 2,6-DNT peaks was 2.06. The recovery rates for spiked environmental samples were between 95-98%. The detection limits for diol column ranged from 0.78 to 1.17 µg/L for TNT and its byproducts. While the solvent consumption was 26.4 mL/min for two-phase EPA and 30 mL/min for EPA 8330 methods, it was only 8.8 mL/min for diol column. The resolution was improved up to 49% respect to two-phase EPA and EPA 8330 methods. When compared to C-18 and phenyl-3 columns, solvent usage was reduced up to 64% using diol column and resolution was enhanced approximately two-fold. The sensitivity of diol column was afforded by the hydroxyl groups on polyol layer, joining the formation of charge-transfer complexes with nitroaromatic compounds according to acceptor-donor interactions. Having compliance with current requirements, the proposed method demonstrates sensitive and robust separation.
Shakya, K. M.; Sarkar, D.; Datta, R.; Makris, K.; Pachanoor, D.
2006-05-01
2,4,6-Trinitrotoluene(TNT) is a potent mutagen and a Group C human carcinogen that has been widely used to produce munitions and explosives. As a result, vast areas that have been previously used as military ranges, munition burning and open detonation sites have been heavily contaminated with TNT. Conventional remedial activities in such contaminated sites commonly rely on methods such as incineration, land filling and soil composting. Phytoremediation offers a cost-effective solution, utilizing plants to phytoextract TNT from the contaminated soil. We propose the use of vetiver grass (Vetiveria zizanoides) to remove TNT from such contaminated soils. Vetiver is a fast-growing and adaptive grass, enabling its use in TNT-contaminated sites in a wide variety of soil types and climate. We also hypothesized that TNT removal by vetiver grass will be enhanced by utilizing a chaotropic agent (urea) to alter rhizosphere/root hair chemical environment. The objectives of this preliminary hydroponic study were: i) to investigate the effectiveness of vetiver grass in removing TNT from solution, and ii) to evaluate the use of a common agrochemical (urea) in enhancing TNT removal by vetiver grass. Vetiver plants were grown in a hydroponic system with five different TNT concentrations (0, 5, 10, 25, and 50 mg TNT L-1) and three urea concentrations (0, 0.01 and 0.1%). A plant density of 10 g L-1 and three replicate vessels per treatment were used. Aliquots were collected at several time intervals up to 192 hour, and were analyzed for TNT with HPLC. Results showed that vetiver was able to remove TNT from hydroponic solutions. The overall magnitude and kinetics of TNT removal by vetiver grass was enhanced in the presence of urea. TNT removal kinetics depended on TNT and urea initial concentrations, suggestive of second-order kinetic reactions. Preliminary results are encouraging, but in need for verification using more detailed studies involving TNT-contaminated soils. Ongoing
Sangeetha, V.; Govindarajan, M.; Kanagathara, N.; Marchewka, M. K.; Drozd, M.; Anbalagan, G.
2013-12-01
New organic crystals of 2,4,6-triamino-1,3,5-triazin-1-ium 3-(prop-2-enoyloxy) propanoate acrylic acid monosolvate monohydrate (MAC) have been obtained from aqueous solution by the slow solvent evaporation method at room temperature. Single crystal X-ray diffraction analysis reveals that the compound crystallises in the triclinic system with centrosymmetric space group P-1. FT-IR and FT-Raman spectra of MAC have been recorded and analyzed. The molecular geometry and vibrational frequencies and intensity of the vibrational bands are interpreted with the aid of structure optimization based on density functional theory (DFT) B3LYP method with 6-31G(d,p) basis set. The results of the optimized molecular structure are presented and compared with the experimental X-ray diffraction data. The theoretical results show that the optimized geometry can well reproduce the crystal structure, and the calculated vibrational frequency values show good agreement with experimental values. A study of the electronic properties, such as HOMO and LUMO energies and Molecular electrostatic potential (MEP) were performed. Mulliken charges and NBO charges of the title molecule were also calculated and interpreted. Thermogravimetric analysis has been done to study the thermal behaviour of MAC. The 13C and 1H nuclear magnetic resonance (NMR) chemical shifts of the molecule are calculated by the gauge independent atomic orbital (GIAO) method and compared with experimental results.
Directory of Open Access Journals (Sweden)
Seiya Nagao
2011-12-01
Full Text Available The influence of halogen substituents on the catalytic oxidation of 2,4,6-trihalogenated phenols (TrXPs by iron(III-porphyrin/KHSO5 catalytic systems was investigated. Iron(III-5,10,15,20-tetrakis(p-hydroxyphenylporphyrin (FeTHP and its supported variants were employed, where the supported catalysts were synthesized by introducing FeTHP into hydroquinone-derived humic acids via formaldehyde poly-condensation. F (TrFP, Cl (TrCP, Br (TrBP and I (TrIP were examined as halogen substituents for TrXPs. Although the supported catalysts significantly enhanced the degradation and dehalogenation of TrFP and TrCP, the oxidation of TrBP and TrIP was not enhanced, compared to the FeTHP catalytic system. These results indicate that the degree of oxidation of TrXPs is strongly dependent on the types of halogen substituent. The order of dehalogenation levels for halogen substituents in TrXPs was F > Cl > Br > I, consistent with their order of electronegativity. The electronegativity of a halogen substituent affects the nucleophilicity of the carbon to which it is attached. The levels of oxidation products in the reaction mixtures were analyzed by GC/MS after extraction with n-hexane. The most abundant dimer product from TrFP via 2,6-difluoroquinone is consistent with a scenario where TrXP, with a more electronegative halogen substituent, is readily oxidized, while less electronegative halogen substituents are oxidized less readily by iron(III-porphyrin/KHSO5 catalytic systems.
Analysis of Americium in Transplutonium Process Solutions
International Nuclear Information System (INIS)
Ferguson, R.B.
2001-01-01
One of the more difficult analyses in the transplutonium field is the determination of americium at trace levels in a complex matrix such as a process dissolver solution. Because of these conditions a highly selective separation must precede the measurement of americium. The separation technique should be mechanically simple to permit remote operation with master-slave manipulators. For subsequent americium measurement by the mass spectroscopic isotopic-dilution technique, plutonium and curium interferences must also have been removed
Recent solvent extraction experience at Savannah River
International Nuclear Information System (INIS)
Gray, L.W.; Burney, G.A.; Gray, J.H.; Hodges, M.E.; Holt, D.L.; Macafee, I.M.; Reif, D.J.; Shook, H.E.
1986-01-01
Tributyl phosphate-based solvent extraction processes have been used at Savannah River for more than 30 years to separate and purify thorium, uranium, neptunium, plutonium, americium, and curium isotopes. This report summarizes the advancement of solvent extraction technology at Savannah River during the 1980's. Topics that are discussed include equipment improvements, solvent treatment, waste reduction, and an improved understanding of the various chemistries in the process streams entering, within, and leaving the solvent extraction processes
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
Marshalkin, V. Ye.; Povyshev, V. M.
2017-12-01
It is shown for a closed thorium-uranium-plutonium fuel cycle that, upon processing of one metric ton of irradiated fuel after each four-year campaign, the radioactive wastes contain 54 kg of fission products, 0.8 kg of thorium, 0.10 kg of uranium isotopes, 0.005 kg of plutonium isotopes, 0.002 kg of neptunium, and "trace" amounts of americium and curium isotopes. This qualitatively simplifies the handling of high-level wastes in nuclear power engineering.
1985-01-01
thle early life * of" the system. Figure 4-2 shows the variation in power output for polonium - 210 (Po- 210 ) with a 138-day half-life, curium-242 (Cm...miles above the earth’s surface. Above this altitude they must take everything they need with them. The environment will supply them with neither food ...can move large payloads through space. The radioisotope heat cycle engines use high-energy particle sources such as plutonium and polonium . The walls
International Nuclear Information System (INIS)
Vestner, Jochen; Fritsch, Stefanie; Rauhut, Doris
2010-01-01
The aim of this research work was focused on the replacement of the time-consuming soaking of cork stoppers which is mainly used as screening method for cork lots in connection with sensory analysis and/or analytical methods to detect releasable 2,4,6-trichloroanisole (TCA) of natural cork stoppers. Releasable TCA from whole cork stoppers was analysed with the application of a microwave assisted extraction method (MAE) in combination with stir bar sorptive extraction (SBSE). The soaking of corks (SOAK) was used as a reference method to optimise MAE parameters. Cork lots of different quality and TCA contamination levels were used to adapt MAE. Pre-tests indicated that an MAE at 40 deg. C for 120 min with 90 min of cooling time are suitable conditions to avoid an over-extraction of TCA of low and medium tainted cork stoppers in comparison to SOAK. These MAE parameters allow the measuring of almost the same amounts of releasable TCA as with the application of the soaking procedure in the relevant range ( -1 releasable TCA from one cork) to evaluate the TCA level of cork stoppers. Stable isotope dilution assay (SIDA) was applied to optimise quantification of the released TCA with deuterium-labelled TCA (TCA-d 5 ) using a time-saving GC-MS technique in single ion monitoring (SIM) mode. The developed MAE method allows the measuring of releasable TCA from the whole cork stopper under improved conditions and in connection with a low use of solvent and a higher sample throughput.
Vestner, Jochen; Fritsch, Stefanie; Rauhut, Doris
2010-02-15
The aim of this research work was focused on the replacement of the time-consuming soaking of cork stoppers which is mainly used as screening method for cork lots in connection with sensory analysis and/or analytical methods to detect releasable 2,4,6-trichloroanisole (TCA) of natural cork stoppers. Releasable TCA from whole cork stoppers was analysed with the application of a microwave assisted extraction method (MAE) in combination with stir bar sorptive extraction (SBSE). The soaking of corks (SOAK) was used as a reference method to optimise MAE parameters. Cork lots of different quality and TCA contamination levels were used to adapt MAE. Pre-tests indicated that an MAE at 40 degrees C for 120 min with 90 min of cooling time are suitable conditions to avoid an over-extraction of TCA of low and medium tainted cork stoppers in comparison to SOAK. These MAE parameters allow the measuring of almost the same amounts of releasable TCA as with the application of the soaking procedure in the relevant range (cork) to evaluate the TCA level of cork stoppers. Stable isotope dilution assay (SIDA) was applied to optimise quantification of the released TCA with deuterium-labelled TCA (TCA-d(5)) using a time-saving GC-MS technique in single ion monitoring (SIM) mode. The developed MAE method allows the measuring of releasable TCA from the whole cork stopper under improved conditions and in connection with a low use of solvent and a higher sample throughput. Copyright 2009 Elsevier B.V. All rights reserved.
Yum, Hye-Won; Kang, Jing X; Hahm, Ki Baik; Surh, Young-Joon
2017-06-10
Omega-3 (ω-3) polyunsaturated fatty acids (PUFAs) are known to have strong anti-inflammatory effects. In the present study, we investigated the protective effects of ω-3 PUFAs on experimentally induced murine colitis. Intrarectal administration of 2.5% 2,4,6-trinitrobenzene sulfonic acid (TNBS) caused inflammation in the colon of wild type mice, but this was less severe in fat-1 transgenic mice that constitutively produce ω-3 PUFAs from ω-6 PUFAs. The intraperitoneal administration of docosahexaenoic acid (DHA), a representative ω-3 PUFA, was also protective against TNBS-induced murine colitis. In addition, endogenously formed and exogenously introduced ω-3 PUFAs attenuated the production of malondialdehyde and 4-hydroxynonenal in the colon of TNBS-treated mice. The effective protection against inflammatory and oxidative colonic tissue damages in fat-1 and DHA-treated mice was associated with suppression of NF-κB activation and cyclooxygenase-2 expression and with elevated activation of Nrf2 and upregulation of its target gene, heme oxygenase-1. Taken together, these results provide mechanistic basis of protective action of ω-3 fatty PUFAs against experimental colitis. Copyright © 2017. Published by Elsevier Inc.
Vauchy, Romain; Belin, Renaud C; Robisson, Anne-Charlotte; Lebreton, Florent; Aufore, Laurence; Scheinost, Andreas C; Martin, Philippe M
2016-03-07
Innovative americium-bearing uranium-plutonium mixed oxides U1-yPuyO2-x are envisioned as nuclear fuel for sodium-cooled fast neutron reactors (SFRs). The oxygen-to-metal (O/M) ratio, directly related to the oxidation state of cations, affects many of the fuel properties. Thus, a thorough knowledge of its variation with the sintering conditions is essential. The aim of this work is to follow the oxidation state of uranium, plutonium, and americium, and so the O/M ratio, in U0.750Pu0.246Am0.004O2-x samples sintered for 4 h at 2023 K in various Ar + 5% H2 + z vpm H2O (z = ∼ 15, ∼ 90, and ∼ 200) gas mixtures. The O/M ratios were determined by gravimetry, XAS, and XRD and evidenced a partial oxidation of the samples at room temperature. Finally, by comparing XANES and EXAFS results to that of a previous study, we demonstrate that the presence of uranium does not influence the interactions between americium and plutonium and that the differences in the O/M ratio between the investigated conditions is controlled by the reduction of plutonium. We also discuss the role of the homogeneity of cation distribution, as determined by EPMA, on the mechanisms involved in the reduction process.
Fission-product yields for thermal-neutron fission of curium-243
International Nuclear Information System (INIS)
Breederland, D.G.
1982-01-01
Cumulative fission yields for 25 gamma rays emitted during the decay of 23 fission products produced by thermal-neutron fission of 243 Cm have been determined. Using Ge(Li) spectroscopy, 33 successive pulse-height spectra of gamma rays emitted from a 77-ng sample of 243 Cm over a period of approximately two and one-half months were analyzed. Reduction of these spectra resulted in the identification and matching of gamma-ray energies and half-lives to specific radionuclides. Using these results, 23 cumulative fission-product yields were calculated. Only those radionuclides having half-lives between 6 hours and 65 days were observed. Prior to this experiment, no fission-product yields had been recorded for 243 Cm
LARGE SCALE METHOD FOR THE PRODUCTION AND PURIFICATION OF CURIUM
Higgins, G.H.; Crane, W.W.T.
1959-05-19
A large-scale process for production and purification of Cm/sup 242/ is described. Aluminum slugs containing Am are irradiated and declad in a NaOH-- NaHO/sub 3/ solution at 85 to 100 deg C. The resulting slurry filtered and washed with NaOH, NH/sub 4/OH, and H/sub 2/O. Recovery of Cm from filtrate and washings is effected by an Fe(OH)/sub 3/ precipitation. The precipitates are then combined and dissolved ln HCl and refractory oxides centrifuged out. These oxides are then fused with Na/sub 2/CO/sub 3/ and dissolved in HCl. The solution is evaporated and LiCl solution added. The Cm, rare earths, and anionic impurities are adsorbed on a strong-base anfon exchange resin. Impurities are eluted with LiCl--HCl solution, rare earths and Cm are eluted by HCl. Other ion exchange steps further purify the Cm. The Cm is then precipitated as fluoride and used in this form or further purified and processed. (T.R.H.)
Americium-Curium Stabilization - 5'' Cylindrical Induction Melter System Design Basis
International Nuclear Information System (INIS)
Witt, D.C.
1999-01-01
Approximately 11,000 liters (3,600) gallons of solution containing isotopes of Am and Cm are currently stored in F-Canyon Tank 17.1. These isotopes were recovered during plutonium-242 production campaigns in the mid- and late-1970s. Experimental work for the project began in 1995 by the Savannah River Technology Center (SRTC). Details of the process are given in the various sections of this document
International Nuclear Information System (INIS)
Demaziere, C.
