Measurement of curium in marine samples
Schneider, D. L.; Livingston, H. D.
1984-06-01
Measurement of environmentally small but detectable amounts of curium requires reliable, accureate, and sensitive analytical methods. The radiochemical separation developed at Woods Hole is briefly reviewed with specific reference to radiochemical interferences in the alpha spectrometric measurement of curium nuclides and to the relative amounts of interferences expected in different oceanic regimes and sample types. Detection limits for 242 Cm and 244 Cm are ultimately limited by their presence in the 243Am used as curium yield monitor. Environmental standard reference materials are evaluated with regard to curium. The marine literature is reviewed and curium measurements are discussed in relation to their source of introduction to the environment. Sources include ocean dumping of low-level radioactive wastes and discharges from nuclear fuel reporcessing activities, In particular, the question of a detectable presence of 244Cm in global fallout from nuclear weapons testing is addressed and shown to be essentially negligible. Analyses of Scottish coastal sedimantes show traces of 242Cm and 244Cm activity which are believed to originate from transport from sources in the Irish Sea.
Biological transport of curium-243 in dairy animals
International Nuclear Information System (INIS)
Sutton, W.W.; Patzer, R.G.; Hahn, P.B.; Potter, G.D.
1979-04-01
Lactating cows and goats were used to examine the biological transport of curium-243 in dairy animals. After either single oral or intravenous nuclide doses were administered, samples of milk, urine, blood, and feces were taken over a 144-hr priod, and the curium concentrations were determined by gamma counting. Gastrointestinal uptake of curium was estimated to be 0.02 and 0.006% of the oral dose for cows and goats, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.6 x 10 -4 and 1.9 x 10 -3 , respectively, for a cow and 2.7 x 10 -4 and 1.6 x 10 -4 , respectively, for goats. Plasma concentrations of curium decreased rapidly following all intravenous injections. The average percentage of injected curium transferred to milk, urine, and feces was 2, 8, and 1, respectively, for a cow and 2, 5, and 5, respectively, for goats. All animals were sacrificed one week after dosing. Bovine bone retained the greatest fraction of the administered dose and the next highest was the liver. However, in all three intravenously dosed goats the liver contained the greatest amount of curium. Nuclide deposition in bone and liver was essentially equal for two of the three orally dosed goats while the skeleton contained the most curium in the other animal. Comparisons are presented between curium-243 and americium-241 transport in dairy cows
Infrared spectrum of curium-244
International Nuclear Information System (INIS)
Conway, J.G.; Blaise, J.; Verges, J.
1974-09-01
The spectrum of curium-244 has been observed on the high resolution Fourier-transform spectrometer at Laboratoire Aime Cotton. An electrodeless lamp containing 50 μg of CmI 3 was run for 12 hours and 800,000 points were taken. A total of 1743 lines have been ascribed to curium and 87 percent of the lines have been assigned to transitions between known energy levels
International Nuclear Information System (INIS)
Chuveleva, Eh.A.; Kharitonov, O.V.; Firsova, L.A.
1994-01-01
Certain heavy rare earths, curium and americium were separated by the method of displacement complexing chromatography using DTPA solutions and solutions containing DTPA and citric acid as eluents. Separation factors of rare earths and curium (americium) were calculated. Imitators for curium and americium separation were suggested: thulium for curium elution using 0.025 mol/l DTPA, holmium-for curium elution using 0.025 mol/l DTPA in the presence of 0.025 mol/l citric acid; terbium can serve as the imitator in both cases. 5 refs., 5 figs
PROCESS FOR SEPARATING AMERICIUM AND CURIUM FROM RARE EARTH ELEMENTS
Baybarz, R.D.; Lloyd, M.H.
1963-02-26
This invention relates to methods of separating americium and curium values from rare earth values. In accordance with the invention americium, curium, and rare earth values are sorbed on an anion exchange resin. A major portion of the rare earth values are selectively stripped from the resin with a concentrated aqueous solution of lithium chloride, and americium, curium, and a minor portion of rare earth values are then stripped from the resin with a dilute aqueous solution of lithium chloride. The americium and curium values are further purified by increasing the concentration of lithium chloride in the solution to at least 8 molar and selectively extracting rare earth values from the resulting solution with a monoalkylphosphoric acid. (AEC)
The curium tagging approach for enhanced safeguards for spent fuel handling and reprocessing
International Nuclear Information System (INIS)
Menlove, H.O.; Beddingfield, D.H.; Rinard, P.M.; Wenz, T.R.
1999-01-01
Because of the intense neutron emission rate from curium, it can be a useful signature to measure and track special nuclear material in spent fuel and waste. By measuring the concentration of curium as well as plutonium and uranium in spent fuel streams, the ratio of curium to plutonium, uranium or other actinides can be used for waste assay. The quantity of special nuclear material in the waste streams such as the leached hulls and vitrified high-level waste can be calculated from the ratio of the curium to the plutonium, etc. The quantity of curium can be measured from the neutron emission rate from the various waste streams in the presence of the high-level gamma-ray backgrounds from fission products. Examples of using the curium ratio technique for measuring plutonium in leached hulls and vitrified waste canisters are presented in this paper. (author)
A contribution to preparative micro-chemistry and structural chemistry of element 96, curium
International Nuclear Information System (INIS)
Kohl, R.
1984-01-01
Ternary oxides of curium are analyzed by preparing a spectrum of different phases and characterizing it by radiography. Physical and thermodynamic data are established on curium trihalogenides. Particular interest is taken in experiments for preparing curium of the higher valency stages IV, V, and VI. (orig./PW) [de
Analytical separation of americium and curium, using high performance liquid chromatography
International Nuclear Information System (INIS)
Billon, A.
1978-01-01
Americium and curium are separated on a column of cation exchange resin (Aminex) using hydroxyisobutyric acid (α HIBA) as eluent, at a temperature of 80 0 C. Americium and curium were detected in line using their α emission: the separation was performed in a shielded glove box whose setting-up is given. Finally, the time necessary for a separation is comprised between 30 min and 1 hr. The purity of separated fractions was assayed by mass-spectrometry. An application in the determination of isotopic composition of americium and curium in fuels is described
Sorption of curium by silica colloids: Effect of humic acid
International Nuclear Information System (INIS)
Kar, Aishwarya Soumitra; Kumar, Sumit; Tomar, B.S.; Manchanda, V.K.
2011-01-01
Sorption of curium by silica colloids has been studied as a function of pH and ionic strength using 244 Cm as a tracer. The sorption was found to increase with increasing pH and reach a saturation value of ∼95% at pH beyond 5.3. The effect of humic acid on the sorption of 244 Cm onto silica was studied by changing the order of addition of the metal ion and humic acid. In general, in the presence of humic acid (2 mg/L), the sorption increased at lower pH (<5) while it decreased in the pH range 6.5-8 and above pH 8, the sorption was found to increase again. As curium forms strong complex with humic acid, its presence results in the enhancement of curium sorption at lower pH. At higher pH the humic acid present in the solution competes with the surface sites for curium thus decreasing the sorption. The decrease in the Cm sorption in presence of humic acid was found to be less when humic acid was added after the addition of curium. Linear additive model qualitatively reproduced the profile of the Cm(III) sorption by silica in presence of humic acid at least in the lower pH region, however it failed to yield quantitative agreement with the experimental results. The results of the present study evidenced the incorporation of Cm into the silica matrix.
Process for the recovery of curium-244 from nuclear waste
International Nuclear Information System (INIS)
Posey, J.C.
1980-10-01
A process has been designed for the recovery of curium from purex waste. Curium and americium are separated from the lanthanides by a TALSPEAK extraction process using differential extraction. Equations were derived for the estimation of the economically optimum conditions for the extraction using laboratory batch extraction data. The preparation of feed for the extraction involves the removal of nitric acid from the Purex waste by vaporization under reduced pressure, the leaching of soluble nitrates from the resulting cake, and the oxalate precipitation of a pure lanthanide-actinide fraction. Final separation of the curium from americium is done by ion-exchange. The steps of the process, except ion-exchange, were tested on a laboratory scale and workable conditions were determined
Gut uptake factors for plutonium, americium and curium
International Nuclear Information System (INIS)
Harrison, J.D.
1982-01-01
Data on estimates of the absorption of plutonium, americium and curium from the human gut based on measurements of uptake in other mammalian species are reviewed. It is proposed that for all adult members of the public ingesting low concentrations of plutonium in food and water, 0.05% would be an appropriate value of absorption except when the conditions of exposure are known and a lower value can be justified. For dietary intakes of americium and curium, the available data do not warrant a change from the ICRP value of 0.05%. For newborn children ingesting americium, curium and soluble forms of plutonium, a value of 1% absorption is proposed for the first 3 months of life during which the infant is maintained on a milk diet. It is proposed that a value of 0.5% should be used for the first year of life to take account of the gradual maturation of the gut. In considering the ingestion of insoluble oxides of plutonium by infants, it is proposed that absorption is taken as 0.1% for the first 3 months and 0.05% for the first year. (author)
Study of Reaction of Curium Oxy-Compound Formation in Molten Chlorides
Energy Technology Data Exchange (ETDEWEB)
Osipenko, A.G.; Mayorshin, A.A.; Bychkov, A.V. [Dimitrovgrad-10, Ulyanovsk region, 433510 (Russian Federation)
2008-07-01
The method of potentiometric titration using oxygen sensors with solid electrolyte membrane was applied for the study of the interaction of curium cations with oxygen anions in the molten alkali metal chlorides in the temperature range of 450-850 C degrees depending on oxy-acidity of the environment. Assumptions were made concerning ion and phase composition of the obtained high-temperature compounds and chemical reactions taking place in the melts. This scheme assumes that as the basicity of the melt increases, initially the formation of soluble curium oxychlorides takes place in the melt (presumably CmO{sup -}) that is followed by formation of solid CmOCl and finally sesquioxide Cm{sub 2}O{sub 3}. Basic thermodynamic values were calculated for the resultant curium oxy-compounds.
The biokinetics and radiotoxicology of curium: A comparison with americium
Energy Technology Data Exchange (ETDEWEB)
Menetrier, F. [CEA, Fontenay-aux-Roses (France); Taylor, D.M. [School of Chemistry, Cardiff University, Cardiff CF10 3AT (United Kingdom)], E-mail: davtay@btinternet.com; Comte, A. [CEA, Fontenay-aux-Roses (France)
2008-05-15
The human and animal data on the biokinetics of {sup 242}Cm and {sup 244}Cm are reviewed and shown to be very similar to those for {sup 241}Am. Liver and skeleton are the main organs of deposition and the retention of curium in the skeleton is very prolonged in all the species examined. Retention of both curium and americium in the liver appears to be species-dependent, being relatively rapidly removed from the liver of rats, and probably humans, but being tenaciously retained in dogs and some other species. The radiotoxicity of curium is also reviewed and it is shown that, as with {sup 241}Am, lung and bone tumour induction are the major hazards from inhaled and systemically deposited {sup 244}Cm. The use of chelating agents for the treatment of accidental contamination of the human body with {sup 242,244}Cm is also discussed.
Plant uptake of americium, curium, and the chemical analog neodymium
International Nuclear Information System (INIS)
Weimer, W.C.; Laul, J.C.; Kutt, J.C.; Bondietti, E.A.
1977-01-01
The plant uptake from several bulk soils has been determined for neodymium, a chemical analog to the transuranium elements americium and curium, and several other native rare earth elements as well. These investigations have demonstrated that neodymium, which has very similar chemical properties to amercium and curium and should have a similar environmental behavior, does behave indistinguishably under both laboratory and field conditions. The uptake of the weathered or mobile forms of these elements from soils is expected to be governed primarily by their identical oxidation states and nearly identical ionic radii. This hypothesis is strongly supported by the chondritic (primordial) normalized rare earth element patterns in several plants. In these samples, the entire series of rare earth elements behaves as a smooth function of the REE ionic radii, as is also seen in the contiguous soils. This behavior suggests that the plant uptake of other ions with similar chemical properties (i.e., americium and curium) would also be governed by ionic size and charge
Americium/Curium Disposition Life Cycle Planning Study
International Nuclear Information System (INIS)
Jackson, W.N.; Krupa, J.; Stutts, P.; Nester, S.; Raimesch, R.
1998-01-01
At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS)
Americium/curium bushing melter drain tests
International Nuclear Information System (INIS)
Smith, M.E.; Hardy, B.J.; Smith, M.E.
1997-01-01
Americium and curium were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. They have been stored in a nitric acid solution in an SRS reprocessing facility for a number of years. Vitrification of the americium/curium (Am/Cm) solution will allow the material to be safely stored or transported to the DOE Oak Ridge Reservation. Oak Ridge is responsible for marketing radionuclides for research and medical applications. The bushing melter technology being used in the Am/Cm vitrification research work is also under consideration for the stabilization of other actinides such as neptunium and plutonium. A series of melter drain tests were conducted at the Savannah River Technology Center to determine the relationship between the drain tube assembly operating variables and the resulting pour initiation times, glass flowrates, drain tube temperatures, and stop pour times. Performance criteria such as ability to start and stop pours in a controlled manner were also evaluated. The tests were also intended to provide support of oil modeling of drain tube performance predictions and thermal modeling of the drain tube and drain tube heater assembly. These drain tests were instrumental in the design of subsequent melter drain tube and drain tube heaters for the Am/Cm bushing melter, and therefore in the success of the Am/Cm vitrification and plutonium immobilization programs
International Nuclear Information System (INIS)
Yamagishi, Isao; Choi, Yong-Joon; Glatz, Jean-Paul; Hyland, Bronwyn; Uhlir, Jan; Baron, Pascal; Warin, Dominique; DE ANGELIS, Giorgio; LUCE, Alfredo; Inoue, Tadashi; Morita, Yasuji; Minato, Kazuo; Lee, Han Soo; Ignatiev, Victor V.; Kormilitsyn, Mikhail V.; Caravaca, Concepcion; Lewin, Robert g.; Taylor, Robin J.; Collins, Emory D.; Laidler, James J.
2012-01-01
Curium is closely associated with americium in irradiated fuels because of their chemical similarity with regard to potential separation requirements, and because americium also requires special shielding and handling requirements due to its gamma radiation emission. Americium is produced in greater mass than curium in irradiated nuclear fuels and the mass ratio can grow exponentially with decay time because of the simultaneous decay of 244 Cm and in-growth of 241 Am from decay of 241 Pu (half-life = 14.4 years). For these reasons, curium management is challenging. Countries that are now engaged in or planning future fuel recycle operations, are considering methods to manage the curium produced and minimise the shielding and handling requirements, as well as the reprocessing requirements for separation of curium from americium France, Japan, and the USA have begun curium management studies. Curium management methods under consideration include (1) separation of curium from americium and storage of curium for several decades to allow 244 Cm to decay substantially to 240 Pu, while moving ahead to recycle americium; (2) recycling of americium and curium without separation; and (3) waiting several decades to reprocess used nuclear fuels, allowing decay minimisation of curium emissions and the requirement for separation of curium from americium, and allowing an alteration of the subsequent transmutation path to reduce the production of curium in recycled used fuels. In this report, recent curium management studies in France, Japan, and the USA have been described. The French studies included scenarios that compared the recycle of ail minor actinides (neptunium, americium, and curium) with the recycle of only neptunium and americium in radial blankets of sodium-cooled fast reactors (SFR). In the latter scenario, curium is separated from americium during used fuel reprocessing and stored for 5000 years to allow 244 Cm to decay to 240 Pu which is then recycled. Even though
Calculation of prompt neutron spectra for curium isotopes
Energy Technology Data Exchange (ETDEWEB)
Ohsawa, Takaaki [Kinki Univ., Higashi-Osaka, Osaka (Japan). Atomic Energy Research Inst.
1997-03-01
With the aim of checking the existing evaluations contained in JENDL-3.2 and providing new evaluations based on a methodology proposed by the author, a series of calculations of prompt neutron spectra have been undertaken for curium isotopes. Some of the evaluations in JENDL-3.2 was found to be unphysically hard and should be revised. (author)
The rapid determination of americium curium, and uranium in urine by ultrafiltration
International Nuclear Information System (INIS)
Stradling, G.N.; Popplewell, D.S.; Ham, G.J.; Griffin, R.
1975-01-01
The rapid ultrafiltration method developed for the assay of plutonium has been extended to the determination of americium, curium and uranium in urine. The limits of detection for americium and curium, and uranium are 0.09 and 0.12 dm -1 l -1 respectively, and the analysis time excluding counting less than 2 hours. The method can therefor be effectively used as a rapid screening procedure. When the reference level for plutonium is exceeded, the α activity may require to be characterised. The single ultrafiltration technique must be modified for turbid urine samples. The method is inappropriate, except for uranium, when the urine contains DTPA. (author)
Thermodynamic systematics of oxides of americium, curium, and neighboring elements
International Nuclear Information System (INIS)
Morss, L.R.
1984-01-01
Recently-obtained calorimetric data on the sesquioxides and dioxides of americium and curium are summarized. These data are combined with other properties of the actinide elements to elucidate the stability relationships among these oxides and to predict the behavior of neighboring actinide oxides. 45 references, 4 figures, 5 tables
In vitro dissolution of curium oxide using a phagolysosomal simulant solvent system
International Nuclear Information System (INIS)
Helfinstine, S.Y.; Guilmette, R.A.; Schlapper, G.A.
1992-01-01
Detailed study of actinide oxide behavior in alveolar macrophages (AM) in vitro is limited because of the short life span of these cells in culture. We created an in vitro dissolution system that could mimic the acidic phagolysosomal environment for the actinide and be maintained for an indefinite period so that dissolution of more insoluble materials could be measured. The dissolution system for this investigation, consisting of nine different solutions of HCl and the chelating agent diethylenetriamine pentaacetate (DTPA) in distilled water, is called the phagolysosomal simulant solvent (PSS). In this system, both the pH and the amount of DTPA were varied. We could observe the effect of altering pH within a range of 4.0-6.0 (similar to that of the phagolysosome) and the effect of the molar ratio of DTPA to curium at 1000: 1, 100;1, or 10:1. We chose curium sesquioxide ( 244 Cm 2 O 3 ) to validate the PSS for actinide dissolution versus that occurring in AM in vitro because it dissolves significantly in less than 1 week. The polydisperse 244 Cm 2 O 3 aerosol was generated, collected on filters, resuspended, and added to the PSS solutions and to cultured canine AM. By comparing dissolution in the two systems directly, we hoped to arrive at an optimum PSS for future dissolution studies. PSS and cell culture samples were taken daily for 7 days after exposure and tested for the solubilized curium. The amount of soluble material was determined by ultracentrifugation to separate the insoluble CM 2 O 3 from the soluble curium in the PSS solutions and filtration for the cell-containing material. After separating the soluble and insoluble fractions, the samples were analyzed using alpha liquid scintillation counting. Time-dependent dissolution measurements from the PSS/AM showed that the CM 2 O 3 dissolution was similar for both the PSS solutions and the cultured AM. 13 refs., 4 tabs
Extraction separation of americium and curium. A review
International Nuclear Information System (INIS)
Petrzilova, H.
1976-11-01
A survey is given of extraction systems suitable for transplutonium element separation and preparation as well as for the practical application of their nuclear properties. Methods are discussed in detail of separating the actinide and the lanthanide fractions from fission and corrosion products and of separating americium from curium. The description is completed with flowsheets showing the separation of transplutonium elements from irradiated targets and waste solutions after spent fuel reprocessing. (L.K.)
International Nuclear Information System (INIS)
Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.
1983-01-01
Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed
International Nuclear Information System (INIS)
Rinard, P.M.; Menlove, H.O.
1996-03-01
In large-scale reprocessing plants for spent fuel assemblies, the quantity of plutonium in the waste streams each year is large enough to be important for nuclear safeguards. The wastes are drums of leached hulls and cylinders of vitrified high-level liquid waste. The plutonium amounts in these wastes cannot be measured directly by a nondestructive assay (NDA) technique because the gamma rays emitted by plutonium are obscured by gamma rays from fission products, and the neutrons from spontaneous fissions are obscured by those from curium. The most practical NDA signal from the waste is the neutron emission from curium. A diversion of waste for its plutonium would also take a detectable amount of curium, so if the amount of curium in a waste stream is reduced, it can be inferred that there is also a reduced amount of plutonium. This report studies the feasibility of tracking the curium through a reprocessing plant with neutron measurements at key locations: spent fuel assemblies prior to shearing, the accountability tank after dissolution, drums of leached hulls after dissolution, and canisters of vitrified high-level waste after separation. Existing pertinent measurement techniques are reviewed, improvements are suggested, and new measurements are proposed. The authors integrate these curium measurements into a safeguards system
Determination of plutonium, americium and curium in the marine environment
International Nuclear Information System (INIS)
Grenaut, CLaude; Germain, Pierre; Miramand, Pierre.
1982-01-01
The method used in the Laboratory for plutonium, americium and curium determination in marine samples (water, sediments, animals, plants) is presented. It is a modification of a procedure based on adsorption on ion exchange resins developed by other authors. The preliminary preparation of the samples, the radiochemical procedures and electrodeposition are described so as to be used as a practical handbook [fr
Final report on the decontamination of the Curium Source Fabrication Facility
International Nuclear Information System (INIS)
Schaich, R.W.
1983-12-01
The Curium Source Fabrication Facility (CSFF) at Oak Ridge National Laboratory (ORNL) was decontaminated to acceptable contamination levels for maintenance activities, using standard decontamination techniques. Solid and liquid waste volumes were controlled to minimize discharges to the ORNL waste systems. This program required two years of decontamination effort at a total cost of approximately $700K. 5 references, 7 figures, 2 tables
Pretreatment of americium/curium solutions for vitrification
International Nuclear Information System (INIS)
Rudisill, T.S.
1996-01-01
Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to the heavy isotope programs at Oak Ridge National Laboratory. Prior to vitrification, an in-tank oxalate precipitation and a series of oxalic/nitric acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Pretreatment development experiments were performed to understand the behavior of the lanthanides and the metal impurities during the oxalate precipitation and properties of the precipitate slurry. The results of these experiments will be used to refine the target glass composition allowing optimization of the primary processing parameters and design of the solution transfer equipment
Electrochemistry of oxygen-free curium compounds in fused NaCl-2CsCl eutectic
International Nuclear Information System (INIS)
Osipenko, A.; Maershin, A.; Smolenski, V.; Novoselova, A.; Kormilitsyn, M.; Bychkov, A.
2010-01-01
This work presents the electrochemical study of Cm(III) in fused NaCl-2CsCl eutectic in the temperature range 823-1023 K. Transient electrochemical techniques such as cyclic, differential pulse and square wave voltammetry, and chronopotentiometry have been used in order to investigate the reduction mechanism of curium ions up to the metal. The results obtained show that the reduction reaction takes place in a single step Cm(III)+3e-bar →Cm(0). The diffusion coefficient of [CmCl 6 ] 3- complex ions was determined by cyclic voltammetry at different temperatures by applying the Berzins-Delahay equation. The validity of the Arrhenius law was also verified and the activation energy for diffusion was found to be 44.46 kJ/mol. The apparent standard electrode potential of the redox couple Cm(III)/Cm(0) was found by chronopotentiometry at several temperatures. The thermodynamic properties of curium trichloride have also been calculated.
National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242
International Nuclear Information System (INIS)
Adams, J.P.
1995-08-01
This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 ( 242 Cm). This report also includes discussions about waste types and forms in which 242 Cm can be found and 242 Cm behavior in the environment and in the human body
National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242
Energy Technology Data Exchange (ETDEWEB)
Adams, J.P.
1995-08-01
This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 ({sup 242}Cm). This report also includes discussions about waste types and forms in which {sup 242}Cm can be found and {sup 242}Cm behavior in the environment and in the human body.
Americium/Curium Vitrification Pilot Tests - Part II
International Nuclear Information System (INIS)
Marra, J.E.; Baich, M.A.; Fellinger, A.P.; Hardy, B.J.; Herman, D.T.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T. K.; Stone, M.E.
1998-05-01
Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. A previous paper described operation results from the Am-Cm Melter 2A pilot system, a full-scale non-radioactive pilot facility. This paper presents the results from continued testing in the Pilot Facility and also describes efforts taken to look at alternative vitrification process operations and flowsheets designed to address the problems observed during melter 2A pilot testing
Energy Technology Data Exchange (ETDEWEB)
Salminen, S.
2009-07-01
In this work, separation methods have been developed for the analysis of anthropogenic transuranium elements plutonium, americium, curium and neptunium from environmental samples contaminated by global nuclear weapons testing and the Chernobyl accident. The analytical methods utilized in this study are based on extraction chromatography. Highly varying atmospheric plutonium isotope concentrations and activity ratios were found at both Kurchatov (Kazakhstan), near the former Semipalatinsk test site, and Sodankylae (Finland). The origin of plutonium is almost impossible to identify at Kurchatov, since hundreds of nuclear tests were performed at the Semipalatinsk test site. In Sodankylae, plutonium in the surface air originated from nuclear weapons testing, conducted mostly by USSR and USA before the sampling year 1963. The variation in americium, curium and neptunium concentrations was great as well in peat samples collected in southern and central Finland in 1986 immediately after the Chernobyl accident. The main source of transuranium contamination in peats was from global nuclear test fallout, although there are wide regional differences in the fraction of Chernobyl-originated activity (of the total activity) for americium, curium and neptunium. The separation methods developed in this study yielded good chemical recovery for the elements investigated and adequately pure fractions for radiometric activity determination. The extraction chromatographic methods were faster compared to older methods based on ion exchange chromatography. In addition, extraction chromatography is a more environmentally friendly separation method than ion exchange, because less acidic waste solutions are produced during the analytical procedures. (orig.)
Quantitative determination of americium and curium in solutions using potassium tungstophosphate
International Nuclear Information System (INIS)
Chistyakov, V.M.; Baranov, A.A.; Erin, E.A.; Timoaeev, G.A.
1990-01-01
Two methods of americium (4) and curium (4) titration-replacement and redox ones - have been considered. According to the replacement method thorium nitrate solution was used as a titrant and the final point of titration was determined spectophotometrically. Using the method developed, on the basis of experimental data, the composition of thorium (4) complex with potassium tungstophosphate was determined. In case of the redox titration sodium nitrite was used, and the final titration point was indicated either spectrophotometrically or potentiometrically
Vitrification of F-area americium/curium: feasibility study and preliminary process recommendation
International Nuclear Information System (INIS)
Ramsey, W.G.; Miller, D.; Minichan, R.; Coleman, L.; Schumacher, R.; Hardy, B.; Jones, R.
1994-01-01
Work was performed to identify a process to vitrify the contents of F- canyon Tank 17.1. Tank 17.1 contains the majority of americium (Am) and curium (Cm) contained in the DOE Complex. Oak Ridge National Laboratory (ORNL) has made a formal request for this material as fuel for production of Cf252 and other transplutonium actinides. The Am and Cm (and associated lanthanide fission products) are currently in nitric acid solution. Transportation of the intensely radioactive Am/Cm in liquid form is not considered possible. As a result, the material will either be solidified and shipped to ORNL or discarded to the Tank Farm. Nuclear Materials Processing Technology (NMPT), therefore, requested Defense Waste Processing Technology (DWPT) to determine if the Tank 17.1 material could be vitrified, and if it was vitrified could the americium and curium be successfully recovered. Research was performed to determine if the Tank 17.1 contents could indeed be mixed with glass formers and vitrified. Additional studies identified critical process parameters such as heat loading, melter requirements, off-gas evolution, etc. Discussions with NMPT personnel were initiated to determine existing facilities where this work could be accomplished safely. A process has been identified which will convert the Am/Cm material into approximately 300kg of glass
Remote micro-encapsulation of curium-gold cermets
International Nuclear Information System (INIS)
Coops, M.S.; Voegele, A.L.; Hayes, W.N.; Sisson, D.H.
1980-01-01
A technique is described for fabricating minature, high-density capsules of curium-244 oxide contained in three concentric jackets of metallic gold (or silver), with the outer surface being free of alpha contamination. The completed capsules are right circular cylinders 0.2500-inch diameter and 0.125-inch tall, with each level of containment soldered (or brazed) closed. A typical capsule would contain approx. 70 mg of 244 Cm (5.7 Ci) mixed with 120 mg of gold powder in the form of a cermet wafer clad in three concentric, 0.010-inch thick, liquid tight jackets. This method of fabrication eliminates voids between the jackets and produces a minimum size, maximum density capsule. Cermet densities of 11.5 g/cc were obtained, with an overall density of 17.3 g/cc for the finished capsule
Americium-curium vitrification process development
International Nuclear Information System (INIS)
Fellinger, A.P.; Baich, M.A.; Hardy, B.J
1999-01-01
The successful demonstration of sequentially drying, calcining and vitrifying an oxalate slurry in the Drain Tube Test Stand (DTTS) vessel provided the process basis for testing on a larger scale in a cylindrical induction heated melter. A single processing issue, that of batch volume expansion, was encountered during the initial stage of testing. The increase in batch volume centered on a sintered frit cap and high temperature bubble formation. The formation of a sintered frit cap expansion was eliminated with the use of cullet. Volume expansions due to high temperature bubble formation (oxygen liberation from cerium reduction) were mitigated in the DTTS melter vessel through a vessel temperature profile that effectively separated the softening point of the glass cullet and the evolving oxygen from cerium reduction. An increased processing temperature of 1,470 C and a two hour hold time to find any remaining bubbles successfully reduced bubbles in the poured glass to an acceptable level. The success of the preliminary process demonstrations provided a workable process basis that was directly applicable to the newly installed Cylindrical Induction Melter (CIM) system, making the batch flowsheet the preferred option for vitrification of the americium-curium surrogate feed stream
International Nuclear Information System (INIS)
Bigelow, J.E.; Collins, E.D.; King, L.J.
1979-01-01
At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter
International Nuclear Information System (INIS)
Box, W.D.; Klima, B.B.; Seagren, R.D.; Shappert, L.B.; Aramayo, G.A.
1980-06-01
An analytical evaluation of the Oak Ridge National Laboratory Transuranium (TRU) Curium Shipping Container was made to demonstrate its compliance with the regulations governing offsite shipment of packages containing radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of the evaluation show that the container complies with the applicable regulations
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Delay time. 236.563 Section 236.563 Transportation... Cab Signal Systems Rules and Instructions; Locomotives § 236.563 Delay time. Delay time of automatic... requirements of § 236.24 shall take into consideration the delay time. ...
49 CFR 236.588 - Periodic test.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Periodic test. 236.588 Section 236.588..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.588 Periodic test. Except as provided in § 236.586, periodic test of the automatic train stop, train control, or cab signal apparatus...
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Gambling. 2.36 Section 2.36 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.36 Gambling. (a) Gambling in any form, or the operation of gambling...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Block. 236.708 Section 236.708 Transportation... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.708 Block. A length of track of defined limits, the use of which by trains is governed by block signals, cab signals, or both. ...
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Audit. 236.901 Section 236.901... AND INTEREST REDUCTION PAYMENT FOR RENTAL PROJECTS Audits § 236.901 Audit. Where a State or local... mortgagor of a mortgage insured or held by the Commissioner under this part, it shall conduct audits in...
49 CFR 236.717 - Characteristics, operating.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Characteristics, operating. 236.717 Section 236.717 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.717 Characteristics, operating. The measure of electrical values at which electrical or electronic...
49 CFR 236.105 - Electric lock.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock. 236.105 Section 236.105 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION...: All Systems Inspections and Tests; All Systems § 236.105 Electric lock. Electric lock, except forced...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Shoe, latch. 236.801 Section 236.801 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.801...
49 CFR 236.384 - Cross protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Cross protection. 236.384 Section 236.384 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... and Tests § 236.384 Cross protection. Cross protection shall be tested at least once every six months...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Chart, dog. 236.718 Section 236.718 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.718 Chart, dog. A...