1999-01-01
This report is a part of the project titled 'Boiling Water Reactors With Uranium-Plutonium Mixed Oxide (MOx) Fuel'. The aim of this study is to model the impact of a core loading pattern containing MOx bundles upon the main characteristics of a BWR (reactivity coefficients, stability, etc.). The tools that are available to perform a modeling in the Department of Reactor Physics in Chalmers are CASMO-4/TABLES-3/SIMULATE-3 from Studsvik of America. These CMS (Core Management System) programs have been extensively compared with both measurements and reference codes. Nevertheless some data are proprietary in particular the comparison of the calculated nuclide concentrations versus experiments (because of the cost of this kind of experimental study). This is why this report describes such a comparative investigation carried out with a General Electric 7x7 BWR bundle. Unfortunately, since some core history parameters were unknown, a lot of hypotheses have been adopted. This invokes sometimes a significant discrepancy in the results without being able to determine the origin of the differences between calculations and experiments. Yet one can assess that, except for four nuclides - Plutonium-238, Curium-243, Curium-244 and Cesium-135 - for which the approximate power history (history effect) can be invoked, the accuracy of the calculated nuclide concentrations is rather good if one takes the numerous approximations into account
International Nuclear Information System (INIS)
Sabo, Martin; Malásková, Michaela; Matejčík, Štefan
2014-01-01
In this study we have investigated the negative reactant ion formation in a negative corona discharge (CD) using the corona discharge ion mobility spectrometry orthogonal acceleration time-of-flight (CD-IMS-oaTOF) technique. The reactant ions were formed in the CD operating in the reverse gas flow mode at an elevated temperature of 363.5 K in synthetic and ambient air. Under these conditions mainly O 2 − and their clusters were formed. We have also studied the influence of CCl 4 admixture to air (dopant gas) on the composition of the reactant ions, which resulted in the formation of Cl − and its clusters with a reduced ion mobility of 3.05 cm 2 V −1 s −1 as a major reactant ion peak. Additional IMS peaks with reduced ion mobilities of 2.49, 2.25 and 2.03 cm 2 V −1 s −1 were detected, and Cl − · (NO 2 ) and Cl − · (NO) n (n = 2, 3) anions were identified. The negative reactant ions were used to detect 2,4,6 trinitrotoluene (TNT) using the thermal desorption (TD) technique using a CD-IMS instrument. Using TD sampling and a negative CD ion source doped by CCl 4 we have achieved a limit of detection of 350 pg for direct surface analysis of TNT. (paper)
A warning on fission resonance intergrals: Caveat utor
International Nuclear Information System (INIS)
Holden, N.E.
1988-01-01
A common error is made in defining the resonance integral in most tabulations and handbooks. Although it has a minor effect on the capture resonance integral and on the fission resonance integral for the fissile nuclides, it leads to gross errors in the fission resonance integral for the fertile nuclides. The errors in the fission resonance integral for fertile nuclides of the elements from thorium through curium in the ENDF/B-V library will be presented. Let the user beware
Sorption and chromatographic techniques for processing liquid waste of nuclear fuel cycle
International Nuclear Information System (INIS)
Gelis, V.M.; Milyutin, V.V.; Chuveleva, E.A.; Maslova, G.B.; Kudryavtseva, S.P.; Firsova, L.A.; Kozlitin, E.A.
2000-01-01
In the spent nuclear fuel processing procedures the significant quantity of high level liquid waste containing long-lived high toxic radionuclides of cesium, strontium, promethium, americium, curium, etc. is generated. Separation of those radionuclides from the waste not merely simplifies the further safe waste handling but also reduces the waste processing operation costs due to the market value of certain individual radionuclide preparations. Recovery and separation of high grade pure long-lived radionuclide preparations is frequently performed by means of chromatographic techniques. (authors)
Nuclear data needs for subcritical reactors with heavy-metal coolant
International Nuclear Information System (INIS)
Ignatyuk, A.V.
2001-01-01
Requests on improvement of evaluated data files for minor actinides (MA) are briefly reviewed. New evaluations of neutron cross sections for Np-237, Am-241 and Am-243 after the corresponding tests and verifications should satisfy the required accuracies of data for developing MA-burners. More difficult problems arise for curium isotopes, evaluated data of which are strongly divergent. International expertise of available evaluations could be very desirable. Needs in data improvements for perspective heavy-metal liquid coolants are outlined. (author)
Actinide nuclides in environmental air and precipitation samples after the Chernobyl accident
International Nuclear Information System (INIS)
Rosner, G.; Hoetzl, H.; Winkler, R.
1988-01-01
The present paper describes the analysis of isotopes of uranium, neptunium, plutonium, americium and curium, in air and deposition samples taken at our laboratory site 10 km north of Munich, subsequent to the Chernobyl accident. Uranium-234, 237 U, 238 U, 239 Np, 238 Pu, 239+240 Pu and 242 Cm have been identified and upper limits of detection have been established for 241 Am and 244 Cm. Deposition and air concentration values are discussed. 12 refs., 1 fig., 2 tabs
International Nuclear Information System (INIS)
Raake, W.; Tempel, K.
1977-01-01
1. Phagocytic activity measured by means of the intravasal clearence of a soot dispersion in male NMRI-mice was increased six to ten days after whole-body X-irradiation (640 R) and decreased during the same period after i.v. administration of 2,4,6-triethyleneimino-s-triazine (TEM 2.0 mg/kg). 2. By means of 6-methyl-uracil food admixtures (200 to 400 ppm during 2 or 3 weeks) or by repeated intravenous injections of a N-methyl-D-glucosamine-6-methyluracil complex (62.5 to 250 mg/kg daily during five days), a significant augmentation of the phagocytic index being related to time and dosage was obtained in otherwise untreated mice. Comparable results were seen using cytidine and cytidine-5'-phosphate, whereas guanosine-5'-phosphate remained ineffective. 3. Whilst stimulating effects of 6-methyl-uracil or its N-methyl-D-glucosamine complex on X-irradiated mice were suspended, an increase up to supernormal values of the phagocytic index was produced by the pyrimidine base in animals treated with TEM. In accordance to this the survival rate of lethally X-irradiated mice (960 R) could not be increased; with animals given lethal TEM-doses, however, a significantly increased survival rate was obtained. 4. The present investigations as well as former biochemical analyses confirm the assumption that 6-methyluracil produces its regeneration effects, to some extent at least, by specific pathways influencing the reticuloendothelium. Different results from X-irradiated and TEM-treated mice are referring to the different points of attack of the two noxa. (orig.) [de
Liang, Zhishu; Li, Guiying; An, Taicheng
2017-06-01
2,4,6-Tribromophenol (TBP), an intermediate of brominated flame retardants, can easily release to environment and recalcitrant to degradation. Previously, Bacillus sp. GZT, a pure aerobic strain capable of simultaneously debrominating and mineralizing TBP, was successfully isolated by us. To further obtain a practical application and dig up its TBP degradation mechanism, a total of 46.7-fold purification of a novel dehalogenase with a final specific activity of 18.9 U mg -1 and a molecular mass of 63.4 kDa was achieved. Under optimal conditions (35 °C and 200 rpm), up to 80% degradation efficiencies were achieved within 120 min. Adding H 2 O 2 , NADPH, Mn 2+ and Mg 2+ promoted enzyme reaction effectively; while EDTA, methyl viologen, Ni 2+ , Cu 2+ , Ca 2+ and Fe 2+ strongly inhibited reaction activities. The debromination of TBP was catalyzed by the enzyme at a Km of 78 μM and a Vmax of 0.65 min -1 mg protein -1 , which indicated that this dehalogenase could specifically eliminate TBP with a high efficiency and stability. Based on MALDI-TOF/TOF analysis, the dehalogenase shared 98% identity with peptide ABC transporter substrate-binding protein. One open reading frame (ORF) encoding this peptide was found in Strain GZT genome, subjected to clone and expressed in Escherichia coli (E. coli) to characterize the encoding gene. Result showed that this recombinant strain could also remove as similar amount of TBP as Bacillus sp. GZT under the identical condition. Based on these results, we suggest that this newly-isolated TBP dehalogenase highlights a new approach for remediating TBP pollution. Copyright © 2017 Elsevier Ltd. All rights reserved.
Partitioning of minor actinides: research at Juelich and Karlsruhe Research Centres
International Nuclear Information System (INIS)
Geist, A.; Weigl, M.; Gompper, K.; Modolo, G.
2007-01-01
Full text of publication follows. The work on minor actinide (MA) partitioning carried out at Karlsruhe and Juelich is integrated in the EC FP6 programme, EUROPART. Studies include the DIAMEX process (co-extraction of MA and lanthanides from PUREX raffinate) and the SANEX process (separation of MA from lanthanides). Aspects ranging from developing and improving highly selective and efficient extraction reagents, to fundamental structural studies, to process development and testing are covered. SANEX is a challenge in separation chemistry because of the chemical similarity of trivalent actinides and lanthanides. The extracting agents 2,6-di(5,6-di-propyl-1,2,4-triazine-3-yl)pyridine (n-Pr-BTP), developed at Karlsruhe, and the synergetic mixture of di(chloro-phenyl)di-thio-phosphinic acid (R2PSSH) with tri-n-octyl-phosphine oxide (TOPO), developed at Juelich, are considered a breakthrough because of their high separation efficiency in acidic systems. Separation factors for americium over lanthanides of more than 30 (R2PSSH+TOPO) and 130 (n-Pr-BTP) are achieved. To gain understanding of these selectivities, comparative investigations on the structures of curium and europium complexed with these SANEX ligands were performed at Karlsruhe. Extended X-ray absorption fine structure (EXAFS) analysis revealed distinct structural differences between curium and europium complexed with R2PSSH + TOPO, though no such differences were found for n-Pr-BTP. These investigations were therefore complemented by time-resolved laser fluorescence spectroscopic investigations (TRLFS), showing complex stabilities and speciation to differ between n-Pr-BTP complexes of curium and europium. Kinetics of mass transfer was studied for both R2PSSH+TOPO and n-Pr-BTP systems. For the R2PSSH + TOPO system, diffusion was identified to control extraction rates. For the n-Pr-BTP system, a slow chemical reaction was identified as the rate-controlling process. These results were implemented into computer
International Nuclear Information System (INIS)
Madrakian, Tayyebeh; Zolfigol, Mohammad Ali; Solgi, Mohammad
2008-01-01
A method was proposed for the preconcentration of some transition elements at trace levels using a column packed with silica gel modified by a synthetic ligand. Metal ions were adsorbed on 2,4,6-trimorpholino-1,3,5-triazin modified silica gel, then analytes retained on the adsorbent were eluted by 1 mol L -1 hydrochloric acid and determined by flame atomic absorption spectrometry (FAAS). The influences of some experimental parameters including pH of the sample solution, weight of adsorbent, type, concentration and volume of eluent, flow rates of the sample solution and eluent, and sample volume on the preconcentration efficiency have been investigated. The influences of some matrix elements were also examined. The method also was used for simultaneous preconcentration of these elements and the method was successfully applied to the preconcentration and determination of them. The detection limits of the method for Ni 2+ , Co 2+ , Cd 2+ and Zn 2+ were 0.29, 0.20, 0.23 and, 0.30 ng mL -1 , respectively. The application of this modified silica gel to preconcentration of investigated cation from tap water, lake water, urine and apple leaves gave high accuracy and precision (relative standard deviation (R.S.D.) <3%)
International Nuclear Information System (INIS)
Doxtader, M.M.; Beitz, J.V.; Reed, D.T.; Bates, J.K.
1988-02-01
Two ultrasensitive laser techniques, laser photoacoustic spectroscopy (LPAS) and laser-induced fluorescence (LIF), are being developed for the detection and speciation of trace levels of actinides in solutions typical of those expected in a high-level waste repository. An LPAS system was set up for these studies. Experiments were carried out to determine the detection limits of plutonium and americium in solution. Concurrently with the LPAS work, LIF studies were carried out on uranyl ion and curium in solution. 32 refs., 35 figs., 8 tabs
Jin, Yutaka
2008-01-01
Inhalation therapy of diethylene-triamine-penta-acetate (DTPA) should be initiated immediately to workers who have significant incorporation of plutonium, americium or curium in the nuclear fuel reprocessing plant. A newly designed electric mesh nebulizer is a small battery-operated passive vibrating mesh device, in which vibrations in an ultrasonic horn are used to force drug solution through a mesh of micron-sized holes. This nebulizer enables DTPA administration at an early stage in the event of a radiation emergency from contamination from the above radioactive metals.
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Objectives, Strategies, and Challenges for the Advanced Fuel Cycle Initiative
International Nuclear Information System (INIS)
Steven Piet; Brent Dixon; David Shropshire; Robert Hill; Roald Wigeland; Erich Schneider; J. D. Smith
2005-01-01
This paper will summarize the objectives, strategies, and key chemical separation challenges for the Advanced Fuel Cycle Initiative (AFCI). The major objectives are as follows: Waste management--defer the need for a second geologic repository for a century or more, Proliferation resistance--be more resistant than the existing PUREX separation technology or uranium enrichment, Energy sustainability--turn waste management liabilities into energy source assets to ensure that uranium ore resources do not become a constraint on nuclear power, and Systematic, safe, and economic management of the entire fuel cycle. There are four major strategies for the disposal of civilian spent fuel: Once-through--direct disposal of all discharged nuclear fuel, Limited recycle--recycle transuranic elements once and then direct disposal, Continuous recycle--recycle transuranic elements repeatedly, and Sustained recycle--same as continuous except previously discarded depleted uranium is also recycled. The key chemical separation challenges stem from the fact that the components of spent nuclear fuel vary greatly in their influence on achieving program objectives. Most options separate uranium to reduce the weight and volume of waste and the number and cost of waste packages that require geologic disposal. Separated uranium can also be used as reactor fuel. Most options provide means to recycle transuranic (TRU) elements--plutonium (Pu), neptunium (Np), americium (Am), curium (Cm). Plutonium must be recycled to obtain repository, proliferation, and energy recovery benefits. U.S. non-proliferation policy forbids separation of plutonium by itself; therefore, one or more of the other transuranic elements must be kept with the plutonium; neptunium is considered the easiest option. Recycling neptunium also provides repository benefits. Americium recycling is also required to obtain repository benefits. At the present time, curium recycle provides relatively little benefit; indeed, recycling
Impact of Transmutation Scenarios on Fuel Transportation
International Nuclear Information System (INIS)
Saturnin, A.; Duret, B.; Allou, A.; Jasserand, F.; Fillastre, E.; Giffard, F.X.; Chabert, C.; Caron-Charles, M.; Garzenne, C.; Laugier, F.
2015-01-01
Minor actinides transmutation scenarios have been studied in the frame of the French Sustainable Radioactive Waste Management Act of 28 June 2006. Transmutation scenarios supposed the introduction of a sodium-cooled fast reactor fleet using homogeneous or heterogeneous recycling modes for the minor actinides. Americium, neptunium and curium (MA) or americium alone (Am) can be transmuted together in a homogeneous way embedded in FR-MOX fuel or incorporated in MA or Am-Bearing radial Blankets (MABB or AmBB). MA transmutation in Accelerator Driven System has also been studied while plutonium is being recycled in SFR. Assessments and comparisons of these advanced cycles have been performed considering technical and economic criteria. Transportation needs for fresh and used transmutation fuels is one of these criteria. Transmutation fuels have specific characteristics in terms of thermal load and neutron emissions. Thermal, radiation and criticality constraints have been taken into account in this study to suggest cask concepts for routine conditions of transport, to estimate the number of assemblies to be transported in a cask and the number of annual transports. Comparison with the no transmutation option, i.e. management of uranium and plutonium in SFRs, is also presented. Regarding these matters, no high difficulties appear for assemblies with limited content of Am (homogeneous or heterogeneous recycling modes). When fuels contain curium, technical transport uncertainties increase because of the important heat release requiring dividing fresh fuels and technological innovations development (MABB and ADS). (authors)
Validation of KENOREST with LWR-PROTEUS phase II samples
Energy Technology Data Exchange (ETDEWEB)
Wagner, M.; Kilger, R.; Pautz, A.; Zwermann, W. [GRS, Garching (Germany); Grimm, P.; Vasiliev, A.; Ferroukhi, H. [Paul Scherrer Institut, Villigen (Switzerland)
2012-11-01
In order to broaden the validation basis of the reactivity and nuclide inventory code KENOREST two samples of the LWR-PROTEUS phase II program have been calculated and compared to the experimental results. In general most nuclides are reproduced very well and agree within about ten percent with the experiment. Some already known problems, the overprediction of metallic fission products and the underprediction of the higher curium isotopes, have been confirmed. One of the largest uncertainties in the calculation was the burnup of the samples due to differences between a core simulation of the fuel vendor and the burnup determined from the measured values of the burnup indicator Nd-148. Two different models taking into account the environment for a peripheral fuel rod have been studied. The more detailed model included the three direct neighbor fuel assemblies depleted along with the fuel rod of interest. The influence on the results has been found to be very small. Compared to the uncertainties from the burnup, this effect can be considered negligible. The reason for the low influence was basically that the spectrum did not get considerably harder with increasing burnup beyond about 20GWd/tHM. Since the sample reached burnups far beyond that value, an effect could not be seen. In the near future an update of the used libraries is planned and it will be very interesting to study the effect on the results, especially for Curium. (orig.)