49 CFR 236.742 - Dog, locking.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Dog, locking. 236.742 Section 236.742 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.742 Dog...
8 CFR 236.13 - Ineligible aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 236.13 Section 236.13 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE AND DEPORTABLE ALIENS; REMOVAL OF ALIENS ORDERED REMOVED Family Unity Program § 236...
International Nuclear Information System (INIS)
Stumpf, Th.; Fanghaenel, Th.
2002-01-01
Cm(III) interaction with calcite was investigated in the trace concentration range. Two different Cm(III)/calcite sorption species were found. The first Cm(III) sorption species consists of a curium ion that is bonded onto the calcite surface. The second Cm(III) sorption species has lost its complete hydration sphere and is incorporated into the calcite bulk structure /1/. (orig.)
49 CFR 236.705 - Bar, locking.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Bar, locking. 236.705 Section 236.705..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.705 Bar, locking. A bar in an interlocking machine to which the locking dogs are attached. ...
49 CFR 236.516 - Power supply.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Power supply. 236.516 Section 236.516..., Train Control and Cab Signal Systems Standards § 236.516 Power supply. Automatic cab signal, train stop, or train control device hereafter installed shall operate from a separate or isolated power supply...
49 CFR 236.587 - Departure test.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Departure test. 236.587 Section 236.587..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.587 Departure test. (a) The...: (1) Operation over track elements; (2) Operation over test circuit; (3) Use of portable test...
49 CFR 236.777 - Operator, control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Operator, control. 236.777 Section 236.777..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.777 Operator, control. An employee assigned to operate the control machine of a traffic control system. ...
49 CFR 236.814 - Station, control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Station, control. 236.814 Section 236.814..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.814 Station, control. The place where the control machine of a traffic control system is located. ...
49 CFR 236.771 - Machine, control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Machine, control. 236.771 Section 236.771..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.771 Machine, control. An assemblage of manually operated devices for controlling the functions of a traffic...
2010-10-01
... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.712 Brake pipe. A pipe running from the engineman's brake valve through the train, used for the transmission of air under... 49 Transportation 4 2010-10-01 2010-10-01 false Brake pipe. 236.712 Section 236.712 Transportation...
42 CFR 438.236 - Practice guidelines.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Practice guidelines. 438.236 Section 438.236 Public... Improvement Standards § 438.236 Practice guidelines. (a) Basic rule: The State must ensure, through its...) Adoption of practice guidelines. Each MCO and, when applicable, each PIHP and PAHP adopts practice...
49 CFR 236.721 - Circuit, control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Circuit, control. 236.721 Section 236.721..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.721 Circuit, control. An electrical circuit between a source of electric energy and a device which it operates. ...
24 CFR 236.60 - Excess Income.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Excess Income. 236.60 Section 236... § 236.60 Excess Income. (a) Definition. Excess Income consists of cash collected as rent from the... Rent. The unit-by-unit requirement necessitates that, if a unit has Excess Income, the Excess Income...
Americium/Curium Melter 2A Pilot Tests
International Nuclear Information System (INIS)
Smith, M.E.; Fellinger, A.P.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T.K.; Stone, M.E.; Witt, D.C.
1998-05-01
Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. To this end, the Am/Cm Melter 2A pilot system, a full-scale non- radioactive pilot plant of the system to be installed at the reprocessing facility, was designed, constructed and tested. The full- scale pilot system has a frit and aqueous feed delivery system, a dual zone bushing melter, and an off-gas treatment system. The main items which were tested included the dual zone bushing melter, the drain tube with dual heating and cooling zones, glass compositions, and the off-gas system which used for the first time a film cooler/lower melter plenum. Most of the process and equipment were proven to function properly, but several problems were found which will need further work. A system description and a discussion of test results will be given
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Dog, swing. 236.743 Section 236.743 Transportation... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.743 Dog, swing. A locking dog mounted in such a manner that it is free to rotate on a trunnion which is riveted to a locking...
49 CFR 236.809 - Signal, slotted mechanical.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, slotted mechanical. 236.809 Section 236.809 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.809 Signal, slotted mechanical. A mechanically operated signal with an electromagnetic device...
International Nuclear Information System (INIS)
Yaita, T.; Hirata, M.; Narita, H.; Tachimori, S.; Yamamoto, H.; Edelstein, N.M.; Bucher, J.J.; Shuh, D.K.; Rao, L.
2001-01-01
Co-ordination properties of diglycol-amide (DGA) to trivalent curium and to the trivalent lanthanides were studied by the EXAFS, the XRD and the XPS methods. The structural determinations by both the crystal XRD and the solution EXAFS methods showed that the DGA co-ordinated to the trivalent lanthanide ion in a tridentate fashion: co-ordination of three oxygen atoms of each ligand to the metal ion. The bond distances of Er-O (carbonyl) and Er-O (ether) in the Er-DGA complex were 2.35 Angstrom, and 2.46 Angstrom, respectively, while the atom distances of Cm-O (carbonyl) and Cm-O (ether) in the Cm-DGA complex were 2.42 Angstrom and 3.94 Angstrom, respectively from the EXAFS data for the Cm-DGA complex. Accordingly, the DGA would behave only as a semi-tridentate in the co-ordination to trivalent curium in solution. We determined the valence band structures of the Er-DGA complex by the XPS in order to clarify the bond properties of the complex, and assigned the XPS spectrum by using the DV-DS molecular orbital calculation method. (authors)
Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986
International Nuclear Information System (INIS)
Love, G.L.; Butler, H.M.; Duncan, D.T.; Oakes, T.W.
1986-04-01
This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances
49 CFR 236.52 - Relayed cut-section.
2010-10-01
..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Rules and Instructions: All Systems Track Circuits § 236.52 Relayed cut-section. Where relayed cut-section is used in... 49 Transportation 4 2010-10-01 2010-10-01 false Relayed cut-section. 236.52 Section 236.52...
48 CFR 852.236-78 - Government supervision.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government supervision. 852.236-78 Section 852.236-78 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.236-78 Government supervision. As prescribed in...
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Filing. 236.14 Section 236.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE... initial denial, to allow the alien the opportunity to file a new Form I-817 application in order to...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions. 23.6 Section 23.6 Commerce and Foreign Trade Office of the Secretary of Commerce USE OF PENALTY MAIL IN THE LOCATION AND... entities outside the Office of the Secretary charged with carrying out specified substantive functions (i.e...
Transmutation of americium and curium incorporated in zirconia-based host materials
International Nuclear Information System (INIS)
Raison, P.E.
2001-01-01
Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO 2 -ZrO 2 -Y 2 O 3 . It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO 2 content. The Cm 2 O 3 -ZrO 2 system was also investigated. It was found that at 25 mol% of CmO 1.5 , the Cm(III) stabilized zirconia in its cubic form (a = 5.21 ±0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO 1.5 , a pyrochlore oxide - Cm 2 Zr 2 O 7 - is formed (a = 10.63 ±0.02 Angstrom). (author)
Density of simulated americium/curium melter feed solution
International Nuclear Information System (INIS)
Rudisill, T.S.
1997-01-01
Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70 degrees C. The measured density decreased linearly at a rate of 0.0007 g/cm3/degree C from an average value of 1.2326 g/cm 3 at 20 degrees C to an average value of 1.1973g/cm 3 at 70 degrees C
Density of simulated americium/curium melter feed solution
Energy Technology Data Exchange (ETDEWEB)
Rudisill, T.S.
1997-09-22
Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70{degrees} C. The measured density decreased linearly at a rate of 0.0007 g/cm3/{degree} C from an average value of 1.2326 g/cm{sup 3} at 20{degrees} C to an average value of 1.1973g/cm{sup 3} at 70{degrees} C.
48 CFR 252.236-7000 - Modification proposals-price breakdown.
2010-10-01
...-price breakdown. 252.236-7000 Section 252.236-7000 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.236-7000 Modification proposals—price breakdown. As prescribed in 236.570(a), use the following clause: Modification Proposals—Price Breakdown (DEC 1991) (a) The...
48 CFR 552.236-77 - Specifications and Drawings
2010-10-01
... Drawings 552.236-77 Section 552.236-77 Federal Acquisition Regulations System GENERAL SERVICES....236-77 Specifications and Drawings As prescribed in 536.570-8, insert the following clause: Specifications and Drawings (SEP 1999) The requirements of the clause entitled “Specifications and Drawings for...
Marçalo, Joaquim; Gibson, John K.
2009-09-01
An assessment of the gas-phase energetics of neutral and singly and doubly charged cationic actinide monoxides and dioxides of thorium, protactinium, uranium, neptunium, plutonium, americium, and curium is presented. A consistent set of metal-oxygen bond dissociation enthalpies, ionization energies, and enthalpies of formation, including new or revised values, is proposed, mainly based on recent experimental data and on correlations with the electronic energetics of the atoms or cations and with condensed-phase thermochemistry.
49 CFR 236.761 - Locking, electric.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, electric. 236.761 Section 236.761 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Locking, electric. The combination of one or more electric locks and controlling circuits by means of...
49 CFR 236.765 - Locking, mechanical.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, mechanical. 236.765 Section 236.765 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Locking, mechanical. An arrangement of locking bars, dogs, tappets, cross locking and other apparatus by...
49 CFR 236.707 - Blade, semaphore.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Blade, semaphore. 236.707 Section 236.707 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Blade, semaphore. The extended part of a semaphore arm which shows the position of the arm. ...
49 CFR 236.787 - Protection, cross.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Protection, cross. 236.787 Section 236.787 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Protection, cross. An arrangement to prevent the improper operation of a signal, switch, movable-point frog...
49 CFR 236.804 - Signal, block.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, block. 236.804 Section 236.804 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Signal, block. A roadway signal operated either automatically or manually at the entrance to a block. ...
Transmutation of americium and curium incorporated in zirconia-based host materials
Energy Technology Data Exchange (ETDEWEB)
Raison, P.E. [CEA Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. d' Etudes des Combustibles; Haire, R.G. [Oak Ridge National Lab., TN (United States)
2001-07-01
Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO{sub 2}-ZrO{sub 2}-Y{sub 2}O{sub 3}. It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO{sub 2} content. The Cm{sub 2}O{sub 3}-ZrO{sub 2} system was also investigated. It was found that at 25 mol% of CmO{sub 1.5}, the Cm(III) stabilized zirconia in its cubic form (a = 5.21 {+-}0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO{sub 1.5}, a pyrochlore oxide - Cm{sub 2}Zr{sub 2}O{sub 7} - is formed (a = 10.63 {+-}0.02 Angstrom). (author)
49 CFR 236.702 - Arm, semaphore.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Arm, semaphore. 236.702 Section 236.702 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., semaphore. The part of a semaphore signal displaying an aspect. It consists of a blade fastened to a...
49 CFR 236.790 - Release, time.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Release, time. 236.790 Section 236.790... Release, time. A device used to prevent the operation of an operative unit until after the expiration of a predetermined time interval after the device has been actuated. ...
49 CFR 236.791 - Release, value.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Release, value. 236.791 Section 236.791 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Release, value. The electrical value at which the movable member of an electromagnetic device will move to...
International Nuclear Information System (INIS)
Holm, E.; Fukai, R.
1976-01-01
While transplutonic elements are only slightly sorbed to anion exchangers from hydrochloric or nitric acid media, the presence of alcohol enhances the anionic exchange of these elements, especially in nitric and sulfuric solutions. In the present work a method has been developed for determining americium and curium in environmental samples, on the basis of the difference between the sorption characteristics to anion exchangers in the acid-methanol system of these transplutonic elements and those of plutonium, polonium and thorium. The method also permits us to perform sequential determination of plutonium, when necessary
46 CFR 169.236 - Inspection and testing required.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection and testing required. 169.236 Section 169.236... Inspection and Certification Repairs and Alterations § 169.236 Inspection and testing required. (a) The... involving riveting, welding, burning, or other fire-producing actions may be made— (1) Within or on the...
49 CFR 236.776 - Movement, trailing.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Movement, trailing. 236.776 Section 236.776 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Movement, trailing. The movement of a train over the points of a switch which face in the direction in...
49 CFR 236.774 - Movement, facing.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Movement, facing. 236.774 Section 236.774 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Movement, facing. The movement of a train over the points of a switch which face in a direction opposite to...
48 CFR 53.236-1 - Construction.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Construction. 53.236-1... AND FORMS FORMS Prescription of Forms 53.236-1 Construction. The following forms are prescribed, as stated below, for use in contracting for construction, alteration, or repair, or dismantling, demolition...
49 CFR 236.806 - Signal, home.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, home. 236.806 Section 236.806 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Signal, home. A roadway signal at the entrance to a route or block to govern trains in entering and using...
49 CFR 236.768 - Locking, time.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, time. 236.768 Section 236.768... Locking, time. A method of locking, either mechanical or electrical, which, after a signal has been caused to display an aspect to proceed, prevents, until after the expiration of a predetermined time...
28 CFR 2.36 - Rescission guidelines.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Rescission guidelines. 2.36 Section 2.36... guidelines. (a) The following guidelines shall apply to the sanctioning of disciplinary infractions or new... such period of confinement has resulted from initial parole to a detainer). These guidelines specify...
48 CFR 552.236-72 - Specialist.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Specialist. 552.236-72... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.236-72 Specialist. As prescribed in 536.570-3, insert the following clause: Specialist (APR 1984) The term “Specialist...
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Heat. 552.236-80 Section... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.236-80 Heat. As prescribed in 536.570-11, insert the following clause: Heat (APR 1984) Unless otherwise specified or unless already...
The use of curium neutrons to verify plutonium in spent fuel and reprocessing wastes
International Nuclear Information System (INIS)
Miura, N.
1994-05-01
For safeguards verification of spent fuel, leached hulls, and reprocessing wastes, it is necessary to determine the plutonium content in these items. We have evaluated the use of passive neutron multiplicity counting to determine the plutonium content directly and also to measure the 240 Pu/ 244 Cm ratio for the indirect verification of the plutonium. Neutron multiplicity counting of the singles, doubles, and triples neutrons has been evaluated for measuring 240 Pu, 244 Cm, and 252 Cf. We have proposed a method to establish the plutonium to curium ratio using the hybrid k-edge densitometer x-ray fluorescence instrument plus a neutron coincidence counter for the reprocessing dissolver solution. This report presents the concepts, experimental results, and error estimates for typical spent fuel applications
49 CFR 236.757 - Lock, electric.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Lock, electric. 236.757 Section 236.757... Lock, electric. A device to prevent or restrict the movement of a lever, a switch or a movable bridge, unless the locking member is withdrawn by an electrical device, such as an electromagnet, solenoid or...
48 CFR 853.236 - Construction and architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Construction and architect-engineer contracts. 853.236 Section 853.236 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS FORMS Prescription of Forms 853.236 Construction and architect-engineer...
Preparation of curium-americium oxide microspheres by resin-bead loading
International Nuclear Information System (INIS)
Chattin, F.R.; Benker, D.E.; Lloyd, M.H.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.
1980-01-01
Resin-bead loading and calcination techniques have been used to produce all curium and americium oxide feed material (about 2.2 kg) for HFIR targets since 1971. The process based on Dowex 50W resin has progressed from a series of test runs, through special production runs, into routine production in permanent equipment beginning in 1975. Key attributes of this process are its reliability, high yields, and ease of operation. The process is suited for remote operation in hot cells. Yields approaching 95% are routinely obtained and only one unacceptable product has been generated during routine production operations. There have been no problems in fabricating targets from this oxide or in the subsequent irradiation of these targets. The present scale of production of 150 to 250 g/y supplies the present need and is comparable with the level of other chemical process operations at TRU. Since the annual production is accomplished in two 8 to 12 day periods, there has been no reason to consider further scale-up. However, the rate of production could easily be doubled by simply adding a second set of calcination equipment
48 CFR 52.236-6 - Superintendence by the Contractor.
2010-10-01
... Contractor. 52.236-6 Section 52.236-6 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....236-6 Superintendence by the Contractor. As prescribed in 36.506, insert the following clause: Superintendence by the Contractor (APR 1984) At all times during performance of this contract and until the work...
49 CFR 236.766 - Locking, movable bridge.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, movable bridge. 236.766 Section 236.766... Locking, movable bridge. The rail locks, bridge locks, bolt locks, circuit controllers, and electric locks used in providing interlocking protection at a movable bridge. ...
49 CFR 236.786 - Principle, closed circuit.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Principle, closed circuit. 236.786 Section 236.786 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Principle, closed circuit. The principle of circuit design where a normally energized electric circuit which...
Excess of {sup 236}U in the northwest Mediterranean Sea
Energy Technology Data Exchange (ETDEWEB)
Chamizo, E., E-mail: echamizo@us.es [Centro Nacional de Aceleradores, Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía, Thomas Alva Edison 7, 41092 Seville (Spain); López-Lora, M., E-mail: mlopezlora@us.es [Centro Nacional de Aceleradores, Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía, Thomas Alva Edison 7, 41092 Seville (Spain); Bressac, M., E-mail: matthieu.bressac@utas.edu.au [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco); Institute for Marine and Antarctic Studies, University of Tasmania, Hobart, TAS (Australia); Levy, I., E-mail: I.N.Levy@iaea.org [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco); Pham, M.K., E-mail: M.Pham@iaea.org [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco)
2016-09-15
In this work, we present first {sup 236}U results in the northwestern Mediterranean. {sup 236}U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25′N, 07°52′E). The obtained {sup 236}U/{sup 238}U atom ratios in the dissolved phase, ranging from about 2 × 10{sup −9} at 100 m depth to about 1.5 × 10{sup −9} at 2350 m depth, indicate that anthropogenic {sup 236}U dominates the whole seawater column. The corresponding deep-water column inventory (12.6 ng/m{sup 2} or 32.1 × 10{sup 12} atoms/m{sup 2}) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5 ng/m{sup 2} or 13 × 10{sup 12} atoms/m{sup 2}), evidencing the influence of local or regional {sup 236}U sources in the western Mediterranean basin. On the other hand, the input of {sup 236}U associated to Saharan dust outbreaks is evaluated. An additional {sup 236}U annual deposition of about 0.2 pg/m{sup 2} based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that {sup 236}U stays in solution in seawater. Overall, this source accounts for about 0.1% of the {sup 236}U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. - Highlights: • First {sup 236}U results in the northwest Mediterranean Sea are reported. • Anthropogenic {sup 236}U dominates the whole seawater column at DYFAMED station. • {sup 236}U deep-water column inventory exceeds by a factor of 2.5 the global fallout one. • Saharan dust intrusions are responsible for an annual
49 CFR 236.810 - Spectacle, semaphore arm.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Spectacle, semaphore arm. 236.810 Section 236.810 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Spectacle, semaphore arm. That part of a semaphore arm which holds the roundels and to which the blade is...
7 CFR 205.236 - Origin of livestock.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Origin of livestock. 205.236 Section 205.236... livestock. (a) Livestock products that are to be sold, labeled, or represented as organic must be from livestock under continuous organic management from the last third of gestation or hatching: Except, That: (1...
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; Tweed, C.J.; Yui, M.
1997-01-01
A study of the sorption of the radioelements technetium; uranium; neptunium; and curium onto geological materials has been carried out as part of the PNC program to increase confidence in the performance assessment for a high-level radioactive waste repository in Japan. Batch sorption experiments have been performed in order to study the sorption of the radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water under strongly-reducing conditions at both room temperature and at 60 C. Mathematical modelling using the geochemical speciation program HARPHRQ in conjunction with the HATCHES database has been undertaken in order to interpret the experimental results
8 CFR 236.5 - Fingerprints and photographs.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Fingerprints and photographs. 236.5 Section... to Order of Removal § 236.5 Fingerprints and photographs. Every alien 14 years of age or older... photographs shall be made available to Federal, State, and local law enforcement agencies upon request to the...
27 CFR 24.236 - Losses of spirits.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses of spirits. 24.236... OF THE TREASURY LIQUORS WINE Spirits § 24.236 Losses of spirits. Losses by theft or any other cause... the losses are discovered. A physical inventory of the spirits storage tanks will be taken at the...
48 CFR 952.236-71 - Inspection in architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Inspection in architect-engineer contracts. 952.236-71 Section 952.236-71 Federal Acquisition Regulations System DEPARTMENT OF....236-71 Inspection in architect-engineer contracts. As prescribed at 936.609-3 insert the following...
49 CFR 236.527 - Roadway element insulation resistance.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Roadway element insulation resistance. 236.527 Section 236.527 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... element insulation resistance. Insulation resistance between roadway inductor and ground shall be...
Anthropogenic 236U in Danish Seawater: Global Fallout versus Reprocessing Discharge.
Qiao, Jixin; Steier, Peter; Nielsen, Sven; Hou, Xiaolin; Roos, Per; Golser, Robin
2017-06-20
This work focuses on the occurrence of 236 U in seawater along Danish coasts, which is the sole water-exchange region between the North Sea-Atlantic Ocean and the Baltic Sea. Seawater collected in 2013 and 2014 were analyzed for 236 U (as well as 238 U and 137 Cs). Our results indicate that 236 U concentrations in Danish seawater are distributed within a relatively narrow range of (3.6-8.2) × 10 7 atom/L and, to a certain extent, independent of salinity. 236 U/ 238 U atomic ratios in Danish seawater are more than 4 times higher than the estimated global fallout value of 1× 10 -9 . The levels of 236 U/ 238 U atomic ratios obtained are comparable to those reported for the open North Sea and much higher than several other open oceans worldwide. This indicates that besides the global fallout input, the discharges from the two major European nuclear reprocessing plants are dominating sources of 236 U in Danish seawater. However, unexpectedly high 236 U/ 238 U ratios as well as high 236 U concentrations were observed at low-salinity locations of the Baltic Sea. While this feature might be interpreted as a clue for another significant 236 U input in the Baltic Sea, it may also be caused by the complexity of water currents or slow turnover rate.
29 CFR 1952.236 - Where the plan may be inspected.
2010-07-01
... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.236 Section 1952.236..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Kentucky § 1952.236...
International Nuclear Information System (INIS)
Casella, V.R.
2004-01-01
Co-60 was historically produced in the SRS reactors. Cobalt slugs were irradiated in the early 1970s. Post-production, remaining cobalt slugs (including slab form) were consolidated for storage. There are approximately nine hundred cobalt slugs currently stored awaiting final disposition. These slugs had historically incomplete documentation for activity rates; therefore, assaying was required in order to determine their activity levels. Since the gamma dose rate from these slugs is extremely high, the most cost effective way to shield a source of this magnitude from personnel and the radiation detector was to use the basin water in which the slugs are stored as the shield. A sodium iodide gamma detector was placed above a specially designed air collimator assembly, so that slug was at least eight feet from the detector and was shielded by the basin water. Using a sodium iodide detector and multichannel analyzer system and an underwater collimator assembly, Co-60 concentrations we re determined for Disassembly Basin cobalt slugs and slabs and 18 curium sampler slugs. The total activity of all of the assayed slugs summed to 31,783 curies. From the Co-60 concentrations of the curium sampler slugs, the irradiation flux was determined for the known irradiation time. The amounts of Pu-238, 239, 240, 241, 242; Am-241, 243; and Cm-242, 244 produced were then obtained based on the original amount of Pu-239 irradiated
Excess of "2"3"6U in the northwest Mediterranean Sea
International Nuclear Information System (INIS)
Chamizo, E.; López-Lora, M.; Bressac, M.; Levy, I.; Pham, M.K.
2016-01-01
In this work, we present first "2"3"6U results in the northwestern Mediterranean. "2"3"6U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25′N, 07°52′E). The obtained "2"3"6U/"2"3"8U atom ratios in the dissolved phase, ranging from about 2 × 10"−"9 at 100 m depth to about 1.5 × 10"−"9 at 2350 m depth, indicate that anthropogenic "2"3"6U dominates the whole seawater column. The corresponding deep-water column inventory (12.6 ng/m"2 or 32.1 × 10"1"2 atoms/m"2) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5 ng/m"2 or 13 × 10"1"2 atoms/m"2), evidencing the influence of local or regional "2"3"6U sources in the western Mediterranean basin. On the other hand, the input of "2"3"6U associated to Saharan dust outbreaks is evaluated. An additional "2"3"6U annual deposition of about 0.2 pg/m"2 based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that "2"3"6U stays in solution in seawater. Overall, this source accounts for about 0.1% of the "2"3"6U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. - Highlights: • First "2"3"6U results in the northwest Mediterranean Sea are reported. • Anthropogenic "2"3"6U dominates the whole seawater column at DYFAMED station. • "2"3"6U deep-water column inventory exceeds by a factor of 2.5 the global fallout one. • Saharan dust intrusions are responsible for an annual "2"3"6U flux of 0.02 pg/m"2. • Further studies are necessary to explain the
49 CFR Appendix A to Part 236 - Civil Penalties 1
2010-10-01
... 1,000 2,000 236.329Bolt lock 1,000 2,000 236.330Locking dog of switch and lock movement 1,000 2,000....338Mechanical locking required in accordance with locking sheet and dog chart 1,000 2,000 236.339Mechanical... next available point of communication after automatic train stop, train control, or cab signal device...
International Nuclear Information System (INIS)
Alekseev, V.A.; Klokman, V.R.; Morozova, Z.E.; Ziv, V.S.
1986-01-01
The authors consider the behavior of americium, curium, and certain fission products (europium, cerium, yttrium, and strontium) in fluoride and chlode-fluoride melts in the presence of nonisomorphous solid phases: calcium fluoride and lanthanum and zirconium oxides. It is shown that the trace components enter the solid calcium fluoride in a regular fashion only in the presence of an adequate amount of oxygen in the melt. The effect of oxygen on the coprecipitation with calcium fluoride occurs because oxygen compounds of the elements must be formed in the melt, and these are then coprecipitated with the calcium fluoride
48 CFR 53.236 - Construction and architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Construction and architect-engineer contracts. 53.236 Section 53.236 Federal Acquisition Regulations System FEDERAL ACQUISITION...-engineer contracts. ...
49 CFR 236.813a - State, most restrictive.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false State, most restrictive. 236.813a Section 236.813a Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... State, most restrictive. The mode of an electric or electronic device that is equivalent to a track...
49 CFR 236.825 - System, automatic train control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false System, automatic train control. 236.825 Section..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.825 System, automatic train control. A system so arranged that its operation will automatically...
49 CFR 236.1033 - Communications and security requirements.
2010-10-01
... Train Control Systems § 236.1033 Communications and security requirements. (a) All wireless... 49 Transportation 4 2010-10-01 2010-10-01 false Communications and security requirements. 236.1033... exceeding the security strength required to protect the data as defined in the railroad's PTCSP and required...
7 CFR 58.236 - Pasteurization and heat treatment.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Pasteurization and heat treatment. 58.236 Section 58... Service 1 Operations and Operating Procedures § 58.236 Pasteurization and heat treatment. All milk and... is handled according to sanitary conditions approved by the Administrator. (a) Pasteurization. (1...
International Nuclear Information System (INIS)
Okuno, Hiroshi
2002-01-01
Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)
48 CFR 452.236-74 - Control of Erosion, Sedimentation, and Pollution.
2010-10-01
..., Sedimentation, and Pollution. 452.236-74 Section 452.236-74 Federal Acquisition Regulations System DEPARTMENT OF....236-74 Control of Erosion, Sedimentation, and Pollution. As prescribed in 436.574, insert the following clause: Control of Erosion, Sedimentation, and Pollution (NOV 1996) (a) Operations shall be...
48 CFR 236.602 - Selection of firms for architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Selection of firms for architect-engineer contracts. 236.602 Section 236.602 Federal Acquisition Regulations System DEFENSE... ARCHITECT-ENGINEER CONTRACTS Architect-Engineer Services 236.602 Selection of firms for architect-engineer...
48 CFR 952.236 - Construction and architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Construction and architect-engineer contracts. 952.236 Section 952.236 Federal Acquisition Regulations System DEPARTMENT OF ENERGY... Construction and architect-engineer contracts. ...
48 CFR 52.236-23 - Responsibility of the Architect-Engineer Contractor.
2010-10-01
... Architect-Engineer Contractor. 52.236-23 Section 52.236-23 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.236-23 Responsibility of the Architect-Engineer Contractor. As prescribed in 36.609-2(b), insert the following clause: Responsibility of the Architect-Engineer Contractor (APR 1984) (a...
7 CFR 2.36 - Director, Office of Communications.
2010-01-01
... are made by the Secretary of Agriculture to Director, Office of Communications: (1) Related to public...) Organize and direct the activities of a public affairs office to include press relations of the secretary... 7 Agriculture 1 2010-01-01 2010-01-01 false Director, Office of Communications. 2.36 Section 2.36...
49 CFR 236.18 - Software management control plan.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Software management control plan. 236.18 Section... Instructions: All Systems General § 236.18 Software management control plan. (a) Within 6 months of June 6, 2005, each railroad shall develop and adopt a software management control plan for its signal and train...
Energy Technology Data Exchange (ETDEWEB)
Moll, H.; Merroun, M.; Geipel, G.; Rossberg, A.; Hennig, C.; Selenska-Pobell , S.; Bernhard, G. [Forschungszentrum Dresden-Rossendorf e.V., Inst. fuer Radioc hemie, 01314 Dresden (Germany)]. e-mail: h.moll@fzd.de; Stumpf, Th. [Forschungszentru m Karlsruhe, Inst. fuer Nukleare Entsorgung, 76021 Karlsruhe (Germany)
2007-06-15
Sulfate-reducing bacteria (SRB) frequently occur in the deep granitic rock aquifers at the Aespoe Hard Rock Laboratory (Aespoe HRL), Sweden. The new SRB strain Desulfovibrio aespoeensis could be isolated. Results describing the basic interaction mechanisms of uranium, curium, and plutonium with cells of D. aespoeensis DSM 10631T will be presented. The interaction experiments with the actinides showed that the cells are able to remove all three actinides from the surrounding solution. The amount of removed actinide and the interaction mechanism varied among the different actinides. The main U(VI) removal occurred after the first 24 h. The contact time, pH and [U(VI)]initial influence the U removal efficiency. The presence of uranium caused a damaging of the cell membranes. TEM revealed an accumulation of U inside the bacterial cell. D. aespoeensis are able to form U(IV). A complex interaction mechanism takes place consisting of biosorption, bioreduction and bioaccumulation. In the case of {sup 242}Pu, solvent extractions, UV-vis- and XANES spectroscopy were used to determine the speciation of the Pu oxidation states. In the first step, the Pu(VI) and Pu(IV)-polymers are bound to the biomass. Solvent extractions showed that 97 % of the initially present Pu(VI) is reduced to Pu(V) due to the activity of the cells within the first 24 h. Most of the formed Pu(V) dissolves from the cell envelope back to the aqueous solution due to the weak complexing properties of this plutonium oxidation state. In the case of curium at a much lower metal concentration of 3x10{sup -7} M, a pure biosorption of Cm(III) on the cell envelope forming an inner-sphere surface complex most likely with organic phosphate groups was detected. To summarize, the strength of the interaction of D. aespoeensis with the selected actinides at pH 5 and actinide concentrations = 10 mg/L ([Cm] 0.07 mg/L) follows the pattern: Cm > U > Pu >> Np.
48 CFR 52.236-24 - Work Oversight in Architect-Engineer Contracts.
2010-10-01
... Architect-Engineer Contracts. 52.236-24 Section 52.236-24 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.236-24 Work Oversight in Architect-Engineer Contracts. As prescribed in 36.609-3, insert the following clause: Work Oversight in Architect-Engineer Contracts (APR 1984) The extent and...
Mass and abundance 236U sensitivities at CIRCE
De Cesare, M.; De Cesare, N.; D'Onofrio, A.; Fifield, L. K.; Gialanella, L.; Terrasi, F.
2015-10-01
The actinides (e.g. 236U and xPu isotopes) are present in environmental samples at the ultra trace level since atmospheric tests of NWs (Nuclear Weapons) performed in the past, deliberate dumping of nuclear waste, nuclear fuel reprocessing, on a large scale and operation of NPPs (Nuclear Power Plants) on a small scale have led to the release of a wide range of radioactive nuclides in the environment. Their detection requires the most sensitive AMS (Accelerator Mass Spectrometry) techniques and at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy, an upgraded actinide AMS system, based on a 3-MV pelletron tandem accelerator, has been operated. In this paper the progress made in order to push the 236U mass sensitivity and 236U/238U isotopic ratio down to the natural levels is reported. A uranium contamination mass of about 0.05 μg and a 236U/238U isotopic ratio sensitivities at the level of 3.2 × 10-13 are presently achievable.
49 CFR 236.330 - Locking dog of switch-and-lock movement.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking dog of switch-and-lock movement. 236.330 Section 236.330 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Rules and Instructions § 236.330 Locking dog of switch-and-lock movement. Locking dog of switch-and-lock...
Subcellular distribution of curium in beagle liver
International Nuclear Information System (INIS)
Bruenger, F.W.; Grube, B.J.; Atherton, D.R.; Taylor, G.N.; Stevens, W.
1976-01-01
The subcellular distribution of curium ( 243 244 Cm) was studied in canine liver from 2 hr to 47 days after injection of 3 μCi 243 244 Cm/kg of body weight. The pattern of distribution for Cm was similar to other trivalent actinide elements studied previously (Am, Cf). Initially (2 hr), most of the nuclide was found in the cytosol and at least 90 percent was protein bound. About 70 percent of the Cm was bound to ferritin, approximately 5 percent was associated with a protein of MW approximately 200,000, and approximately 25 percent was found in the low-molecular-weight region (approximately 5000). The decrease in the Cm content of cytosol, nuclei, and microsomes coincided with an increase in the amount associated with mitochondria and lysosomes. The concentration of the Cm in the mitochondrial fraction was higher than it was in the lysosomal fraction at each time studied. In the mitochondrial fraction approximately 30 percent of the Cm was bound to membranous or granular material, and 70 percent was found in the soluble fraction. The Cm concentration initially associated with cell nuclei was high but had diminished to 20 percent of the 2 hr concentration by 20 days post injection (PI). The subcellular distribution of Cm in the liver of a dog which had received the same dose and was terminated because of severe liver damage was studied at 384 days PI. The liver weighed 130 g and contained approximately 30 percent of the injected Cm. In contrast, a normal liver weighs 280 g and at 2 hr PI contains approximately 40 percent of the injected dose. The subcellular distribution of Cm in this severely damaged liver differed from the pattern observed at earlier times after injection. The relative concentration of Cm in the cytosol was doubled; it was higher in the nuclei-debris fraction; and it was lower in the mitochondrial and lysosomal fractions when compared to earlier times
8 CFR 236.2 - Confined aliens, incompetents, and minors.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Confined aliens, incompetents, and minors. 236.2 Section 236.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE AND DEPORTABLE ALIENS; REMOVAL OF ALIENS ORDERED REMOVED Detention...
Natural and anthropogenic {sup 236}U in environmental samples
Energy Technology Data Exchange (ETDEWEB)
Steier, Peter [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)], E-mail: peter.steier@univie.ac.at; Bichler, Max [Atominstitut der Osterreichischen Universitaeten, Technische Universitaet Wien, Stadionallee 2, Wien A-1020 (Austria); Keith Fifield, L. [Department of Nuclear Physics, RSPhysSE, Australian National University, Canberra, ACT 0200 (Australia); Golser, Robin; Kutschera, Walter; Priller, Alfred [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Quinto, Francesca [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Richter, Stephan [Euopean Commission, Directorate-General Joint Research Centre, Institute for Reference Materials and Measurements (IRMM), Retieseweg 111, B-2440 Geel (Belgium); Srncik, Michaela [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Terrasi, Philippo [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Wacker, Lukas [Institute for Particle Physics, HPK H25, Schafmattstrasse 20, CH-8093 Zuerich (Switzerland); Wallner, Anton [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Wallner, Gabriele [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Wilcken, Klaus M. [Scottish Universities Environmental Research Centre, Scottish Enterprise Technology Park, East Kilbride G75 OQF (United Kingdom); Maria Wild, Eva [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)
2008-05-15
The interaction of thermal neutrons with {sup 235}U results in fission with a probability of {approx}85% and in the formation of {sup 236}U (t{sub 1/2} = 2.3 x 10{sup 7} yr) with a probability of {approx}15%. While anthropogenic {sup 236}U is, therefore, present in spent nuclear fuel at levels of {sup 236}U/U up to 10{sup -2}, the expected natural ratios in the pre-anthropogenic environment range from 10{sup -14} to 10{sup -10}. At VERA, systematic investigations suggest a detection limit below {sup 236}U/U = 5 x 10{sup -12} for samples of 0.5 mg U, while chemistry blanks of {approx}2 x 10{sup 7} atoms {sup 236}U per sample limit the sensitivity for smaller samples. We have found natural isotopic ratios in uranium reagents separated before the onset of human nuclear activities, in uranium ores from various origins and in water from a subsurface well in Bad Gastein, Austria. Anthropogenic contamination was clearly visible in soil and rivulet samples from Salzburg, Austria, whereas river sediments from Garigliano river (Southern Italy) were close to the detection limit. Finally, our natural in-house standard Vienna-KkU was calibrated against a certified reference material (IRMM REIMEP-18 A)
Anthropogenic 236U in Danish Seawater: Global Fallout versus Reprocessing Discharge
DEFF Research Database (Denmark)
Qiao, Jixin; Steier, Peter; Nielsen, Sven Poul
2017-01-01
This work focuses on the occurrence of 236U in seawater along Danish coasts, which is the sole water-exchange region between the North Sea-Atlantic Ocean and the Baltic Sea. Seawater collected in 2013 and 2014 were analyzed for 236U (as well as 238U and 137Cs). Our results indicate that 236U...... seawater. However, unexpectedly high 236U/238U ratios as well as high 236U concentrations were observed at low-salinity locations of the Baltic Sea. While this feature might be interpreted as a clue for another significant 236U input in the Baltic Sea, it may also be caused by the complexity of water...... currents or slow turnover rate....
Energy Technology Data Exchange (ETDEWEB)
Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)
2002-10-01
Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)
49 CFR 236.1043 - Task analysis and basic requirements.
2010-10-01
... Train Control Systems § 236.1043 Task analysis and basic requirements. (a) Training structure and... classroom, simulator, computer-based, hands-on, or other formally structured training designed to impart the... 49 Transportation 4 2010-10-01 2010-10-01 false Task analysis and basic requirements. 236.1043...
49 CFR 236.923 - Task analysis and basic requirements.
2010-10-01
... for Processor-Based Signal and Train Control Systems § 236.923 Task analysis and basic requirements... structured training designed to impart the knowledge, skills, and abilities identified as necessary to... 49 Transportation 4 2010-10-01 2010-10-01 false Task analysis and basic requirements. 236.923...
49 CFR 236.102 - Semaphore or searchlight signal mechanism.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Semaphore or searchlight signal mechanism. 236.102... Instructions: All Systems Inspections and Tests; All Systems § 236.102 Semaphore or searchlight signal mechanism. (a) Semaphore signal mechanism shall be inspected at least once every six months, and tests of...
Energy Technology Data Exchange (ETDEWEB)
Winkler, Stephan; Steier, Peter [University of Vienna, Faculty of Physics, Vienna (Austria); Carilli, Jessica [Australian Nuclear Science and Technology Organisation, Lucas Heights (Australia)
2012-07-01
Since uranium is known to behave conservatively in ocean waters, 236-U has great potential in application as oceanic tracer. 236-U (t1/2=23.4 Ma) was introduced into the oceans by atmospheric nuclear weapon testing with amount estimates ranging from 700 kg to 1500 kg. Thus a resulting initial average 236-U/238-U ratio of at least 5e-9 is expected for an oceanic mixed layer depth of 100 m. This ratio is already higher than the natural pre-nuclear background, which is expected to be at 10e-14 levels. Even the elevated ratios of global stratospheric fall-out are beyond the capabilities of ICPMS and TIMS methods. However, the exceptional sensitivity and ultra-low background for 236-U of the Vienna Environmental Research Accelerator's Accelerator Mass Spectrometry system allows us to measure down to 10-13 detection limits. We present a year-by-year record of 236-U/238-U for a Caribbean coral core covering years 1944 to 2006, thus allowing to us put constraints on the oceanic input of 236-U by atmospheric testing. Moreover modeling of the results also demonstrates the capabilities of 236-U as oceanic tracer.
Energy Technology Data Exchange (ETDEWEB)
Christl, Marcus, E-mail: mchristl@ethz.ch [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Casacuberta, Nuria; Lachner, Johannes; Maxeiner, Sascha; Vockenhuber, Christof; Synal, Hans-Arno [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Goroncy, Ingo; Herrmann, Jürgen [Bundesamt für Seeschifffahrt und Hydrographie, Hamburg (Germany); Daraoui, Abdelouahed; Walther, Clemens; Michel, Rolf [Institut für Radioökologie und Strahlenschutz, Leibniz Universität Hannover (Germany)
2015-10-15
Compact, low energy accelerator mass spectrometry (AMS) has evolved over the past years as one of the most sensitive, selective, and robust techniques for the analysis of heavy and long lived radionuclides. In this study, we will first focus on the analytical capabilities of the compact AMS system TANDY, mainly for {sup 236}U analyses, and then present a new dual tracer approach, that combines {sup 129}I and {sup 236}U. The measured {sup 129}I/{sup 236}U ratios of samples collected in the North Sea in 2009 are in reasonable agreement with the expectations from documented or estimated releases from the two major nuclear reprocessing plants located at Sellafield (GB) and La Hague (F), suggesting that the {sup 129}I/{sup 236}U ratio can be used as a water mass tag in the North Atlantic region. However, our results indicate that, in contrast to {sup 129}I, additional contributions of bomb produced {sup 236}U cannot be neglected in the North Sea region. This complicates the simple and straight forward use of the {sup 129}I/{sup 236}U ratio as a quantitative tool for the calculation of transport times of North Sea water in the Arctic Ocean.
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-...VDCVTNSSDASCTNFQYPLANITADINNL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC
International Nuclear Information System (INIS)
Miramand, P.
1984-06-01
The tranfer of transuranic elements -americium, curium and plutonium- from the sediments containing them to some marine benthic species (endofauna and epifauna) was studied with a twofold approach - laboratory and in-situ investigation. The experimental investigations, divided into three parts, made it possible to specify concentration factors (F.C.), transfer factors (F.T.) and to understand the process involved for 5 benthic species. The result were refined by an in-situ study that brought new data on the marine distribution of the transuranic elements released by the La Hague plant. Finally, the localization of americium and plutonium in the tissues and cells of these species was determined by autoradiography [fr
Mass and abundance {sup 236}U sensitivities at CIRCE
Energy Technology Data Exchange (ETDEWEB)
De Cesare, M., E-mail: m.decesare@cira.it [Department of Nuclear Physics, Research School of Physics and Engineering, Australian National University, ACT 0200 Canberra (Australia); CIRCE and Dipartimento di Matematica e Fisica, Seconda Universitá di Napoli, via Vivaldi 43, 81100 Caserta (Italy); De Cesare, N.; D’Onofrio, A. [CIRCE and Dipartimento di Matematica e Fisica, Seconda Universitá di Napoli, via Vivaldi 43, 81100 Caserta (Italy); INFN Sezione di Napoli, via Cintia, Edificio G, 80126 Napoli (Italy); Fifield, L.K. [Department of Nuclear Physics, Research School of Physics and Engineering, Australian National University, ACT 0200 Canberra (Australia); Gialanella, L.; Terrasi, F. [CIRCE and Dipartimento di Matematica e Fisica, Seconda Universitá di Napoli, via Vivaldi 43, 81100 Caserta (Italy); INFN Sezione di Napoli, via Cintia, Edificio G, 80126 Napoli (Italy)
2015-10-15
The actinides (e.g. {sup 236}U and {sup x}Pu isotopes) are present in environmental samples at the ultra trace level since atmospheric tests of NWs (Nuclear Weapons) performed in the past, deliberate dumping of nuclear waste, nuclear fuel reprocessing, on a large scale and operation of NPPs (Nuclear Power Plants) on a small scale have led to the release of a wide range of radioactive nuclides in the environment. Their detection requires the most sensitive AMS (Accelerator Mass Spectrometry) techniques and at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy, an upgraded actinide AMS system, based on a 3-MV pelletron tandem accelerator, has been operated. In this paper the progress made in order to push the {sup 236}U mass sensitivity and {sup 236}U/{sup 238}U isotopic ratio down to the natural levels is reported. A uranium contamination mass of about 0.05 μg and a {sup 236}U/{sup 238}U isotopic ratio sensitivities at the level of 3.2 × 10{sup −13} are presently achievable.
49 CFR 236.312 - Movable bridge, interlocking of signal appliances with bridge devices.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Movable bridge, interlocking of signal appliances with bridge devices. 236.312 Section 236.312 Transportation Other Regulations Relating to... SYSTEMS, DEVICES, AND APPLIANCES Interlocking Standards § 236.312 Movable bridge, interlocking of signal...
Uranium-236 in light water reactor spent fuel recycled to an enriching plant
International Nuclear Information System (INIS)
de la Garza, A.
1977-01-01
The introduction of 236 U to an enriching plant by recycling spent fuel uranium results in enriched products containing 236 U, a parasitic neutron absorber in reactor fuel. Convenient approximate methodology determines 235 236 U, and total uranium flowsheets with associated separative work requirements in enriching plant operations for use by investigators of the light water reactor fuel cycle not having recourse to specialized multicomponent cascade technology. Application of the methodology has been made to compensation of an enriching plant product for 236 U content and to the value at an enriching plant of spent fuel uranium. The approximate methodology was also confirmed with more exact calculations and with some experience with 236 U in an enriching plant
Srncik, M; Tims, S G; De Cesare, M; Fifield, L K
2014-06-01
The variation of the (236)U and (239)Pu concentrations as a function of depth has been studied in a soil profile at a site in the Southern Hemisphere well removed from nuclear weapon test sites. Total inventories of (236)U and (239)Pu as well as the (236)U/(239)Pu isotopic ratio were derived. For this investigation a soil core from an undisturbed forest area in the Herbert River catchment (17°30' - 19°S) which is located in north-eastern Queensland (Australia) was chosen. The chemical separation of U and Pu was carried out with a double column which has the advantage of the extraction of both elements from a relatively large soil sample (∼20 g) within a day. The samples were measured by Accelerator Mass Spectrometry using the 14UD pelletron accelerator at the Australian National University. The highest atom concentrations of both (236)U and (239)Pu were found at a depth of 2-3 cm. The (236)U/(239)Pu isotopic ratio in fallout at this site, as deduced from the ratio of the (236)U and (239)Pu inventories, is 0.085 ± 0.003 which is clearly lower than the Northern Hemisphere value of ∼0.2. The (236)U inventory of (8.4 ± 0.3) × 10(11) at/m(2) was more than an order of magnitude lower than values reported for the Northern Hemisphere. The (239)Pu activity concentrations are in excellent agreement with a previous study and the (239+240)Pu inventory was (13.85 ± 0.29) Bq/m(2). The weighted mean (240)Pu/(239)Pu isotopic ratio of 0.142 ± 0.005 is slightly lower than the value for global fallout, but our results are consistent with the average ratio of 0.173 ± 0.027 for the southern equatorial region (0-30°S). Copyright © 2014 Elsevier Ltd. All rights reserved.
49 CFR 236.16 - Electric lock, main track releasing circuit.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock, main track releasing circuit. 236... Rules and Instructions: All Systems General § 236.16 Electric lock, main track releasing circuit. When an electric lock releasing circuit is provided on the main track to permit a train or an engine to...
Resolved resonance parameters for 236Np
International Nuclear Information System (INIS)
Morogovskij, G.B.; Bakhanovich, L.A.
2002-01-01
Multilevel Breit-Wigner parameters were obtained for fission cross-section representation in the 0.01-33 eV energy region from evaluation of a 236 Np experimental fission cross-section in the resolved resonance region. (author)
24 CFR 236.755 - Housing owner's obligation under contract to report tenant income increase.
2010-04-01
... FOR RENTAL PROJECTS Rental Assistance Payments § 236.755 Housing owner's obligation under contract to... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Housing owner's obligation under contract to report tenant income increase. 236.755 Section 236.755 Housing and Urban Development...
24 CFR 236.252 - First, second, and third mortgage insurance premiums.
2010-04-01
... insurance premiums. 236.252 Section 236.252 Housing and Urban Development Regulations Relating to Housing... insurance premiums. All of the provisions of § 207.252 of this chapter governing the first, second, and third mortgage insurance premiums shall apply to mortgages insured under this subpart, except: (a) Where...
48 CFR 236.604 - Performance evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance evaluation... Architect-Engineer Services 236.604 Performance evaluation. (a) Preparation of performance reports. Use DD Form 2631, Performance Evaluation (Architect-Engineer), instead of SF 1421. (2) Prepare a separate...
49 CFR 236.74 - Protection of insulated wire; splice in underground wire.
2010-10-01
... underground wire. 236.74 Section 236.74 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING... wire; splice in underground wire. Insulated wire shall be protected from mechanical injury. The...
International Nuclear Information System (INIS)
Sakaguchi, Aya; Eto, Asuka; Takahashi, Yoshio; Steier, Peter; Yamazaki, Atsuko; Watanabe, Tsuyoshi; Sasaki, Keiichi; Yamano, Hiroya
2013-01-01
Historical 236 U/ 238 U atom ratio and concentration of 236 U were determined by Accelerator Mass Spectrometry (AMS) in skeletons of dated modern coral core sample collected from Majuro atoll, equatorial Pacific, to reconstruct anthropogenic 236 U inputs to the Equatorial Pacific. The maximum hydrogen bomb-pulses of 236 U/ 238 U and 236 U concentration, 2.83x10 -9 and 1.85x10 7 atom/g, in an annually resolved coral core were captured in 1954 (Operation Castle at Bikini and Enewetok atolls). The values were abruptly decreased in a few years, and they have been gradually decreased over time. Our results allow studies of not only the present distribution pattern, but gives access to the temporal evolution of 236 U in surface seawater of North Equatorial Current which is introduced to the Japan Sea and the North West Pacific Ocean as Kuroshio and Tsushima currents over the past decades. (author)
33 CFR 2.36 - Navigable waters of the United States, navigable waters, and territorial waters.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Navigable waters of the United States, navigable waters, and territorial waters. 2.36 Section 2.36 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL JURISDICTION Jurisdictional Terms § 2.36 Navigable waters...
Phenotype abnormality: 236 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 236 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u742i decreased susceptibility... in response to organism Agrobacterium ... Agrobacterium ... decreased susceptibility toward ...
Reference: 236 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 236 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15992545i Dharmasiri...5 Jul Developmental cell Dharmasiri Nihal|Dharmasiri Sunethra|Ehrismann Jasmin S|Estelle Mark|Hobbie Lawrence|J端rgens Gerd|Lechner Esther|Weijers Dolf|Yamada Masashi
Chronology of Pu isotopes and 236U in an Arctic ice core.
Wendel, C C; Oughton, D H; Lind, O C; Skipperud, L; Fifield, L K; Isaksson, E; Tims, S G; Salbu, B
2013-09-01
In the present work, state of the art isotopic fingerprinting techniques are applied to an Arctic ice core in order to quantify deposition of U and Pu, and to identify possible tropospheric transport of debris from former Soviet Union test sites Semipalatinsk (Central Asia) and Novaya Zemlya (Arctic Ocean). An ice core chronology of (236)U, (239)Pu, and (240)Pu concentrations, and atom ratios, measured by accelerator mass spectrometry in a 28.6m deep ice core from the Austfonna glacier at Nordaustlandet, Svalbard is presented. The ice core chronology corresponds to the period 1949 to 1999. The main sources of Pu and (236)U contamination in the Arctic were the atmospheric nuclear detonations in the period 1945 to 1980, as global fallout, and tropospheric fallout from the former Soviet Union test sites Novaya Zemlya and Semipalatinsk. Activity concentrations of (239+240)Pu ranged from 0.008 to 0.254 mBq cm(-2) and (236)U from 0.0039 to 0.053 μBq cm(-2). Concentrations varied in concordance with (137)Cs concentrations in the same ice core. In contrast to previous published results, the concentrations of Pu and (236)U were found to be higher at depths corresponding to the pre-moratorium period (1949 to 1959) than to the post-moratorium period (1961 and 1962). The (240)Pu/(239)Pu ratio ranged from 0.15 to 0.19, and (236)U/(239)Pu ranged from 0.18 to 1.4. The Pu atom ratios ranged within the limits of global fallout in the most intensive period of nuclear atmospheric testing (1952 to 1962). To the best knowledge of the authors the present work is the first publication on biogeochemical cycles with respect to (236)U concentrations and (236)U/(239)Pu atom ratios in the Arctic and in ice cores. Copyright © 2013 Elsevier B.V. All rights reserved.
2010-10-01
... TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Traffic Control Systems Standards § 236.401 Automatic... 49 Transportation 4 2010-10-01 2010-10-01 false Automatic block signal system and interlocking standards applicable to traffic control systems. 236.401 Section 236.401 Transportation Other Regulations...
Plutonium-236 traces determination in plutonium-238 by α spectrometry
International Nuclear Information System (INIS)
Acena, M.L.; Pottier, R.; Berger, R.
1969-01-01
Two methods are described in this report for the determination of plutonium-236 traces in plutonium-238 by a spectrometry using semi-conductor detectors. The first method involves a direct comparison of the areas under the peaks of the α spectra of plutonium-236 and plutonium-238. The electrolytic preparation of the sources is carried out after preliminary purification of the plutonium. The second method makes it possible to determine the 236 Pu/ 238 Pu ratio by comparing the areas of the α peaks of uranium-232 and uranium-234, which are the decay products of the two plutonium isotopes respectively. The uranium in the source, also deposited by electrolysis, is separated from a 1 mg amount of plutonium either by a T.L.A. extraction, or by the use of ion-exchange resins. The report ends with a discussion of the results obtained with plutonium of two different origins. (authors) [fr
Transuranium analysis methodologies for biological and environmental samples
International Nuclear Information System (INIS)
Wessman, R.A.; Lee, K.D.; Curry, B.; Leventhal, L.
1978-01-01
Analytical procedures for the most abundant transuranium nuclides in the environment (i.e., plutonium and, to a lesser extent, americium) are available. There is a lack of procedures for doing sequential analysis for Np, Pu, Am, and Cm in environmental samples, primarily because of current emphasis on Pu and Am. Reprocessing requirements and waste disposal connected with the fuel cycle indicate that neptunium and curium must be considered in environmental radioactive assessments. Therefore it was necessary to develop procedures that determine all four of these radionuclides in the environment. The state of the art of transuranium analysis methodology as applied to environmental samples is discussed relative to different sample sources, such as soil, vegetation, air, water, and animals. Isotope-dilution analysis with 243 Am ( 239 Np) and 236 Pu or 242 Pu radionuclide tracers is used. Americium and curium are analyzed as a group, with 243 Am as the tracer. Sequential extraction procedures employing bis(2-ethyl-hexyl)orthophosphoric acid (HDEHP) were found to result in lower yields and higher Am--Cm fractionation than ion-exchange methods
48 CFR 852.236-89 - Buy American Act.
2010-10-01
... contained in this clause 852.236-89 are waived for World Trade Organization (WTO) Government Procurement... not anticipate accepting an offer that includes foreign construction material, other than WTO GPA...
48 CFR 52.236-13 - Accident Prevention.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Accident Prevention. 52....236-13 Accident Prevention. As prescribed in 36.513, insert the following clause: Accident Prevention... contracts for construction or dismantling, demolition, or removal of improvements, the Contractor shall— (1...
48 CFR 852.236-82 - Payments under fixed-price construction contracts (without NAS).
2010-10-01
... manner; or (iv) Failure to comply in good faith with approved subcontracting plans, certifications, or... under other provisions of the contract or in accordance with the general law and regulations regarding... construction contracts (without NAS). 852.236-82 Section 852.236-82 Federal Acquisition Regulations System...
International Nuclear Information System (INIS)
Frolova, L.M.; Frolov, A.A.; Vasil'ev, V.Ya.
1984-01-01
Radiation-chemical behaviour of neptunium ions in nitric acid solutions is studied under the action of intensive internal alpha-irradiation conditioned by curium nuclides. In 0.3-1.1 mol/l solutions of nitric acid radiation-chemical oxidation of neptunium (4) and reduction of neptunium (6) is obeyed to the first order law of reaction rate in respect to neptunium concentration. Effective constants of neptunium (4) oxidation rates and neptuniumi(6) reduction rates are not dependent on neptunium ion in1tial concentration and increase with a growth of a dose rate of alpha-irradiation of solution. In equilibrium only neptunium (5) and neptunium (6) are present in solutions with HNO 3 concentration less than 1 mol/l. In more concentrated solutions equilibrium between sexa-, penta- and tetravalent neptunium forms is established. Equilibrium concentrations of neptunium valent forms are not dependent on neptunium initial oxidation state under the same initial conditions (dose rate, neptunium concentration and acidity. It is shown form experimental data that under the action of alpha-irradiation neptunium (5) both is oxidated to neptunium (6) and is reduced to neptunium (4)
Chronology of Pu isotopes and {sup 236}U in an Arctic ice core
Energy Technology Data Exchange (ETDEWEB)
Wendel, C.C., E-mail: cato.wendel@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Oughton, D.H., E-mail: deborah.oughton@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Lind, O.C., E-mail: ole-christian.lind@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Skipperud, L., E-mail: lindis.skipperud@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Fifield, L.K., E-mail: keith.fifield@anu.edu.au [Department of Nuclear Physics, Australian National University, Canberra ACT 0200 (Australia); Isaksson, E., E-mail: elisabeth.isaksson@npolar.no [Norwegian Polar Institute, Fram Centre, Hjalmar Johansens Gate 14, N9296 Tromsø (Norway); Tims, S.G., E-mail: steve.tims@anu.edu.au [Department of Nuclear Physics, Australian National University, Canberra ACT 0200 (Australia); Salbu, B., E-mail: brit.salbu@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway)
2013-09-01
In the present work, state of the art isotopic fingerprinting techniques are applied to an Arctic ice core in order to quantify deposition of U and Pu, and to identify possible tropospheric transport of debris from former Soviet Union test sites Semipalatinsk (Central Asia) and Novaya Zemlya (Arctic Ocean). An ice core chronology of {sup 236}U, {sup 239}Pu, and {sup 240}Pu concentrations, and atom ratios, measured by accelerator mass spectrometry in a 28.6 m deep ice core from the Austfonna glacier at Nordaustlandet, Svalbard is presented. The ice core chronology corresponds to the period 1949 to 1999. The main sources of Pu and {sup 236}U contamination in the Arctic were the atmospheric nuclear detonations in the period 1945 to 1980, as global fallout, and tropospheric fallout from the former Soviet Union test sites Novaya Zemlya and Semipalatinsk. Activity concentrations of {sup 239+240}Pu ranged from 0.008 to 0.254 mBq cm{sup −2} and {sup 236}U from 0.0039 to 0.053 μBq cm{sup −2}. Concentrations varied in concordance with {sup 137}Cs concentrations in the same ice core. In contrast to previous published results, the concentrations of Pu and {sup 236}U were found to be higher at depths corresponding to the pre-moratorium period (1949 to 1959) than to the post-moratorium period (1961 and 1962). The {sup 240}Pu/{sup 239}Pu ratio ranged from 0.15 to 0.19, and {sup 236}U/{sup 239}Pu ranged from 0.18 to 1.4. The Pu atom ratios ranged within the limits of global fallout in the most intensive period of nuclear atmospheric testing (1952 to 1962). To the best knowledge of the authors the present work is the first publication on biogeochemical cycles with respect to {sup 236}U concentrations and {sup 236}U/{sup 239}Pu atom ratios in the Arctic and in ice cores. - Highlights: • Concentrations and atom ratios of Pu and {sup 236}U determined in an Arctic ice core. • Concentrations of U and Pu found to be higher pre- than post-moratorium. • U and Pu concentrations
Energy Technology Data Exchange (ETDEWEB)
Lindner, M.; Dupzyk, R.J.; Hoff, R.W.; Nagle, R.J. (California Univ., Livermore (USA). Lawrence Livermore National Lab.)
1981-01-01
The half-life of long-lived /sup 236/Np, due to ..cap alpha.., ..beta.. and electron-capture decay, was found to be 1.55 x 10/sup 5/ yr. Of all decays, 88% populate excited states in /sup 236/U and 12% populate levels in /sup 236/Pu. Lifetimes measured by growth of the ground states of /sup 236/U and /sup 236/Pu agree with values from corresponding ..gamma.. de-excitations in these daughter nuclei. Therefore, nearly all the electron-capture decays populate the 6/sup +/ level of the ground-state band in /sup 236/U. Similarly, essentially all the ..beta../sup -/ decay populates an analogous 6/sup +/ level in /sup 236/Pu, which de-excites through a previously unreported transition of 158.3 keV. If a very week ..gamma..-ray at 894 keV can be ascribed to a level in /sup 232/U populated by ..beta.. decay of /sup 232/Pa, its existence establishes a 0.2% ..cap alpha..-branching decay in /sup 236/Np.
International Nuclear Information System (INIS)
Paviet, P.; Fanghaenel, T.; Klenze, R.; Kim, J.I.
1996-01-01
The formation of sulfate complexes of Curium in aqueous solutions is studied by time resolved laser fluorescence spectroscopy (TRLFS) at 25 C. The species Cm 3+ , Cm(SO 4 ) - , Cm(SO 4 ) - 2 and Cm(SO 4 ) 3- 3 are quantified spectroscopically in the trace concentration range by peak deconvolution of fluorescence emission spectra. The complex formation equilibria are measured in NaCl/ Na 2 SO 4 solutions of constant ionic strength (3 molal) as a function of the sulfate concentration. The stability constants of Cm(SO 4 ) + and Cm(SO 4 ) - 2 are determined to be log β 1 = 0.93±0.08 and log β 2 = 0.61±0.08, respectively. The complex Cm(SO 4 ) 3- 3 is found to be stable only at very high sulfate concentrations (above 1 molal) and therefore not considered for further evaluation. (orig.)
48 CFR 853.236-70 - VA Form 10-6298, Architect-Engineer Fee Proposal.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA Form 10-6298, Architect-Engineer Fee Proposal. 853.236-70 Section 853.236-70 Federal Acquisition Regulations System DEPARTMENT OF...-Engineer Fee Proposal. VA Form 10-6298, Architect-Engineer Fee Proposal, shall be used as prescribed in 836...
Update neutron nuclear data evaluation for 236,238Np
International Nuclear Information System (INIS)
Chen, Guochang; Wang, Jimin; Yu, Baosheng; Cao, Wentian; Tang, Guo-you
2015-01-01
The nuclear data with high accuracy for actinides play an important role in nuclear technology applications, including reactor design and operation, fuel cycle, estimation of the amount of minor actinides (MAs) in high burnup reactors and to research to transmute the MAs to short half-lived nuclides or stable ones. The nuclides of 236 Np are generated via the α-decay of 240 Am or 237 Np(n, 2n) and 237 Np(d, t) reactions. And the nuclides of 238 Np are generated via the α-decay of 242 Am or 237 Np(n, γ) and 237 Np(d, p) reactions. In the present work, according to the systematic trend of the total cross section and elastic cross section etc. of different Np isotopes, and based on the neutron optical model parameters (OMP) of 237 Np, a new set of neutron optical model parameters were obtained for 236,238 Np. Based on the new set OMP and the systematic trend of the cross sections of different Np isotopes, a full set of 236,238 Np neutron nuclear data has been updated and improved by theoretical calculation. The present result has significant improvements over the data in CENDL-3.1
Buildup of 236U in the gaseous diffusion plant product
International Nuclear Information System (INIS)
Ford, J.S.