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
International Nuclear Information System (INIS)
Schwoebel, R.L.; Northrup, C.J.
1978-01-01
Abstracts and visual aids from the following talks are presented: removal of radionuclides from Hanford defense waste solutions; waste management programs at Savannah River Plant; application of defense waste decontamination; americium and curium recovery from nuclear waste using inorganic ion exchanger materials; removal of trace 106 Ru in nuclear waste processing; and titanate characterization and consolidation processes. Copies of three memos are included: 90 Sr radiation effects on sodium titanate loaded macroreticular resin; 238 239 Pu content in defense waste; and preparation and physical properties of sodium titanate in ion exchange resin
Ground depositions and air concentrations of Chernobyl fallout radionuclides at Munich-Neuherberg
Energy Technology Data Exchange (ETDEWEB)
Hoetzl, H.; Rosner, G.; Winkler, R.
1987-01-01
Southern Bavaria has received a comparatively high deposition of fallout radionuclides from the reactor accident at Chernobyl. As a result, in addition to the measurement of numerous gamma emitting nuclides and of strontium isotopes, the determination of several actinides, including isotopes of uranium, neptunium, plutonium and curium was possible. The observed radionuclide composition of the fallout and the time course of ground deposition and air concentration at the site of the Gesellschaft fuer Strahlen- und Umweltforschung (GSF) at Neuherberg, 10 km north of Munich, are reported and discussed.
Ground depositions and air concentrations of Chernobyl fallout radionuclides at Munich-Neuherberg
International Nuclear Information System (INIS)
Hoetzl, H.; Rosner, G.; Winkler, R.
1987-01-01
Southern Bavaria has received a comparatively high deposition of fallout radionuclides from the reactor accident at Chernobyl. As a result, in addition to the measurement of numerous gamma emitting nuclides and of strontium isotopes, the determination of several actinides, including isotopes of uranium, neptunium, plutonium and curium was possible. The observed radionuclide composition of the fallout and the time course of ground deposition and air concentration at the site of the Gesellschaft fuer Strahlen- und Umweltforschung (GSF) at Neuherberg, 10 km north of Munich, are reported and discussed. (orig.)
Actinide nuclides in environmental air and precipitation samples after the Chernobyl accident
Energy Technology Data Exchange (ETDEWEB)
Rosner, G.; Hoetzl, H.; Winkler, R. (Gesellschaft fuer Strahlen- und Umweltforschung mbH Muenchen (West Germany))
1988-01-01
The present paper describes the analysis of isotopes of uranium, neptunium, plutonium, americium and curium, in air and deposition samples taken at our laboratory site 10 km north of Munich, subsequent to the Chernobyl accident. Uranium-234, {sup 237}U, {sup 238}U, {sup 239}Np, {sup 238}Pu, {sup 239+240}Pu and {sup 242}Cm have been identified and upper limits of detection have been established for {sup 241}Am and {sup 244}Cm. Deposition and air concentration values are discussed. 12 refs., 1 fig., 2 tabs.
Researches on nuclear criticality safety evaluation
Energy Technology Data Exchange (ETDEWEB)
Okuno, Hiroshi; Suyama, Kenya; Nomura, Yasushi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
2003-10-01
For criticality safety evaluation of burnup fuel, the general-purpose burnup calculation code, SWAT, was revised, and its precision was confirmed through comparison with other results from OECD/NEA's burnup credit benchmarks. Effect by replacing the evaluated nuclear data from JENDL-3.2 to ENDF/B-VI and JEF-2.2 was also studied. Correction factors were derived for conservative evaluation of nuclide concentrations obtained with the simplified burnup code ORIGEN2.1. The critical masses of curium were calculated and evaluated for nuclear criticality safety management of minor actinides. (author)
Researches on nuclear criticality safety evaluation
International Nuclear Information System (INIS)
Okuno, Hiroshi; Suyama, Kenya; Nomura, Yasushi
2003-01-01
For criticality safety evaluation of burnup fuel, the general-purpose burnup calculation code, SWAT, was revised, and its precision was confirmed through comparison with other results from OECD/NEA's burnup credit benchmarks. Effect by replacing the evaluated nuclear data from JENDL-3.2 to ENDF/B-VI and JEF-2.2 was also studied. Correction factors were derived for conservative evaluation of nuclide concentrations obtained with the simplified burnup code ORIGEN2.1. The critical masses of curium were calculated and evaluated for nuclear criticality safety management of minor actinides. (author)
A New Alkali-Stable Phosphonium Cation Based on Fundamental Understanding of Degradation Mechanisms.
Zhang, Bingzi; Kaspar, Robert B; Gu, Shuang; Wang, Junhua; Zhuang, Zhongbin; Yan, Yushan
2016-09-08
Highly alkali-stable cationic groups are a critical component of hydroxide exchange membranes (HEMs). To search for such cations, we studied the degradation kinetics and mechanisms of a series of quaternary phosphonium (QP) cations. Benzyl tris(2,4,6-trimethoxyphenyl)phosphonium [BTPP-(2,4,6-MeO)] was determined to have higher alkaline stability than the benchmark cation, benzyl trimethylammonium (BTMA). A multi-step methoxy-triggered degradation mechanism for BTPP-(2,4,6-MeO) was proposed and verified. By replacing methoxy substituents with methyl groups, a superior QP cation, methyl tris(2,4,6-trimethylphenyl)phosphonium [MTPP-(2,4,6-Me)] was developed. MTPP-(2,4,6-Me) is one of the most stable cations reported to date, with <20 % degradation after 5000 h at 80 °C in a 1 m KOD in CD3 OD/D2 O (5:1 v/v) solution. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
Preparation, characterization, and sensitivity data of some azidomethyl nitramines
Energy Technology Data Exchange (ETDEWEB)
Klapoetke, Thomas M.; Krumm, Burkhard; Steemann, F.X. [Department of Chemistry and Biochemistry, Ludwig-Maximilian University of Munich (Germany)
2009-02-15
1,3-Diazido-2-nitro-2-azapropane (DANP) and 1,7-diazido-2,4,6-trinitro-2,4,6-triazaheptane (DATH) were synthesized, thoroughly analyzed, and their explosive properties and sensitivities toward friction and impact were measured. The precursors 1,3-diacetoxy-2-nitro-2-azapropane (1), 1,3-dichloro-2-nitro-2-azapropane (3), and 1,7-dichloro-2,4,6-trinitro-2,4,6-triazaheptane (4) - as well as DATH - were furthermore characterized by X-ray diffraction. (Abstract Copyright [2009], Wiley Periodicals, Inc.)
Zou, Wen-Sheng; Sheng, Dong; Ge, Xin; Qiao, Jun-Qin; Lian, Hong-Zhen
2011-01-01
Rayleigh scattering (RS) as an interference factor to detection sensitivity in ordinary fluorescence spectrometry is always avoided in spite of considerable efforts toward the development of RS-based resonance Rayleigh scattering (RRS) and hyper-Rayleigh scattering (HRS) techniques. Here, combining advantages of quantum dots (QDs) including chemical modification of functional groups and the installation of recognition receptors at their surfaces with those of phosphorescence such as the avoidance of autofluorescence and scattering light, l-cys-capped Mn-doped ZnS QDs have been synthesized and used for room-temperature phosphorescence (RTP) to sense and for RS chemodosimetry to image ultratrace 2,4,6-trinitrotoluene (TNT) in water. The l-cys-capped Mn-doped ZnS QDs interdots aggregate with TNT species induced by the formation of Meisenheimer complexes (MHCs) through acid-base pairing interaction between l-cys and TNT, hydrogen bonding, and electrostatic interaction between l-cys intermolecules. Although the resultant MHCs may quench the fluorescence at 430 nm, interdots aggregation can greatly influence the light scattering property of the aqueous QDs system, and therefore, dominant RS enhancement at defect-related emission wavelength was observed under the excitation of violet light of Mn-doped ZnS QDs, which was applied in chemodosimetry to image TNT in water. Meanwhile, Mn-doped ZnS QDs also exhibited a highly selective response to the quenching of the (4)T(1)-(6)A(1) transition emission (RTP) and showed a very good linearity in the range of 0.0025-0.45 μM TNT with detection limit down to 0.8 nM and RSD of 2.3% (n = 5). The proposed methods are well-suited for detecting the ultratrace TNT and distinguishing different nitro compounds.
Dhamodharan, P.; Sathya, K.; Dhandapani, M.
2017-10-01
A novel organic crystal, 1H-benzo[d]imidazol-3-ium-2,4,6-trinitrobenzene-1,3 bis(olate) (BITB), was synthesized. Single crystals of BITB were harvested by solution growth-slow evaporation technique. 1H and 13C NMR spectroscopic techniques were utilized to confirm the presence of various types of carbons and protons in BITB. Single crystal XRD confirms that BITB crystallizes in monoclinic system with a space group of P21/n. The suitability of this material for optical applications was assessed by optical absorption, transmittance, reflectance and refractive index spectroscopic techniques. Gaussian 09 program at B3LYP/6-311++G(d,p) level of basis set as used for the optimization of molecular structure of BITB. Greater first order hyperpolarizability value of BITB is due to intensive hydrogen bond network in the crystal. The value is 15 times greater than that of Urea, a reference standard. Computation of frontier molecular orbitals and electrostatic potential surface helped to understand the electron density and reactive sites in BITB. The material was thermally stable up to 220 °C. Hirshfeld surface analysis was performed to quantify the covalent and non covalent interactions.
Maghami, Mahboobeh; Farzaneh, Faezeh; Simpson, Jim; Ghiasi, Mina; Azarkish, Mohammad
2015-08-01
A cobalt complex was prepared from CoCl2·6H2O and 2,4,6-tris(2-pyridyl)-1,3,5-triazine (tptz) in methanol and designated as [Co(tptz)(CH3OH)Cl2]·CH3OH·0.5H2O (1). It was characterized by several techniques including TGA analysis and FT-IR, UV-Vis and 1H NMR spectral studies. The crystal structure of 1 was determined by single-crystal X-ray diffraction. The Co(II) metal center in 1 is six coordinated with a distorted octahedral geometry. The tptz ligand is tridentate and coordinates to the cobalt through coplanar nitrogen atoms from the triazine and two pyridyl rings. Two chloride anions and a methanol molecule complete the inner coordination sphere of the metal ion. The optimized geometrical parameters obtained by DFT calculation are in good agreement with single XRD data. The in vitro antibacterial activity of various tptz complexes of Co(II), Ni(II), Cu(II), Mn(II) and Rh(III) were evaluated against Gram-positive (Bacillus subtilis, Staphylococcus aureus and Gram-negative (Escherichia coli and Pseudomonas aeruginosa) bacteria. Whereas all complexes exhibited good activity in comparison to standard antibacterial drugs, the inhibitory effects of complexes were found to be more than that of the parent ligand. Overall, the obtained results strongly suggest that the cobalt(II) complex is a suitable candidate for counteracting antibiotic resistant microorganisms.
Zhang, Yabing; Zhou, Rui; Zhou, Feng; Cheng, Hong; Xia, Bing
2014-01-01
The present study is to investigate effects of total glucosides of peony (TGP) on 2,4,6-trinitrobenzene sulfonic acid (TNBS)/ethanol-induced colitis in rats and to explore potential clinical use of TGP for treatment of inflammatory bowel disease. Sixty Sprague-Dawley rats were randomly grouped into normal controls, model controls, sulfasalazine (SASP) controls (100 mg/kg/day), and low, medium, and high-dose TGP groups (25, 50, and 100 mg/kg/day, respectively). 24 h following colonic instillation of TNBS, TGP, and SASP were given by gastric gavage three times a day for 7 days. Disease activity index (DAI), colon macroscopic damage index (CMDI), histopathological score (HPS), and myeloperoxidase (MPO) activity were evaluated. Levels of serum TNF-α, IL-1β, and IL-10 were measured by ELISA, and expression of TNF-α, IL-1β, and IL-10 mRNA and protein in colonic tissues was detected by RT-PCR and western blot, respectively. Compared with rats in the model controls, TGP (50 or 100 mg/kg/day)-treated rats with TNBS/ethanol-induced colitis showed significant improvements of DAI, CMDI, HPS, and MPO activity. Moreover, administration of TGP (50 or 100 mg/kg/day) decreased the up-regulated levels of serum TNF-α and IL-1β, and expression of TNF-α and IL-1β mRNA and protein in colonic tissues, and increased the serum IL-10 and colonic IL-10 mRNA and protein level. And there was no significant difference compared with administration of SASP (P > 0.05). TGP attenuates TNBS/ethanol-induced colitis in rats and its efficacy is similar to SASP, the potential mechanism might be related to the adjustment of Th1/Th2 cytokines polarization by decreasing pro-inflammatory cytokine TNF-α and IL-1β, and increasing anti-inflammatory cytokine IL-10.
2010-01-01
... CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN... by OIG to be necessary. In performing such audits, OIG will rely to the extent feasible on audit work... implementation and for completion of correction of deficiencies and their causes. (3) FNS will determine whether...
2010-01-01
...; (d) Conditions that directly affect the nutritional health of a person, including alcoholism or drug... termination of pregnancy. Poverty income guidelines means the poverty income guidelines prescribed by the...
2010-10-01
.... (c) Individual. As used in this subpart, “individual” means a citizen of the United States or an... Department or a bureau thereof, including, but not limited to, education, financial transactions, medical... print, or a photograph. (f) System of records. As used in this subpart, “System of records” means a...
2010-07-01
... (or materials which have been separated for the purpose of recycling) from a central storage point. (f... facilities for the purpose of these guidelines. United States Government installations located on foreign... facilities for the purpose of these guidelines. (m) Food waste means the organic residues generated by the...
2010-01-01
... chapter. (b) Opening. The immigration judge shall advise the respondent of the nature of the proceeding... answer, if any, as exhibits in the record. (c) Pleading by respondent. The immigration judge shall...
N-(2,4,6-Trimethylphenylformamide
Directory of Open Access Journals (Sweden)
David C. Liles
2011-01-01
Full Text Available The title compound, C10H13NO, was obtained as the unexpected, almost exclusive, product in the attempted synthesis of a manganese(I–N-heterocyclic carbene (NHC complex. The dihedral angle between the planes of the formamide moiety and the aryl ring is 68.06 (10°. In the crystal, molecules are linked by N—H...O hydrogen bonds, forming infinite chains along the c axis.
32 CFR 246.5 - Responsibilities.
2010-07-01
... APF accounting and reporting procedures required by DoD Instruction 7000.12 5 , in coordination with... unacceptable conflict of interest damaging to the editorial integrity and credibility of the Stars and Stripes... initiatives to ensure support of U.S. Armed Forces during contingency operations and armed conflict. The S&S...
7 CFR 246.8 - Nondiscrimination.
2010-01-01
... CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN... Amendments of 1972, section 504 of the Rehabilitation Act of 1973, the Age Discrimination Act of 1975... discrimination under the Program. Compliance with title VI of the Civil Rights Act of 1964, title IX of the...
Energy Technology Data Exchange (ETDEWEB)
Hadasch, A.; Sorokin, A.; Meunier, B. [Centre National de la Recherche Scientifique (CNRS), 31 - Toulouse (France). Lab. de Chimie de Coordination; Rabion, A. [Centre de Recherche ELF-Atochem, Departement Chimie Organique et Biochimie, 64 - Artix (France)
1998-01-01
Degradation of chlorinated aromatics is an important environmental research field since these compounds are among the most recalcitrant pollutants. With hydrogen peroxide, iron tetra-sulfo-phthalocyanine (FePcS) has been shown to catalyze aromatic ring cleavage of 2,4,6-tri-chloro-phenol (TCP). Here are reported new data on the key factors controlling the catalytic activity of the FePcS-H{sub 2} O{sub 2} system in the oxidation of TCP: the sequential addition of H{sub 2} O{sub 2} and the pH and solvent effects on the monomer/dimer equilibria of the catalyst precursors. The efficiency of the H{sub 2}O{sub 2} oxidation TCP catalyzed by FePcS is highly dependent on the pH value of the reaction mixture, the local hydrogen peroxide concentration and the organisation of FePcS molecules in solution. Among the several forms of FePcS in aqueous solutions (dimer or monomer), monomeric FePcS is proposed to be the catalytically active complex. The key role of the organic co-solvent (acetonitrile, acetone, alcohol,...) is to shift the dimer/monomer equilibrium toward monometric FePcS, the efficient catalyst precursor. A stepwise addition of hydrogen peroxide significantly improves the conversion of TCP and allows a low catalyst loading, below 1% with respect to the pollutant, to improves the conversion of TCP and allows a low catalyst loading, below 1% with respect to the pollutant, to be used. (authors) 23 refs.
The speciation of dissolved elements in aquatic solution. Radium and actinides
International Nuclear Information System (INIS)
Haesaenen, E.
1994-01-01
In the publication, the chemistry and speciation of radium, thorium, protactinium, uranium, neptunium, lutonium, americium and curium in ground-water environment is reviewed. Special attention is given to the transuranium elements, which have a central role in the repository of nuclear wastes. The most important methods used in the speciation of these elements is presented. The laser-induced methods, developed in the 1980's, are especially discussed. These have made it possible, e.g., to speciate the transuranium elements in their very low, actual repository ground-water concentrations (10-100 ng/l). (54 refs., 10 figs., 3 tabs.)
International Nuclear Information System (INIS)
Anon.
1999-01-01
These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)
Analogs for transuranic elements
International Nuclear Information System (INIS)
Weimer, W.C.; Laul, J.C.; Kutt, J.C.
1981-01-01
A combined theoretical and experimental approach is being used to estimate the long-term environmental and biogeochemical behaviors of selected transuranic elements. The objective of this research is to estimate the effect that long-term (hundreds of years) environmental weathering has on the behavior of the transuranic elements americium and curium. This is achieved by investigating the actual behavior of naturally occurring rare earth elements, especially neodymium, that serve as transuranic analogs. Determination of the analog element behavior provides data that can be used to estimate the ultimate availability to man of transuranic materials released into the environment
Helium behaviour in nuclear glasses
International Nuclear Information System (INIS)
Fares, T.
2011-01-01
The present thesis focuses on the study of helium behavior in R7T7 nuclear waste glass. Helium is generated by the minor actinides alpha decays incorporated in the glass matrix. Therefore, four types of materials were used in this work. These are non radioactive R7T7 glasses saturated with helium under pressure, glasses implanted with 3 He + ions, glasses doped with curium and glasses irradiated in nuclear reactor. The study of helium solubility in saturated R7T7 glass has shown that helium atoms are inserted in the glass free volume. The results yielded a solubility of about 10 16 at. cm -3 atm. -1 . The incorporation limit of helium in this type of glass has been determined; its value amounted to about 2*10 21 at. cm -3 , corresponding to 2.5 at.%. Diffusion studies have shown that the helium migration is controlled by the single population dissolved in the glass free volume. An ideal diffusion model was used to simulate the helium release data which allowed to determine diffusion coefficients obeying to the following Arrhenius law: D = D 0 exp(-E a /kBT), where D 0 = 2.2*10 -2 and 5.4*10 -3 cm 2 s -1 and E a = 0.61 eV for the helium saturated and the curium doped glass respectively. These results reflect a thermally activated diffusion mechanism which seems to be not influenced by the glass radiation damage and helium concentrations studied in the present work (up to 8*10 19 at. g -1 , corresponding to 0.1 at.%). Characterizations of the macroscopic, structural and microstructural properties of glasses irradiated in nuclear reactor did not reveal any impact associated with the presence of helium at high concentrations. The observed modifications i.e. a swelling of 0.7 %, a decrease in hardness by 38 %, an increase between 8 and 34 % of the fracture toughness and a stabilization of the glass structure under irradiation, were attributed to the glass nuclear damage induced by the irradiation in reactor. Characterizations by SEM and TEM of R7T7 glasses implanted
Zaki, Mohamed A; Nanayakkara, N P Dhammika; Hetta, Mona H; Jacob, Melissa R; Khan, Shabana I; Mohammed, Rabab; Ibrahim, Mohamed A; Samoylenko, Volodymyr; Coleman, Christina; Fronczek, Frank R; Ferreira, Daneel; Muhammad, Ilias
2016-09-23
Two new flavonoids, rac-6-formyl-5,7-dihydroxyflavanone (1) and 2',6'-dihydroxy-4'-methoxy-3'-methylchalcone (2), together with five known derivatives, rac-8-formyl-5,7-dihydroxyflavanone (3), 4',6'-dihydroxy-2'-methoxy-3'-methyldihydrochalcone (4), rac-7-hydroxy-5-methoxy-6-methylflavanone (5), 3'-formyl-2',4',6'-trihydroxy-5'-methyldihydrochalcone (6), and 3'-formyl-2',4',6'-trihydroxydihydrochalcone (7), were isolated from the leaves of Eugenia rigida. The individual (S)- and (R)-enantiomers of 1 and 3, together with the corresponding formylated flavones 8 (6-formyl-5,7-dihydroxyflavone) and 9 (8-formyl-5,7-dihydroxyflavone), as well as 2',4',6'-trihydroxychalcone (10), 3'-formyl-2',4',6'-trihydroxychalcone (11), and the corresponding 3'-formyl-2',4',6'-trihydroxydihydrochalcone (7) and 2',4',6'-trihydroxydihydrochalcone (12), were synthesized. The structures of the isolated and synthetic compounds were established via NMR, HRESIMS, and electronic circular dichroism data. In addition, the structures of 3, 5, and 8 were confirmed by single-crystal X-ray diffraction crystallography. The isolated and synthetic flavonoids were evaluated for their antimicrobial and cytotoxic activities against a panel of microorganisms and solid tumor cell lines.
Toklu, H Z; Kabasakal, L; Imeryuz, N; Kan, B; Celikel, C; Cetinel, S; Orun, O; Yuksel, M; Dulger, G A
2013-08-01
The intestinal microflora is an important cofactor in the pathogenesis of intestinal inflammation; and the epithelial cell barrier function is critical in providing protection against the stimulation of mucosal immune system by the microflora. In the present study, therapeutic role of the antibacterial drugs rifampicin and ciprofloxacine were investigated in comparison to spironolactone, an enzyme inducer, in 2,4,6-trinitrobenzenesulfonic acid (TNBS)-induced colitis of the rats. Drugs were administered for 14 days following induction of colitis. All drug treatments ameliorated the clinical hallmarks of colitis as determined by body weight loss and assessment of diarrhea, colon length, and histology. Oxidative damage and neutrophil infiltration as well as nuclear factor κB (NF-κB) and tumor necrosis factor α (TNF-α) expressions that were increased during colitis, were decreased significantly. Rifampicin and ciprofloxacin were probably effective due to their antibacterial and immunomodulating properties. The multidrug resistence gene (MDR1) and its product p-glycoprotein (P-gp) has been implicated in the pathogenesis of inflammatory bowel disease (IBD). In the present study, findings of the P-gp expression were inconclusive but regarding previous studies, it can be suggested that the beneficial effects of rifampicin and spironolactone may be partly due to their action as a P-gp ligand. Spironolactone has been reported to supress the transcription of proinflamatory cytokines that are considered to be of importance in immunoinflammatory diseases. It is also a powerful pregnane X receptor (PXR) inducer; thus, inhibition of the expression of NF-κB and TNF-α, and amelioration of inflammation by spironolactone suggest that this may have been through the activation of PXR. However, our findings regarding PXR expression were inconclusive. Activation of PXR by spironolactone probably also contributed to the induction of P-gp, resulting in extrusion of noxious substances
ORF Alignment: NC_002950 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ASCRQAELGGATRVELCAGIPEGGTTPSAGEMAVARSLIAIPIHVIIR 60 ... Query: 121 FHRAFDVCAAPFEMLEKLIAAGFHRVLTSGCAPTALEGKDMIGA...LNKQATGRIGIMAGCG 180 ... FHRAFDVCAAPFEMLEKLIAAGFHRVLTSGCAPTALEGKDMIGALNKQA...TGRIGIMAGCG Sbjct: 121 FHRAFDVCAAPFEMLEKLIAAGFHRVLTSGCAPTALEGKDMIGALNKQATGRIGIMAGCG 180 ... Query: 241 AVDILQ 246 ... AVDILQ Sbjct: 241 AVDILQ 246
A POC Clinical Trial for PTSD with a First-In-Class Vasopressin 1a Receptor Antagonist
2017-10-01
clinical benefit of SRX246 for the treatment of anger, irritability, and aggression; major depression ; disturbed sleep; and quality of life that...safety and tolerability of SRX246 (160 mg PO BID) and ii) clinical benefit of SRX246 for the treatment of major depression , anger, irritability, and...colleagues. Changes that had a significant impact on expenditures Nothing to Report Significant changes in use or care of human subjects, vertebrate
Hou, Ling; Li, Wei-Dong; Wang, Fangwei; Eriksson, Olle; Wang, Bao-Tian
2017-12-01
We present a systematic investigation of the structural, magnetic, electronic, mechanical, and thermodynamic properties of CmO2 with the local density approximation (LDA)+U and the generalized gradient approximation (GGA)+U approaches. The strong Coulomb repulsion and the spin-orbit coupling (SOC) effects on the lattice structures, electronic density of states, and band gaps are carefully studied, and compared with other A O2 (A =U , Np, Pu, and Am). The ferromagnetic configuration with half-metallic character is predicted to be energetically stable while a charge-transfer semiconductor is predicted for the antiferromagnetic configuration. The elastic constants and phonon spectra show that the fluorite structure is mechanically and dynamically stable. Based on the first-principles phonon density of states, the lattice vibrational energy is calculated using the quasiharmonic approximation. Then, the Gibbs free energy, thermal expansion coefficient, specific heat, and entropy are obtained and compared with experimental data. The mode Grüneisen parameters are presented to analyze the anharmonic properties. The Slack relation is applied to obtain the lattice thermal conductivity in temperature range of 300-1600 K. The phonon group velocities are also calculated to investigate the heat transfer. For all these properties, if available, we compare the results of CmO2 with other A O2 .
Assessment of Neptunium, Americium, and Curium in the Savannah River Site Environment
International Nuclear Information System (INIS)
Carlton, W.H.
1997-01-01
A series of documents has been published in which the impact of various radionuclides released to the environment by Savannah River Site (SRS) operations has been assessed. The quantity released, the disposition of the radionuclides in the environment, and the dose to offsite individuals has been presented for activation products, carbon cesium, iodine, plutonium, selected fission products, strontium, technetium, tritium, uranium, and the noble gases. An assessment of the impact of nonradioactive mercury also has been published.This document assesses the impact of radioactive transuranics released from SRS facilities since the first reactor became operational late in 1953. The isotopes reported here are 239Np, 241Am, and 244Cm
Organobromine compound profiling in human adipose: Assessment of sources of bromophenol
International Nuclear Information System (INIS)
Gao, Shixiong; Wan, Yi; Zheng, Guomao; Luo, Kai; Kannan, Kurunthachalam; Giesy, John P.; Lam, Michael H.W.; Hu, Jianying
2015-01-01
Bromophenols (BRPs) have been widely detected in human tissues, however, relative proportions from natural products and/or anthropogenic flame retardants are not clear. 21 polybrominated diphenyl ethers (PBDEs), 15 MeO/OH-PBDEs, and 10 BRPs were simultaneously quantified in adipose collected from people from New York City, USA. An in vitro assay utilizing human liver microsomes was performed for detected predominant organobromine. High concentrations of 2,4,6-triBRP and PBDEs were observed, and extremely low concentrations of naturally occurring MeO/OH-PBDEs were detected. Similar biotransformatioin rates of BRPs and MeO/OH-PBDEs indicated that the relative high concentration of 2,4,6-triBRP in humans was not of natural origin. Significant correlation observed between concentrations of 2,4,6-triBRP and BDE-209 suggested that the two chemicals may share a common source. Both 2,4,6-triBRP and BDE-209 were detected in commercial ABS resins, suggesting that plastic products made from ABS resins could be potential sources of co-exposure of the two compounds for humans. - Highlights: • 2,4,6-triBRP detected with high concentrations in human was not of natural origin. • Co-exposure of 2,4,6-triBRP and BDE-209 was observed in human samples. • Products made from ABS resins were potential exposure sources of 2,4,6-triBRP. - The profile of organobromine compounds in human together with biotransformation behaviors indicate that anthropogenic sources mainly contribute to high levels of bromophenols in humans
Energy Technology Data Exchange (ETDEWEB)
Dhamodharan, P.; Sathya, K.; Dhandapani, M., E-mail: chemistrydhandapani@gmail.com
2017-03-01
A new organic proton transfer complex having NLO activity, 4-amino-4H-1,2,4-triazol-1-ium-3-hydroxy-2,4,6-trinitrophenolate (ATHTP), was crystallized to investigate the factors which stabilize the structure of the crystal. The compound crystallizes in triclinic system with space group P-1. Elemental analysis, thermal analysis, UV–Vis–NIR, FT-IR and NMR spectral analyses were carried out to characterize the crystal. Optical, spectral and thermal properties of the title crystal were analyzed to recommend the material for optical applications. Z-scan was used to measure the effective third-order nonlinear optical susceptibility and nonlinear refractive index. The crystal structure was determined using single crystal XRD method and the structure was optimized using Gaussian 09 program at B3LYP/6-311++G(d,p) level of basis set. This hydrogen bond interactions led to the increase in first-order hyperpolarizability of ATHTP and was 30 times greater than that of urea. Hirshfeld analyses surface analysis was carried out to explore intermolecular interactions in the crystalline state. - Highlights: • Single crystals were grown by slow evaporation solution growth technique. • N-H…O, O-H…O and C-H…O type of interactions lead to stable network. • The thermal stability of the compound was investigated by TG/DTA analyses. • The third-order nonlinear optical susceptibility is found to be 2.1×10{sup −7} esu. • Hirshfeld analyses explore covalent and non covalent interactions.
324 Building Baseline Radiological Characterization
International Nuclear Information System (INIS)
Reeder, R.J.; Cooper, J.C.
2010-01-01
This report documents the analysis of radiological data collected as part of the characterization study performed in 1998. The study was performed to create a baseline of the radiological conditions in the 324 Building. A total of 85 technical (100 square centimeter (cm 2 )) smears were collected from the Room 147 hoods, the Shielded Materials Facility (SMF), and the Radiochemical Engineering Cells (REC). Exposure rate readings (window open and window closed) were taken at a distance of 2.5 centimeters (cm) and 30 cm from the surface of each smear. Gross beta-gamma and alpha counts of each smear were also performed. The smear samples were analyzed by gamma energy analysis (GEA). Alpha energy analysis (AEA) and strontium-90 analysis were also performed on selected smears. GEA results for one or more samples reported the presence of manganese-54, cobalt-60, silver-108m antimony-125, cesium-134, cesium-137, europium-154, europium-155, and americium-241. AEA results reported the presence of plutonium-239/240, plutonium-238/ 241 Am, curium-243/244, curium-242, and americium-243. Tables 5 through 9 present a summary by location of the estimated maximum removable and total contamination levels in the Room 147 hoods, the SMF, and the REC. The smear sample survey data and laboratory analytical results are presented in tabular form by sample in Appendix A. The Appendix A tables combine survey data documented in radiological survey reports found in Appendix B and laboratory analytical results reported in the 324 Building Physical and Radiological Characterization Study (Berk, Hill, and Landsman 1998), supplemented by the laboratory analytical results found in Appendix C.
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-10-01
Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated
Wu, Y H; Cheong, L C; Meon, S; Lau, W H; Kong, L L; Joseph, H; Vadamalai, G
2013-06-01
A 246-nt variant of Coconut cadang-cadang viroid (CCCVd) has been identified and described from oil palms with orange spotting symptoms in Malaysia. Compared with the 246-nt form of CCCVd from coconut, the oil palm variant substituted C(31)→U in the pathogenicity domain and G(70)→C in the central conserved domain. This is the first sequence reported for a 246-nt variant of CCCVd in oil palms expressing orange spotting symptoms.