1975-01-01
A generalized projection of the average annual 236 U concentration that can be expected in future enriched uranium product from the US-ERDA gaseous diffusion plants when reprocessed fuels become available for cascade feeding is given. It is concluded that the buildup of 236 U is not an ever-increasing function, but approaches a limiting value. Projected concentrations result in only slight separative work losses and present no operational problem to ERDA in supplying light water reactor requirements. The use of recycle uranium from power reactor spent fuels will result in significant savings in natural uranium feed
European roe deer antlers as an environmental archive for fallout 236U and 239Pu
International Nuclear Information System (INIS)
Froehlich, M.B.; Steier, P.; Wallner, G.; Fifield, L.K.
2016-01-01
Anthropogenic 236 U and 239 Pu were measured in European roe deer antlers hunted between 1955 and 1977 which covers and extends beyond the period of intensive nuclear weapons testing (1954–1962). The antlers were hunting trophies, and hence the hunting area, the year of shooting and the approximate age of each animal is given. Uranium and plutonium are known to deposit in skeletal tissue. Since antler histology is similar to bone, both elements were expected in antlers. Furthermore, roe deer shed their antlers annually, and hence antlers may provide a time-resolved environmental archive for fallout radionuclides. The radiochemical procedure is based on a Pu separation step by anion exchange (Dowex 1 × 8) and a subsequent U purification by extraction chromatography using UTEVA ® . The samples were measured by Accelerator Mass Spectrometry at the VERA facility (University of Vienna). In addition to the 236 U and 239 Pu concentrations, the 240 Pu/ 239 Pu isotopic ratios were determined with a mean value of 0.172 ± 0.023 which is in agreement with the ratio of global fallout (∼0.18). Rather high 236 U/ 238 U ratios of the order of 10 −6 were observed. These measured ratios, where the 236 U arises only from global fallout, have implications for the use of the 236 U/ 238 U ratio as a fingerprint for nuclear accidents or releases from nuclear facilities. Our investigations have shown the potential to use antlers as a temporally resolved archive for the uptake of actinides from the environment. - Highlights: • Roe deer antlers were studied as an environmental archive for the retrospective study of fallout isotopes 236 U and 239 Pu. • The rather high 236 U/ 238 U ratios of about 10 −6 suggest 236 U as a fingerprint tool for nuclear material releases. • The 240 Pu/ 239 Pu atom ratio underpins global fallout as the main anthropogenic contributor in antlers.
Transport of plutonium, americium, and curium from soils into plants by roots
International Nuclear Information System (INIS)
Pimpl, M.; Schuettelkopf, H.
1979-12-01
For assessing the dose from radionuclides in agricultural products by ingestion it is necessary to know the soil to plant transfer factors. The literature was entirely investigated, in order to judge the size of the soil to plant transfer factors. In total, 92 publications - from 1948 to 1978 -have been evaluated. As result, transfer factors from 10 -9 to 10 -3 have been found for Plutonium, and from 10 -6 to 1 for Americium. For Curium only few data are available in literature. The considerable variation of the measured transfer factors is based on the dependence of these transfer factors from the ion exchange capacity of soils, from the amount of organic materials, from the pH-value, and from the mode of contamination. There are, in any case, contradictory data, although there has been detected a dependence of the transfer factors from these parameters. Chelating agenst increase the transfer factors to approximately 1300. As well, fertilizers have an influence on the size of the transfer factors - however, the relationships have been scarcely investigated. The distribution of actinides within the individual parts of plants has been investigated. The highest concentrations are in the roots; in the plant parts above ground the concentration of actinides decreases considerably. The most inferior transfer factors were measured for the respective seed or fruits. The soil to plant transfer factors of actinides are more dependend on the age of the plants within one growing period. At the beginning of the period, the transfer factor is considerably higher than at the end of this period. With respect to plants with a growing period of several years, correlations are unknown. (orig.) [de
Longkumer, Toshisangba; Kamireddy, Swetha; Muthyala, Venkateswar Reddy; Akbarpasha, Shaikh; Pitchika, Gopi Krishna; Kodetham, Gopinath; Ayaluru, Murali; Siddavattam, Dayananda
2013-01-01
While analyzing plasmids of Acinetobacter sp. DS002 we have detected a circular DNA molecule pTS236, which upon further investigation is identified as the genome of a phage. The phage genome has shown sequence similarity to the recently discovered Sphinx 2.36 DNA sequence co-purified with the Transmissible Spongiform Encephalopathy (TSE) particles isolated from infected brain samples collected from diverse geographical regions. As in Sphinx 2.36, the phage genome also codes for three proteins. One of them codes for RepA and is shown to be involved in replication of pTS236 through rolling circle (RC) mode. The other two translationally coupled ORFs, orf106 and orf96, code for coat proteins of the phage. Although an orf96 homologue was not previously reported in Sphinx 2.36, a closer examination of DNA sequence of Sphinx 2.36 revealed its presence downstream of orf106 homologue. TEM images and infection assays revealed existence of phage AbDs1 in Acinetobacter sp. DS002.
49 CFR 236.51 - Track circuit requirements.
2010-10-01
...: All Systems Track Circuits § 236.51 Track circuit requirements. Track relay controlling home signals shall be in deenergized position, or device that functions as a track relay controlling home signals... conditions exist: (a) When a rail is broken or a rail or switch-frog is removed except when a rail is broken...
48 CFR 552.236-74 - Working Hours.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Working Hours. 552.236-74... Hours. As prescribed in 536.570-5, insert the following clause: Working Hours (APR 1984) (a) It is contemplated that all work will be performed during the customary working hours of the trades involved unless...
48 CFR 1852.236-73 - Hurricane plan.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Hurricane plan. 1852.236-73... Hurricane plan. As prescribed in 1836.570(c), insert the following clause: Hurricane Plan (DEC 1988) In the event of a hurricane warning, the Contractor shall— (a) Inspect the area and place all materials...
49 CFR 236.338 - Mechanical locking required in accordance with locking sheet and dog chart.
2010-10-01
... locking sheet and dog chart. 236.338 Section 236.338 Transportation Other Regulations Relating to... in accordance with locking sheet and dog chart. Mechanical locking shall be in accordance with locking sheet and dog chart currently in effect. ...
Recommendation on changing interfaces of W-058 and W-236A
International Nuclear Information System (INIS)
Light, J.M.
1994-01-01
This position paper recommends changes to improve the interface between the Cross-Site Transfer System (Project W-058) and the Multi-Function Waste Tank Facility (Project W-236A) to handle planned waste retrieval and storage operations. Appendix A includes cost estimates and schedule impacts for each project. The cost estimates, schedule impacts, and this position paper will be the basis for writing a change request to formally implement these changes on Project W-236A and Project W-058/W-028. Recommendations are made on pipeline rerouting, pump and configuration, and flushing configuration
49 CFR 236.919 - Operations and Maintenance Manual.
2010-10-01
..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Standards for Processor-Based Signal and Train Control Systems § 236.919 Operations and Maintenance Manual. (a... identify all software versions, revisions, and revision dates. Plans must be legible and correct. (c...
49 CFR 236.1039 - Operations and Maintenance Manual.
2010-10-01
..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Positive Train Control Systems § 236.1039 Operations and Maintenance Manual. (a) The railroad shall catalog and... software versions, revisions, and revision dates. Plans must be legible and correct. (c) Hardware, software...
48 CFR 852.236-74 - Inspection of construction.
2010-10-01
...: (a) Inspection of materials and articles furnished under this contract will be made at the site by... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Inspection of construction... CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.236-74...
{sup 236}U and {sup 129}I as tracers of water masses in the Arctic Ocean
Energy Technology Data Exchange (ETDEWEB)
Casacuberta, Nuria; Christl, Marcus; Vockenhuber, Christof; Synal, Hans-Arno [Laboratory of Ion Beam Physics, ETH-Zurich (Switzerland); Walther, Clemens [Institut fuer Radiooekologie und Strahlenschutz, Leibniz Universitaet Hannover (Germany); Loeff, Michiel van der [AWI-Geochemistry, Alfred Wegener Institut Fuer Polar und Meeresforshung, Bremerhaven (Germany); Masque, Pere [Institut de Ciencia i Tecnologia Ambientals, Universitat Autonoma de Barcelona, Bellaterra (Spain)
2014-07-01
Recently {sup 236}U attested to be a new transient oceanographic tracer: it is conservative in seawater and far from having reached steady state in the oceans. Its main sources in the North Atlantic are global fallout and European reprocessing plants. In this study, concentrations of {sup 236}U and {sup 129}I of eight deep profiles in the Arctic Ocean collected in 2011-2012 were determined with a compact ETH Zurich AMS system (TANDY). Results on {sup 236}U/{sup 238}U show a steep gradient, from the lowest ever-reported {sup 236}U/{sup 238}U atomic ratio in open ocean water (5±5) x 10{sup -12} up to (3700±80) x 10{sup -12}. Whereas the very low ratios are indicative for deep old waters, high ratios in shallow and surface waters show a clear signature of Atlantic Waters (AW) penetrating to the Arctic Ocean. The combination of {sup 236}U with {sup 129}I, both being released by the nuclear reprocessing plants of Sellafield and La Hague, with a distinct temporal input function, is used to estimate transit time of AW distributions in the Arctic Ocean.
42 CFR 435.236 - Individuals in institutions who are eligible under a special income level.
2010-10-01
... a special income level. 435.236 Section 435.236 Public Health CENTERS FOR MEDICARE & MEDICAID... in institutions who are eligible under a special income level. (a) If the agency provides Medicaid... not institutionalized; but (2) Have income below a level specified in the plan under § 435.722. (See...
27 CFR 40.236 - Release from customs custody.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Release from customs... on Tobacco Products § 40.236 Release from customs custody. The release of tobacco products from customs custody, in bond, for transfer to the premises of a tobacco products factory, shall be in...
Radioisotope dilution analyses of geological samples using 236U and 229Th
International Nuclear Information System (INIS)
Rosholt, J.N.
1984-01-01
The use of 236 U and 229 Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: 1) these isotopes do not occur in terrestrial rocks, 2) they have negligible decay losses because of their long half lives, 3) they cause minimal recoil contamination to surface-barrier detectors, 4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and 5) they allow for simple and constant corrections for spectral interferences, 0.5% of the 238 U activity is subtracted for the contribution of 235 U in the 236 U peak and 1% of the 229 Th activity is subtracted from the 230 Th activity. Disadvantages in using 236 U and 229 Th are: 1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, 2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and 3) separate calibrations of the 236 U and 229 Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. (orig.)
Radioisotope dilution analyses of geological samples using 236U and 229Th
Rosholt, J.N.
1984-01-01
The use of 236U and 229Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: (1) these isotopes do not occur in terrestrial rocks, (2) they have negligible decay losses because of their long half lives, (3) they cause minimal recoil contamination to surface-barrier detectors, (4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and (5) they allow for simple and constant corrections for spectral inferences, 0.5% of the 238U activity is subtracted for the contribution of 235U in the 236U peak and 1% of the 229Th activity is subtracted from the 230Th activity. Disadvantages in using 236U and 229Th are: (1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, (2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and (3) separate calibrations of the 236U and 229Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. ?? 1984.
48 CFR 52.236-17 - Layout of Work.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Layout of Work. 52.236-17... Layout of Work. As prescribed in 36.517, insert the following clause in solicitations and contracts when... need for accurate work layout and for siting verification during work performance: Layout of Work (APR...
Energy Technology Data Exchange (ETDEWEB)
Yang, Guosheng [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan); Division of Nuclear Technology and Applications, Institute of High Energy Physics, Chinese Academy of Sciences (China); Beijing Engineering Research Center of Radiographic Techniques and Equipment, Beijing, 100049 (China); Tazoe, Hirofumi [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan); Yamada, Masatoshi, E-mail: myamada@hirosaki-u.ac.jp [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan)
2016-11-09
In order to measure trace {sup 236}U and {sup 236}U/{sup 238}U in environmental samples with a high matrix effect, a novel and simple method was developed that makes the digestion and purification procedures compatible with advanced triple-quadrupole inductively coupled plasma-mass spectrometry. A total dissolution of sample with HF + HNO{sub 3} + HClO{sub 4} was followed by chromatographic separation with a single resin column containing normal type DGA resin (N,N,N′,N’-tetra-n-octyldiglycolamide) as the extractant system. The analytical accuracy and precision of {sup 236}U/{sup 238}U ratios, measured as {sup 236}U{sup 16}O{sup +}/{sup 238}U{sup 16}O{sup +}, were examined by using the reference materials IAEA-135, IAEA-385, IAEA-447, and JSAC 0471. The low method detection limit (3.50 × 10{sup −6} Bq kg{sup −1}) makes it possible to perform routine monitoring of environmental {sup 236}U due to global fallout combined with the Fukushima Daiichi Nuclear Power Plant accident fallout (>10{sup −5} Bq kg{sup −1}). Finally, the developed method was successfully applied to measure {sup 236}U/{sup 238}U ratios and {sup 236}U activities in soil samples contaminated by the accident. The low {sup 236}U/{sup 238}U atom ratios ((1.50–13.5) × 10{sup −8}) and {sup 236}U activities ((2.25–14.1) × 10{sup −2} mBq kg{sup −1}) indicate {sup 236}U contamination was mainly derived from global fallout in the examined samples. - Highlights: • A simple {sup 236}U/{sup 238}U analytical method has been developed. • The separation required just one DGA column chromatography. • {sup 236}U/{sup 238}U atom ratios in soil were measured by ICP-MS/MS. • {sup 236}U/{sup 238}U atom ratios of (1.50–13.5) × 10{sup −8} were observed in Japanese samples. • {sup 236}U activities of (2.25–14.1) × 10{sup −2} mBq kg{sup −1} were found in Japanese samples.
MODELING AND DESIGN STUDY USING HFC-236EA AS AN ALTERNATIVE REFRIGERANT IN A CENTRIFUGAL COMPRESSOR
The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...
24 CFR 236.253 - Premiums-operating loss loans.
2010-04-01
... Obligations for Mortgage Insurance § 236.253 Premiums—operating loss loans. All of the provisions of § 207.252a of this chapter relating to mortgage insurance premiums on operating loss loans shall apply to... Act the mortgage insurance premiums due in accordance with § 207.252a shall be calculated on the basis...
236-Z canyon utilization study
International Nuclear Information System (INIS)
Dixon, D.R.
1977-01-01
The 236-Z canyon contains equipment for repurification of plutonium and recovery of plutonium from scrap material. To meet production requirements of Fast Flux Test Facility/Clinch River Breeder Reactor oxide with the existing plant, several new pieces of equipment will be needed in the future. More storage space and a better accountability system are needed to support this increased production. The available canyon space needs to be utilized to its fullest in order to accommodate the new equipment. The purpose of this document is to identify the new pieces of equipment, show how they fit into the flowsheet, and locate them in the canyon
27 CFR 46.236 - Articles in a warehouse.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles in a warehouse... Tubes Held for Sale on April 1, 2009 Filing Requirements § 46.236 Articles in a warehouse. (a) Articles... articles will be offered for sale. (b) Articles offered for sale at several locations must be reported on a...
48 CFR 236.271 - Cost-plus-fixed-fee contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-fixed-fee... CONTRACTS Special Aspects of Contracting for Construction 236.271 Cost-plus-fixed-fee contracts. Annual military construction appropriations acts restrict the use of cost-plus-fixed-fee contracts (see 216.306(c...
236U and 239,240Pu ratios from soils around an Australian nuclear weapons test site
International Nuclear Information System (INIS)
Tims, S.G.; Froehlich, M.B.; Fifield, L.K.; Wallner, A.; De Cesare, M.
2016-01-01
The isotopes 236 U, 239 Pu and 240 Pu are present in surface soils as a result of global fallout from nuclear weapons tests carried out in the 1950's and 1960's. These isotopes potentially constitute artificial tracers of recent soil erosion and sediment movement. Only Accelerator Mass Spectrometry has the requisite sensitivity to measure all three isotopes at these environmental levels. Coupled with its relatively high throughput capabilities, this makes it feasible to conduct studies of erosion across the geographical extent of the Australian continent. In the Australian context, however, global fallout is not the only source of these isotopes. As part of its weapons development program the United Kingdom carried out a series of atmospheric and surface nuclear weapons tests at Maralinga, South Australia in 1956 and 1957. The tests have made a significant contribution to the Pu isotopic abundances present in the region around Maralinga and out to distances ∼1000 km, and impact on the assessment techniques used in the soil and sediment tracer studies. Quantification of the relative fallout contribution derived from detonations at Maralinga is complicated owing to significant contamination around the test site from numerous nuclear weapons safety trials that were also carried out around the site. We show that 236 U can provide new information on the component of the fallout that is derived from the local nuclear weapons tests, and highlight the potential of 236 U as a new fallout tracer. - Highlights: • Measured 236 U inventories around the Maralinga Test Nuclear weapons test site. • Comparison of 236 U and 239 Pu soil depth profiles at Maralinga. • Differences in 236 U and 239 Pu inventories indicate most Pu fallout is from the safety trials, rather than the weapons tests.
Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms
International Nuclear Information System (INIS)
Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z.; Gillow, J.B.; Francis, A.J.
2004-01-01
We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K d ) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N H 2 O ) and the degree of strength of ligand field (R E/M ) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K d of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K d , indicating that an exchange with Na + on the functional groups was involved in their sorption. The ΔN H 2 O (= 9 - N H 2 O ) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R E/M for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)
Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms
Energy Technology Data Exchange (ETDEWEB)
Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z. [Advanced Science Research Center, Japan Atomic Energy Research Inst., Ibaraki (Japan); Gillow, J.B.; Francis, A.J. [Environmental Sciences Dept., Brookhaven National Lab., Upton, NY (United States)
2004-07-01
We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K{sub d}) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N{sub H{sub 2}O}) and the degree of strength of ligand field (R{sub E/M}) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K{sub d} of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K{sub d}, indicating that an exchange with Na{sup +} on the functional groups was involved in their sorption. The {delta}N{sub H{sub 2}O} (= 9 - N{sub H{sub 2}O}) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R{sub E/M} for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)
GERRITSE, J; GOTTSCHAL, JC
1992-01-01
Bacteria from an anaerobic enrichment reductively removed chlorine from the ortho- position of 2,3,6-trichlorobenzoic acid (2,3,6-TBA) producing 2,5-dichlorobenzoate (2,5-DBA). The strictly aerobic bacterium Pseudomonas aeruginosa JB2 subsequently used 2,5-DBA as a growth substrate in the presence
49 CFR 236.1045 - Training specific to office control personnel.
2010-10-01
... control system, including provision for movement and protection of roadway workers, unequipped trains... 49 Transportation 4 2010-10-01 2010-10-01 false Training specific to office control personnel. 236... INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES...
49 CFR 236.925 - Training specific to control office personnel.
2010-10-01
... applicable to the train control system, including provision for movement and protection of roadway workers... 49 Transportation 4 2010-10-01 2010-10-01 false Training specific to control office personnel. 236... INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES...
Study of 236U/238U ratio at CIRCE using a 16-strip silicon detector with a TOF system
De Cesare, M.; De Cesare, N.; D'Onofrio, A.; Gialanella, L.; Terrasi, F.
2015-04-01
Accelerator Mass Spectrometry (AMS) is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and xPu isotopes. A new actinide AMS system, based on a 3-MV pelletron tandem accelerator, is operated at the Center for Isotopic Research on Cultural and Environmental Heritage (CIRCE) in Caserta, Italy. In this paper we report on the procedure adopted to increase the 236U abundance sensitivity as low as possible. The energy and position determinations of the 236U ions, using a 16-strip silicon detector have been obtained. A 236U/238U isotopic ratio background level of about 2.9×10-11 was obtained, summing over all the strips, using a Time of Flight-Energy (TOF-E) system with a 16-strip silicon detector (4.9×10-12 just with one strip).
Energy Technology Data Exchange (ETDEWEB)
Quinto, Francesca; Hrnecek, Erich; Krachler, Michael [European Commission Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Shotyk, William [Department of Renewable Resources, University of Alberta, 839 General Services Building, Edmonton, AB (Canada); Steier, Peter; Winkler, Stephan; Golser, Robin [VERA Laboratory, Faculty of Physics, University of Vienna, Waehringer Strasse 17, A-1090 Vienna (Austria)
2014-07-01
U-236, Pu-239, Pu-240, Pu-241 and Pu-242 were analysed in an ombrotrophic peat core representing the last 80 years of atmospheric deposition. The determination of these isotopes at femtogram and attogram levels was possible by using ultra-clean laboratory procedures and accelerator mass spectrometry. Since the Pu isotopic composition characteristic for global fallout, as well as anthropogenic U-236, were identified in peat samples pre-dating the period of atmospheric atom bomb testing, migration of Pu and U within the peat profile is clearly indicated. The vertical profile of the U-236/U-238 isotopic ratio represents the first observation of the U-236 bomb peak in a terrestrial environment. Comparing the abundances of the global fallout derived U-236 and Pu-239 along the peat core, the post depositional migration of plutonium exceeds that of uranium. These results highlight, for the first time, the mobility of Pu and U in a peat bog with implications for their migration in other acidic, organic rich environments.
International Nuclear Information System (INIS)
Pimpel, M.; Schuettelkopf, H.
1984-01-01
A radiochemical method is described by which Np, Pu, Am and Cm in environmental samples can be determined. The transuranium elements are dissolved with acids out of the ashed material. Np/Pu is separated from Am/Cm by sequential extraction using TOPO/cyclohexane. The two fractions are radiochemically purified. Np-237, Pu-239+240, Pu-238 and Pu-236 as well as Am-243, Am-241, Cm-244 and Cm-242 are measured by alpha spectrometery. Pu-236, Am-243 and Np-239 are used to determine the respective yields. A fast method of Np-239 preparation is described. The chemical yields range from 60 to 90%. The detection limit attained per nuclide is 10 fCi/sample. 20 reference, 1 table
Study of 236U/238U ratio at CIRCE using a 16-strip silicon detector with a TOF system
Directory of Open Access Journals (Sweden)
De Cesare M.
2015-01-01
Full Text Available Accelerator Mass Spectrometry (AMS is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and xPu isotopes. A new actinide AMS system, based on a 3-MV pelletron tandem accelerator, is operated at the Center for Isotopic Research on Cultural and Environmental Heritage (CIRCE in Caserta, Italy. In this paper we report on the procedure adopted to increase the 236U abundance sensitivity as low as possible. The energy and position determinations of the 236U ions, using a 16-strip silicon detector have been obtained. A 236U/238U isotopic ratio background level of about 2.9×10−11 was obtained, summing over all the strips, using a Time of Flight-Energy (TOF-E system with a 16-strip silicon detector (4.9×10−12 just with one strip.
HEAT TRANSFER EVALUATION OF HFC-236FA IN CONDENSATION AND EVAPORATION
The report gives results of an evaluation of the shell-side heat transfer performance of hydrofluorocarbon (HFC)-236fa, which is considered to be a potential substitute for chlorofluorocarbon (CFC)-114 in Navy shipboard chillers, for both conventional finned [1024- and 1575-fpm (...
Energy Technology Data Exchange (ETDEWEB)
Christl, Marcus; Casacuberta, Nuria; Lachner, Johannes; Maxeiner, Sascha; Vockenhuber, Christof; Synal, Hans-Arno [Labor fuer Ionenstrahlphysik, ETH Zuerich (Switzerland); Herrmann, Juergen [Bundesamt fuer Seeschifffahrt und Hydroghraphie, Hamburg (Germany); Castrillejo, Maxi; Masque, Pere [Universitat Autonoma de Barcelona (Spain); Rutgers van der Loeff, Michiel [Alfred-Wegener-Institut, Bremerhaven (Germany)
2015-07-01
The technical developments of recent years, such as the introduction of helium as a stripping gas, make compact AMS systems probably among the most sensitive analyzers available for ultra-trace analyzes of actinides in the environment. Such systems are particularly suitable for the trace analysis of {sup 236}U since conventional mass spectrometry does not provide the necessary suppression of the substrate caused by molecules or neighboring masses. Over the past few years, unique data sets of {sup 236}U/{sup 238}U have been produced at the AMS System Tandy of the ETH Zurich in the Atlantic and Arctic Ocean as well as in the Mediterranean and the North Sea. This lecture will provide a brief overview of the latest technical developments in the field of heavy ion analysis at compact AMS plants at ETH Zurich. In the second part, the produced data sets are then assembled and the current understanding of this new ocean tracer discussed. [German] Die technischen Entwicklungen der letzten Jahre, wie zum Beispiel die Einfuehrung von Helium als stripper Gas, machen kompakte AMS Systeme wahrscheinlich zu den sensitivsten verfuegbaren Analysegeraeten fuer Ultra-Spurenstoffanalysen von Aktiniden in der Umwelt. Solche Systeme eignen sich im Besonderen zur Spurenanalyse von {sup 236}U, da konventionelle Massenspektrometrie hier nicht die erforderliche Unterdrueckung des durch Molekuele oder Nachbarmassen verursachten Untergrundes bietet. Am AMS System Tandy der ETH Zuerich wurden waehrend der letzten Jahre einzigartige Datensaetze von {sup 236}U/{sup 238}U im Atlantischen und Arktischen Ozean, sowie im Mittelmeer und der Nordsee produziert. In diesem Vortrag soll zunaechst ein kurzer Ueberblick ueber die neuesten technischen Entwicklungen im Bezug auf Schwerionen Analysen an kompakten AMS Anlagen der ETH Zuerich gegeben werden. Im zweiten Teil werden dann die produzierten Datensaetze zusammengefuegt und das gegenwaertige Verstaendnis dieses neuen Ozean-Tracers diskutiert.
24 CFR 1000.236 - What are eligible administrative and planning expenses?
2010-04-01
... administrative management; (2) Coordination monitoring and evaluation; (3) Preparation of the IHP including data... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false What are eligible administrative...) § 1000.236 What are eligible administrative and planning expenses? (a) Eligible administrative and...
Directory of Open Access Journals (Sweden)
J. Konki
2017-01-01
Full Text Available The new neutron-deficient nuclei 240Es and 236Bk were synthesised at the gas-filled recoil separator RITU. They were identified by their radioactive decay chains starting from 240Es produced in the fusion–evaporation reaction 209Bi(34S,3n240Es. Half-lives of 6(2s and 22−6+13s were obtained for 240Es and 236Bk, respectively. Two groups of α particles with energies Eα=8.19(3MeV and 8.09(3MeV were unambiguously assigned to 240Es. Electron-capture delayed fission branches with probabilities of 0.16(6 and 0.04(2 were measured for 240Es and 236Bk, respectively. These new data show a continuation of the exponential increase of ECDF probabilities in more neutron-deficient isotopes.
49 CFR 236.335 - Dogs, stops and trunnions of mechanical locking.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Dogs, stops and trunnions of mechanical locking..., AND APPLIANCES Interlocking Rules and Instructions § 236.335 Dogs, stops and trunnions of mechanical locking. Driving pieces, dogs, stops and trunnions shall be rigidly secured to locking bars. Swing dogs...
49 CFR 236.207 - Electric lock on hand-operated switch; control.
2010-10-01
..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.207 Electric lock on hand-operated switch; control. Electric lock on hand-operated switch shall be controlled so that it cannot be unlocked... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock on hand-operated switch; control...
48 CFR 652.236-71 - Foreign Service Buildings Act, as Amended.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Foreign Service Buildings....236-71 Foreign Service Buildings Act, as Amended. As prescribed in 636.570(a), insert the following provision: Foreign Service Buildings Act, as Amended (APR 2004) (a) This solicitation is subject to Section...
49 CFR 236.22 - Semaphore signal arm; clearance to other objects.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Semaphore signal arm; clearance to other objects... Rules and Instructions: All Systems Roadway Signals and Cab Signals § 236.22 Semaphore signal arm; clearance to other objects. At least one-half inch clearance shall be provided between semaphore signal arm...
International Nuclear Information System (INIS)
Geraldo, Bianca
2012-01-01
Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)
Solubility of Plutonium (IV) Oxalate During Americium/Curium Pretreatment
International Nuclear Information System (INIS)
Rudisill, T.S.
1999-01-01
Approximately 15,000 L of solution containing isotopes of americium and curium (Am/Cm) will undergo stabilization by vitrification at the Savannah River Site (SRS). Prior to vitrification, an in-tank pretreatment will be used to remove metal impurities from the solution using an oxalate precipitation process. Material balance calculations for this process, based on solubility data in pure nitric acid, predict approximately 80 percent of the plutonium in the solution will be lost to waste. Due to the uncertainty associated with the plutonium losses during processing, solubility experiments were performed to measure the recovery of plutonium during pretreatment and a subsequent precipitation process to prepare a slurry feed for a batch melter. A good estimate of the plutonium content of the glass is required for planning the shipment of the vitrified Am/Cm product to Oak Ridge National Laboratory (ORNL).The plutonium solubility in the oxalate precipitation supernate during pretreatment was 10 mg/mL at 35 degrees C. In two subsequent washes with a 0.25M oxalic acid/0.5M nitric acid solution, the solubility dropped to less than 5 mg/mL. During the precipitation and washing steps, lanthanide fission products in the solution were mostly insoluble. Uranium, and alkali, alkaline earth, and transition metal impurities were soluble as expected. An elemental material balance for plutonium showed that greater than 94 percent of the plutonium was recovered in the dissolved precipitate. The recovery of the lanthanide elements was generally 94 percent or higher except for the more soluble lanthanum. The recovery of soluble metal impurities from the precipitate slurry ranged from 15 to 22 percent. Theoretically, 16 percent of the soluble oxalates should have been present in the dissolved slurry based on the dilution effects and volumes of supernate and wash solutions removed. A trace level material balance showed greater than 97 percent recovery of americium-241 (from the beta dec
48 CFR 852.236-72 - Performance of work by the contractor.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance of work by the....236-72 Performance of work by the contractor. As prescribed in 836.501, insert the following clause: Performance of Work by the Contractor (JUL 2002) The clause entitled “Performance of Work by the Contractor...
48 CFR 52.236-1 - Performance of Work by the Contractor.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Performance of Work by the....236-1 Performance of Work by the Contractor. As prescribed in 36.501(b), insert the following clause... the work and customary or necessary specialty subcontracting (see 36.501(a)).] Performance of Work by...
49 CFR 236.308 - Mechanical or electric locking or electric circuits; requisites.
2010-10-01
..., AND APPLIANCES Interlocking Standards § 236.308 Mechanical or electric locking or electric circuits; requisites. Mechanical or electric locking or electric circuits shall be installed to prevent signals from... 49 Transportation 4 2010-10-01 2010-10-01 false Mechanical or electric locking or electric...
48 CFR 53.236-2 - Architect-engineer services (SF's 252 and 330).
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Architect-engineer... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.236-2 Architect-engineer...-engineer and related services: (a) SF 252 (Rev. 10/83), Architect-Engineer Contract. SF 252 is prescribed...
Position paper: Live load design criteria for Project W-236A Multi-Function Waste Tank Facility
International Nuclear Information System (INIS)
Giller, R.A.
1995-01-01
The purpose of this paper is to discuss the live loads applied to the underground storage tanks of the Multi Function Waste Tank Facility, and to provide the basis for Project W-236A live load criteria. Project 236A provides encompasses building a Weather Enclosure over the two underground storage tanks at the 200-West area. According to the Material Handling Study, the Groves AT 1100 crane used within the Weather Enclosure will have a gross vehicle weight of 66.5 tons. Therefore, a 100-ton concentrated live load is being used for the planning of the construction of the Weather Enclosure
Isotope shift of 234U, 236U, 238U in U I
International Nuclear Information System (INIS)
Gagne, J.M.; Nguyen Van, S.; Saint-Dizier, J.P.; Pianarosa, P.
1976-01-01
New and very accurate data of isotope shifts and relative isotope shifts in 234 U, 236 U, 238 U are presented. The invariance of the relative isotope shift, for the transitions we have investigated, supports the hypothesis that the so called specific mass effect is negligible in uranium
International Nuclear Information System (INIS)
Kim, Su-Jin; Jeong, Hyun-Ja; Park, Rae-Kil; Lee, Kang-Min; Kim, Hyung-Min; Um, Jae-Young; Hong, Seung-Heon
2007-01-01
SC-236 (4-[5-(4-chlorophenyl)-3-(trifluoromethyl)-1-pyrazol-1-]benzenesulfonamide; C 16 H 11 ClF 3 N 3 O 2 S), is a highly selective cyclooxygenase (COX)-2 inhibitor. Recently, there have been reports that SC-236 protects against cartilage damage in addition to reducing inflammation and pain in osteoarthritis. However, the mechanism involved in the inflammatory allergic reaction has not been examined. Mast cells accumulation can be related to inflammatory conditions, including allergic rhinitis, asthma, and rheumatoid arthritis. The aim of the present study is to investigate the effects of SC-236 on stem cell factor (SCF)-induced migration, morphological alteration, and cytokine production of rat peritoneal mast cells (RPMCs). We observed that SCF significantly induced the migration and morphological alteration. The ability of SCF to enhance migration and morphological alteration was abolished by treatment with SC-236. In addition, production of tumor necrosis factor (TNF)-α, interleukin (IL)-1β, and vascular endothelial growth factor (VEGF) production induced by SCF was significantly inhibited by treatment with SC-236. Previous work has demonstrated that SCF-induced migration and cytokine production of mast cells require p38 MAPK activation. We also showed that SC-236 suppresses the SCF-induced p38 MAPK activation in RPMCs. These data suggest that SC-236 inhibits migration and cytokine production through suppression of p38 MAPK activation. These results provided new insight into the pharmacological actions of SC-236 and its potential therapeutic role in the treatment of inflammatory allergic diseases
Neutron widths for 236U from high resolution transmission measurements at a 100M flightpath
International Nuclear Information System (INIS)
Carraro, G.; Brusegan, A.
1975-01-01
A series of neutron transmission measurements has been performed on 236 U aiming at a determination of the resonance parameters and their statistical properties. The analysis range covered neutron energies from 40eV to 4.1 keV. The experiments were carried out at about 100 m flightpath of the 80 MeV electron linear accelerator of CBNM using a 10 B slab-NaI detector and 2 236 U-oxyde samples on loan from the USAEC. A table displays the details of 6 experimental runs, 3 of which were arranged in such a way that the effect of the 235 U and 238 U impurities in the sample on the transmission was automatically compensated
International Nuclear Information System (INIS)
Beims, H.D.
1986-01-01
The starting point for the considerations and calculations given in this dissertation is the inevitable production of radioactive materials in the use of nuclear energy, which creates a considerable potential danger in a final store for a very long period. As one possibility of alleviating this problem, a concept for recycling the waste actinides neptunium, americium and curium was proposed. The waste actinides are separated in the reprocessing of burnt-up fuel elements and reach a further irradiation circuit. There they pass through the stages 'manufacture of irradiation elements', 'use in a fast power reactor' and reprocessing of irradiation elements' several times. In each irradiation and subsequent storage, about 17% of the waste actinides are removed by fission or by conversion into nuclides which can be reused as fuel, so that during the life of 40 years of the fast recycling reacor, the waste actinides can be reduced in mass by one half. In order to determine this mass reduction effect, a model calculation was developed, which includes the representation of the neutron physics and thermal properties of the reactor core and the storage and reprocessing of the irradiation elements. (orig./RB) [de
International Nuclear Information System (INIS)
Sawant, Pramilla D.; Prabhu, Supreetha P.; Kalsi, P.C.
2008-01-01
236 Pu and 242 Pu are routinely used as radiochemical yield monitors in India for bioassay monitoring of occupational workers by alpha spectrometry. Fission Track Analysis (FTA) is also being standardized for trace level determination of Pu in bioassay samples. The present study, reports the utility of 236 Pu and 242 Pu as radiochemical tracers in estimation of Pu in bioassay samples by FTA technique. The advantages of using 236 Pu tracer in FTA over 242 Pu as well as the interference caused due to presence of 241 Pu in the bioassay samples of occupational workers handling power reactor grade Pu is discussed. (author)
Shape Isomer in 236U Populated by Thermal Neutron Capture
DEFF Research Database (Denmark)
Andersen, Verner; Christensen, Carl Jørgen; Borggreen, J.
1976-01-01
The 116 ns shape isomer in 236U was populated by thermal neutron capture. Conversion electrons and X-rays were detected simultaneously in delayed coincidence with fission. The ratio of delayed to prompt fission was measured with the result, σIIf/σf = (1.0±0.2) × 10−5. A branching of the isomeric ...... decay σIIγ/σIIf = 7±2 was deduced from this number. No definite electron line structure was observed....
17 CFR 230.236 - Exemption of shares offered in connection with certain transactions.
2010-04-01
... Exemptions § 230.236 Exemption of shares offered in connection with certain transactions. Shares of stock or... securities in lieu of issuing fractional shares, script certificates or order forms, in connection with a stock dividend, stock split, reverse stock split, conversion, merger or similar transaction, shall be...
Fission Fragment Angular Distributions in the $^{234}$U(n,f) and $^{236}$U(n,f) reactions
We propose to measure the fission fragment angular distribution (FFAD) of the $^{234}$U(n,f) and $^{236}$U (n,f) reactions with the PPAC detection setup used in previous n_TOF-14 experiment. This experiment would take advantage of the high resolution of the n_TOF facility to investigate the FFAD behaviour in the pronounced vibrational resonances that have been observed between 0.1 and 2 MeV for the thorium cycle isotopes. In addition, the angular distribution of these isotopes will be measured for the first time beyond 14 MeV. Furthermore, the experiment will also provide the fission cross section with reduced statistical uncertainty, extending the $^{236}$U(n,f) data up to 1 GeV
49 CFR 236.206 - Battery or power supply with respect to relay; location.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Battery or power supply with respect to relay..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.206 Battery or power supply with respect to relay; location. The battery or power supply for each signal control relay circuit, where an open...
International Nuclear Information System (INIS)
Denyak, V.V.; Khvastunov, V.M.; Paschuk, S.A.; Schelin, H.R.
2013-01-01
Fission of the even-even nuclei 232 Th, 236,238 U and even-odd nuclei 233,235 U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of 236 U and 238 U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of 236 U. The measured cross section azimuthal asymmetry of the fission of 232 Th does not show any fragment mass dependence. In the even-odd nuclei 233 U and 235 U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)
HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION
The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...
International Nuclear Information System (INIS)
Boulyga, Sergei F.; Heumann, Klaus G.
2006-01-01
A method by inductively coupled plasma mass spectrometry (Icp-Ms) was developed which allows the measurement of 236 U at concentration ranges down to 3 x 10 -14 g g -1 and extremely low 236 U/ 238 U isotope ratios in soil samples of 10 -7 . By using the high-efficiency solution introduction system APEX in connection with a sector-field ICP-MS a sensitivity of more than 5000 counts fg -1 uranium was achieved. The use of an aerosol desolvating unit reduced the formation rate of uranium hydride ions UH + /U + down to a level of 10 -6 . An abundance sensitivity of 3 x 10 -7 was observed for 236 U/ 238 U isotope ratio measurements at mass resolution 4000. The detection limit for 236 U and the lowest detectable 236 U/ 238 U isotope ratio were improved by more than two orders of magnitude compared with corresponding values by alpha spectrometry. Determination of uranium in soil samples collected in the vicinity of Chernobyl nuclear power plant (NPP) resulted in that the 236 U/ 238 U isotope ratio is a much more sensitive and accurate marker for environmental contamination by spent uranium in comparison to the 235 U/ 238 U isotope ratio. The ICP-MS technique allowed for the first time detection of irradiated uranium in soil samples even at distances more than 200 km to the north of Chernobyl NPP (Mogilev region). The concentration of 236 U in the upper 0-10 cm soil layers varied from 2 x 10 -9 g g -1 within radioactive spots close to the Chernobyl NPP to 3 x 10 -13 g g -1 on a sampling site located by >200 km from Chernobyl
Boulyga, Sergei F; Heumann, Klaus G
2006-01-01
A method by inductively coupled plasma mass spectrometry (ICP-MS) was developed which allows the measurement of (236)U at concentration ranges down to 3 x 10(-14)g g(-1) and extremely low (236)U/(238)U isotope ratios in soil samples of 10(-7). By using the high-efficiency solution introduction system APEX in connection with a sector-field ICP-MS a sensitivity of more than 5,000 counts fg(-1) uranium was achieved. The use of an aerosol desolvating unit reduced the formation rate of uranium hydride ions UH(+)/U(+) down to a level of 10(-6). An abundance sensitivity of 3 x 10(-7) was observed for (236)U/(238)U isotope ratio measurements at mass resolution 4000. The detection limit for (236)U and the lowest detectable (236)U/(238)U isotope ratio were improved by more than two orders of magnitude compared with corresponding values by alpha spectrometry. Determination of uranium in soil samples collected in the vicinity of Chernobyl nuclear power plant (NPP) resulted in that the (236)U/(238)U isotope ratio is a much more sensitive and accurate marker for environmental contamination by spent uranium in comparison to the (235)U/(238)U isotope ratio. The ICP-MS technique allowed for the first time detection of irradiated uranium in soil samples even at distances more than 200 km to the north of Chernobyl NPP (Mogilev region). The concentration of (236)U in the upper 0-10 cm soil layers varied from 2 x 10(-9)g g(-1) within radioactive spots close to the Chernobyl NPP to 3 x 10(-13)g g(-1) on a sampling site located by >200 km from Chernobyl.
Separation and recovery of Cm from Cm-Pu mixed oxide samples containing Am impurity
International Nuclear Information System (INIS)
Hirokazu Hayashi; Hiromichi Hagiya; Mitsuo Akabori; Yasuji Morita; Kazuo Minato
2013-01-01
Curium was separated and recovered as an oxalate from a Cm-Pu mixed oxide which had been a 244 Cm oxide sample prepared more than 40 years ago and the ratio of 244 Cm to 240 Pu was estimated to 0.2:0.8. Radiochemical analyses of the solution prepared by dissolving the Cm-Pu mixed oxide in nitric acid revealed that the oxide contained about 1 at% of 243 Am impurity. To obtain high purity curium solution, plutonium and americium were removed from the solution by an anion exchange method and by chromatographic separation using tertiary pyridine resin embedded in silica beads with nitric acid/methanol mixed solution, respectively. Curium oxalate, a precursor compound of curium oxide, was prepared from the purified curium solution. 11.9 mg of Cm oxalate having some amounts of impurities, which are 243 Am (5.4 at%) and 240 Pu (0.3 at%) was obtained without Am removal procedure. Meanwhile, 12.0 mg of Cm oxalate (99.8 at% over actinides) was obtained with the procedure including Am removals. Both of the obtained Cm oxalate sample were supplied for the syntheses and measurements of the thermochemical properties of curium compounds. (author)
Energy Technology Data Exchange (ETDEWEB)
Boulyga, Sergei F. [Institute of Inorganic Chemistry and Analytical Chemistry, Johannes Gutenberg-University Mainz, Duesbergweg 10-14, 55099 Mainz (Germany)]. E-mail: sergei.boulyga@univie.ac.at; Heumann, Klaus G. [Institute of Inorganic Chemistry and Analytical Chemistry, Johannes Gutenberg-University Mainz, Duesbergweg 10-14, 55099 Mainz (Germany)
2006-07-01
A method by inductively coupled plasma mass spectrometry (Icp-Ms) was developed which allows the measurement of {sup 236}U at concentration ranges down to 3 x 10{sup -14} g g{sup -1} and extremely low {sup 236}U/{sup 238}U isotope ratios in soil samples of 10{sup -7}. By using the high-efficiency solution introduction system APEX in connection with a sector-field ICP-MS a sensitivity of more than 5000 counts fg{sup -1} uranium was achieved. The use of an aerosol desolvating unit reduced the formation rate of uranium hydride ions UH{sup +}/U{sup +} down to a level of 10{sup -6}. An abundance sensitivity of 3 x 10{sup -7} was observed for {sup 236}U/{sup 238}U isotope ratio measurements at mass resolution 4000. The detection limit for {sup 236}U and the lowest detectable {sup 236}U/{sup 238}U isotope ratio were improved by more than two orders of magnitude compared with corresponding values by alpha spectrometry. Determination of uranium in soil samples collected in the vicinity of Chernobyl nuclear power plant (NPP) resulted in that the {sup 236}U/{sup 238}U isotope ratio is a much more sensitive and accurate marker for environmental contamination by spent uranium in comparison to the {sup 235}U/{sup 238}U isotope ratio. The ICP-MS technique allowed for the first time detection of irradiated uranium in soil samples even at distances more than 200 km to the north of Chernobyl NPP (Mogilev region). The concentration of {sup 236}U in the upper 0-10 cm soil layers varied from 2 x 10{sup -9} g g{sup -1} within radioactive spots close to the Chernobyl NPP to 3 x 10{sup -13} g g{sup -1} on a sampling site located by >200 km from Chernobyl.
The report gives results of an evaluation of the heat transfer performance of pure hydrofluorocarbon (HFC)-236ea for high performance enhanced tubes which had not been previously used in Navy shipboard chillers. Shell-side heat transfer coefficient data are presented for condensa...
(236)U and (239,)(240)Pu ratios from soils around an Australian nuclear weapons test site.
Tims, S G; Froehlich, M B; Fifield, L K; Wallner, A; De Cesare, M
2016-01-01
The isotopes (236)U, (239)Pu and (240)Pu are present in surface soils as a result of global fallout from nuclear weapons tests carried out in the 1950's and 1960's. These isotopes potentially constitute artificial tracers of recent soil erosion and sediment movement. Only Accelerator Mass Spectrometry has the requisite sensitivity to measure all three isotopes at these environmental levels. Coupled with its relatively high throughput capabilities, this makes it feasible to conduct studies of erosion across the geographical extent of the Australian continent. In the Australian context, however, global fallout is not the only source of these isotopes. As part of its weapons development program the United Kingdom carried out a series of atmospheric and surface nuclear weapons tests at Maralinga, South Australia in 1956 and 1957. The tests have made a significant contribution to the Pu isotopic abundances present in the region around Maralinga and out to distances ∼1000 km, and impact on the assessment techniques used in the soil and sediment tracer studies. Quantification of the relative fallout contribution derived from detonations at Maralinga is complicated owing to significant contamination around the test site from numerous nuclear weapons safety trials that were also carried out around the site. We show that (236)U can provide new information on the component of the fallout that is derived from the local nuclear weapons tests, and highlight the potential of (236)U as a new fallout tracer. Crown Copyright © 2015. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Denyak, V.V. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Pele Pequeno Principe Research Institute, Curitiba (Brazil); Khvastunov, V.M. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Paschuk, S.A. [Federal University of Technology - Parana, Curitiba (Brazil); Schelin, H.R. [Federal University of Technology - Parana, Curitiba (Brazil); Pele Pequeno Principe Research Institute, Curitiba (Brazil)
2013-04-15
Fission of the even-even nuclei {sup 232}Th, {sup 236,238}U and even-odd nuclei {sup 233,235}U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of {sup 236}U and {sup 238}U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of {sup 236}U. The measured cross section azimuthal asymmetry of the fission of {sup 232}Th does not show any fragment mass dependence. In the even-odd nuclei {sup 233}U and {sup 235}U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)
Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Ero, Janos; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hoch, Michael; Hormann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schofbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; De Wolf, Eddi A.; Hashemi, Majid; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Mozer, Matthias Ulrich; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Villella, Ilaria; Chabert, Eric Christian; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Marage, Pierre Edouard; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; Cortina Gil, Eduardo; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Gregoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Militaru, Otilia; Ovyn, Severine; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Herquet, Philippe; Alves, Gilvan; Pol, Maria Elena; Henrique Gomes e Souza, Moacyr; Carvalho, Wagner; Melo Da Costa, Eliza; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Oguri, Vitor; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Dias, Marco Andre Ferreira; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Damgov, Jordan; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Stoykova, Stefka; Sultanov, Georgi; Trayanov, Rumen; Vankov, Ivan; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leandar; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Jian; Wang, Xianyou; Wang, Zheng; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Hu, Zhen; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Andres Carrillo Montoya, Camilo; Gomez Moreno, Bernardo; Andres Ocampo Rios, Alberto; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Papadakis, Antonakis; Ptochos, Fotios; Razis, Panos A.; Tsiakkouri, Demetra; Zinonos, Zinonas; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Muntel, Mait; Raidal, Martti; Rebane, Liis; Eerola, Paula; Czellar, Sandor; Harkonen, Jaakko; Heikkinen, Mika Aatos; Karimaki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampen, Tapio; Lassila-Perini, Kati; Lehti, Sami; Linden, Tomas; Luukka, Panja-Riina; Maenpaa, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Descamps, Julien; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, Francois-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, Andre; Rousseau, Delphine; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Bianchini, Lorenzo; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Elgammal, Sherif; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Mine, Philippe; Paganini, Pascal; Sirois, Yves; Thiebaux, Christophe; Zabi, Alexandre; Agram, Jean-Laurent; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Conte, Eric; Drouhin, Frederic; Ferro, Cristina; Fontaine, Jean-Charles; Gele, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Ripp-Baudot, Isabelle; Speck, Joaquim; Van Hove, Pierre; Baty, Clement; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fassi, Farida; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Pandoulas, Demetrios; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Actis, Oxana; Bender, Walter; Biallass, Philipp; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Kirsch, Matthias; Klimkovich, Tatsiana; Kreuzer, Peter; Lanske, Dankfried; Merschmeyer, Markus; Meyer, Arnd; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sowa, Michael; Steggemann, Jan; Teyssier, Daniel; Zeidler, Clemens; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flugge, Gunter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrens, Ulf; Borras, Kerstin; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Meyer, Andreas Bernhard; Mnich, Joachim; Olzem, Jan; Parenti, Andrea; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Volyanskyy, Dmytro; Wissing, Christoph; Autermann, Christian; Draeger, Jula; Eckstein, Doris; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Sander, Christian; Schleper, Peter; Schroder, Matthias; Schum, Torben; Stadie, Hartmut; Steinbruck, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Blum, Peter; Buege, Volker; Cakir, Altan; Chwalek, Thorsten; Daeuwel, Daniel; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Frey, Martin; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heinrich, Michael; Hoffmann, Karl-heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Muller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Renz, Manuel; Sabellek, Andreas; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jurgen; Stober, Fred-Markus; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Karafasoulis, Konstantinos; Kyriakis, Aristoteles; Loukas, Demitrios; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Zachariadou, Aikaterini; Agapitos, Antonis; Gouskos, Loukas; Katsas, Panagiotis; Panagiotou, Apostolos; Saganis, Konstantinos; Xaxiris, Evangelos; Evangelou, Ioannis; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Sharma, Richa; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Chauhan, Sushil; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Sandhya; Jain, Shilpi; Kumar, Ashok; Ranjan, Kirti; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Nayak, Aruna; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Fahim, Ali; Jafari, Abideh; Mohammadi Najafabadi, Mojtaba; Moshaii, Ahmad; Paktinat Mehdiabadi, Saeid; Zeinali, Maryam; Felcini, Marta; Abbrescia, Marcello; Barbone, Lucia; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pierro, Giuseppe Antonio; Polese, Giovanni; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Chiorboli, Massimiliano; Costa, Salvatore; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Broccolo, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Landi, Gregorio; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Menasce, Dario; Miccio, Vincenzo; Moroni, Luigi; Negri, Pietro; Paganoni, Marco; Pedrini, Daniele; Pullia, Antonino; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Salerno, Roberto; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Taroni, Silvia; Cimmino, Anna; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Biasotto, Massimo; Carlin, Roberto; Checchia, Paolo; De Mattia, Marco; Dorigo, Tommaso; Fanzago, Federica; Gasparini, Fabrizio; Giubilato, Piero; Gonella, Franco; Gresele, Ambra; Gulmini, Michele; Lacaprara, Stefano; Lazzizzera, Ignazio; Maron, Gaetano; Mattiazzo, Serena; Meneguzzo, Anna Teresa; Passaseo, Marina; Pegoraro, Matteo; Pozzobon, Nicola; Ronchese, Paolo; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Ventura, Sandro; Zotto, Pierluigi; Baesso, Paolo; Berzano, Umberto; Pagano, Davide; Ratti, Sergio P.; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fano, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Bocci, Andrea; Castaldi, Rino; Dell'Orso, Roberto; Dutta, Suchandra; Fiori, Francesco; Foa, Lorenzo; Gennai, Simone; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Sarkar, Subir; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Rovelli, Chiara; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Borgia, Maria Assunta; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Dellacasa, Giulio; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Penzo, Aldo; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kong, Dae Jung; Park, Hyangkyu; Son, Dong-Chul; Kim, Jaeho; Song, Sanghyeon; Jung, Seung Yong; Hong, Byung-Sik; Kim, Hyunchul; Kim, Ji Hyun; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Sim, Kwang Souk; Kim, Jangho; Choi, Minkyoo; Park, In Kyu; Choi, Suyong; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Jo, Youngkwon; Kwon, Jeongteak; Lee, Jongseok; Lee, Sungeun; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; Sanchez Hernandez, Alberto; Carrillo Moreno, Salvador; Ibarguen, Humberto Antonio Salazar; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Allfrey, Philip; Krofcheck, David; Aumeyr, Thomas; Butler, Philip H.; Signal, Tony; Williams, Jennifer C.; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Gorski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; Bargassa, Pedrame; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Musella, Pasquale; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Varela, Joao; Wohri, Hermine Katharina; Altsybeev, Igor; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger, Michael, Jr.; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Vishnevskiy, Alexander; Volodko, Anton; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Obrant, Gennady; Shcheglov, Yury; Shchetkovskiy, Alexander; Smirnov, Igor; Sulimov, Valentin; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Ilina, Natalia; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Kuleshov, Sergey; Oulianov, Alexei; Safronov, Grigory; Semenov, Sergey; Shreyber, Irina; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Vardanyan, Irina; Dremin, Igor; Kirakosyan, Martin; Konovalova, Nina; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Datsko, Kirill; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Sytine, Alexandre; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Maletic, Dimitrije; Puzovic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernandez Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Pelayo, Jesus Puerta; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; de Troconiz, Jorge F.; Cuevas, Javier; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; Iglesias, Lara Lloret; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Diaz Merino, Irma; Diez Gonzalez, Carlos; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Pardo, Patricia Lobelle; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Rodrigo, Teresa; Jimeno, Alberto Ruiz; Scodellaro, Luca; Sanudo, Mar Sobron; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Beaudette, Florian; Beccati, Barbara; Bell, Alan James; Bellan, Riccardo; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bolognesi, Sara; Bona, Marcella; Breuker, Horst; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cattai, Ariella; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Cure, Benoit; Dahms, Torsten; De Roeck, Albert; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gowdy, Stephen; Guiducci, Luigi; Gutleber, Johannes; Hartl, Christian; Harvey, John; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Huhtinen, Mika; Innocente, Vincenzo; Janot, Patrick; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Meridiani, Paolo; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mulders, Martijn; Noy, Matthew; Orimoto, Toyoko; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimia, Martti; Racz, Attila; Rolandi, Gigi; Rovere, Marco; Ryjov, Vladimir; Sakulin, Hannes; Schafer, Christoph; Schlatter, Wolf-Dieter; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stockli, Fabian; Traczyk, Piotr; Tropea, Paola; Tsirou, Andromachi; Istvan Veres, Gabor; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Konig, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Caminada, Lea; Casella, Maria Chiara; Chen, Zhiling; Cittolin, Sergio; Dambach, Sarah; Dissertori, Gunther; Dittmar, Michael; Eggel, Christina; Eugster, Jurg; Freudenreich, Klaus; Grab, Christoph; Herve, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Milenovic, Predrag; Moortgat, Filip; Nardulli, Alessandro; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann-Karin; Sawley, Marie-Christine; Schinzel, Dietrich; Sordini, Viola; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Trub, Peter; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Rikova, Mirena Ivova; Regenfus, Christian; Robmann, Peter; Rommerskirchen, Tanja; Schmidt, Alexander; Snoek, Hella; Tsirigkas, Dimitrios; Wilke, Lotte; Chang, Yuan-Hann; Chen, E.Augustine; Chen, Wan-Ting; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Wu, Jing-Han; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Lei, Yeong-Jyi; Lin, Sheng-wen; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-ming; Ueno, Koji; Wang, Chin-chi; Wang, Minzu; Adiguzel, Aytul; Ayhan, Aydin; Bakirci, Mustafa Numan; Cerci, Salim; Demir, Zahide; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gurpinar, Emine; Karaman, Turker; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sahin, Ozge; Sengul, Ozden; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gulmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Cussans, David; Frazier, Robert; Goldstein, Joel; Hansen, Maria; Heath, Greg P.; Heath, Helen F.; Hill, Christopher; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Mackay, Catherine Kirsty; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Davies, Gavin; Della Negra, Michel; Foudas, Costas; Fulcher, Jonathan; Futyan, David; Hall, Geoffrey; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; MacEvoy, Barry C.; Magnan, Anne-Marie; Marrouche, Jad; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Stoye, Markus; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Reid, Ivan; Teodorescu, Liliana; Bose, Tulika; Clough, Andrew; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sulak, Lawrence; Andrea, Jeremy; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Speer, Thomas; Tsang, Ka Vang; Breedon, Richard; Calderon de la Barca Sanchez, Manuel; Cebra, Daniel; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Erhan, Samim; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Wallny, Rainer; Babb, John; Chandra, Avdhesh; Clare, Robert; Ellison, John Anthony; Gary, J.William; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, Andre; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Norman, Matthew; Padhi, Sanjay; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Vartak, Adish; Wurthwein, Frank; Yagil, Avraham; Barge, Derek; Blume, Michael; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Garberson, Jeffrey; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lamb, James; Lowette, Steven; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Witherell, Michael; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Gataullin, Marat; Litvine, Vladimir; Ma, Yousi; Newman, Harvey B.; Rogan, Christopher; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Jang, Dong Wook; Jun, Soon Yung; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Blekman, Freya; Cassel, David; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Patterson, Juliet Ritchie; Puigh, Darren; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Vaughan, Jennifer; Weng, Yao; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Albrow, Michael; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Binkley, Morris; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gottschalk, Erik; Green, Dan; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lueking, Lee; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Smith, Richard P.; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Piero Di Giovanni, Gian; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Pakhotin, Yuriy; Piedra Gomez, Jonatan; Prescott, Craig; Rapsevicius, Valdas; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Luis Rodriguez, Jorge; Adams, Todd; Askew, Andrew; Chen, Jie; Dharmaratna, Welathantri G.D.; Diamond, Brendan; Gleyzer, Sergei V.; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Baarmand, Marc M.; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Mermerkaya, Hamit; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatian, Samvel; Mironov, Camelia; Shabalina, Elizaveta; Smoron, Agata; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Chung, Kwangzoo; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bandurin, Dmitry; Barfuss, Anne-fleur; Bolton, Tim; Chakaberia, Irakli; Kaadze, Ketino; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; D'Enterria, David; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristian Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Wyslouch, Bolek; Xie, Si; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Petyt, David; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A.; Sonnek, Peter; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Strang, Michael; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Reucroft, Steve; Swain, John; Wood, Darien; Anastassov, Anton; Kubik, Andrew; Ofierzynski, Radoslaw Adrian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Ruchti, Randy; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Killewald, Phillip; Ling, Ta-Yung; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroue, Pierre; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatzerklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, K.; Sedov, Alexey; Shipsey, Ian; Silvers, David; Yoo, Hwi Dong; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Matveev, Mikhail; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Flacher, Henning; Garcia-Bellido, Aran; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Korjenevski, Sergey; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Hatakeyama, Kenichi; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Gershtein, Yuri; Halkiadakis, Eva; Hits, Dmitry; Lath, Amitabh; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Toback, David; Weinberger, Michael; Akchurin, Nural; Jeong, Chiyoung; Lee, Sung Won; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Brownson, Eric; Engh, Daniel; Florez, Carlos; Johns, Willard; Kurt, Pelin; Sheldon, Paul; Arenton, Michael Wayne; Balazs, Michael; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Gunthoti, Kranti; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Efron, Jonathan; Flood, Kevin; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Reeder, Don; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc
2010-01-01
Measurements of inclusive charged-hadron transverse-momentum and pseudorapidity distributions are presented for proton-proton collisions at sqrt(s) = 0.9 and 2.36 TeV. The data were collected with the CMS detector during the LHC commissioning in December 2009. For non-single-diffractive interactions, the average charged-hadron transverse momentum is measured to be 0.46 +/- 0.01 (stat.) +/- 0.01 (syst.) GeV/c at 0.9 TeV and 0.50 +/- 0.01 (stat.) +/- 0.01 (syst.) GeV/c at 2.36 TeV, for pseudorapidities between -2.4 and +2.4. At these energies, the measured pseudorapidity densities in the central region, dN(charged)/d(eta) for |eta| < 0.5, are 3.48 +/- 0.02 (stat.) +/- 0.13 (syst.) and 4.47 +/- 0.04 (stat.) +/- 0.16 (syst.), respectively. The results at 0.9 TeV are in agreement with previous measurements and confirm the expectation of near equal hadron production in p-pbar and pp collisions. The results at 2.36 TeV represent the highest-energy measurements at a particle collider to date.
Feasibility studies to assess the use of 236Pu as a radiochemical yield monitor in bioassay samples
International Nuclear Information System (INIS)
Sawant, P.D.; Kalsi, P.C.
2007-01-01
Various plutonium compounds are handled in nuclear facilities of BARC. Hence, there is a possibility of occupational workers getting exposed to Pu. In vitro bioassay monitoring in which Pu is separated by chemical procedures from excreta samples and estimated by alpha-spectrometry, is the method of choice for the evaluation of internal dose to the occupational workers handling Pu. However, this method requires a suitable Pu tracer for reducing the uncertainties due to chemical yield in the separation, electro-deposition and counting efficiency. 242 Pu is commonly used as a tracer but due to its non-availability, efforts were made earlier to indigenously synthesis 236 Pu by proton irradiation of 237 Np in BARC-TIFR pelletron facility. The present study, reports the feasibility of using 236 Pu as a radiochemical yield monitor (tracer) in bioassay samples. (author)
The 236U neutron capture cross-section measured at the n_TOF CERN facility
Directory of Open Access Journals (Sweden)
Mastromarco M.
2017-01-01
Full Text Available The 236U isotope plays an important role in nuclear systems, both for future and currently operating ones. The actual knowledge of the capture reaction of this isotope is satisfactory in the thermal region, but it is considered insufficient for Fast Reactor and ADS applications. For this reason the 236U(n, γ reaction cross-section has been measured for the first time in the whole energy region from thermal energy up to 1 MeV at the n_TOF facility with two different detection systems: an array of C6D6 detectors, employing the total energy deposited method, and a FX1 total absorption calorimeter (TAC, made of 40 BaF2 crystals. The two n_TOF data sets agree with each other within the statistical uncertainty in the Resolved Resonance Region up to 800 eV, while sizable differences (up to ≃ 20% are found relative to the current evaluated data libraries. Moreover two new resonances have been found in the n_TOF data. In the Unresolved Resonance Region up to 200 keV, the n_TOF results show a reasonable agreement with previous measurements and evaluated data.
Estimation of 244Cm intake by bioassay measurements following a contamination incident
International Nuclear Information System (INIS)
Thein, M.; Bogard, J.S.; Eckerman, K.F.