Protein (Cyanobacteria): 281806 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MIEESKSIKEKFGVLDSVPVGACLLQDDFVVLFWNTCLEE...YP_007117793.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla
Protein (Cyanobacteria): 281805 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MYLILPDLYANMTYQIDERLNTSPCGFLSFADDGTIVMVN...YP_007118829.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla
Protein (Cyanobacteria): 281754 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MLYNNEILPTLTVESSPRSMNILLYKLLSLRRIEYIAVDR...YP_007115817.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
Thermodynamics of carbothermic synthesis of actinide mononitrides
International Nuclear Information System (INIS)
Ogawa, T.; Shirasu, Y.; Minato, K.; Serizawa, H.
1997-01-01
Carbothermic synthesis will be further applied to the fabrication of nitride fuels containing minor actinides (MA) such as neptunium, americium and curium. A thorough understanding of the carbothermic synthesis of UN will be beneficial in the development of the MA-containing fuels. Thermodynamic analysis was carried out for conditions of practical interest in order to better understand the recent fabrication experiences. Two types of solution phases, oxynitride and carbonitride phases, were taken into account. The Pu-N-O ternary isotherm was assessed for the modelling of M(C, N, O). With the understanding of the UN synthesis, the fabrication problems of Am-containing nitrides are discussed. (orig.)
NCBI nr-aa BLAST: CBRC-DSIM-01-0041 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-01-0041 ref|ZP_00141975.1| phosphatidate cytidylyltransferase [Rickettsia sibi...rica 246] gb|EAA25384.1| phosphatidate cytidylyltransferase [Rickettsia sibirica 246] ZP_00141975.1 0.009 26% ...
Directory of Open Access Journals (Sweden)
Yousef Mirzai
2014-04-01
Full Text Available The protozoan intestinal parasite Cryptosporidium commonly infects cattle throughout the world and Iran. The present study was undertaken to determine the abundance and associated risk factors of Cryptosporidium infection in cattle herds of northwestern Iran. A total number of 246 fecal samples from 138 (56.1% diarrheic (D and 108 (43.9% non-diarrheic (ND cattle were randomly collected and examined by fecal smears stained with Ziehl-Neelsen. For molecular specification, DNA was extracted from collected Cryptosporidium oocysts and a fragment of 1325 bp in size from 18S rRNA gene was amplified. The overall prevalence of Cryptosporidium infection was 22.3% (55/246. The prevalence of Cryptosporidium infection in examined calves less than 6 month-old was significantly higher than adult cattle. C. parvum and C. andersoni were identified in 20.3% (50/246 and 2.03% (5/246 of examined cattle, respectively. The highest prevalence of C. parvum infection was found in D calves < 6 month-old (13.4%, 33/246, while C. andersoni was only detected in ND cattle (8.9%, 22/246. There was significant difference in the prevalence between male than female cattle. There was no significant difference between prevalence and seasons of investigation. It was concluded that C. parvum was the prevalent species in younger animals compared to older ones as a potentially zoonotic agent in the region.
2010-10-01
... QUALITY ASSURANCE Warranties 46.705 Limitations. (a) Except for the warranties in the clauses at 52.246-3, Inspection of Supplies—Cost-Reimbursement, and 52.246-8, Inspection of Research and Development—Cost...
NCBI nr-aa BLAST: CBRC-TTRU-01-0188 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0188 ref|ZP_00142186.1| heme exporter protein B [Rickettsia sibirica 2...46] gb|EAA25595.1| heme exporter protein B [Rickettsia sibirica 246] ZP_00142186.1 0.055 25% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0560 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0560 ref|ZP_00142186.1| heme exporter protein B [Rickettsia sibirica 2...46] gb|EAA25595.1| heme exporter protein B [Rickettsia sibirica 246] ZP_00142186.1 0.14 23% ...
A trace of anger is enough: on the enforcement of social norms
Czech Academy of Sciences Publication Activity Database
Steiner, Jakub
-, č. 246 (2005), s. 1-10 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : punishment * public good * reciprocity Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp246.pdf
2010-01-01
... following: (1) The cost of nutrition education and breastfeeding promotion and support which meets the... documentation of the nutrition education and breastfeeding promotion and support expenditure requirement. Costs... producing nutrition education and breastfeeding promotion and support materials including handouts, flip...
2010-01-01
... jurisdiction; (ii) Vendor limiting and selection criteria. Vendor limiting criteria, if used by the State agency, and the vendor selection criteria established by the State agency consistent with the... friends; or, (iii) One employee determining eligibility for all certification criteria and issuing food...
7 CFR 246.27 - Program information.
2010-01-01
..., New Jersey, Pennsylvania, Puerto Rico, Virginia, Virgin Islands, West Virginia: U.S. Department of Agriculture, FNS, Mid-Atlantic Region, Mercer Corporate Park, 300 Corporate Boulevard, Robbinsville, New...
Publications | Page 246 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... Governance, Health, Information and Communication, Natural Resources ... Wednesday, 11 May 2011, saw the fifth Information for Change workshop, held in Lagos ... complex institutions, especially health systems and development projects. ... communities have a set of characteristics that makes them very vulnerable to ...
Publications | Page 246 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Transnational migration of Vietnamese women in Asia : experiences, rights and citizenship; final technical report (restricted access). Women who work in South Korea and Taiwan had access to NGOs and government services when facing difficulties while women in the Gulf region have nowhere to turn. Transnational ...
1-Bromo-2,4,6-tricyclohexylbenzene
Directory of Open Access Journals (Sweden)
Joel T. Mague
2008-01-01
Full Text Available The title compound, C24H25Br, packs efficiently in the crystal structure with no solvent-accessible voids and several intermolecular H...H contacts approximating the sum of the van der Waals radii. The molecule is quite crowded, with intramolecular Br...H and C...H contacts ca 0.38 and 0.30 Å, respectively, less than the sum of the corresponding van der Waals radii. All cyclohexyl rings adopt chair conformations with the `seat' of the chair inclined at approximately 57–81° to the mean plane of the benzene ring, while those ortho to bromine have their centroids displaced in opposite directions from this plane.
43 CFR 24.6 - Cooperative agreements.
2010-10-01
... Congressional policy (e.g., Fish and Wildlife Coordination Act of 1956) of State-Federal cooperation and coordination in the area of fish and wildlife conservation, State and Federal agencies have implemented...: (1) Protection, maintenance, and development of fish and wildlife habitat; (2) Fish and wildlife...
Studies of neutron-deficient mendelevium isotopes at SHIP
Energy Technology Data Exchange (ETDEWEB)
Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Kuusiniemi, P. [University of Oulu, Centre for Underground Physics in Pyhaesalmi (CUPP), Oulu (Finland); Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland)
2010-01-15
The radioactive decay of the isotopes {sup 247}Md, {sup 246}Md and their daughter products was investigated by means of {alpha}-{alpha} and {alpha}-{gamma} coincidence spectroscopy. The isotopes were produced using the fusion reaction {sup 40}Ar + {sup 209}Bi. Decay schemes are suggested for {sup 247}Md and {sup 243}Es. A new isomeric state in {sup 246}Md with a half-life of (4.4{+-}0.8) s was observed. Previous data of electron-capture delayed fission of {sup 246}Md and {sup 242}Es were confirmed. The probability for this decay branch in {sup 246}Md was measured to be P{sub ECDF}>0.10. The probability for electron-capture delayed fission in the case of {sup 242}Es was determined to be P{sub ECDF}=0.013{sup +0.012} {sub -0.007}. (orig.)
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
High Altitude Plant Physiology Research Centre, Srinagar, Pauri Garhwal 246 174 Uttarakhand, India; Department of Forestry & Natural Resources, School of Agriculture & Allied Sciences, HNB Garhwal University, Srinagar, Pauri Garhwal 246 174, Uttarakhand, India; Department of Horticulture, Aromatic & Medicinal Plant, ...
International Nuclear Information System (INIS)
Gurdale-Tack, K.; Aubert, M.; Chartier, F.
2000-01-01
For an accurate determination of the isotopic and elemental composition of americium (Am), curium (Cm), neodymium (Nd) and cesium (Cs) in spent nuclear fuels, performed by Thermal Ionization Mass Spectrometry (TIMS) and Inductively Coupled Plasma Mass Spectrometry (ICP-MS), it is necessary to separate these elements before analysis. This separation is mandatory because of isobaric interferences between americium and curium, neodymium and samarium (Sm) and between cesium and barium (Ba). This is the reason why Ba and Sm are analyzed with the other four elements. Separation is carried out by cation-exchange chromatography on a silica-based stationary phase in the presence of a complexing eluent. The complexing agent is 2-hydroxy-2-methyl butanoic acid (HMB), a monoprotic acid (HL) with a pK a of 3.6. Cations (M n+ ) interact with it to form ML y (n-y)+ complexes. Optimization of chromatographic separation conditions requires monitoring of the pH and eluent composition. The influence of each parameter on metal ion retention and on selectivity was investigated. The first studies on standard solutions with Sm(III), Nd(III), Cs(I) and Ba(II) showed that four conditions allow efficient separation. However, only one allows good separation with a real solution of spent nuclear fuels. This condition is a chelating agent concentration of 0.1 mol.l -1 and a pH of 4.2. With the other conditions, co-elution is observed for Cs(I) and Am(III). The overall results were used to study the retention mechanisms. The aim of this modeling is a closer knowledge of the form in which (M n+ and/or ML y (n-y)+ ...) each cationic element is extracted into the stationary phase. In fact, while cations can exist in the eluent in various forms depending on the analytical conditions, their forms may be different in the stationary phase. (authors)
International Nuclear Information System (INIS)
Pimpl, M.; Schmidt, W.
1984-01-01
The root-uptake of Np, Pu, Am, and Cm from three different artificially contaminated soils in grass, maize, spring wheat, and potatoes was investigated under greenhouse conditions in pots filled with 9 kg contaminated soil and in lysimeters with a surface area of 0,5 m 2 containing the soils in undisturbed profils up to a depth of 80 cm. Only the plough layer of 30 cm was contaminated with Np, Pu, Am, and Cm. Crop cultivation was done corresponding to usual practice in agriculture. Results of the 1st vegetation period are represented. Transfer factors obtained deviate considerably from those which are recommended for the estimation of long-term exposure of man in the Federal Republic of Germany. (orig.)
Multi-recycling of plutonium and incineration of americium, curium, and technetium in PWRs
International Nuclear Information System (INIS)
Golfier, H.; Bergeron, J.; Puill, A.; Rohart, M.
2000-01-01
The future of nuclear power requires a clear strategy for radwaste and Plutonium management. Pressurized water reactors (PWR) and the associated fuel cycle installations represent the largest part of the French power plants (and are partly paid off). The reactors in service produce an annual 10 tons of Pu, 1.4 tons of minor actinides (MA), and 3.8 tons of long-lived fission products (LLFP). The spent fuel is reprocessed in La Hague plant to recover the energetic elements U and Pu. The latter was initially dedicated to power Fast Breeder Reactors that converted the depleted and reprocessed, thus ensuring a significant part of the French national energy resources. The shut-down of Super-Phenix, the postponement of building of Fast Breeder Reactors (FBR) and the relaxed need for stretching natural U resources raise the issue of Pu management. In fact, the Pu mono-recycling practiced in France since 1987 (St Laurent B1) only slows down the Pu accumulation in spent nuclear fuel, yet it is unable to stabilize the Pu inventory. Beyond the cooperation with its industrial partners, CEA investigates solutions for short and medium term Pu management thus contributing to research required for keeping nuclear power as an energy option. The range of these investigations shall cover both adaptations for light water reactors to facilitate Pu recycling and more innovative solutions concerning reactors, fuel and fuel cycle. The aim of using Pu more efficiently in PWR has led, not only for economic and non-proliferation reasons, but also for considerations related to the optimization of Pu and MA management. The mastery of Pu inventory is a requirement for all long-lived radwaste management methods. In this context, the potential of innovative PWRs has been investigated to control the Pu fluxes and to make them a milestone on the way to clean nuclear power. This paper presents the most recent results related to Pu utilization and MA and LLFP incineration like (Am+Cm) and Tc. To determine the influence of the Pu fluxes, a 1450 MWe PWR with one standard and one innovative concept (code named APA for Advanced Plutonium fuel Assembly) have been performed. A multi-recycling scenario is simulated with a 400 TWhe power plant park. (authors)
International Nuclear Information System (INIS)
Fukushima, M.; Chatt, A.
2013-01-01
Soft tissues of cultivated Japanese (Miyagi Prefecture) and South Korean (Koje-do and Kosong) oysters and Japanese rock oysters (Honshu Island) were analyzed to measure silver levels. The soft tissues, namely hepatopancreas, gill, muscle, and mantle were separated, freeze-dried, pulverized, and analyzed by an instrumental neutron activation analysis method in conjunction with Compton suppression spectrometry (INAA-CSS). The method consisted of the irradiation of samples in a neutron flux of 5 x 10 11 cm -2 s -1 using the rapid transfer system in an inner pneumatic irradiation site of the Dalhousie University SLOWPOKE-2 reactor (DUSR) facility for 12-15 s, decay for 20 s, and counting for 60 s. The 657.8-keV gamma-ray of the 24.6-s nuclide 110 Ag was used for assaying silver. The method was validated using NIST, NRC and NIES certified reference materials. An absolute detection limit of 0.05 μg silver using NIST SRM 1566b Oyster Tissue was achieved. About 10-50 times higher levels of silver were found in cultivated Japanese oysters compared to the South Korean ones. The silver concentrations in cultivated oysters in Miyagi Prefecture showed the following trend: gill > mantle > hepatopancreas > muscle as well as on the age. Rock oysters generally had higher silver content compared to cultivated oysters. A very preliminary value of about 0.466 μg silver average intake per person per day was estimated from the consumption of oysters by the people living in the Sendai city of Miyagi Prefecture. (author)
The objective of this study was to evaluate the aquatic chronic lethal and sublethal toxicity effects from the phytoremediation of water contaminated with 2,4,6-trinitrotoluene (2,4,6-TNT) by the wetland plant species Myriophyllum aquaticum (parrot feather). Rotifers (Brachionus...
Relationship between Indian summer monsoon rainfall and position of Pacific Ocean warm pool
Digital Repository Service at National Institute of Oceanography (India)
Gopinathan, C.K.; Sastry, J
stream_size 5 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_246.pdf.txt stream_source_info Indian_J_Mar_Sci_19_246.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Ichikawa, S; Asai, M; Haba, H; Sakama, M; Kojima, Y; Shibata, M; Nagame, Y; Oura, Y; Kawade, K
2002-01-01
A multiple target He/PbI sub 2 aerosol jet system coupled with a thermal ion source was installed in the isotope separator on line (JAERI-ISOL) at the JAERI tandem accelerator facility. The neutron-deficient americium and curium isotopes produced in the sup 2 sup 3 sup 3 sup , sup 2 sup 3 sup 5 U( sup 6 Li, xn) and sup 2 sup 3 sup 7 Np( sup 6 Li, xn) reactions were successfully mass-separated and the overall efficiency including the ionization of Am atoms was evaluated to be 0.3-0.4%. The identification of a new isotope sup 2 sup 3 sup 7 Cm with the present system is reported.
International Nuclear Information System (INIS)
Kaminski, Michael D.
2005-01-01
The US Department of Energy is developing an integrated nuclear fuel cycle technology under its Advanced Fuel Cycle Initiative (AFCI). Under the AFCI, waste minimization is stressed. Engineered product storage materials will be required to store concentrated radioactive cesium, strontium, americium, and curium for periods of tens to hundreds of years. The fabrication of such engineered products has some precedence but the concept is largely novel. We thus present a theoretical model used to calculate the maximum radial dimensions of right cylinder storage forms under several scenarios. Maximum dimensions are small, comparable to nuclear fuel pins in some cases, to avoid centerline melting temperatures; this highlights the need for a careful strategy for engineered product storage fabrication and storage
Trivalent lanthanide/actinide separation in the spent nuclear fuel wastes' reprocessing
International Nuclear Information System (INIS)
Narbutt, J.; Krejzler, J.
2006-01-01
Separation of trivalent actinides, in particular americium and curium, from lanthanides is an important step in an advanced partitioning process for future reprocessing of spent nuclear fuels. Since the trivalent actinides and lanthanides have similar chemistries, it is rather difficult to separate them from each other. The aim of presented work was to study solvent extraction of Am(III) and Eu(III) in a system containing diethylhemi-BTP (6-(5,6-diethyl-1,2,4-triazin-3-yl)-2,2'-bipyridine) and COSAN (protonated bis(chlorodicarbollido)cobalt(III)). The system was chosen by several groups working in the integrated EC research Project EUROPART. Several physicochemical properties of the extraction system were analyzed and discussed
Studies of high-level radioactive waste form performance at Japan Atomic Energy Research Institute
International Nuclear Information System (INIS)
Banba, Tsunetaka; Kamizono, Hiroshi; Mitamura, Hisayoshi
1992-02-01
The recent studies of high-level radioactive waste form at Japan Atomic Energy Research Institute can be classified into the following three categories; (1) Study on the leaching behavior of the nuclear waste glass placing the focus on the alteration layer and the chemical composition of leachant for the prediction of the long-term corrosion of the waste glass. (2) Study on the radiation (alpha-radiation) effects which have relation to the long-term stability of the nuclear waste glass. (3) Study on the long-term self-irradiation damage of a SYNROC waste form using a curium-doped sample. In the present report, the recent results corresponding to the above categories are described. (author)
Final report on fabrication and study of SYNROC containing radioactive waste elements
International Nuclear Information System (INIS)
Reeve, K.D.; Levins, D.M.; Seatonberry, B.W.; Ryan, R.K.; Hart, K.P.; Stevens, G.T.
1987-01-01
Two facilities for the fabrication and testing of Synroc samples containing separate additions of the transuranic actinides americium, plutonium, curium and neptunium, a fission product solution, and two radioisotopes of caesium and strontium were designed, built and operated by the AAEC at the Lucas Heights Research Laboratories. Twenty-one 75 g batches of radioactive Synroc were made and representative samples were characterised by alpha track etching, scanning electron microscopy and aqueous leach testing, mostly at 70 deg C. Where comparisons were possible, radioactive fission products behaved as expected from non-radioactive tests. The leaching behaviour of the actinides was complex but as a group they were the least leachable of all the elements studied
Actinide elements in aquatic and terrestrial environments
International Nuclear Information System (INIS)
Bondietti, E.A.
1978-01-01
Progress is reported in terrestrial ecology studies with regard to plutonium in biota from the White Oak Creek forest; comparative distribution of plutonium in two forest ecosystems; an ecosystem model of plutonium dynamics; actinide element metabolism in cotton rats; and crayfish studies. Progress is reported in aquatic studies with regard to transuranics in surface waters, frogs, benthic algae, and invertebrates from pond 3513; and radioecology of transuranic elements in cotton rats bordering waste pond 3513. Progress is also reported in stability of trivalent plutonium in White Oak Lake water; chemistry of plutonium, americium, curium, and uranium in pond water; uranium, thorium, and plutonium in small mammals; and effect of soil pretreatment on the distribution of plutonium
Use of Low-cost Adsorbents to Chlorophenols and Organic Matter Removal of Petrochemical Wastewater
Directory of Open Access Journals (Sweden)
Aretha Moreira de Oliveira
2013-11-01
Full Text Available The removal of 2,4 diclorophenol (2,4-DCF and 2,4,6 trichlorophenol (2,4,6 TCF present in petrochemical wastewater was evaluated using low-cost adsorbents, such as chitin, chitosan and coconut shells. Batch studies showed that the absorption efficiency for 2,4 DCF and 2,4,6 TCF follow the order: chitosan > chitin > coconut shells. Langmuir and Freundlich models have been applied to experimental isotherms data, to better understand the adsorption mechanisms. Petrochemical wastewater treatment with fixed bed column system using chitinous adsorbents showed a removal of COD (75% , TOG (90% and turbidity (74-89%.
2011-03-10
.... Corporation, West Plains Division, Regal Beloit Corporation. 75,201 Abbott Laboratories, Irving, TX February 9... Jeanerette Distribution Center; Fruit of the Loom; Leased Workers Spherion. 74,902 Abbott Diabetes Care, Inc... Subject firm Location Impact date 75,246 Deluxe Laboratories......... Hollywood, CA 75,246A Deluxe...
Xu, Jinxia; Bai, Zhangjun; Zu, Fanlin; Yan, Fanyong; Wei, Junfu; Zhang, Saihui; Luo, Yunmei
2018-07-05
A convenient, highly sensitive and reliable assay for 2,4,6‑trinitrophenol (TNP) and Fe (III) ion (Fe 3+ ) in the dual spectroscopic manner is developed based on novel carbon dots (CDs). The CDs with highly blue emitting fluorescent were easily prepared via the one-step potassium hydroxide-assisted reflux method from dextrin. The as-synthesized CDs exhibited the high crystalline quality, the excellent fluorescence characteristics with a high quantum yield of ~13.1%, and the narrow size distribution with an average diameter of 6.3±0.5nm. Fluorescence and frequency doubling scattering (FDS) spectra of CDs show the unique changes in the presence of TNP/Fe 3+ by different mechanism. The fluorescence of CDs decreased apparently in the presence of TNP via electron-transfer. Thus, after the experimental conditions were optimized, the linear range for detection TNP is 0-50μM, the detection limit was 19.1nM. With the addition of Fe 3+ , the FDS of CDs appeared to be highly sensitive with a quick response to Fe 3+ as a result of the change concentration of the scattering particle. The emission peak for FDS at 450nm was enhanced under the excitation wavelength at 900nm. The fluorescence response changes linearly with Fe 3+ concentration in the range of 8-40μM, the detection limits were determined to be 44.1nM. The applications of CDs were extended for the detection of TNP, Fe 3+ in real water samples with a high recovery. The results reported here may become the potential tools for the fast response of TNP and Fe 3+ in the analysis of environmental pollutants. Copyright © 2018 Elsevier B.V. All rights reserved.
Paul, Mithun; Sarkar, Koushik; Dastidar, Parthasarathi
2015-01-02
By applying a recently developed crystal engineering rationale, four C3 symmetric tris(pyridylamide) ligands namely 1,3,5-tris(nicotinamidomethyl)-2,4,6-triethylbenzene, 1,3,5-tris(isonicotinamidomethyl)-2,4,6-triethylbenzene, 1,3,5-tris(nicotinamidomethyl)-2,4,6-trimethylbenzene, and 1,3,5-tris(isonicotinamidomethyl)-2,4,6-trimethylbenzene, which contain potential hydrogen-bonding sites, were designed and synthesized for generating Ag(I) coordination polymers and coordination-polymer-based gels. The coordination polymers thus obtained were characterized by single-crystal X-ray diffraction. The silver metallogels were characterized by transmission electron microscopy (TEM) and dynamic rheology. Upon exposure to visible light, these silver metallogels produced silver nanoparticles (AgNPs), which were characterized by TEM, powder X-ray diffraction, energy dispersive X-ray and X-ray photoelectron spectroscopy. These NPs were found to be effectively catalyzed the reduction of 4-nitrophenolate to 4-aminophenolate without the use of any exogenous reducing agent. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
2010-07-01
... Lead Mercury Nickel Silver Tin Titanium Vanadium Zinc (2) The in-plant limitations that apply to metal... Pyridine 2,4,6-trichlorophenol Metal parameters Arsenic Cadmium Chromium Cobalt Copper Lead Mercury Tin...-Cresol p-Cresol n-Decane Fluoranthene n-Octadecane Phenol Pyridine 2,4,6-trichlorophenol Metal parameters...
Experimental studies on removal of airborne haloanisoles by non-thermal plasma air purifiers
DEFF Research Database (Denmark)
Fang, Lei; Hallam, David; Bermúdez, Raúl
2016-01-01
A laboratory study was conducted to test the performance of non-thermal plasma air purifiers on its removal effectiveness of two haloanisoles – 2,4,6-trichloroanisole (TCA) and 2,4,6-Tribromoanisole (TBA). TCA and TBA are the two major compounds found in wine cellars that can contaminate wine to ...
Prevalence of intestinal helminth parasites in stray dogs in urban ...
African Journals Online (AJOL)
A total of 246 faecal samples were collected between October 2015 to February 2016, 154 from stray dogs in Harare and 92 from rural dogs in Arcturas, Goromonzi and Christon Bank. The samples were examined by flotation and sedimentation methods and helminth eggs identified and EPG counted. Of the 246 samples, ...
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
International Nuclear Information System (INIS)
Galle, P.
1982-01-01
The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr
Bondarkov, Mikhail D; Zheltonozhsky, Viktor A; Zheltonozhskaya, Maryna V; Kulich, Nadezhda V; Maksimenko, Andrey M; Farfán, Eduardo B; Jannik, G Timothy; Marra, James C
2011-10-01
Fuel-containing materials sampled from within the Chernobyl Nuclear Power Plant (ChNPP) Unit 4 Confinement Shelter were spectroscopically studied for gamma and alpha content. Isotopic ratios for cesium, europium, plutonium, americium, and curium were identified, and the fuel burn-up in these samples was determined. A systematic deviation in the burn-up values based on the cesium isotopes in comparison with other radionuclides was observed. The studies conducted were the first ever performed to demonstrate the presence of significant quantities of 242Cm and 243Cm. It was determined that there was a systematic underestimation of activities of transuranic radionuclides in fuel samples from inside of the ChNPP Confinement Shelter, starting from 241Am (and going higher) in comparison with the theoretical calculations.
International Nuclear Information System (INIS)
Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu
2010-01-01
Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)
Ballesteros Gomez, A.M.; de Boer, J.; Leonards, P.E.G.
2014-01-01
The presence of a novel brominated flame retardant named 2,4,6-tris(2,4,6-tribromophenoxy)-1,3,5-triazine (TTBP-TAZ) is reported for the first time in plastic parts of consumer products and indoor dust samples. TTBP-TAZ was identified by untargeted screening and can be a replacement of the banned
Czech Academy of Sciences Publication Activity Database
Ptáček, Jiří; Melichar, R.; Hájek, Antonín; Koníček, Petr; Souček, Kamil; Staš, Lubomír; Kříž, P.; Lazárek, J.
2013-01-01
Roč. 10, č. 2 (2013), s. 237-246 ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : structural analysis * deformation * stress * underground gas storage Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_13_Ptacek_237-246.pdf
Kroonblawd, Matthew P; Sewell, Thomas D; Maillet, Jean-Bernard
2016-02-14
In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock.
International Nuclear Information System (INIS)
Kroonblawd, Matthew P.; Sewell, Thomas D.; Maillet, Jean-Bernard
2016-01-01
In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock
Kroonblawd, Matthew P.; Sewell, Thomas D.; Maillet, Jean-Bernard
2016-02-01
In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock.
International Nuclear Information System (INIS)
1976-01-01
Certain 3,5-disubstituted, 2,4,6-triiodoanilides of polyhydroxymonobasic acids have recently been found useful as non-ionic x-ray contrast agents. The 3-(lower acylamino)-5-amino-2,4,6-triiodobenzamides are prepared by hydrogenation of a 3,5-dinitrobenzamide, acylation of the resulting diamino compound to the bis-(acylamino) level and iodination of the acylamino compound
Degradation of chlorophenol mixtures in a fed-batch system by two ...
African Journals Online (AJOL)
This work was undertaken to investigate the effect of variations of the feed rate on a fed-batch set-up used to degrade xenobiotics. The mixture of substrates was composed of PCP, 2,4,6 TCP and 2,3,5,6 TeCP (pentachlorophenol, 2,4,6 trichlorophenol and 2,3,5,6 tetrachlorophenol respectively). Two acclimated bacteria ...
Energy Technology Data Exchange (ETDEWEB)
Higginson, Matthew A.; Livens, Francis R.; Heath, Sarah L. [Manchester Univ. (United Kingdom). Centre for Radiochemistry Research; Thompson, Paul; Marsden, Olivia J. [AWE, Aldermaston, Reading (United Kingdom); Harwood, Laurence M.; Hudson, Michael J. [Reading Univ. (United Kingdom). Dept. of Chemistry; Lewis, Frank W. [Reading Univ. (United Kingdom). Dept. of Chemistry; Northumbria Univ., Newcastle upon Tyne (United Kingdom). Dept. of Chemical and Forensic Sciences
2015-07-01
In analysis of complex nuclear forensic samples containing lanthanides, actinides and matrix elements, rapid selective extraction of Am/Cm for quantification is challenging, in particular due the difficult separation of Am/Cm from lanthanides. Here we present a separation process for Am/Cm(III) which is achieved using a combination of AG1-X8 chromatography followed by Am/Cm extraction with a triazine ligand. The ligands tested in our process were CyMe{sub 4}-BTPhen, CyMe{sub 4}-BTBP, CA-BTP and CA-BTPhen. Our process allows for purification and quantification of Am and Cm (recoveries 80% - 100%) and other major actinides in < 2 d without the use of multiple columns or thiocyanate. The process is unaffected by high level Ca(II)/Fe(III)/Al(III) (10 mg mL{sup -1}) and thus requires little pre-treatment of samples.
Sorption of plutonium and curium on ion exchange resins in mixed aqueous organic solutions
International Nuclear Information System (INIS)
Haidvogel, N.; Reitsamer, G.; Grass, F.
1974-12-01
The sorption of the sulfate and nitrate-complexes of the actinides Pu(III), Pu(IV), Pu(VI), Am(III) and Om(III) on the ion-exchange-resins Dowex 1X8 and Dowex 50 WX8 is investigated. The strong sorbability of these actinide ions in solvents with high content of alcohol is explained by the existence of anionic complexes like Pu(III) (SO 4 ) 2 - , Pu(IV) (SO 4 ) 3 2 - , Pu(VI)O 2 (SO 4 ) 2 2 - , Am(SO 4 ) 2 - respectively Am(NO 3 ) 4 - and Om(NO 3 ) 4 - . The taking of autoradiographs from the thin-layer chromatograms by the aid of a special device and the evaluation of the autoradiographs by a particular photodensitometer are described. The measurement of the radioactivity of the α-emitting nuclides Pu 239, Am 241 and Om 242 are done by liquid-scintillation spectrometry. (author)
Incorporation of plutonium, americium and curium into the Irish Sea seabed by biological activity
Energy Technology Data Exchange (ETDEWEB)
Kershaw, P J; Swift, D J; Pentreath, R J; Lovett, M B
1984-12-01
Bioturbation was considered as a potentially significant mechanism for the incorporation of long-lived radionuclides into the seabed and in particular the activities of a large echiuran Maximulleria lankesteri. Radionuclides of the transuranium elements plutonium, americium and cirium are discharged into the Irish Sea under authorization as part of the low-level liquid effluent from the British Nuclear Fuels plc reprocessing plant at Sellafield, Cumbria, England. The distribution of Pu-239, 240, Pu-238, Am-241, Cm-244 and Cm-242 concentrations and the Pu-239, 240/Pu-238 quotient in samples taken in April and May 1983 from the sediment surface, burrow linings, sediments adjacent to burrows, and the gut contents and body of a large M. lankesteri clearly indicate that bioturbation is responsible, at least in part, for the incorporation of these radionuclides to depths of up to 140 cm. This area of sediments represents a significant present-day sink, but the permanence of this sink and the likelihood that radioactivity will be remobilized and be returned to man, depends on a large number of factors. 15 references, 18 figures.