1990-01-01
An employee was contaminated with radioactive material consisting primarily of 244 Cm and 246 Cm as a consequence of handling a curium nitrate solution at a reprocessing facility. In vivo gamma analysis and in vitro (urine and fecal) bioassay measurements were performed. A sample of the curium solution from the workplace was obtained to confirm that the nitrate was the chemical form and to identify the isotopes of curium present. The mass ratio of 244 Cm/ 246 Cm was determined to be 91 to 7. Observed excretion rates were consistent with available information on curium. The results of the in vivo and in vitro measurements are presented and intake estimates for the incident are developed. (author) 11 refs.; 3 figs.; 2 tabs
International Nuclear Information System (INIS)
Reis Junior, Aluisio S.; Temba, Eliane S.C.; Kastner, Geraldo F.; Monteiro, Roberto P.G.
2013-01-01
Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241 Am, 242 Cm and 24 3 ,244 Cm isotopes is possible using the 243 Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238 Pu, 243 Am, 244 Cm and 232 U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241 Am it was (1,040 ± 160 mBqKg -1 ), relative standard deviation 15.38%, and for 239+240 Pu it was (551 +- 44 mBqKg -1 ), relative standard deviation 7.98%. In addition, for the 242 Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg -1 ), with the relative standard deviation 30.67% higher than for 241 Am and 239+240 Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg -1 . (author)
International Nuclear Information System (INIS)
Louwrier, K.P.; Richter, K.
1976-01-01
During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239 Pu containing 8-12% 240 Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241 Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241 Am, 243 Am and 244 Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241 Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)
Boulyga, S F; Becker, J S
2001-07-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10(-4) and 10(-3) counts per atom were achieved for 238U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH+/U+ was 1.2 x 10(-4) and 1.4 x 10(-4), respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 microg L(-1) NBS U-020 standard solution was 0.11% (238U/235U) and 1.4% (236U/238U) using a MicroMist nebulizer and 0.25% (235U/238U) and 1.9% (236U/P38U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236U/238U ratio ranged from 10(-5) to 10(-3). Results obtained with ICP-MS, alpha- and gamma-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples.
International Nuclear Information System (INIS)
Boulyga, S.F.; Becker, J.S.
2001-01-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236 U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10 -4 and 10 -3 counts per atom were achieved for 238 U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH + /U + was 1.2 x 10 -4 and 1.4 x 10 -4 , respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 μg L -1 NBS U-020 standard solution was 0.11% ( 238 U/ 235 U) and 1.4% ( 236 U/ 238 U) using a MicroMist nebulizer and 0.25% ( 235 U/ 238 U) and 1.9% ( 236 U/ 238 U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236 U/ 238 U ratio ranged from 10 -5 to 10 -3 . Results obtained with ICP-MS, α- and γ-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples. (orig.)
International Nuclear Information System (INIS)
Schenkel, R.
1977-03-01
The temperature dependence of the electrical resistivity of thin films of bulk 241 Am metal were measured between 300 and 4.5 K. The room temperature resistivity was found to be 68.90μΩcm. At room temperature the electrical resistivity of americium increases with pressure (3% up to 13 kbar). The application of 13 kbar pressure did not change the low temperature power law in the electrical resistivity. The resistivity vs temperature curve can be explained by assuming s-d scattering of conduction electrons. The localized 5f electrons are considered to be about 5eV below the Fermi level. Americium therefore should be the first lanthanide-like element in the actinide series. The defect production due to self-irradiation damage was studied by measuring the increase of the resistivity at 4.2 K over a period of 738 h. A saturation resistivity of 16.036 μΩcm was found corresponding to a defect concentration of about 0.22 a/o. After isochronal annealing two recovery stages were observed at about 65 and 145 K. The two stages shift with increasing initial defect concentration to lower temperatures. Estimates of the activation energies and the reaction order were made and possible defect reactions suggested. The magnetic contribution to the electrical resistivity of curium, which shows an antiferromagnetic transition at 52.5 k, was obtained by subtracting the resistivity of americium (to be considered as phonon part). Comparison with theoretical models were made. At low temperatures the measurements are strongly affected by self-irradiation damage [drho/dt(t=0)=9.8μΩcm/h
International Nuclear Information System (INIS)
Waris, R.; Bhatti, N.; Nisar, Y. B.
2016-01-01
Background: Despite reduction in ld mortality during last decade, lower respiratory tract infection (LRTI) remained number one killer of under-five. The current study aimed to assess the association of haematological and radiological findings with clinical outcome in hospitalized children 2-36 months old with severe LRTI. Methods: In the current cross sectional study, 581 children 2-36 months old with severe LRTI were enrolled and followed at the Children Hospital, Islamabad, between 2011 and 2014. At the time of enrolment, complete history of present illness, anthropometric measurements, blood sample and chest radiograph were obtained. The primary outcome was either early clinical response (within 72 hours) or delayed clinical response (>72 hours). Multivariable logistic regression was performed to examine the association between haematological and radiological findings with clinical outcome, adjusted for potential confounding factors. Results: Of 581 enrolled children, 292 (50.3 percent) children had early, and 289 (49.7 percent) had delayed clinical response. The multivariable logistic regression showed that leucocytosis (OR 1.79, 95 percent CI 1.15-2.79), neutrophilia (OR 1.91, 95 percent CI 1.29-2.84), radiological interstitial pneumonia (OR 2.49, 95 percent CI 1.70-3.64), and lobar consolidation (OR 6.00, 95 percent CI 2.41-14.96) were significantly associated with delayed clinical response, after adjusted for potential confounding factors. Conclusions: Delayed clinical response was significantly associated with abnormal haematological and radiological findings at the time of admission in children 2-36 months old with severe LRTI. Haematological and radiological findings at the time of presentation are useful for predicting delayed clinical response in children 2-36 months old with severe LRTI. (author)
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pacific Ocean off Barbers Point... Grounds § 110.236 Pacific Ocean off Barbers Point, Island of Oahu, Hawaii: Offshore pipeline terminal... regulations. (1) No vessels may anchor, moor, or navigate in anchorages A, B, C, or D except: (i) Vessels...
Energy Technology Data Exchange (ETDEWEB)
Chamizo, Elena; López-Lora, Mercedes [Centro Nacional de Aceleradores (Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía), Thomas Alva Edison 7, 41092 Seville (Spain); Villa, María [Departamento de Física Aplicada II, Universidad de Sevilla, Av. Reina Mercedes 4A, 41012 Seville (Spain); Servicio de Radioisótopos, Centro de Investigación, Tecnología e Innovación, Universidad de Sevilla, Av. Reina Mercedes 4B, 41012 Seville (Spain); Casacuberta, Núria [Laboratory of Ion Beam Physics, ETH Zürich, Otto-Stern-Weg 5, CH-8093 Zürich (Switzerland); López-Gutiérrez, José María [Centro Nacional de Aceleradores (Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía), Thomas Alva Edison 7, 41092 Seville (Spain); Departamento de Física Aplicada I, Escuela Universitaria Politécnica, Universidad de Sevilla, Virgen de África 7, 41011 Seville (Spain); Pham, Mai Khanh [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco)
2015-10-15
The performance of the 1 MV AMS system at the CNA (Centro Nacional de Aceleradores, Seville, Spain) for {sup 236}U and {sup 239,240}Pu measurements has been extensively investigated. A very promising {sup 236}U/{sup 238}U abundance sensitivity of about 3 × 10{sup −11} has been recently achieved, and background figures for {sup 239}Pu of about 10{sup 6} atoms were reported in the past. These promising results lead to the use of conventional low energy AMS systems for the analysis of {sup 236}U and {sup 239}Pu and its further application in environmental studies. First {sup 236}U results obtained on our AMS system for marine samples (sediments and water) are presented here. Results of two new IAEA reference materials (IAEA-410 and IAEA-412, marine sediments from Pacific Ocean) are reported. The obtained {sup 236}U/{sup 239}Pu atom ratios, of 0.12 and 0.022, respectively, show a dependency with the contamination source (i.e. local fallout from the US tests performed at the Bikini Atoll and general fallout). The results obtained for a third IAEA reference material (IAEA-381, seawater from the Irish Sea), are also presented. In the following, the uranium and plutonium isotopic compositions obtained on a set of 5 intercomparison seawater samples from the Arctic Ocean provided by the ETH Zürich are discussed. By comparing them with the obtained results on the 600 kV AMS facility Tandy at the ETH Zürich, we demonstrate the solidity of the CNA technique for {sup 236}U/{sup 238}U determinations at, at least, 7 × 10{sup −10} level. Finally, these results are discussed in their environmental context.
Uranium and transuranium analysis
International Nuclear Information System (INIS)
Regnaud, F.
1989-01-01
Analytical chemistry of uranium, neptunium, plutonium, americium and curium is reviewed. Uranium and neptunium are mainly treated and curium is only briefly evoked. Analysis methods include coulometry, titration, mass spectrometry, absorption spectrometry, spectrofluorometry, X-ray spectrometry, nuclear methods and radiation spectrometry [fr
International Nuclear Information System (INIS)
Stepanov, A.; Belyaev, B.; Buljanitsa, L.
1989-11-01
The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233 U, 236 U, 242 Pu and 244 Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233 U/ 236 U ratio and the 236 U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235 U/ 238 U ratio of NBS500 used as internal standard. The coefficients of variation of the 244 Pu/ 242 Pu ratio and the 242 Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240 Pu/ 239 Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs
236 children with developmental hydrocephalus: causes and clinical consequences
Tully, Hannah M; Ishak, Gisele E; Rue, Tessa C; Dempsey, Jennifer C; Browd, Samuel R; Millen, Kathleen J; Doherty, Dan; Dobyns, William B
2016-01-01
Few systematic assessments of developmental forms of hydrocephalus exist. We reviewed MRIs and clinical records of patients with infancy-onset hydrocephalus. Among 411 infants, 236 had hydrocephalus with no recognizable extrinsic cause. These children were assigned to one of five subtypes and compared on the basis of clinical characteristics, developmental and surgical outcomes. At an average age of 5.3 years, 72% of children were walking independently and 87% could eat by mouth. 18% had epilepsy. Distinct patterns of associated malformations and syndromes were observed within each subtype. On average, children with aqueductal obstruction, cysts and encephaloceles had worse clinical outcomes than those with other forms of developmental hydrocephalus. 53% of surgically-treated patients experienced at least one shunt failure, but hydrocephalus associated with posterior fossa crowding required fewer shunt revisions. We conclude that each subtype of developmental hydrocephalus is associated with distinct clinical characteristics, syndromology, and outcomes, suggesting differences in underlying mechanisms. PMID:26184484
Larijani, Cyrus Kouroush
This thesis is based on the development of a radiochemical separation scheme capable of separating both 236gNp and 236Pu from a uranium target of natural isotopic composition ( 1 g uranium) and 200 MBq of fission decay products. The isobaric distribution of fission residues produced following the bombardment of a natural uranium target with a beam of 25 MeV protons has been evaluated. Decay analysis of thirteen isobarically distinct fission residues were carried out using high-resolution gamma-ray spectrometry at the UK National Physical Laboratory. Stoichiometric abundances were calculated via the determination of absolute activity concentrations associated with the longest-lived members of each isobaric chain. This technique was validated by computational modelling of likely sequential decay processes through an isobaric decay chain. The results were largely in agreement with previously published values for neutron bombardments on natural uranium at energies of 14 MeV. Higher relative yields of products with mass numbers A 110-130 were found, consistent with the increasing yield of these radionuclides as the bombarding energy is increased. Using literature values for the production cross-section for fusion of protons with uranium targets, it is estimated that an upper limit of approximately 250 Bq of activity from the 236Np ground state was produced in this experiment. Using a radiochemical separation scheme, Np and Pu fractions were separated from the produced fission decay products, with analyses of the target-based final reaction products made using Inductively Couple Plasma Mass Spectrometry (ICP-MS) and high-resolution alpha and gamma-ray spectrometry. In a separate research theme, reliable measurement of Naturally Occurring Radioactive Materials is of significance in order to comply with environmental regulations and for radiological protection purposes. The thesis describes the standardisation of three reference materials, namely Sand, Tuff and TiO2 which
Epidemiological and clinical features of primary liver cancer: an analysis of 236 patients
Directory of Open Access Journals (Sweden)
ZHAO Rongrong
2016-08-01
Full Text Available ObjectiveTo investigate the epidemiological and clinical features of patients with primary liver cancer (PLC. MethodsA retrospective analysis was performed for the clinical data of 236 patients with complete information who were admitted to The First Hospital of Lanzhou University and diagnosed with PLC for the first time form August 2012 to August 2014, and their epidemiological and clinical features were analyzed. The chi-square test was used for comparison of categorical data between groups. ResultsAmong the 236 PLC patients, there were 198 male patients (83.9% and 38 female patients (16.1%, and the patients aged 41-60 years has the highest incidence rate (58.5%, 138/236. Nineteen patients had a family history of liver cancer, 28 had a history of heavy drinking, 34 were complicated by type 2 diabetes, and 44 were complicated by hypertension. Among these patients, 232 (98.3% developed PLC on the basis of chronic liver disease, and 4 (1.7% had no chronic liver disease. There were 207 patients (87.7% with chronic HBV infection, and most of them had HBeAg-negative infection. Fourteen patients (5.9% had chronic HCV infection, 5 (2.1% had HBV/HCV co-infection, and 6 (2.5% had chronic alcoholic hepatitis. Among the 212 patients with HBV infection, 51(241% had HBeAg-positive chronic hepatitis B, and 95(448% had HBeAg-negative chronic hepatitis B; there was significant difference in HBV DNA level between the two groups (χ2=40687,Ρ=0001. Among all the PLC patients, 104 had an alpha-fetoprotein(AFP level of >400 IU/ml, 48 had an AFP level of 200-400 IU/ml, and 84 had an AFP level of <200 IU/ml; 154 (62.3% had a single lesion, and 72 (30.5% had multiple lesions; most (72.7% of patients with a single lesion had the single lesion in the right lobe, and the proportions of patients with multiple lesions in the right lobe and in both lobes accounted for 58.3% and 41.7%, respectively. Among the 80 PLC patients with
Froehlich, M B; Chan, W Y; Tims, S G; Fallon, S J; Fifield, L K
2016-12-01
A comprehensive series of nuclear tests were carried out by the United States at Enewetak Atoll in the Marshall Islands, especially between 1952 and 1958. A Porites Lutea coral that was growing in the Enewetak lagoon within a few km of all of the high-yield tests contains a continuous record of isotopes, which are of interest (e.g. 14 C, 236 U, 239,240 Pu) through the testing period. Prior to the present work, 14 C measurements at ∼2-month resolution had shown pronounced peaks in the Δ 14 C data that coincided with the times at which tests were conducted. Here we report measurements of 236 U and 239,240 Pu on the same coral using accelerator mass spectrometry, and again find prominent peaks in the concentrations of these isotopes that closely follow those in 14 C. Consistent with the 14 C data, the magnitudes of these peaks do not, however, correlate well with the explosive yields of the corresponding tests, indicating that smaller tests probably contributed disproportionately to the debris that fell in the lagoon. Additional information about the different tests can also be obtained from the 236 U/ 239 Pu and 240 Pu/ 239 Pu ratios, which are found to vary dramatically over the testing period. In particular, the first thermonuclear test, Ivy-Mike, has characteristic 236 U/ 239 Pu and 240 Pu/ 239 Pu signatures which are diagnostic of the first arrival of nuclear test material in various archives. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
1997-08-01
On July 2, 1997 at approximately 6:00 A.M., two operators (Workers 1 and 2), wearing approved personal protective equipment (PPE), began a shredding operation of HEPA filters for volume reduction in Building 513 (B-513) at Lawrence Livermore National Laboratory (LLNL). The waste requisitions indicated they were shredding filters containing ≤ 1 μCi of americium-241 (Am-241). A third operator (Worker 3) provided support to the shredder operators in the shredding area (hot area) from a room that was adjacent to the shredding area (cold area). At Approximately 8:00 A.M., a fourth operator (Worker 4) relieved Worker 2 in the shredding operation. Sometime between 8:30 A.M. and 9:00 A.M., Worker 3 left the cold area to make a phone call and set off a hand and foot counter in Building 514. Upon discovering the contamination, the shredding operation was stopped and surveys were conducted in the shredder area. Surveys conducted on the workers found significant levels of contamination on their PPE and the exterior of their respirator cartridges. An exit survey of Worker 1 was conducted at approximately 10:05 A.M., and found contamination on his PPE, as well as on the exterior and interior of his respirator. Contamination was also found on his face, chest, back of neck, hair, knees, and mustache. A nose blow indicated significant contamination, which was later determined to be curium-244
Energy Technology Data Exchange (ETDEWEB)
Boulyga, S.F. [Radiation Physics and Chemistry Problems Inst., Minsk (Belarus); Becker, J.S. [Central Department for Analytical Chemistry, Research Centre Juelich (Germany)
2001-07-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The {sup 236}U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10{sup -4} and 10{sup -3} counts per atom were achieved for {sup 238}U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH{sup +}/U{sup +} was 1.2 x 10{sup -4} and 1.4 x 10{sup -4}, respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 {mu}g L{sup -1} NBS U-020 standard solution was 0.11% ({sup 238}U/{sup 235}U) and 1.4% ({sup 236}U/{sup 238}U) using a MicroMist nebulizer and 0.25% ({sup 235}U/{sup 238}U) and 1.9% ({sup 236}U/{sup 238}U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the {sup 236}U/{sup 238}U ratio ranged from 10{sup -5} to 10{sup -3}. Results obtained with ICP-MS, {alpha}- and {gamma}-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples. (orig.)
International Nuclear Information System (INIS)
Jeo, Kih-Soo; Song, Byung-Chul; Kim, Young-Bok; Han, Sun-Ho; Jeon, Young-Shin; Jung, Euo-Chang; Jee, Kwang-Yong
2007-01-01
Determination of actinide elements and fission products in spent nuclear fuels is of importance for a burnup determination and source term evaluation. Especially, the amounts of uranium and plutonium isotopes are used for the evaluation of a burnup credit in spent nuclear fuels. Additionally, other actinides such as Np, Am and Cm in spent nuclear fuel samples is also required for the purposes mentioned above. In this study, 237 Np, 241 Am and 244 Cm were determined by an alpha spectrometry for the source term data for high burnup spent nuclear fuels ranging from 37 to 62.9 GWD/MtU as a burnup. Generally, mass spectrometry has been known as the most powerful method for isotope determinations such as high concentrations of uranium and plutonium. However, in the case of minor actinides such as Np, Am and Cm, alpha spectrometry would be recommended instead. Determination of the transuranic elements in spent nuclear fuel samples is different from that for environmental samples because the amount of each nuclide in the spent fuel samples is higher and the relative ratios between each nuclide are also different from those for environmental samples. So, it is important to select an appropriate tracer and an optimum sample size depending on the nuclides and analytical method. In this study 237 Np was determined by an isotope dilution alpha(gamma) spectrometry using 239 Np as a spike, and 241 Am and curium isotopes were determined by alpha spectrometry using 243 Am as a tracer. The content of each nuclide was compared with that by the Origen-2 code
Recovery of trans-plutonium elements; Recuperation des elements transplutoniens
Energy Technology Data Exchange (ETDEWEB)
Espie, J Y; Poncet, B; Simon, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1970-07-01
The object of this work is to study the recovery of americium and curium from the fission-product solution obtained from the processing of irradiated fuel elements made of natural metallic uranium alloyed with aluminium, iron and silicon; these elements have been subjected to an average irradiation of 4000 MW days/ton in a gas-graphite type reactor having a thermal power of 3.7 MW/ton of uranium. The process used consists of 3 extraction cycles and one americium-curium separation: - 1) extraction cycle in 40 per cent TBP: extraction of actinides and lanthanides; elimination of fission products; - 2) extraction cycle in 8 per cent D2EHPA: decontamination from the fission products, decontamination of actinides from lanthanides; - 3) extraction cycle in 40 per cent TBP: separation of the complexing agent and concentration of the actinides; - 4) americium-curium separation by precipitation. (authors) [French] Cette etude a pour objet, la recuperation de l'americium et du curium de la solution de produits de fission provenant du traitement de combustibles irradies a base d'uranium naturel metallique allie a l'aluminium, le fer, et le silicium, et ayant subi une irradiation moyenne de 4000 MWj/t dans une pile du type graphite-gaz, dont la puissance thermique est de 3.7 MW/t d'uranium. Le procede utilise comprend 3 cycles d'extraction et une separation americium-curium: - 1. cycle d'extraction dans le TBP a 40 pour cent: extraction des actinides et des lanthanides, elimination des produits de fission; - 2. cycle d'extraction dans le D2EHPA a 8 pour cent: decontamination en produits de fission, decontamination des actinides en lanthanides; - 3. cycle d'extraction dans le TBP a 40 pour cent: separation du complexant et concentration des actinides; - 4. separation americium-curium par precipitation. (auteurs)
Determination of 241Am and 244Cm in environmental samples
International Nuclear Information System (INIS)
Bonino, N.O.; Grinman, A.D.R.; Serdeiro, N.H.
1998-01-01
The present technique describes a method to separate, purify and measure low levels of americium and curium in different environmental samples such as sediments, soils, water, vegetables, and air filters. The determination of radionuclides in theses environmental matrices have analytical problems, since a simple method doesn't exist for the purification, which is indispensable for its later measuring alpha spectrometry. The developed technique consist on taking an aliquot of the sample to analyze, to add tracer as americium 243 and curium 242, and to dissolve the matrix in a such way to have a clear solution. For the isolation of the americium and curium of the other actinides ar used as separation techniques: precipitation with Fe 3+ , anionic and cationic exchange, and extraction with a appropriate organic solvent. The purification of the americium and curium is followed by the electrodeposition habitually used. The measurement is carried out by alpha spectrometry with a detector of implanted ion. The detection limit for this techniques is of 0,002 Bq/l or 0,2 mBq in the case of filters. (author)
H-alpha observations of Sh2-190, Sh2-222, Sh2-229, Sh2-236 HII regions
Sahan, Muhittin
2018-02-01
Hα spectral line (6563Å) profiles of four northern HII regions in the our galaxy (Sh2-190, Sh2-222, Sh2-229, Sh2-236) have been obtained using DEFPOS spectrometer, located at coude focus of 150 cm RTT150 telescope at TUBITAK National Observatory (TUG, Antalya, Turkey). Observations were carried out at nights of 2015 December 24-27 with long exposure times ranging from 900s to 3600s. The LSR velocities and the linewidths (Full Width Half Maximum: FWHM) of the Hα emission lines were found to be in the range of -45.46 kms-1 to +3.57 kms-1 and 38.50 kms-1 to 44.10 kms-1, respectively. The Sh2-229 HII region is the faintest one (211.16 R), while the Sh2-236 HII region (IC410) is brightest source (535.75 R). The LSR velocity and the line width (FWHM) results of the DEFPOS/RTT150 system were compared with the data by several authors given in literature and results of DEFPOS data were found to be in good agreement with data given in literature.
Some basic advantages of accelerator-driven transmutation of minor actinides and iodine-129
Energy Technology Data Exchange (ETDEWEB)
Shmelev, A.N.; Apse, V.A.; Kulikov, G.G. [Moscow Engineering Physics Institute (Russian Federation)
1995-10-01
The blanket of accelerator-driven facility designed for I-129 transmutation doesn`t contain fissile and fertile materials. So the overheating of iodine compounds transmuted is practically excluded. The efficacy of I-129 transmutation is estimated. Curium being accumulated in nuclear reactors can be incinerated in blanket of accelerator-driven facility. The deep depletion of curium diluted with inert material can be achieved.
Tsai, Yi-Ming; Wu, Pei-Shan; Lo, Wen-Sui; Kuo, Chih-Horng
2018-04-19
Spiroplasma floricola 23-6 T (ATCC 29989) was isolated from the flower surface of a tulip tree ( Liriodendron tulipifera L.). Here, we report the complete genome sequence of this bacterium to facilitate the investigation of its biology and the comparative genomics among Spiroplasma species. Copyright © 2018 Tsai et al.
International Nuclear Information System (INIS)
Tan, Yingying; Wang, Lin; Liang, Kunfeng
2015-01-01
In this paper, an auto-cascade ejector refrigeration cycle (ACERC) is proposed to obtain lower refrigeration temperature based on conventional ejector refrigeration and auto-cascade refrigeration principle. The thermodynamic performance of ACERC is investigated theoretically. The zeotropic refrigerant mixture R32 + R236fa is used as its working fluid. A parametric analysis is conducted to evaluate the effects of some thermodynamic parameters on the cycle performance. The study shows that refrigerant mixture composition, condenser outlet temperature and evaporation pressure have effects on performance of ACERC. The theoretical results also indicate that the ACERC can achieve the lowest refrigeration temperature at the temperature level of −30 °C. The application of zeotropic refrigerant mixture auto-cascade refrigeration in the ejector refrigeration cycle can provide a new way to obtain lower refrigeration temperature utilizing low-grade thermal energy. - Highlights: • An auto-cascade ejector refrigerator with R32 + R236fa mixed refrigerant is proposed. • The cycle can obtain a refrigeration temperature at −30 °C temperature range. • The effects of some thermodynamic parameters on the cycle performance are evaluated
International Nuclear Information System (INIS)
CASELLA, VITO
2004-01-01
Co-60 was produced in the Savannah River Site (SRS) reactors in the 1970s, and the irradiated cobalt reactor slugs were stored in a reactor basin at SRS. Since the activity rates of these slugs were not accurately known, assaying was required. A sodium iodide gamma detector was placed above a specially designed air collimator assembly, so that the slug was eight to nine feet from the detector and was shielded by the basin water. Also, 18 curium sampler slugs, used to produce Cm-244 from Pu-239, were to be disposed of with the cobalt slugs. The curium slugs were also analyzed with a High Purity Germanium (HPGE) detector in an attempt to identify any additional radionuclides produced from the irradiation. Co-60 concentrations were determined for reactor disassembly basin cobalt slugs and the 18 curium sampler slugs. The total Co-60 activity of all of the assayed slugs in this work summed to 31,783 curies on 9/15/03. From the Co-60 concentrations of the curium sampler slugs, the irradiation flux was determined for the known irradiation time. The amounts of Pu-238,-239,-240,-241,-242; Am-241,-243; and Cm-242,-244 produced were then obtained based on the original amount of Pu-239 irradiated
Consistent evaluation of neutron cross sections for the 242-244Cm isotopes
International Nuclear Information System (INIS)
Ignatyuk, A.V.; Maslov, V.M.
1989-01-01
The knowledge of neutron cross-sections for Curium isotopes is necessary for solving the problems of the external fuel cycle. Experimental information on the cross-sections is very meager and does not satisfy requirements and existing evaluations in different libraries differ substantially for fission and (n,2n) reaction cross-sections. This situation requires a critical review of the entire set of evaluations of the neutron cross-sections for Curium. 17 refs, 3 figs
Sobanska, Marta; Scholz, Stefan; Nyman, Anna-Maija; Cesnaitis, Romanas; Gutierrez Alonso, Simon; Klüver, Nils; Kühne, Ralph; Tyle, Henrik; de Knecht, Joop; Dang, Zhichao; Lundbergh, Ivar; Carlon, Claudio; De Coen, Wim
In 2013 the Organisation for Economic Co-operation and Development (OECD) test guideline (236) for fish embryo acute toxicity (FET) was adopted. It determines the acute toxicity of chemicals to embryonic fish. Previous studies show a good correlation of FET with the standard acute fish toxicity
International Nuclear Information System (INIS)
Mironov, V.P.; Matusevich, Zh.L.; Kudryashov, V.P.; Ananich, P.I.; Zhuravkov, V.V.
2002-01-01
Experiments and calculations for determination of depth of burnup of fuel are carried out on separate sites in Belarus. As a tracer of Chernobyl deposition the uranium-236 was used. The average depth of burnup of fuel in 30 km zone is 9,4 MW*d/kgU
DEFF Research Database (Denmark)
Qiao, Jixin; Hou, Xiaolin; Steier, Peter
2013-01-01
An automated analytical method implemented in a novel dual-column tandem sequential injection (SI) system was developed for simultaneous determination of 236U, 237Np, 239Pu, and 240Pu in seawater samples. A combination of TEVA and UTEVA extraction chromatography was exploited to separate and purify...... target analytes, whereupon plutonium and neptunium were simultaneously isolated and purified on TEVA, while uranium was collected on UTEVA. The separation behavior of U, Np, and Pu on TEVA–UTEVA columns was investigated in detail in order to achieve high chemical yields and complete purification...
Design review plan for Multi-Function Waste Tank Facility (Project W-236A)
International Nuclear Information System (INIS)
Renfro, G.G.