Energy Technology Data Exchange (ETDEWEB)
Schreckhise, R E; Cline, J F [Battelle Pacific Northwest Labs., Richland, WA (USA)
1980-05-01
Uptake of the nitrate forms of /sup 238/Pu, /sup 239/Pu, /sup 241/Am, /sup 244/Cm and /sup 237/Np from soil into selected parts of four different plant species grown under field conditions was compared Alfalfa, barley, peas and cheatgrass were grown outdoors in small weighing lysimeters filled with soil containing these radionuclides. The plants were harvested at maturity, divided into selected components and radiochemically analyzed by alpha-energy analysis. Soil concentration did not appear to affect the plant uptake of /sup 238/Pu, /sup 239/Pu, /sup 241/Am or /sup 244/Cm for the two levels utilized. The relative plant uptake of the five different transuranics was /sup 237/Np>/sup 244/Cm approximately equal /sup 241/Am>/sup 239/Pu approximately equal/sup 238/Pu. Relative uptake values of Np for various plant parts ranged from 2200 to 45,000 times as great as for Pu, while Am and Cm values were 10-20 times as great. The values for seeds were significantly lower than those for the other aboveground plant parts for all four transuranic elements. The legumes accumulated approx. 10 times more than the grasses. A comparison of the postulated radionuclide content of plants grown in soil contaminated with material from spent liquid metal fast breeder reactor fuels indicated that concentrations of isotopes of Am, Cm and Np would exceed /sup 239/Pu values.
7 CFR 246.7 - Certification of participants.
2010-01-01
... age 5 under the medical assistance program established under Title XIX of the Social Security Act (in... Tribal Organization (including, an Indian tribe, band, or group recognized by the Department of the Interior; or an intertribal council or group which is an authorized representative of Indian tribes, bands...
7 CFR 246.12 - Food delivery systems.
2010-01-01
...). (3) Vendor selection criteria. The State agency must develop and implement criteria to select stores for authorization. The State agency must apply its selection criteria consistently throughout its... period using the vendor selection criteria in effect at the time of the reassessment and must terminate...
7 CFR 246.16 - Distribution of funds.
2010-01-01
... percent of poverty criterion. The Department will determine each State agency's population of persons categorically eligible for WIC which are at or below 185% of poverty, through the best available, nationally... Statistics, for the twelve months ending on March 31 of the fiscal year immediately prior to the adjustment...
7 CFR 246.25 - Records and reports.
2010-01-01
... CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN... normal business hours for representatives of the Department and the Comptroller General of the United...) Financial and participation reports—(1) Monthly reports. (i) State agencies must submit financial and...
7 CFR 246.23 - Claims and penalties.
2010-01-01
... through a review of the State agency's reports, program or financial analysis, monitoring, audit, or... cash-value vouchers and taken appropriate follow-up action on all redeemed food instruments and cash... inability to account for the disposition of each redeemed food instrument or cash-value voucher; and (iii...
Naumenko, Ekaterina Anatolevna; Ahlemeyer, Barbara; Baumgart-Vogt, Eveline
2017-03-01
2,4,6-Trinitrotoluene (TNT) has been widely used as an explosive substance and its toxicity is still of interest as it persisted in polluted areas. TNT is metabolized in hepatocytes which are prone to its toxicity. Since analysis of the human liver or hepatocytes is restricted due to ethical reasons, we investigated the effects of TNT on cell viability, reactive oxygen species (ROS) production, peroxisome proliferation, and antioxidative enzymes in human (HepG2), mouse (Hepa 1-6), and rat (H4IIEC3) hepatoma cell lines. Under control conditions, hepatoma cells of all three species were highly comparable exhibiting identical proliferation rates and distribution of their cell cycle phases. However, we found strong differences in TNT toxicity with the lowest IC 50 values (highest cell death rate) for rat cells, whereas human and mouse cells were three to sevenfold less sensitive. Moreover, a strong decrease in cellular dehydrogenase activity (MTT assay) and increased ROS levels were noted. TNT caused peroxisome proliferation with rat hepatoma cells being most responsive followed by those from mouse and human. Under control conditions, rat cells contained fivefold higher peroxisomal catalase and mitochondrial SOD2 activities and a twofold higher capacity to reduce MTT than human and mouse cells. TNT treatment caused an increase in catalase and SOD2 mRNA and protein levels in human and mouse, but not in rat cells. Similarly, human and mouse cells upregulated SOD2 activity, whereas rat cells failed therein. We conclude that TNT induced oxidative stress, peroxisome proliferation and mitochondrial damage which are highest in rat cells rendering them most susceptible toward TNT. © 2016 Wiley Periodicals, Inc. Environ Toxicol 32: 989-1006, 2017. © 2016 Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
Abdulagatov, I.M.; Zeinalova, A.B.; Azizov, N.D.
2006-01-01
Viscosity of nine aqueous Ni(NO 3 ) 2 solutions (0.050, 0.153, 0.218, 0.288, 0.608, 0.951, 1.368, 1.824, and 2.246) mol . kg -1 was measured in the temperature range from (297 to 475) K and at pressures (0.1, 10, 20, and 30) MPa. The measurements were carried out with a capillary flow technique. The total experimental uncertainty of viscosity, pressure, temperature, and composition measurements were estimated to be less than 1.6%, 0.05%, 15 mK, and 0.02%, respectively. All experimental and derived results are compared with experimental and calculated values reported in the literature. Extrapolation of the solution viscosity measurements to zero concentration (pure water values) for the given temperature and pressure are in excellent agreement (average absolute deviation, AAD = 0.13%) with the values of pure water viscosity from IAPWS formulation [J. Kestin, J.V. Sengers, B. Kamgar-Parsi, J.M.H. Levelt Sengers, J. Phys. Chem. Ref. Data 13 (1984) 175-189]. The viscosity data for the solutions as a function of concentration have been interpreted in terms of the extended Jones-Dole equation for strong electrolytes. The values of viscosity A-, B-, and D-coefficients of the extended Jones-Dole equation for the relative viscosity (η/η ) of aqueous Ni(NO 3 ) 2 solutions as a function of temperature are studied. The derived values of the viscosity A- and B-coefficients were compared with the results predicted by Falkenhagen-Dole theory (limiting law) of electrolyte solutions and the values calculated with the ionic B-coefficient data. The measured values of viscosity for the solutions were also used to calculate the effective rigid molar volumes in the extended Einstein relation for the relative viscosity (η/η )
Impact of partitioning and transmutation in radioactive waste management
International Nuclear Information System (INIS)
Magill, J.
2006-01-01
Nuclear energy provides a significant contribution to the overall energy supply in Europe. With 148 reactors in 13 of the 25 Member States producing a total power of 125 G We, the resulting energy generation of 850 TWh per year provides 35% of the total electrical energy requirements in the European Union. Worldwide, 441 commercial reactors operate in 31 countries and provide 17% of the electrical requirements. Currently 32 nuclear reactors are being built worldwide mostly in India, China and in neighbouring countries. The used fuel discharged from nuclear power plants constitutes the main contribution to nuclear waste in countries which do not undertake reprocessing. As such, its disposal requires isolation from the biosphere in stable deep geological formations for long periods of time (some hundred thousand years) until its radioactivity decreases through the process of radioactive decay. Ways for significantly reducing the volumes and radio toxicities of the waste and to shorten the very long times for which the waste must be stored safely are being investigated. This is the motivation behind the partitioning and transmutation (P and T) activities worldwide. Most of the hazard from the spent fuel stems from only a few chemical elements, namely plutonium, neptunium, americium, curium, and some long-lived fission products such as iodine, caesium and technetium. At present approximately 2500 t of spent fuel are produced annually in the EU, containing about 25 t of plutonium, and 3.5 t of the minor actinides neptunium, americium and curium, and about 3 t of long-lived fission products. These radioactive by-products, although present in relatively low concentrations in the used fuel, are a hazard to life forms when released into the environment. This paper addresses the potential impact of P and T on the long-term disposal of nuclear waste. In particular, it evaluates how realistic P and T scenarios can lead to a reduction in the time required for the waste to be
Lin, Kunde; Zhou, Shiyang; Chen, Xi; Ding, Jiafeng; Kong, Xiaoyan; Gan, Jay
2015-11-01
Hydroxylated polybrominated diphenyl ethers (OH-PBDEs) have been frequently found in the marine biosphere as emerging organic contaminants. Studies to date have suggested that OH-PBDEs in marine biota are natural products. However, the mechanisms leading to the biogenesis of OH-PBDEs are still far from clear. In this study, using a laccase isolated from Trametes versicolor as the model enzyme, we explored the formation of OH-PBDEs from the laccase-catalyzed oxidation of simple bromophenols (e.g., 2,4-DBP and 2,4,6-TBP). Experiments under ambient conditions clearly showed that OH-PBDEs were produced from 2,4-DBP and 2,4,6-TBP in presence of laccase. Polybrominated compounds 2'-OH-BDE68, 2,2'-diOH-BB80, and 1,3,8-TrBDD were identified as the products from 2,4-DBP, and 2'-OH-BDE121 and 4'-OH-BDE121 from 2,4,6-TBP. The production of OH-PBDEs was likely a result of the coupling of bromophenoxy radicals, generated from the laccase-catalyzed oxidation of 2,4-DBP or 2,4,6-TBP. The transformation of bromophenols by laccase was pH-dependant, and was also influenced by enzymatic activity. In view of the abundance of 2,4-DBP and 2,4,6-TBP and the phylogenetic distribution of laccases in the environment, laccase-catalyzed conversion of bromophenols may be potentially an important route for the natural biosynthesis of OH-PBDEs. Copyright © 2015 Elsevier Ltd. All rights reserved.
Sumithran, Suganya; Sono, Masanori; Raner, Gregory M; Dawson, John H
2012-12-01
Horseradish peroxidase (HRP) catalyzes the oxidative para-dechlorination of the environmental pollutant/carcinogen 2,4,6-trichlorophenol (2,4,6-TCP). A possible mechanism for this reaction is a direct oxygen atom transfer from HRP compound I (HRP I) to trichlorophenol to generate 2,6-dichloro 1,4-benzoquinone, a two-electron transfer process. An alternative mechanism involves two consecutive one-electron transfer steps in which HRP I is reduced to compound II (HRP II) and then to the ferric enzyme as first proposed by Wiese et al. [F.W. Wiese, H.C. Chang, R.V. Lloyd, J.P. Freeman, V.M. Samokyszyn, Arch. Environ. Contam. Toxicol. 34 (1998) 217-222]. To probe the mechanism of oxidative halophenol dehalogenation, the reactions between 2,4,6-TCP and HRP compounds I or II have been investigated under single turnover conditions (i.e., without excess H(2)O(2)) using rapid scan stopped-flow spectroscopy. Addition of 2,4,6-TCP to HRP I leads rapidly to HRP II and then more slowly to the ferric resting state, consistent with a mechanism involving two consecutive one-electron oxidations of the substrate via a phenoxy radical intermediate. HRP II can also directly dechlorinate 2,4,6-TCP as judged by rapid scan stopped-flow and mass spectrometry. This observation is particularly significant since HRP II can only carry out one-electron oxidations. A more detailed understanding of the mechanism of oxidative halophenol dehalogenation will facilitate the use of HRP as a halophenol bioremediation catalyst. Copyright © 2012 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Ruff, Christian M.; Muelllich, Udo; Geist, Andreas; Panak, Petra J.
2012-01-01
Reduction of the radiotoxicity and thermal output of radioactive wastes prior to their permanent disposal is a topic of extreme interest for the issue of final nuclear waste disposal. One possibility to this end is a process referred to as actinide separation. This process can be optimised by means of a newly developed water-soluble molecule, as has been shown in studies on the molecule's complex chemistry using ultra-modern laser-based spectroscopy methods under process-relevant reaction conditions. Through the use of curium (III) and europium (III), which as members of the trivalent actinides and lanthanides family have excellent spectroscopic properties, it has been possible to generate spectroscopic and thermodynamic data which will facilitate our understanding of the complex chemistry and extraction chemistry of this molecule family.
International Nuclear Information System (INIS)
Ackermann, R.J.; Chandrasekharaiah, M.S.
1975-01-01
The thermodynamic data for the actinide metals and oxides (thorium to curium ) have been assessed, examined for consistency, and compared with the lanthanides. Correlations relating the enthalpies of formation of the solid oxides with the corresponding aquo ions make possible the estimation of the thermodynamic properties of AmO 2 (s) and Am 2 O 3 (s) which are in accordance with vaporization data. The known thermodynamic properties of the substoichiometric dioxides MOsub(2-x)(s) at high temperatures demonstrate the relative stabilities of valence states less than 4+ and lead to the examination of stability requirements for the sesquioxides M 2 O 3 (s) and the monoxides MO(s). Sequential trends in the gaseous metals, monoxides and dioxides are examined, compared, and contrasted with the lanthanides. (author)
The analysis and handling concept of minor actinides of NPP’s waste by using Ads technology
International Nuclear Information System (INIS)
Silakhuddin
2008-01-01
The contents of minor actinide elements (americium, neptunium and curium) on the spent fuel inventory from PWR operation of NPP have been calculated using Vista program. The calculation used parameters: enrichment 3.968%, power 1000 M We and burn-up is 60 M Wd/kg. The result of calculation showed that the arising of minor actinide elements on the spent fuel is 16.205 kg/year and 43.471 kg/year for PWR-UOX and PWR-MOX respectively. It is also discussed a concept of the use of ADS technology for transmuting the minor actinide elements contained in spent fuels. The result of the discussion showed that an ADS of 400 M Wth will serve 7 PWRs-UOX, and on the PWR system using UOX and MOX fuels an ADS will serve 3 PWRs. (author)
Potentialities of innovating concepts for the management of radioactive wastes
International Nuclear Information System (INIS)
Boullis, B.
2001-01-01
Nuclear energy has very good assets for the future: economic competitiveness, respect of the environment (no emission of greenhouse gas) and preservation of natural resources (breeding capacity). The main challenge concerns nuclear fuel cycle back-end that is the future of spent fuel but in fact all the cycle is involved because new reactor concepts and multi-recycle strategies can be defined to reduce the amount of high level radioactive wastes. Studies confirm that for an annual production of 400 TWh, it is possible to get a drastic reduction of radiotoxicity of wastes: of about a 3 to 5 ratio by multi-recycling plutonium, of about a 10 to 20 ratio by multi-recycling both plutonium and americium, of about a 100 ratio by multi-recycling plutonium, americium and curium. (A.C.)
International Nuclear Information System (INIS)
Koehler, S.; Albus, F.; Dibenberger, R.; Erdmann, N.; Funk, H.; Hasse, H.; Herrmann, G.; Huber, G.; Kluge, H.; Nunnemann, M.; Passler, G.; Rao, P.M.; Riegel, J.; Trautmann, N.; Urban, F.
1995-01-01
Resonance ionization mass spectroscopy (RIMS) is used for the precise determination of the first ionization potential of transuranium elements. The first ionization potentials (IP) of americium and curium have been measured for the first time to IP Am =5.9738(2) and IP Cm =5.9913(8) eV, respectively, using only 10 12 atoms of 243 Am and 248 Cm. The same technique was applied to thorium, neptunium, and plutonium yielding IP T H =6.3067(2), IP N P =6.2655(2), and IP Pu =6.0257(8) eV. The good agreement of our results with the literature data proves the precision of the method which was additionally confirmed by the analysis of Rydberg seris of americium measured by RIMS. copyright American Institute of Physics 1995
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
Miletic, Vesna; Pongprueksa, Pong; De Munck, Jan; Brooks, Neil R; Van Meerbeek, Bart
2013-10-01
To compare the degree of conversion (DC) of adhesives initiated by diphenyl(2,4,6-trimethylbenzoyl)phosphine oxide (TPO) or a camphorquinone/tertiary amine system (CQ/Amine) as well as their 'immediate' micro-tensile bond strength (μTBS) to bur-cut dentine. DC of Scotchbond Universal ('SBU'; 3M ESPE), its experimental counterpart containing TPO as photo-initiator system, an experimental G-aenial Bond ('Ga-B'; GC) adhesive formulation, and an experimental LUB-102 adhesive formulation ('LUB', Kuraray Noritake), containing as photo-initiatior system either 2wt% CQ along with 2wt% tertiary amine ('SBU_CQ/Amine'; 'Ga-B_CQ/Amine'; 'LUB_CQ/Amine'), or 2wt% TPO ('SBU_TPO'; 'Ga-B_TPO'; 'LUB_TPO'), was determined using Fourier-transform infrared spectroscopy (FTIR), after being cured with a dual-wavelength light-curing unit (bluephase 20i, Ivoclar Vivadent). The same adhesive formulations were applied to bur-cut mid-coronal dentine of intact human molars, and subjected to a μTBS test after 1-week water storage. Besides being applied following a self-etch (SE) application mode, the adhesive formulations SBU_CQ/Amine and SBU_TPO were also applied following an etch-and-rinse (E&R) mode, this both for DS and μTBS measurement. No significant difference in DC was found for any of the adhesive formulations, except for SBU_CQ/Amine_SE and SBU_TPO_SE. For both SBU formulations, a significantly higher DC was reached for the E&R than the SE approach. Regarding μTBS, no significant differences were recorded, except for the significantly higher μTBS measured for SBU_CQ/Amine_E&R and SBU_TPO_E&R. In self-etch adhesives, the photo-initiator TPO may be used instead of CQ/Amine. The curing and 'immediate' bonding efficiency depended on the application protocol (E&R versus SE), but not on the photo-initiator system. The photo-initiator TPO may be used in self-etch adhesives instead of CQ/Amine with similar curing and 'immediate' bonding efficiency. Copyright © 2013 Elsevier Ltd. All
New effective chemically synthesized anti-smallpox compound NIOCH-14.
Mazurkov, Oleg Yu; Kabanov, Alexey S; Shishkina, Larisa N; Sergeev, Alexander A; Skarnovich, Maksim O; Bormotov, Nikolay I; Skarnovich, Maria A; Ovchinnikova, Alena S; Titova, Ksenya A; Galahova, Darya O; Bulychev, Leonid E; Sergeev, Artemiy A; Taranov, Oleg S; Selivanov, Boris A; Tikhonov, Alexey Ya; Zavjalov, Evgenii L; Agafonov, Alexander P; Sergeev, Alexander N
2016-05-01
Antiviral activity of the new chemically synthesized compound NIOCH-14 (a derivative of tricyclodicarboxylic acid) in comparison with ST-246 (the condensed derivative of pyrroledione) was observed in experiments in vitro and in vivo using orthopoxviruses including highly pathogenic ones. After oral administration of NIOCH-14 to outbred ICR mice infected intranasally with 100 % lethal dose of ectromelia virus, it was shown that 50 % effective doses of NIOCH-14 and ST-246 did not significantly differ. The 'therapeutic window' varied from 1 day before infection to 6 days post-infection (p.i.) to achieve 100-60 % survival rate. The administration of NIOCH-14 and ST-246 to mice resulted in a significant reduction of ectromelia virus titres in organs examined as compared with the control and also reduced pathological changes in the lungs 6 days p.i. Oral administration of NIOCH-14 and ST-246 to ICR mice and marmots challenged with monkeypox virus as compared with the control resulted in a significant reduction of virus production in the lungs and the proportion of infected mice 7 days p.i. as well as the absence of disease in marmots. Significantly lower proportions of infected mice and virus production levels in the lungs as compared with the control were demonstrated in experiments after oral administration of NIOCH-14 and ST-246 to ICR mice and immunodeficient SCID mice challenged with variola virus 3 and 4 days p.i., respectively. The results obtained suggest good prospects for further study of the chemical compound NIOCH-14 to create a new smallpox drug on its basis.
International Nuclear Information System (INIS)
Musikas, C.; Germain, M.; Bathellier, A.
1979-01-01
This paper deals with Am (VI) - Cm (III) separation in nitrate media. The kinetics of oxidation of Am (III) by sodium persulfate in the presence of Ag + ions were reinvestigated by studying the effect of additions of small amounts of reagents which do not drastically change the distribution coefficients of Am (VI) or Cm (III) ions. Organo phosphorus solvents were selected because they are radiation resistant, possess weak reductant properties and that their affinity for hexavalent ion is high. The operating procedure was selected by consideration of the results of the two previous investigations. This can be done by using a centrifugal contactor enabling in to set organic-aqueous phase contact time in accordance with the kinetics of extraction of Am (VI), oxidation of Am (III) in aqueous phase, and reduction of Am (VI) in organic phase
The design of the DUPIC spent fuel bundle counter
International Nuclear Information System (INIS)
Menlove, H.O.; Rinard, P.M.; Kroncke, K.E.; Lee, Y.G.
1997-05-01
A neutron coincidence detector had been designed to measure the amount of curium in the fuel bundles and associated process samples used in the direct use of plutonium in Canadian deuterium-uranium (CANDU) fuel cycle. All of the sample categories are highly radioactive from the fission products contained in the pressurized water reactor (PWR) spent fuel feed stock. Substantial shielding is required to protect the He-3 detectors from the intense gamma rays. The Monte Carlo neutron and photon calculational code has been used to design the counter with a uniform response profile along the length of the CANDU-type fuel bundle. Other samples, including cut PWR rods, process powder, waste, and finished rods, can be measured in the system. This report describes the performance characteristics of the counter and support electronics. 3 refs., 23 figs., 6 tabs
International Nuclear Information System (INIS)
Wrenn, M.E.
1981-01-01
The primary purpose of actinide chelation is to decrease the risk from radiation-induced cancer. While occupational exposures in the past have mainly involved low specific activity 239 Pu, future exposures will increasingly involve high specific activity plutonium, americium, and curium - all of which clear more rapidly from the lung. This will tend to shift the cancer risk from lung to bone and liver. Although therapy with Ca- or Zn-DTPA rapidly removes 241 Am from the canine, the sub-human primate, and the human liver, improved methods for removal from bone and lung are needed. DTPA can remove 241 Am more easily from the growing skeleton of a child than from the mature skeleton of an adult. Investigators at Karlsruhe are developing chelation agents for oral administration and are investigating the reduction in local dose to bone resulting from chelation therapy
Transuranic biokinetic parameters for marine invertebrates--a review.
Ryan, T P
2002-04-01
A catalogue of biokinetic parameters for the transuranic elements plutonium, americium, curium, neptunium, and californium in marine invertebrates is presented. The parameters considered are: the seawater-animal concentration factor (CF); the sediment-animal concentration ratio (CR); transuranic assimilation efficiency; transuranic tissue distribution and transuranic elimination rates. With respect to the seawater-animal CF, authors differ considerably on how they define this parameter and a seven-point reporting system is suggested. Transuranic uptake from sediment by animals is characterised by low CRs. The assimilation efficiencies of transuranic elements in marine invertebrates are high compared to vertebrates and mammals in general and the distribution of transuranics within the body tissue of an animal is dependent on the uptake path. The elimination of transuranics from most species examined conformed to a standard biphasic exponential model though some examples with three elimination phases were identified.
Influence of FIMA burnup on actinides concentrations in PWR reactors
Directory of Open Access Journals (Sweden)
Oettingen Mikołaj
2016-01-01
Full Text Available In the paper we present the study on the dependence of actinides concentrations in the spent nuclear fuel on FIMA burnup. The concentrations of uranium, plutonium, americium and curium isotopes obtained in numerical simulation are compared with the result of the post irradiation assay of two spent fuel samples. The samples were cut from the fuel rod irradiated during two reactor cycles in the Japanese Ohi-2 Pressurized Water Reactor. The performed comparative analysis assesses the reliability of the developed numerical set-up, especially in terms of the system normalization to the measured FIMA burnup. The numerical simulations were preformed using the burnup and radiation transport mode of the Monte Carlo Continuous Energy Burnup Code – MCB, developed at the Department of Nuclear Energy, Faculty of Energy and Fuels of AGH University of Science and Technology.
Review of Integral Experiments for Minor Actinide Management
International Nuclear Information System (INIS)
Gil, C.S.; Glinatsis, G.; Hesketh, K.; Iwamoto, O.; Okajima, S.; Tsujimoto, K.; Jacqmin, R.; Khomyakov, Y.; Kochetkov, A.; Kormilitsyn, M.; Palmiotti, G.; Salvatores, M.; Perret, G.; Rineiski, A.; Romanello, V.; Sweet, D.
2015-01-01
Spent nuclear fuel contains minor actinides (MAs) such as neptunium, americium and curium, which require careful management. This becomes even more important when mixed oxide (MOX) fuel is being used on a large scale since more MAs will accumulate in the spent fuel. One way to manage these MAs is to transmute them in nuclear reactors, including in light water reactors, fast reactors or accelerator-driven subcritical systems. The transmutation of MAs, however, is not straightforward, as the loading of MAs generally affects physics parameters, such as coolant void, Doppler and burn-up reactivity. This report focuses on nuclear data requirements for minor actinide management, the review of existing integral data and the determination of required experimental work, the identification of bottlenecks and possible solutions, and the recommendation of an action programme for international co-operation. (authors)
Minor actinides transmutation scenario studies with PWRs, FRs and moderated targets
International Nuclear Information System (INIS)
Grouiller, J.P.; Pillon, S.; Saint Jean, C. de; Varaine, F.; Leyval, L.; Vambenepe, G.; Carlier, B.
2003-01-01
Using current technologies, we have demonstrated in this study that it is theoretically possible to obtain different minor actinide transmutation scenarios with a significant gain on the waste radiotoxicity inventory. The handling of objects with Am+Cm entails the significant increase of penetrating radiation sources (neutron and γ) whatever mixed scenario is envisioned; the PWR and FR scenario involving the recycling of Am + Cm in the form of targets results in the lowest flow. In the light of these outcomes, the detailed studies has allowed to design a target sub assembly with a high fission rate (90%) and define a drawing up of reprocessing diagram with the plant head, the minor actinide separation processes (PUREX, DIAMEX and SANEX). Some technological difficulties appear in manipulating curium, principally in manufacturing where the wet process ('sol-gel') is not acquired for (Am+Cm). (author)
Energy Technology Data Exchange (ETDEWEB)
Fukahori, Tokio [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-03-01
Under International Science Research Center (ISTC) projects, JAERI Nuclear Data Center has been taking a role of collaborator and monitor for following items; (1) Measurement of the Fission Neutron Spectra of the Minor Actinides and Spontaneous Fission of Curium Isotopes (ISTC no. 183: V.I. Khlopin Radium Institute, KRI, St. Petersburg, Russia), (2) Measurement and Analysis of the Basic Nuclear Data for Minor Actinides (ISTC no. 304: Institute of Physics and Power Engineering, IPPE, Obninsk, Russia), and Evaluation of Actinide Nuclear Data (ISTC no. CIS-3: Radiation Physics and Chemistry Problems Institute, RPCPI, Minsk, Belarus). These are related to the Japanese OMEGA Project and expected to supply minor actinide (MA) nuclear data, since Russia has good quality MA samples, experimental technique and nuclear data evaluation experiences. In this report, out-line and some results of above three projects are reviewed. (author)
Mobility of U, Np, Pu, Am and Cm from spent nuclear fuel into bentonite clay
International Nuclear Information System (INIS)
Ramebaeck, H.; Skaalberg, M.; Eklund, U.B.; Kjellberg, L.; Werme, L.
1998-01-01
The mobility of uranium, neptunium, plutonium, americium and curium from spent nuclear fuel (UO 2 ) into compacted bentonite was studied. Pieces of spent BWR UO 2 fuel was embedded in a compacted bentonite clay/low saline synthetic groundwater system. After a contact time of six years the bentonite was sliced into 0.1 mm thick slices and analysed for its content of actinides. Radiometric as well as inductively coupled plasma mass spectrometry (ICP-MS) were used for the analysis. The influence on the mobility by the addition of metallic iron, metallic copper and vivianite (Fe(II)-mineral) to the bentonite clay was investigated. The results show a low mobility of actinides in bentonite clay. Except for uranium the mobility of the other actinides could, after six years of diffusion time, only be detected less than 1 mm from the spent fuel. (orig.)
International Nuclear Information System (INIS)
Bringer, O.
2007-10-01
This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241 Am and 237 Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241 Am isomeric branching ratio were precisely measured at thermal energy point. (author)
Am/Cm Vitrification Process: Pretreatment Material Balance Calculations
International Nuclear Information System (INIS)
Smith, F.G.
2001-01-01
This report documents material balance calculations for the pretreatment steps required to prepare the Americium/Curium solution currently stored in Tank 17.1 in the F-Canyon for vitrification. The material balance uses the latest analysis of the tank contents to provide a best estimate calculation of the expected plant operations during the pretreatment process. The material balance calculations primarily follow the material that directly leads to melter feed. Except for vapor products of the denitration reactions and treatment of supernate from precipitation and precipitate washing, the flowsheet does not include side streams such as acid washes of the empty tanks that would go directly to waste. The calculation also neglects tank heels. This report consolidates previously reported results, corrects some errors found in the spreadsheet and provides a more detailed discussion of the calculation basis
Conceptual methods for actinide partitioning
International Nuclear Information System (INIS)
Leuze, R.E.; Bond, W.D.; Tedder, D.W.
1978-01-01
The conceptual processing sequence under consideration is based on a combination of modified Purex processing and secondary processing of the high-level waste. In this concept, iodine will be removed from dissolver solution prior to extraction, and the Purex processing will be modified so that low- and intermediate-level wastes, all the way through final product purification, are recycled. A supplementary extraction is assumed to ensure adequate recovery of uranium, neptunium and possibly plutonium. Technetium may be removed from the high-level waste if a satisfactory method can be developed. Extraction into a quaternary amine is being evaluated for this removal. Methods that have been used in the past to recover americium and curium have some rather serious deficiencies, including inadequate recovery, solids formation and generation of large volumes of low- and intermediate-level wastes containing significant quantities of chemical reagents
Flammability Analysis For Actinide Oxides Packaged In 9975 Shipping Containers
Energy Technology Data Exchange (ETDEWEB)
Laurinat, James E.; Askew, Neal M.; Hensel, Steve J.
2013-03-21
Packaging options are evaluated for compliance with safety requirements for shipment of mixed actinide oxides packaged in a 9975 Primary Containment Vessel (PCV). Radiolytic gas generation rates, PCV internal gas pressures, and shipping windows (times to reach unacceptable gas compositions or pressures after closure of the PCV) are calculated for shipment of a 9975 PCV containing a plastic bottle filled with plutonium and uranium oxides with a selected isotopic composition. G-values for radiolytic hydrogen generation from adsorbed moisture are estimated from the results of gas generation tests for plutonium oxide and uranium oxide doped with curium-244. The radiolytic generation of hydrogen from the plastic bottle is calculated using a geometric model for alpha particle deposition in the bottle wall. The temperature of the PCV during shipment is estimated from the results of finite element heat transfer analyses.
Chilukuri, Nymisha; West, Meredith; Henderson, Janice Lynn; Lawson, Shari; Ehsanipoor, Robert; Costigan, Kathleen; Polk, Sarah; Bennett, Wendy
2015-07-03
Pregnancy and the postpartum period provide windows of opportunity to impact perinatal and lifelong preventive health behavior for women and their families, but these opportunities are often missed. Understanding racial/ethnic differences in information and communication technology (ICT) use could inform technology-based interventions in diverse populations. The objective of the study was to evaluate differences in the use of ICT between racial and ethnic groups as well as by English language proficiency. We conducted a cross-sectional study of 246 women who were aged 18 years or older and pregnant or within 1 year of delivery. They were recruited from 4 hospital-based outpatient clinics and completed a self-administered survey. We used multivariate regression analysis to evaluate the association between race/ethnicity and ICT (mobile phone/short message service [SMS] text message, Internet, and social network) usage by race/ethnicity and perceived English language proficiency after adjusting for age, income, marital status, and insurance status. In all, 28% (69/246) of participants were Latina, 40% (98/246) were African American, 23% (56/246) were white, and 9% (23/246) from other racial/ethnic groups. Of the Latinas, 84% (58/69) reported limited English language proficiency and 59% (41/69) were uninsured. More than 90% of all participants reported mobile phone use, but more than 25% (65/246) had changed phone numbers 2 or more times in the past year. Compared to white women, African American women were less likely to SMS text message (OR 0.07, 95% CI 0.01-0.63) and Latinas were less likely to use the Internet to find others with similar concerns (OR 0.23, 95% CI 0.08-0.73). Women with limited English language proficiency were less likely to use the Internet overall (OR 0.30, 95% CI 0.09-0.99) or use email (OR 0.22, 95% CI 0.08-0.63) compared to women with adequate English language proficiency. Mobile phones are widely available for the delivery of health
1935 15' Quad #246 Aerial Photo Mosaic Index
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
48 CFR 252.246-7001 - Warranty of data.
2010-10-01
... exceed ten percent of the total contract price. (ii) If the breach of the warranty is with respect to the..., DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions And... contract entitled, Rights in Technical Data and Computer Software. (b) Warranty. Notwithstanding inspection...