1994-01-01
This plan describes how the Multi-Function Waste Tank Facility (MWTF) Project conducts reviews of design media; describes actions required by Project participants; and provides the methodology to ensure that the design is complete, meets the technical baseline of the Project, is operable and maintainable, and is constructable. Project W-236A is an integrated project wherein the relationship between the operating contractor and architect-engineer is somewhat different than that of a conventional project. Working together, Westinghouse Hanford Company (WHC) and ICF Karser Hanford (ICF KH) have developed a relationship whereby ICF KH performs extensive design reviews and design verification. WHC actively participates in over-the-shoulder reviews during design development, performs a final review of the completed design, and conducts a formal design review of the Safety Class I, ASME boiler and Pressure Vessel Code items in accordance with WHC-CM-6-1, Standard Engineering Practices
Aamodt, K.; Abeysekara, U.; Abrahantes Quintana, A.; Abramyan, A.; Adamova, D.; Aggarwal, M.M.; Aglieri Rinella, G.; Agocs, A.G.; Aguilar Salazar, S.; Ahammed, Z.; Ahmad, A.; Ahmad, N.; Ahn, S.U.; Akimoto, R.; Akindinov, A.; Aleksandrov, D.; Alessandro, B.; Alfaro Molina, R.; Alici, A.; Avina, E.Almaraz; Alme, J.; Alt, T.; Altini, V.; Altinpinar, S.; Andrei, C.; Andronic, A.; Anelli, G.; Angelov, V.; Anson, C.; Anticic, T.; Antinori, F.; Antinori, S.; Antipin, K.; Antonczyk, D.; Antonioli, P.; Anzo, A.; Aphecetche, L.; Appelshauser, H.; Arcelli, S.; Arceo, R.; Arend, A.; Armesto, N.; Arnaldi, R.; Aronsson, T.; Arsene, I.C.; Asryan, A.; Augustinus, A.; Averbeck, R.; Awes, T.C.; Aysto, J.; Azmi, M.D.; Bablok, S.; Bach, M.; Badala, A.; Baek, Y.W.; Bagnasco, S.; Bailhache, R.; Bala, R.; Baldisseri, A.; Baldit, A.; Ban, J.; Barbera, R.; Barnafoldi, G.G.; Barnby, L.; Barret, V.; Bartke, J.; Barile, F.; Basile, M.; Basmanov, V.; Bastid, N.; Bathen, B.; Batigne, G.; Batyunya, B.; Baumann, C.; Bearden, I.G.; Becker, B.; Belikov, I.; Bellwied, R.; Belmont-Moreno, E.; Belogianni, A.; Benhabib, L.; Beole, S.; Berceanu, I.; Bercuci, A.; Berdermann, E.; Berdnikov, Y.; Betev, L.; Bhasin, A.; Bhati, A.K.; Bianchi, L.; Bianchi, N.; Bianchin, C.; Bielcik, J.; Bielcikova, J.; Bilandzic, A.; Bimbot, L.; Biolcati, E.; Blanc, A.; Blanco, F.; Blanco, F.; Blau, D.; Blume, C.; Boccioli, M.; Bock, N.; Bogdanov, A.; Boggild, H.; Bogolyubsky, M.; Bohm, J.; Boldizsar, L.; Bombara, M.; Bombonati, C.; Bondila, M.; Borel, H.; Borshchov, V.; Borisov, A.; Bortolin, C.; Bose, S.; Bosisio, L.; Bossu, F.; Botje, M.; Bottger, S.; Bourdaud, G.; Boyer, B.; Braun, M.; Braun-Munzinger, P.; Bravina, L.; Bregant, M.; Breitner, T.; Bruckner, G.; Brun, R.; Bruna, E.; Bruno, G.E.; Budnikov, D.; Buesching, H.; Buncic, P.; Busch, O.; Buthelezi, Z.; Caffarri, D.; Cai, X.; Caines, H.; Camacho, E.; Camerini, P.; Campbell, M.; Canoa Roman, V.; Capitani, G.P.; Cara Romeo, G.; Carena, F.; Carena, W.; Carminati, F.; Casanova Diaz, A.; Caselle, M.; Castellanos, J.Castillo; Castillo Hernandez, J.F.; Catanescu, V.; Cattaruzza, E.; Cavicchioli, C.; Cerello, P.; Chambert, V.; Chang, B.; Chapeland, S.; Charpy, A.; Charvet, J.L.; Chattopadhyay, S.; Chattopadhyay, S.; Cherney, M.; Cheshkov, C.; Cheynis, B.; Chiavassa, E.; Chibante Barroso, V.; Chinellato, D.D.; Chochula, P.; Choi, K.; Chojnacki, M.; Christakoglou, P.; Christensen, C.H.; Christiansen, P.; Chujo, T.; Chuman, F.; Cicalo, C.; Cifarelli, L.; Cindolo, F.; Cleymans, J.; Cobanoglu, O.; Coffin, J.P.; Coli, S.; Colla, A.; Conesa Balbastre, G.; Conesa del Valle, Z.; Conner, E.S.; Constantin, P.; Contin, G.; Contreras, J.G.; Corrales Morales, Y.; Cormier, T.M.; Cortese, P.; Cortes Maldonado, I.; Cosentino, M.R.; Costa, F.; Cotallo, M.E.; Crescio, E.; Crochet, P.; Cuautle, E.; Cunqueiro, L.; Cussonneau, J.; Dainese, A.; Dalsgaard, H.H.; Danu, A.; Das, I.; Das, S.; Dash, A.; Dash, S.; de Barros, G.O.V.; De Caro, A.; de Cataldo, G.; de Cuveland, J.; De Falco, A.; De Gaspari, M.; de Groot, J.; De Gruttola, D.; de Haas, A.P.; De Marco, N.; De Pasquale, S.; De Remigis, R.; de Rooij, R.; de Vaux, G.; Delagrange, H.; Dellacasa, G.; Deloff, A.; Demanov, V.; Denes, E.; Deppman, A.; D'Erasmo, G.; Derkach, D.; Devaux, A.; Di Bari, D.; Di Giglio, C.; Di Liberto, S.; Di Mauro, A.; Di Nezza, P.; Dialinas, M.; Diaz, L.; Diaz, R.; Dietel, T.; Divia, R.; Djuvsland, O.; Dobretsov, V.; Dobrin, A.; Dobrowolski, T.; Donigus, B.; Dominguez, I.; Dordic, O.; Dubey, A.K.; Dubuisson, J.; Ducroux, L.; Dupieux, P.; Dutta Majumdar, A.K.; Dutta Majumdar, M.R.; Elia, D.; Emschermann, D.; Enokizono, A.; Espagnon, B.; Estienne, M.; Esumi, S.; Evans, D.; Evrard, S.; Eyyubova, G.; Fabjan, C.W.; Fabris, D.; Faivre, J.; Falchieri, D.; Fantoni, A.; Fasel, M.; Fateev, O.; Fearick, R.; Fedunov, A.; Fehlker, D.; Fekete, V.; Felea, D.; Fenton-Olsen, B.; Feofilov, G.; Fernandez Tellez, A.; Ferreiro, E.G.; Ferretti, A.; Ferretti, R.; Figueredo, M.A.S.; Filchagin, S.; Fini, R.; Fionda, F.M.; Fiore, E.M.; Floris, M.; Fodor, Z.; Foertsch, S.; Foka, P.; Fokin, S.; Formenti, F.; Fragiacomo, E.; Fragkiadakis, M.; Frankenfeld, U.; Frolov, A.; Fuchs, U.; Furano, F.; Furget, C.; Fusco Girard, M.; Gaardhoje, J.J.; Gadrat, S.; Gagliardi, M.; Gago, A.; Gallio, M.; Ganoti, P.; Ganti, M.S.; Garabatos, C.; Garcia Trapaga, C.; Gebelein, J.; Gemme, R.; Germain, M.; Gheata, A.; Gheata, M.; Ghidini, B.; Ghosh, P.; Giraudo, G.; Giubellino, P.; Gladysz-Dziadus, E.; Glasow, R.; Glassel, P.; Glenn, A.; Gomez Jimenez, R.; Gonzalez Santos, H.; Gonzalez-Trueba, L.H.; Gonzalez-Zamora, P.; Gorbunov, S.; Gorbunov, Y.; Gotovac, S.; Gottschlag, H.; Grabski, V.; Grajcarek, R.; Grelli, A.; Grigoras, A.; Grigoras, C.; Grigoriev, V.; Grigoryan, A.; Grigoryan, S.; Grinyov, B.; Grion, N.; Gros, P.; Grosse-Oetringhaus, J.F.; Grossiord, J.Y.; Grosso, R.; Guber, F.; Guernane, R.; Guerzoni, B.; Gulbrandsen, K.; Gulkanyan, H.; Gunji, T.; Gupta, A.; Gupta, R.; Gustafsson, H.A.; Gutbrod, H.; Haaland, O.; Hadjidakis, C.; Haiduc, M.; Hamagaki, H.; Hamar, G.; Hamblen, J.; Han, B.H.; Harris, J.W.; Hartig, M.; Harutyunyan, A.; Hasch, D.; Hasegan, D.; Hatzifotiadou, D.; Hayrapetyan, A.; Heide, M.; Heinz, M.; Helstrup, H.; Herghelegiu, A.; Hernandez, C.; Herrera Corral, G.; Herrmann, N.; Hetland, K.F.; Hicks, B.; Hiei, A.; Hille, P.T.; Hippolyte, B.; Horaguchi, T.; Hori, Y.; Hristov, P.; Hrivnacova, I.; Hu, S.; Huang, M.; Huber, S.; Humanic, T.J.; Hutter, D.; Hwang, D.S.; Ichou, R.; Ilkaev, R.; Ilkiv, I.; Inaba, M.; Innocenti, P.G.; Ippolitov, M.; Irfan, M.; Ivan, C.; Ivanov, A.; Ivanov, M.; Ivanov, V.; Iwasaki, T.; Jacholkowski, A.; Jacobs, P.; Jancurova, L.; Jangal, S.; Janik, R.; Jena, C.; Jena, S.; Jirden, L.; Jones, G.T.; Jones, P.G.; Jovanovic, P.; Jung, H.; Jung, W.; Jusko, A.; Kaidalov, A.B.; Kalcher, S.; Kalinak, P.; Kalisky, M.; Kalliokoski, T.; Kalweit, A.; Kamal, A.; Kamermans, R.; Kanaki, K.; Kang, E.; Kang, J.H.; Kapitan, J.; Kaplin, V.; Kapusta, S.; Karavichev, O.; Karavicheva, T.; Karpechev, E.; Kazantsev, A.; Kebschull, U.; Keidel, R.; Khan, M.M.; Khan, S.A.; Khanzadeev, A.; Kharlov, Y.; Kikola, D.; Kileng, B.; Kim, D.J.; Kim, D.S.; Kim, D.W.; Kim, H.N.; Kim, J.; Kim, J.H.; Kim, J.S.; Kim, M.; Kim, M.; Kim, S.H.; Kim, S.; Kim, Y.; Kirsch, S.; Kisel, I.; Kiselev, S.; Kisiel, A.; Klay, J.L.; Klein, J.; Klein-Bosing, C.; Kliemant, M.; Klovning, A.; Kluge, A.; Kniege, S.; Koch, K.; Kolevatov, R.; Kolojvari, A.; Kondratiev, V.; Kondratyeva, N.; Konevskih, A.; Kornas, E.; Kour, R.; Kowalski, M.; Kox, S.; Kozlov, K.; Kral, J.; Kralik, I.; Kramer, F.; Kraus, I.; Kravcakova, A.; Krawutschke, T.; Krivda, M.; Krumbhorn, D.; Krus, M.; Kryshen, E.; Krzewicki, M.; Kucheriaev, Y.; Kuhn, C.; Kuijer, P.G.; Kumar, L.; Kumar, N.; Kupczak, R.; Kurashvili, P.; Kurepin, A.; Kurepin, A.N.; Kuryakin, A.; Kushpil, S.; Kushpil, V.; Kutouski, M.; Kvaerno, H.; Kweon, M.J.; Kwon, Y.; La Rocca, P.; Lackner, F.; Ladron de Guevara, P.; Lafage, V.; Lal, C.; Lara, C.; Larsen, D.T.; Laurenti, G.; Lazzeroni, C.; Le Bornec, Y.; Le Bris, N.; Lee, H.; Lee, K.S.; Lee, S.C.; Lefevre, F.; Lenhardt, M.; Leistam, L.; Lehnert, J.; Lenti, V.; Leon, H.; Leon Monzon, I.; Leon Vargas, H.; Levai, P.; Li, X.; Li, Y.; Lietava, R.; Lindal, S.; Lindenstruth, V.; Lippmann, C.; Lisa, M.A.; Listratenko, O.; Liu, L.; Loginov, V.; Lohn, S.; Lopez, X.; Lopez Noriega, M.; Lopez-Ramirez, R.; Lopez Torres, E.; Lovhoiden, G.; Lozea Feijo Soares, A.; Lu, S.; Lunardon, M.; Luparello, G.; Luquin, L.; Lutz, J.R.; Ma, K.; Ma, R.; Madagodahettige-Don, D.M.; Maevskaya, A.; Mager, M.; Mahapatra, D.P.; Maire, A.; Makhlyueva, I.; Mal'Kevich, D.; Malaev, M.; Malagalage, K.J.; Maldonado Cervantes, I.; Malek, M.; Malkiewicz, T.; Malzacher, P.; Mamonov, A.; Manceau, L.; Mangotra, L.; Manko, V.; Manso, F.; Manzari, V.; Mao, Y.; Mares, J.; Margagliotti, G.V.; Margotti, A.; Marin, A.; Martashvili, I.; Martinengo, P.; Martinez Hernandez, M.I.; Martinez Davalos, A.; Martinez Garcia, G.; Maruyama, Y.; Marzari Chiesa, A.; Masciocchi, S.; Masera, M.; Masetti, M.; Masoni, A.; Massacrier, L.; Mastromarco, M.; Mastroserio, A.; Matthews, Z.L.; Matyja, A.; Mayani, D.; Mazza, G.; Mazzoni, M.A.; Meddi, F.; Menchaca-Rocha, A.; Mendez Lorenzo, P.; Meoni, M.; Mercado Perez, J.; Mereu, P.; Miake, Y.; Michalon, A.; Miftakhov, N.; Milosevic, J.; Minafra, F.; Mischke, A.; Miskowiec, D.; Mitu, C.; Mizoguchi, K.; Mlynarz, J.; Mohanty, B.; Molnar, L.; Mondal, M.M.; Montano Zetina, L.; Monteno, M.; Montes, E.; Morando, M.; Moretto, S.; Morsch, A.; Moukhanova, T.; Muccifora, V.; Mudnic, E.; Muhuri, S.; Muller, H.; Munhoz, M.G.; Munoz, J.; Musa, L.; Musso, A.; Nandi, B.K.; Nania, R.; Nappi, E.; Navach, F.; Navin, S.; Nayak, T.K.; Nazarenko, S.; Nazarov, G.; Nedosekin, A.; Nendaz, F.; Newby, J.; Nianine, A.; Nicassio, M.; Nielsen, B.S.; Nikolaev, S.; Nikolic, V.; Nikulin, S.; Nikulin, V.; Nilsen, B.S.; Nilsson, M.S.; Noferini, F.; Nomokonov, P.; Nooren, G.; Novitzky, N.; Nyatha, A.; Nygaard, C.; Nyiri, A.; Nystrand, J.; Ochirov, A.; Odyniec, G.; Oeschler, H.; Oinonen, M.; Okada, K.; Okada, Y.; Oldenburg, M.; Oleniacz, J.; Oppedisano, C.; Orsini, F.; Ortiz Velasquez, A.; Ortona, G.; Oskamp, C.J.; Oskarsson, A.; Osmic, F.; Osterman, L.; Ostrowski, P.; Otterlund, I.; Otwinowski, J.; Ovrebekk, G.; Oyama, K.; Ozawa, K.; Pachmayer, Y.; Pachr, M.; Padilla, F.; Pagano, P.; Paic, G.; Painke, F.; Pajares, C.; Pal, S.; Pal, S.K.; Palaha, A.; Palmeri, A.; Panse, R.; Papikyan, V.; Pappalardo, G.S.; Park, W.J.; Pastircak, B.; Pastore, C.; Paticchio, V.; Pavlinov, A.; Pawlak, T.; Peitzmann, T.; Pepato, A.; Pereira, H.; Peressounko, D.; Perez, C.; Perini, D.; Perrino, D.; Peryt, W.; Peschek, J.; Pesci, A.; Peskov, V.; Pestov, Y.; Peters, A.J.; Petracek, V.; Petridis, A.; Petris, M.; Petrov, P.; Petrovici, M.; Petta, C.; Peyre, J.; Piano, S.; Piccotti, A.; Pikna, M.; Pillot, P.; Pinazza, O.; Pinsky, L.; Pitz, N.; Piuz, F.; Platt, R.; Ploskon, M.; Pluta, J.; Pocheptsov, T.; Pochybova, S.; Podesta Lerma, P.L.M.; Poggio, F.; Poghosyan, M.G.; Polak, K.; Polichtchouk, B.; Polozov, P.; Polyakov, V.; Pommeresch, B.; Pop, A.; Posa, F.; Pospisil, V.; Potukuchi, B.; Pouthas, J.; Prasad, S.K.; Preghenella, R.; Prino, F.; Pruneau, C.A.; Pshenichnov, I.; Puddu, G.; Pujahari, P.; Pulvirenti, A.; Punin, A.; Punin, V.; Putis, M.; Putschke, J.; Quercigh, E.; Rachevski, A.; Rademakers, A.; Radomski, S.; Raiha, T.S.; Rak, J.; Rakotozafindrabe, A.; Ramello, L.; Ramirez Reyes, A.; Rammler, M.; Raniwala, R.; Raniwala, S.; Rasanen, S.S.; Rashevskaya, I.; Rath, S.; Read, K.F.; Real, J.S.; Redlich, K.; Renfordt, R.; Reolon, A.R.; Reshetin, A.; Rettig, F.; Revol, J.P.; Reygers, K.; Ricaud, H.; Riccati, L.; Ricci, R.A.; Richter, M.; Riedler, P.; Riegler, W.; Riggi, F.; Rivetti, A.; Rodriguez Cahuantzi, M.; Roed, K.; Rohrich, D.; Roman Lopez, S.; Romita, R.; Ronchetti, F.; Rosinsky, P.; Rosnet, P.; Rossegger, S.; Rossi, A.; Roukoutakis, F.; Rousseau, S.; Roy, C.; Roy, P.; Rubio-Montero, A.J.; Rui, R.; Rusanov, I.; Russo, G.; Ryabinkin, E.; Rybicki, A.; Sadovsky, S.; Safarik, K.; Sahoo, R.; Saini, J.; Saiz, P.; Sakata, D.; Salgado, C.A.; Salgueiro Domingues da Silva, R.; Salur, S.; Samanta, T.; Sambyal, S.; Samsonov, V.; Sandor, L.; Sandoval, A.; Sano, M.; Sano, S.; Santo, R.; Santoro, R.; Sarkamo, J.; Saturnini, P.; Scapparone, E.; Scarlassara, F.; Scharenberg, R.P.; Schiaua, C.; Schicker, R.; Schindler, H.; Schmidt, C.; Schmidt, H.R.; Schossmaier, K.; Schreiner, S.; Schuchmann, S.; Schukraft, J.; Schutz, Y.; Schwarz, K.; Schweda, K.; Scioli, G.; Scomparin, E.; Segato, G.; Semenov, D.; Senyukov, S.; Seo, J.; Serci, S.; Serkin, L.; Serradilla, E.; Sevcenco, A.; Sgura, I.; Shabratova, G.; Shahoyan, R.; Sharkov, G.; Sharma, N.; Sharma, S.; Shigaki, K.; Shimomura, M.; Shtejer, K.; Sibiriak, Y.; Siciliano, M.; Sicking, E.; Siddi, E.; Siemiarczuk, T.; Silenzi, A.; Silvermyr, D.; Simili, E.; Simonetti, G.; Singaraju, R.; Singh, R.; Singhal, V.; Sinha, B.C.; Sinha, T.; Sitar, B.; Sitta, M.; Skaali, T.B.; Skjerdal, K.; Smakal, R.; Smirnov, N.; Snellings, R.; Snow, H.; Sogaard, C.; Soloviev, A.; Soltveit, H.K.; Soltz, R.; Sommer, W.; Son, C.W.; Son, H.; Song, M.; Soos, C.; Soramel, F.; Soyk, D.; Spyropoulou-Stassinaki, M.; Srivastava, B.K.; Stachel, J.; Staley, F.; Stan, E.; Stefanek, G.; Stefanini, G.; Steinbeck, T.; Stenlund, E.; Steyn, G.; Stocco, D.; Stock, R.; Stolpovsky, P.; Strmen, P.; Suaide, A.A.P.; Subieta Vasquez, M.A.; Sugitate, T.; Suire, C.; Sumbera, M.; Susa, T.; Swoboda, D.; Symons, J.; Szanto de Toledo, A.; Szarka, I.; Szostak, A.; Szuba, M.; Tadel, M.; Tagridis, C.; Takahara, A.; Takahashi, J.; Tanabe, R.; Takaki, D.J.Tapia; Taureg, H.; Tauro, A.; Tavlet, M.; Tejeda Munoz, G.; Telesca, A.; Terrevoli, C.; Thader, J.; Tieulent, R.; Tlusty, D.; Toia, A.; Tolyhy, T.; Torcato de Matos, C.; Torii, H.; Torralba, G.; Toscano, L.; Tosello, F.; Tournaire, A.; Traczyk, T.; Tribedy, P.; Troger, G.; Truesdale, D.; Trzaska, W.H.; Tsiledakis, G.; Tsilis, E.; Tsuji, T.; Tumkin, A.; Turrisi, R.; Turvey, A.; Tveter, T.S.; Tydesjo, H.; Tywoniuk, K.; Ulery, J.; Ullaland, K.; Uras, A.; Urban, J.; Urciuoli, G.M.; Usai, G.L.; Vacchi, A.; Vala, M.; Valencia Palomo, L.; Vallero, S.; van den Brink, A.; van der Kolk, N.; Vyvre, P.Vande; van Leeuwen, M.; Vannucci, L.; Vargas, A.; Varma, R.; Vasiliev, A.; Vassiliev, I.; Vasileiou, M.; Vechernin, V.; Venaruzzo, M.; Vercellin, E.; Vergara, S.; Vernet, R.; Verweij, M.; Vetlitskiy, I.; Vickovic, L.; Viesti, G.; Vikhlyantsev, O.; Vilakazi, Z.; Villalobos Baillie, O.; Vinogradov, A.; Vinogradov, L.; Vinogradov, Y.; Virgili, T.; Viyogi, Y.P.; Vodopianov, A.; Voloshin, K.; Voloshin, S.; Volpe, G.; von Haller, B.; Vranic, D.; Vrlakova, J.; Vulpescu, B.; Wagner, B.; Wagner, V.; Wallet, L.; Wan, R.; Wang, D.; Wang, Y.; Watanabe, K.; Wen, Q.; Wessels, J.; Westerhoff, U.; Wiechula, J.; Wikne, J.; Wilk, A.; Wilk, G.; Williams, M.C.S.; Willis, N.; Windelband, B.; Xu, C.; Yang, C.; Yang, H.; Yasnopolskiy, S.; Yermia, F.; Yi, J.; Yin, Z.; Yokoyama, H.; Yoo, I-K.; Yuan, X.; Yurevich, V.; Yushmanov, I.; Zabrodin, E.; Zagreev, B.; Zalite, A.; Zampolli, C.; Zanevsky, Yu.; Zaporozhets, S.; Zarochentsev, A.; Zavada, P.; Zbroszczyk, H.; Zelnicek, P.; Zenin, A.; Zepeda, A.; Zgura, I.; Zhalov, M.; Zhang, X.; Zhou, D.; Zhou, S.; Zhu, J.; Zichichi, A.; Zinchenko, A.; Zinovjev, G.; Zoccarato, Y.; Zychacek, V.; Zynovyev, M.
2010-01-01
Charged-particle production was studied in proton-proton collisions collected at the LHC with the ALICE detector at centre-of-mass energies 0.9 TeV and 2.36 TeV in the pseudorapidity range |eta| < 1.4. In the central region (|eta| < 0.5), at 0.9 TeV, we measure charged-particle pseudorapidity density dNch/deta = 3.02 +- 0.01 (stat.) +0.08 -0.05 (syst.) for inelastic interactions, and dNch/deta = 3.58 +- 0.01 (stat.) +0.12 -0.12 (syst.) for non-single-diffractive interactions. At 2.36 TeV, we find dNch/deta = 3.77 +- 0.01 (stat.) +0.25 -0.12 (syst.) for inelastic, and dNch/deta = 4.43 +- 0.01 (stat.) +0.17 -0.12 (syst.) for non-single-diffractive collisions. The relative increase in charged-particle multiplicity from the lower to higher energy is 24.7% +- 0.5% (stat.) +5.7% -2.8% (syst.) for inelastic and 23.7% +- 0.5% (stat.) +4.6% -1.1% (syst.) for non-single-diffractive interactions. This increase is consistent with that reported by the CMS collaboration for non-single-diffractive events and larger th...
JPRS Report, Science & Technology, USSR: Space.
1988-08-17
Half-life, years Specific Heat Release W/hr Plutonium-238 87.5 0.46 Curium-244 18.4 2.8 Curium-242 0.45 120 Polonium - 210 0.38 144 Polonium - 210 ...begun train- ing a year before the flight. The prospective space travelers had to be trained to stay in a special capsule and to use nozzles for food ...conditions of extended weight- lessness. On command, the animals are given food and water, waste is removed, and day/night conditions are regulated
Root uptake of transuranic elements
International Nuclear Information System (INIS)
Schulz, R.K.
1977-01-01
The uptake of elements by plant roots is one of the important pathways of entry of many elements into the food chain of man. Data are cited showing plutonium concentration ratios, plant/soil, ranging from 10 -10 to 10 -3 . Concentration ratios for americium range from 10 -7 to 10 +1 . Limited experiments with curium and neptunium indicate that root uptake of curium is similar to that of americium and that plant uptake of neptunium is substantially larger than that of curium and americium. The extreme ranges of concentration ratios cited for plutonium and americium are due to a number of causes. Experimental conditions such as very intensive cropping will lead to abnormally high concentration ratios. In some experiments, addition of chelating agents markedly increased plant root uptake of transuranic elements. Particle size and composition of the source material influenced uptake of the transuranics by plants. Translocation within the plant, and soil factors such as pH and organic matter content, all affect concentration ratios
International Nuclear Information System (INIS)
Haire, R.G.; Young, J.P.; Peterson, J.R.; Tennessee Univ., Knoxville; Benedict, U.
1987-01-01
The anhydrous tri-iodides of plutonium, americium and curium under pressure have been investigated using absorption spectrophotometry. These initial studies on plutonium and curium tri-iodides together with the published data for americium tri-iodide show that the rhombohedral form of these compounds (BiI 3 -type structure) can be converted to the orthorhombic form (PuBr 3 -type structure) by applying pressure at room temperature. Absorption spectrophotometry can often differentiate between two crystallographic forms of a material and has been used in the present high-pressure studies to monitor the effects of pressure on the tri-iodides. A complication in these studies of the tri-iodides is a significant shift of their absorption edges with pressure from the near UV to the visible spectral region. With curium tri-iodide this shift causes interference with the major f-f absorption peaks and precludes identification by absorption spectrophotometry of the high pressure phase of CmI 3 . (orig.)
Criticality and thermal analyses of separated actinides
International Nuclear Information System (INIS)
Bakker, E.
2004-01-01
Curium and americium pose special problems in the chemical preparation of spent fuel for transmutation. Once separated from the other actinides, the isotopes can lead to nuclear fission with the subsequent release of a large amount of radiation. A neutron criticality code was used to determine k eff for varying quantities of Cm 2 O 3 and Am 2 O 3 held within spherical or cylindrical containers. These geometries were investigated both in air and in water. Recommendations are made on the maximum amount of Cm 2 O 3 and Am 2 O 3 that can be safely stored or handled before encountering criticality. Several isotopes of curium and americium also generate a significant amount of heat by radioactive decay. If kilogram quantities are stored in a container, for example, the material may heat to an equilibrium temperature that exceeds its melting temperature. The heat generation of curium and americium present even more restriction on the mass of that can safely be contained in one location. (author)
International Nuclear Information System (INIS)
Apps, J.A.; Benson, L.V.; Lucas, J.; Mathur, A.K.; Tsao, L.
1977-09-01
During fiscal year 1977, the following subtasks were performed. (1) Thermodynamic data were tabulated for those aqueous complexes and solid phases of plutonium, neptunium, americium, and curium likely to form in the environment. (2) Eh-pH diagrams were computed and drafted for plutonium, neptunium, americium and curium at 25 0 C and one atmosphere. (3) The literature on distribution coefficients of plutonium, neptunium, americium, and curium was reviewed. (4) Preliminary considerations were determined for an experimental method of measuring radionuclide transport in water-saturated rocks. (5) The transport mechanisms of radionuclides in water-saturated rocks were reviewed. (6) A computer simulation was attempted of mass transfer involving actinides in water-saturated rocks. Progress in these tasks is reported. Subtasks 1, 2, 3, and 4 are complete. The progress made in subtask 5 is represented by an initial theoretical survey to define the conditions needed to characterize the transport of radionuclides in rocks. Subtask 6 has begun but is not complete
International Nuclear Information System (INIS)
Isaev, S.G.; Piksaikin, L.E.; Kazakov, L.E.; Tarasko, M.Z.
2000-01-01
The measurements of relative abundances and periods of delayed neutrons from fast neutron induced fission of 235 U and 236 U have been made at the electrostatic accelerator CG-2.5 at IPPE. The preliminary results were obtained and discussed in the frame of the systematics of the average half-life of delayed neutron precursors. It was shown that the average half-life value in both reactions depends on the energy of primary neutrons [ru
Energy Technology Data Exchange (ETDEWEB)
Skerencak, Andrej
2010-05-11
The subject of the present investigation is the complexation of trivalent actinides at elevated temperatures. The objective of this work is to broaden the comprehension of the geochemical processes relevant for the migration of radionuclides in the near-field of a nuclear waste repository. Depending on the disposed nuclear waste, the temperature in the direct vicinity of a nuclear waste repository may reach up to 200 C. The result is a distinct change of the geochemistry of the actinides. Many of these processes have already been studied in detail at room temperature. Yet, data at elevated temperature are rare. However, a comprehensive long term safety analysis of a nuclear waste repository requires the precise thermodynamic description of the relevant geochemical processes at room as well as at elevated temperatures. The present work is focused on the investigation of the complexation of trivalent curium (Cm(III)) with different inorganic ligands at elevated temperatures. Due to its outstanding spectroscopic properties, Cm(III) is chosen as a representative for trivalent actinides. The studied ligand systems are nitrate (NO{sub 3}{sup -}), fluoride (F{sup -}), sulphate (SO{sub 4}{sup 2-}) and chloride (Cl{sup -}). The main analytical method employed is the ''time resolved laser fluorescence spectroscopy'' (TRLFS). The experiments with nitrate, sulphate and chloride were carried out in a custom-built high temperature cell, enabling spectroscopic studies at temperatures up to 200 C. The Cm(III)-fluoride-system was studied in a cuvette (quartz glass) in the temperature range from 20 to 90 C. Supplementary structural studies were performed using EXAFS (Extended X-Ray Absorption Fine Structure) spectroscopy and supported by quantum chemical calculations at DFT (Density Functional Theory) level. The results of the TRLFS studies show a general shift of the chemical equilibrium towards the complexed species with increasing temperature. For instance
A-type central stars of planetary nebulae. 2. The central stars of NGC 2346, He 2-36 and NGC 3132
Energy Technology Data Exchange (ETDEWEB)
Mendez, R H [Instituto de Astronomia y Fisica del Espacio, Buenos Aires (Argentina)
1978-12-01
Spectrograms, scanner, uvby and ANS ultraviolet measurements of the central stars of NGC 2346, He 2-36 and NGC 3132 are analysed. The observations suggest that the first one is a foreground horizontal-branch star, and the second is above the horizontal branch, presumably in a rapid evolutionary phase. Both objects are probably variable. The central star of NGC 3132 is a slightly evolved main-sequence star with a hot visual companion. The evolutionary status of this system is briefly discussed.
Data Evaluation of Actinide Cross Sections: 238Pu, 237Pu, and 236Pu
Energy Technology Data Exchange (ETDEWEB)
Guaglioni, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jurgenson, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Descalle, M. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ormand, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Younes, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mattoon, C. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beck, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bailey, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-10-04
This report documents the recent evaluation of the 236Pu, 237Pu, and 238Pu cross section sets. Nuclear data evaluation is the fundamental interface that takes measured nuclear cross section data and turns them into a continuous curve that 1) is consistent with other measurements and nuclear reaction theory/models, and 2) is required by down-stream users. All experiments that generate nuclear data need to include an evaluation step for their data to be broadly useful to the end users.
International Nuclear Information System (INIS)
Alekseev, A.A.; Bergman, A.A.; Berlev, A.I.; Koptelov, E.A.; Samylin, B.F.; Trufanov, A.M.; Fursov, B.I.; Shorin, V.S.
2009-12-01
This report contains brief description of the Lead Slowing Down Spectrometer and results of measurements of neutron-induced fission cross sections for 236 U, 242m Am, 243 Cm, 244 Cm, 245 Cm and 246 Cm done at this spectrometer. The work was partially supported through the IAEA research contract RC-14485-RD in the framework of the IAEA Coordinated Research Project 'Minor Actinide Neutron Reaction Data (MANREAD)'. The detailed description of the experimental set up, measurements procedure and data treatment can be found in the JIA-1182 (2007) and JIA-1212 (2009) reports from the Institute of Nuclear Research of the Russian Academy of Science published in Russian. Part 1 contains the first year report of the research contract and part 2 the second year report. (author)
Vollmer, M. K.; Miller, B. R.; Rigby, M. L.; Reimann, S.; Muhle, J.; Agage, Soge, Snu Members, Kopri Members
2010-12-01
We report on the atmospheric measurements and global emissions of the hydrofluorocarbons (HFCs) HFC-365mfc (CH3CH2CF2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). These measurements are from in-situ observations at stations of AGAGE (Advanced Global Atmospheric Gases Experiment) and SOGE (System for Observations of Halogenated Greenhouse Gases in Europe), and from the Korean station Gosan. We also report on flask sample measurements from the Antarctic stations King Sejong and Troll, and extend our records back to the 1970s using archived air samples of both hemispheres. All data are used in a global 12-box 2-dimensional atmospheric transport model to derive global abundances and emission estimates. All four HFCs have strongly increased in the atmosphere in recent years with growth rates at nearly 10 %, resulting in dry air mole fractions at the end of 2009 of 0.49 ppt for HFC-365mfc, 1.00 ppt for HFC-245fa, and 0.51 ppt for HFC-227ea. HFC-236fa, for which we report the first atmospheric measurements, is less abundant and has grown to 0.069 ppt at the end of 2009. Our model results show rapidly growing emissions of HFC-365mfc and HFC-245fa after 2002 but surprisingly these have now started to decline to globally 2.7 kt/yr (HFC-365mfc) and 6.1 kt/yr (HFC-245fa). On the other hand HFC-227ea and HFC-236fa show uninterrupted growth in their emissions of 2.5 kt/yr and 0.2 kt/yr at the end of 2009.
Low-level determination of transuranic elements in marine environment samples
International Nuclear Information System (INIS)
Ballestra, S.; Holm, E.; Fukai, R.
1978-01-01
The procedures developed and currently employed in the Monaco Laboratory for determining transuranic elements in seawater, marine sediments and organisms are described and discussed. While the standard anion-exchange procedure from the hydrochloric acid medium is used for the separation of plutonium isotopes from americium, purification of americium and curium is achieved by an ion-exchange sorption from the methanol-nitric acid medium, followed by an elution with the methanol-hydrochloric acid mixture. Satisfactory clean-up of plutonium as well as americium and curium can be achieved by applying the described procedures. (author)
Effects of actinide burning on waste disposal at Yucca Mountain
International Nuclear Information System (INIS)
Hirschfelder, J.
1992-01-01
Release rates of 15 radionuclides from waste packages expected to result from partitioning and transmutation of Light-Water Reactor (LWR) and Actinide-Burning Liquid-Metal Reactor (ALMR) spent fuel are calculated and compared to release rates from standard LWR spent fuel packages. The release rates are input to a model for radionuclide transport from the proposed geologic repository at Yucca Mountain to the water table. Discharge rates at the water table are calculated and used in a model for transport to the accessible environment, defined to be five kilometers from the repository edge. Concentrations and dose rates at the accessible environment from spent fuel and wastes from reprocessing, with partitioning and transmutation, are calculated. Partitioning and transmutation of LWR and ALMR spent fuel reduces the inventories of uranium, neptunium, plutonium, americium and curium in the high-level waste by factors of 40 to 500. However, because release rates of all of the actinides except curium are limited by solubility and are independent of package inventory, they are not reduced correspondingly. Only for curium is the repository release rate much lower for reprocessing wastes
International Nuclear Information System (INIS)
Karalova, Z.K.; Bukina, T.I.; Myasoedov, B.F.; Fedorov, L.A.; Sokolovskij, S.A.
1987-01-01
Extraction of trivalent americium, curium, californium and europium by technical mixture of mono- and didecylpyrocatechin (TAP) in various diluents from carbonate solutions is investigated. Effect of many factors (pH, K 2 CO 3 concentration, TAP, metal; the time of phase contact) on the completeness of element isolation and separation is clarified. It is ascertained that the elements listed are quantitatively extracted by TAP solution in toluene and cyclohexane in the range of K 2 CO 3 concentrations from 0.25 to 1.5 mol/l. The difference in americium and curium distribution coefficient during their extraction by TAP from 0.25 mol/l of K 2 CO 3 solution is detected. Separation coefficients of the pair increase with the increase of carbonate solution pH. The separation can be improved at the stage of element reextraction by the mixture of K 2 CO 3 and DTPA or EDTA from alkylpyrocatechin, sunce rate constants of americium and curium reextraction differ greatly. Using 13 C NMR the composition of compounds in organic phase on the basis of 4-(α, α-dioctylethyl)pyrocatechin is investigated
Proliferation resistance of the lithium reduction process
International Nuclear Information System (INIS)
Ko, W. I.; Ha, J. H.; Lee, S. Y.; Song, D. Y.; Kim, H. D.; Park, S. W.
2002-01-01
This paper addresses the characteristics of proliferation resistance of the lithium reduction process and international domestic safeguarding methods. In addition to dealing with qualitative features of the proliferation resistance, this study is emphasizing on the quantitative analysis of radiation barrier, which could be a significant accessibility barrier if the field is high enough to force a theft to shield the object during a theft. From the radiation barrier analysis, it is indicated that whole-body radiation dose is about 20 rem/hr at one meter of smelt and ingot metal of 40 kgHM, which could be considered to be a significant reduction in risk of theft. For safeguarding of this process, we propose a NDA concept for nuclear material accounting which is to measure the amount of curium in the reduction metal and associated process samples using a neutron coincidence counter and then to convert the curium mass into special nuclear material with predetermined curium ratios. For this, a well-type neutron coincidence counter with substantial shielding to protect the system from high gamma radiation is conceptually designed
Identification of colloids in nuclear waste glass reactions
International Nuclear Information System (INIS)
Cunnane, J.C.; Bates, J.K.
1991-01-01
Characterization data for particulates formed under a variety of laboratory leaching conditions that simulate glass reaction in a repository environment are presented. Data on the particle size distributions and filterable fractions for neptunium, plutonium, americium, and curium were obtained by filtrations through a series of filters with pore sizes ranging from 1 μm to 3.8 nm. The neptunium was found to be largely nonfilterable. Americium and plutonium were associated with filterable particles. The particles with which the americium, plutonium, and curium were associated were characterized using transmission electron microscopy (TEM) examination techniques. 8 refs., 1 fig., 2 tabs
Khachatryan, V; Sirunyan, A M; Tumasyan, A; Adam, W; Bergauer, T; Dragicevic, M; Erö, J; Fabjan, C; Friedl, M; Frühwirth, R; Ghete, V M; Hammer, J; Hänsel, S; Hoch, M; Hörmann, N; Hrubec, J; Jeitler, M; Kasieczka, G; Kiesenhofer, W; Krammer, M; Liko, D; Mikulec, I; Pernicka, M; Rohringer, H; Schöfbeck, R; Strauss, J; Taurok, A; Teischinger, F; Waltenberger, W; Walzel, G; Widl, E; Wulz, C-E; Mossolov, V; Shumeiko, N; Suarez Gonzalez, J; Benucci, L; Ceard, L; De Wolf, E A; Hashemi, M; Janssen, X; Maes, T; Mucibello, L; Ochesanu, S; Roland, B; Rougny, R; Selvaggi, M; Van Haevermaet, H; Van Mechelen, P; Van Remortel, N; Adler, V; Beauceron, S; Blyweert, S; D'Hondt, J; Devroede, O; Kalogeropoulos, A; Maes, J; Maes, M; Tavernier, S; Van Doninck, W; Van Mulders, P; Villella, I; Chabert, E C; Charaf, O; Clerbaux, B; De Lentdecker, G; Dero, V; Gay, A P R; Hammad, G H; Marage, P E; Vander Velde, C; Vanlaer, P; Wickens, J; Costantini, S; Grunewald, M; Klein, B; Marinov, A; Ryckbosch, D; Thyssen, F; Tytgat, M; Vanelderen, L; Verwilligen, P; Walsh, S; Zaganidis, N; Basegmez, S; Bruno, G; Caudron, J; De Favereau De Jeneret, J; Delaere, C; Demin, P; Favart, D; Giammanco, A; Grégoire, G; Hollar, J; Lemaitre, V; Militaru, O; Ovyn, S; Pagano, D; Pin, A; Piotrzkowski, K; Quertenmont, L; Schul, N; Beliy, N; Caebergs, T; Daubie, E; Alves, G A; Pol, M E; Souza, M H G; Carvalho, W; Da Costa, E M; De Jesus Damiao, D; De Oliveira Martins, C; Fonseca De Souza, S; Mundim, L; Oguri, V; Santoro, A; Silva Do Amaral, S M; Sznajder, A; Torres Da Silva De Araujo, F; Dias, F A; Dias, M A F; Fernandez Perez Tomei, T R; Gregores, E M; Marinho, F; Novaes, S F; Padula, Sandra S; Darmenov, N; Dimitrov, L; Genchev, V; Iaydjiev, P; Piperov, S; Stoykova, S; Sultanov, G; Trayanov, R; Vankov, I; Dyulendarova, M; Hadjiiska, R; Kozhuharov, V; Litov, L; Marinova, E; Mateev, M; Pavlov, B; Petkov, P; Bian, J G; Chen, G M; Chen, H S; Jiang, C H; Liang, D; Liang, S; Wang, J; Wang, J; Wang, X; Wang, Z; Yang, M; Zang, J; Zhang, Z; Ban, Y; Guo, S; Hu, Z; Mao, Y; Qian, S J; Teng, H; Zhu, B; Cabrera, A; Carrillo Montoya, C A; Gomez Moreno, B; Ocampo Rios, A A; Osorio Oliveros, A F; Sanabria, J C; Godinovic, N; Lelas, D; Lelas, K; Plestina, R; Polic, D; Puljak, I; Antunovic, Z; Dzelalija, M; Brigljevic, V; Duric, S; Kadija, K; Morovic, S; Attikis, A; Fereos, R; Galanti, M; Mousa, J; Nicolaou, C; Papadakis, A; Ptochos, F; Razis, P A; Rykaczewski, H; Tsiakkouri, D; Zinonos, Z; Mahmoud, M; Hektor, A; Kadastik, M; Kannike, K; Müntel, M; Raidal, M; Rebane, L; Azzolini, V; Eerola, P; Czellar, S; Härkönen, J; Heikkinen, A; Karimäki, V; Kinnunen, R; Klem, J; Kortelainen, M J; Lampén, T; Lassila-Perini, K; Lehti, S; Lindén, T; Luukka, P; Mäenpää, T; Tuominen, E; Tuominiemi, J; Tuovinen, E; Ungaro, D; Wendland, L; Banzuzi, K; Korpela, A; Tuuva, T; Sillou, D; Besancon, M; Dejardin, M; Denegri, D; Descamps, J; Fabbro, B; Faure, J L; Ferri, F; Ganjour, S; Gentit, F X; Givernaud, A; Gras, P; Hamel de Monchenault, G; Jarry, P; Locci, E; Malcles, J; Marionneau, M; Millischer, L; Rander, J; Rosowsky, A; Rousseau, D; Titov, M; Verrecchia, P; Baffioni, S; Bianchini, L; Bluj, M; Broutin, C; Busson, P; Charlot, C; Dobrzynski, L; Elgammal, S; Granier de Cassagnac, R; Haguenauer, M; Kalinowski, A; Miné, P; Paganini, P; Sabes, D; Sirois, Y; Thiebaux, C; Zabi, A; Agram, J-L; Besson, A; Bloch, D; Bodin, D; Brom, J-M; Cardaci, M; Conte, E; Drouhin, F; Ferro, C; Fontaine, J-C; Gelé, D; Goerlach, U; Greder, S; Juillot, P; Karim, M; Le Bihan, A-C; Mikami, Y; Speck, J; Van Hove, P; Fassi, F; Mercier, D; Baty, C; Beaupere, N; Bedjidian, M; Bondu, O; Boudoul, G; Boumediene, D; Brun, H; Chanon, N; Chierici, R; Contardo, D; Depasse, P; El Mamouni, H; Fay, J; Gascon, S; Ille, B; Kurca, T; Le Grand, T; Lethuillier, M; Mirabito, L; Perries, S; Sordini, V; Tosi, S; Tschudi, Y; Verdier, P; Xiao, H; Roinishvili, V; Anagnostou, G; Edelhoff, M; Feld, L; Heracleous, N; Hindrichs, O; Jussen, R; Klein, K; Merz, J; Mohr, N; Ostapchuk, A; Perieanu, A; Raupach, F; Sammet, J; Schael, S; Sprenger, D; Weber, H; Weber, M; Wittmer, B; Actis, O; Ata, M; Bender, W; Biallass, P; Erdmann, M; Frangenheim, J; Hebbeker, T; Hinzmann, A; Hoepfner, K; Hof, C; Kirsch, M; Klimkovich, T; Kreuzer, P; Lanske, D; Magass, C; Merschmeyer, M; Meyer, A; Papacz, P; Pieta, H; Reithler, H; Schmitz, S A; Sonnenschein, L; Sowa, M; Steggemann, J; Teyssier, D; Zeidler, C; Bontenackels, M; Davids, M; Duda, M; Flügge, G; Geenen, H; Giffels, M; Haj Ahmad, W; Heydhausen, D; Kress, T; Kuessel, Y; Linn, A; Nowack, A; Perchalla, L; Pooth, O; Sauerland, P; Stahl, A; Thomas, M; Tornier, D; Zoeller, M H; Aldaya Martin, M; Behrenhoff, W; Behrens, U; Bergholz, M; Borras, K; Campbell, A; Castro, E; Dammann, D; Eckerlin, G; Flossdorf, A; Flucke, G; Geiser, A; Hauk, J; Jung, H; Kasemann, M; Katkov, I; Kleinwort, C; Kluge, H; Knutsson, A; Kuznetsova, E; Lange, W; Lohmann, W; Mankel, R; Marienfeld, M; Melzer-Pellmann, I-A; Meyer, A B; Mnich, J; Mussgiller, A; Olzem, J; Parenti, A; Raspereza, A; Schmidt, R; Schoerner-Sadenius, T; Sen, N; Stein, M; Tomaszewska, J; Volyanskyy, D; Wissing, C; Autermann, C; Draeger, J; Eckstein, D; Enderle, H; Gebbert, U; Kaschube, K; Kaussen, G; Klanner, R; Mura, B; Naumann-Emme, S; Nowak, F; Sander, C; Schettler, H; Schleper, P; Schröder, M; Schum, T; Schwandt, J; Stadie, H; Steinbrück, G; Thomsen, J; Wolf, R; Bauer, J; Buege, V; Cakir, A; Chwalek, T; Daeuwel, D; De Boer, W; Dierlamm, A; Dirkes, G; Feindt, M; Gruschke, J; Hackstein, C; Hartmann, F; Heinrich, M; Held, H; Hoffmann, K H; Honc, S; Kuhr, T; Martschei, D; Mueller, S; Müller, Th; Niegel, M; Oberst, O; Oehler, A; Ott, J; Peiffer, T; Piparo, D; Quast, G; Rabbertz, K; Ratnikov, F; Renz, M; Sabellek, A; Saout, C; Scheurer, A; Schieferdecker, P; Schilling, F-P; Schott, G; Simonis, H J; Stober, F M; Troendle, D; Wagner-Kuhr, J; Zeise, M; Zhukov, V; Ziebarth, E B; Daskalakis, G; Geralis, T; Kyriakis, A; Loukas, D; Manolakos, I; Markou, A; Markou, C; Mavrommatis, C; Petrakou, E; Gouskos, L; Katsas, P; Panagiotou, A; Evangelou, I; Kokkas, P; Manthos, N; Papadopoulos, I; Patras, V; Triantis, F A; Aranyi, A; Bencze, G; Boldizsar, L; Debreczeni, G; Hajdu, C; Horvath, D; Kapusi, A; Krajczar, K; Laszlo, A; Sikler, F; Vesztergombi, G; Beni, N; Molnar, J; Palinkas, J; Szillasi, Z; Veszpremi, V; Raics, P; Trocsanyi, Z L; Ujvari, B; Bansal, S; Beri, S B; Bhatnagar, V; Jindal, M; Kaur, M; Kohli, J M; Mehta, M Z; Nishu, N; Saini, L K; Sharma, A; Sharma, R; Singh, A P; Singh, J B; Singh, S P; Ahuja, S; Bhattacharya, S; Chauhan, S; Choudhary, B C; Gupta, P; Jain, S; Jain, S; Kumar, A; Ranjan, K; Shivpuri, R K; Choudhury, R K; Dutta, D; Kailas, S; Kataria, S K; Mohanty, A K; Pant, L M; Shukla, P; Suggisetti, P; Aziz, T; Guchait, M; Gurtu, A; Maity, M; Majumder, D; Majumder, G; Mazumdar, K; Mohanty, G B; Saha, A; Sudhakar, K; Wickramage, N; Banerjee, S; Dugad, S; Mondal, N K; Arfaei, H; Bakhshiansohi, H; Fahim, A; Jafari, A; Mohammadi Najafabadi, M; Paktinat Mehdiabadi, S; Safarzadeh, B; Zeinali, M; Abbrescia, M; Barbone, L; Colaleo, A; Creanza, D; De Filippis, N; De Palma, M; Dimitrov, A; Fedele, F; Fiore, L; Iaselli, G; Lusito, L; Maggi, G; Maggi, M; Manna, N; Marangelli, B; My, S; Nuzzo, S; Pierro, G A; Pompili, A; Pugliese, G; Romano, F; Roselli, G; Selvaggi, G; Silvestris, L; Trentadue, R; Tupputi, S; Zito, G; Abbiendi, G; Benvenuti, A C; Bonacorsi, D; Braibant-Giacomelli, S; Capiluppi, P; Castro, A; Cavallo, F R; Codispoti, G; Cuffiani, M; Fanfani, A; Fasanella, D; Giacomelli, P; Giunta, M; Grandi, C; Marcellini, S; Masetti, G; Montanari, A; Navarria, F L; Odorici, F; Perrotta, A; Rossi, A M; Rovelli, T; Siroli, G; Travaglini, R; Albergo, S; Cappello, G; Chiorboli, M; Costa, S; Tricomi, A; Tuve, C; Barbagli, G; Broccolo, G; Ciulli, V; Civinini, C; D'Alessandro, R; Focardi, E; Frosali, S; Gallo, E; Genta, C; Lenzi, P; Meschini, M; Paoletti, S; Sguazzoni, G; Tropiano, A; Benussi, L; Bianco, S; Colafranceschi, S; Fabbri, F; Piccolo, D; Fabbricatore, P; Musenich, R; Benaglia, A; Cerati, G B; De Guio, F; Di Matteo, L; Ghezzi, A; Govoni, P; Malberti, M; Malvezzi, S; Martelli, A; Massironi, A; Menasce, D; Miccio, V; Moroni, L; Negri, P; Paganoni, M; Pedrini, D; Ragazzi, S; Redaelli, N; Sala, S; Salerno, R; Tabarelli de Fatis, T; Tancini, V; Taroni, S; Buontempo, S; Cimmino, A; De Cosa, A; De Gruttola, M; Fabozzi, F; Iorio, A O M; Lista, L; Noli, P; Paolucci, P; Azzi, P; Bacchetta, N; Bellan, P; Bisello, D; Carlin, R; Checchia, P; Conti, E; De Mattia, M; Dorigo, T; Dosselli, U; Gasparini, F; Gasparini, U; Giubilato, P; Gresele, A; Lacaprara, S; Lazzizzera, I; Margoni, M; Mazzucato, M; Meneguzzo, A T; Nespolo, M; Perrozzi, L; Pozzobon, N; Ronchese, P; Simonetto, F; Torassa, E; Tosi, M; Vanini, S; Zotto, P; Zumerle, G; Baesso, P; Berzano, U; Riccardi, C; Torre, P; Vitulo, P; Viviani, C; Biasini, M; Bilei, G M; Caponeri, B; Fanò, L; Lariccia, P; Lucaroni, A; Mantovani, G; Menichelli, M; Nappi, A; Santocchia, A; Servoli, L; Valdata, M; Volpe, R; Azzurri, P; Bagliesi, G; Bernardini, J; Boccali, T; Castaldi, R; Dagnolo, R T; Dell'orso, R; Fiori, F; Foà, L; Giassi, A; Kraan, A; Ligabue, F; Lomtadze, T; Martini, L; Messineo, A; Palla, F; Palmonari, F; Segneri, G; Serban, A T; Spagnolo, P; Tenchini, R; Tonelli, G; Venturi, A; Verdini, P G; Barone, L; Cavallari, F; Del Re, D; Di Marco, E; Diemoz, M; Franci, D; Grassi, M; Longo, E; Organtini, G; Palma, A; Pandolfi, F; Paramatti, R; Rahatlou, S; Amapane, N; Arcidiacono, R; Argiro, S; Arneodo, M; Biino, C; Botta, C; Cartiglia, N; Castello, R; Costa, M; Demaria, N; Graziano, A; Mariotti, C; Marone, M; Maselli, S; Migliore, E; Mila, G; Monaco, V; Musich, M; Obertino, M M; Pastrone, N; Pelliccioni, M; Romero, A; Ruspa, M; Sacchi, R; Solano, A; Staiano, A; Trocino, D; Vilela Pereira, A; Ambroglini, F; Belforte, S; Cossutti, F; Della Ricca, G; Gobbo, B; Montanino, D; Penzo, A; Chang, S; Chung, J; Kim, D H; Kim, G N; Kim, J E; Kong, D J; Park, H; Son, D C; Kim, Zero; Kim, J Y; Song, S; Hong, B; Kim, H; Kim, J H; Kim, T J; Lee, K S; Moon, D H; Park, S K; Rhee, H B; Sim, K S; Choi, M; Kang, S; Kim, H; Park, C; Park, I C; Park, S; Choi, S; Choi, Y; Choi, Y K; Goh, J; Lee, J; Lee, S; Seo, H; Yu, I; Janulis, M; Martisiute, D; Petrov, P; Sabonis, T; Castilla Valdez, H; De La Cruz Burelo, E; Lopez-Fernandez, R; Sánchez Hernández, A; Villaseñor-Cendejas, L M; Carrillo Moreno, S; Salazar Ibarguen, H A; Casimiro Linares, E; Morelos Pineda, A; Reyes-Santos, M A; Allfrey, P; Krofcheck, D; Tam, J; Butler, P H; Signal, T; Williams, J C; Ahmad, M; Ahmed, I; Asghar, M I; Hoorani, H R; Khan, W A; Khurshid, T; Qazi, S; Cwiok, M; Dominik, W; Doroba, K; Konecki, M; Krolikowski, J; Frueboes, T; Gokieli, R; Górski, M; Kazana, M; Nawrocki, K; Szleper, M; Wrochna, G; Zalewski, P; Almeida, N; David, A; Faccioli, P; Ferreira Parracho, P G; Gallinaro, M; Mini, G; Musella, P; Nayak, A; Raposo, L; Ribeiro, P Q; Seixas, J; Silva, P; Soares, D; Varela, J; Wöhri, H K; Altsybeev, I; Belotelov, I; Bunin, P; Finger, M; Finger, M; Golutvin, I; Kamenev, A; Karjavin, V; Kozlov, G; Lanev, A; Moisenz, P; Palichik, V; Perelygin, V; Shmatov, S; Smirnov, V; Volodko, A; Zarubin, A; Bondar, N; Golovtsov, V; Ivanov, Y; Kim, V; Levchenko, P; Smirnov, I; Sulimov, V; Uvarov, L; Vavilov, S; Vorobyev, A; Andreev, Yu; Gninenko, S; Golubev, N; Kirsanov, M; Krasnikov, N; Matveev, V; Pashenkov, A; Toropin, A; Troitsky, S; Epshteyn, V; Gavrilov, V; Ilina, N; Kaftanov, V; Kossov, M; Krokhotin, A; Kuleshov, S; Oulianov, A; Safronov, G; Semenov, S; Shreyber, I; Stolin, V; Vlasov, E; Zhokin, A; Boos, E; Dubinin, M; Dudko, L; Ershov, A; Gribushin, A; Kodolova, O; Lokhtin, I; Obraztsov, S; Petrushanko, S; Sarycheva, L; Savrin, V; Snigirev, A; Andreev, V; Dremin, I; Kirakosyan, M; Rusakov, S V; Vinogradov, A; Azhgirey, I; Bitioukov, S; Datsko, K; Grishin, V; Kachanov, V; Konstantinov, D; Krychkine, V; Petrov, V; Ryutin, R; Slabospitsky, S; Sobol, A; Sytine, A; Tourtchanovitch, L; Troshin, S; Tyurin, N; Uzunian, A; Volkov, A; Adzic, P; Djordjevic, M; Krpic, D; Maletic, D; Milosevic, J; Puzovic, J; Aguilar-Benitez, M; Alcaraz Maestre, J; Arce, P; Battilana, C; Calvo, E; Cepeda, M; Cerrada, M; Chamizo Llatas, M; Colino, N; De La Cruz, B; Diez Pardos, C; Fernandez Bedoya, C; Fernández Ramos, J P; Ferrando, A; Flix, J; Fouz, M C; Garcia-Abia, P; Gonzalez Lopez, O; Goy Lopez, S; Hernandez, J M; Josa, M I; Merino, G; Puerta Pelayo, J; Redondo, I; Romero, L; Santaolalla, J; Willmott, C; Albajar, C; de Trocóniz, J F; Cuevas, J; Fernandez Menendez, J; Gonzalez Caballero, I; Lloret Iglesias, L; Vizan Garcia, J M; Cabrillo, I J; Calderon, A; Chuang, S H; Diaz Merino, I; Diez Gonzalez, C; Duarte Campderros, J; Fernandez, M; Gomez, G; Gonzalez Sanchez, J; Gonzalez Suarez, R; Jorda, C; Lobelle Pardo, P; Lopez Virto, A; Marco, J; Marco, R; Martinez Rivero, C; Martinez Ruiz Del Arbol, P; Matorras, F; Rodrigo, T; Ruiz Jimeno, A; Scodellaro, L; Sobron Sanudo, M; Vila, I; Vilar Cortabitarte, R; Abbaneo, D; Auffray, E; Baillon, P; Ball, A H; Barney, D; Beaudette, F; Bellan, R; Benedetti, D; Bernet, C; Bialas, W; Bloch, P; Bocci, A; Bolognesi, S; Breuker, H; Brona, G; Bunkowski, K; Camporesi, T; Cano, E; Cattai, A; Cerminara, G; Christiansen, T; Coarasa Perez, J A; Covarelli, R; Curé, B; Dahms, T; De Roeck, A; Elliott-Peisert, A; Funk, W; Gaddi, A; Gennai, S; Gerwig, H; Gigi, D; Gill, K; Giordano, D; Glege, F; Gomez-Reino Garrido, R; Gowdy, S; Guiducci, L; Hansen, M; Hartl, C; Harvey, J; Hegner, B; Henderson, C; Hoffmann, H F; Honma, A; Innocente, V; Janot, P; Lecoq, P; Leonidopoulos, C; Lourenço, C; Macpherson, A; Mäki, T; Malgeri, L; Mannelli, M; Masetti, L; Mavromanolakis, G; Meijers, F; Mersi, S; Meschi, E; Moser, R; Mozer, M U; Mulders, M; Nesvold, E; Orsini, L; Perez, E; Petrilli, A; Pfeiffer, A; Pierini, M; Pimiä, M; Racz, A; Rolandi, G; Rovelli, C; Rovere, M; Sakulin, H; Schäfer, C; Schwick, C; Segoni, I; Sharma, A; Siegrist, P; Simon, M; Sphicas, P; Spiga, D; Spiropulu, M; Stöckli, F; Traczyk, P; Tropea, P; Tsirou, A; Veres, G I; Vichoudis, P; Voutilainen, M; Zeuner, W D; Bertl, W; Deiters, K; Erdmann, W; Gabathuler, K; Horisberger, R; Ingram, Q; Kaestli, H C; König, S; Kotlinski, D; Langenegger, U; Meier, F; Renker, D; Rohe, T; Sibille, J; Starodumov, A; Caminada, L; Chen, Z; Cittolin, S; Dissertori, G; Dittmar, M; Eugster, J; Freudenreich, K; Grab, C; Hervé, A; Hintz, W; Lecomte, P; Lustermann, W; Marchica, C; Meridiani, P; Milenovic, P; Moortgat, F; Nardulli, A; Nef, P; Nessi-Tedaldi, F; Pape, L; Pauss, F; Punz, T; Rizzi, A; Ronga, F J; Sala, L; Sanchez, A K; Sawley, M-C; Schinzel, D; Stieger, B; Tauscher, L; Thea, A; Theofilatos, K; Treille, D; Weber, M; Wehrli, L; Weng, J; Amsler, C; Chiochia, V; De Visscher, S; Ivova Rikova, M; Millan Mejias, B; Regenfus, C; Robmann, P; Rommerskirchen, T; Schmidt, A; Tsirigkas, D; Wilke, L; Chang, Y H; Chen, K H; Chen, W T; Go, A; Kuo, C M; Li, S W; Lin, W; Liu, M H; Lu, Y J; Wu, J H; Yu, S S; Bartalini, P; Chang, P; Chang, Y H; Chang, Y W; Chao, Y; Chen, K F; Hou, W-S; Hsiung, Y; Kao, K Y; Lei, Y J; Lin, S W; Lu, R-S; Shiu, J G; Tzeng, Y M; Ueno, K; Wang, C C; Wang, M; Wei, J T; Adiguzel, A; Ayhan, A; Bakirci, M N; Cerci, S; Demir, Z; Dozen, C; Dumanoglu, I; Eskut, E; Girgis, S; Gökbulut, G; Güler, Y; Gurpinar, E; Hos, I; Kangal, E E; Karaman, T; Kayis Topaksu, A; Nart, A; Onengüt, G; Ozdemir, K; Ozturk, S; Polatöz, A; Sahin, O; Sengul, O; Sogut, K; Tali, B; Topakli, H; Uzun, D; Vergili, L N; Vergili, M; Zorbilmez, C; Akin, I V; Aliev, T; Bilmis, S; Deniz, M; Gamsizkan, H; Guler, A M; Ocalan, K; Ozpineci, A; Serin, M; Sever, R; Surat, U E; Yildirim, E; Zeyrek, M; Deliomeroglu, M; Demir, D; Gülmez, E; Halu, A; Isildak, B; Kaya, M; Kaya, O; Ozbek, M; Ozkorucuklu, S; Sonmez, N; Levchuk, L; Bell, P; Bostock, F; Brooke, J J; Cheng, T L; Cussans, D; Frazier, R; Goldstein, J; Hansen, M; Heath, G P; Heath, H F; Hill, C; Huckvale, B; Jackson, J; Kreczko, L; Mackay, C K; Metson, S; Newbold, D M; Nirunpong, K; Smith, V J; Ward, S; Basso, L; Bell, K W; Belyaev, A; Brew, C; Brown, R M; Camanzi, B; Cockerill, D J A; Coughlan, J A; Harder, K; Harper, S; Kennedy, B W; Olaiya, E; Petyt, D; Radburn-Smith, B C; Shepherd-Themistocleous, C H; Tomalin, I R; Womersley, W J; Worm, S D; Bainbridge, R; Ball, G; Ballin, J; Beuselinck, R; Buchmuller, O; Colling, D; Cripps, N; Cutajar, M; Davies, G; Della Negra, M; Foudas, C; Fulcher, J; Futyan, D; Guneratne Bryer, A; Hall, G; Hatherell, Z; Hays, J; Iles, G; Karapostoli, G; Lyons, L; Magnan, A-M; Marrouche, J; Nandi, R; Nash, J; Nikitenko, A; Papageorgiou, A; Pesaresi, M; Petridis, K; Pioppi, M; Raymond, D M; Rompotis, N; Rose, A; Ryan, M J; Seez, C; Sharp, P; Sparrow, A; Stoye, M; Tapper, A; Tourneur, S; Vazquez Acosta, M; Virdee, T; Wakefield, S; Wardrope, D; Whyntie, T; Barrett, M; Chadwick, M; Cole, J E; Hobson, P R; Khan, A; Kyberd, P; Leslie, D; Reid, I D; Teodorescu, L; Bose, T; Clough, A; Heister, A; St John, J; Lawson, P; Lazic, D; Rohlf, J; Sulak, L; Andrea, J; Avetisyan, A; Bhattacharya, S; Chou, J P; Cutts, D; Esen, S; Heintz, U; Jabeen, S; Kukartsev, G; Landsberg, G; Narain, M; Nguyen, D; Speer, T; Tsang, K V; Borgia, M A; Breedon, R; Calderon De La Barca Sanchez, M; Cebra, D; Chertok, M; Conway, J; Cox, P T; Dolen, J; Erbacher, R; Friis, E; Ko, W; Kopecky, A; Lander, R; Liu, H; Maruyama, S; Miceli, T; Nikolic, M; Pellett, D; Robles, J; Schwarz, T; Searle, M; Smith, J; Squires, M; Tripathi, M; Vasquez Sierra, R; Veelken, C; Andreev, V; Arisaka, K; Cline, D; Cousins, R; Deisher, A; Erhan, S; Farrell, C; Felcini, M; Hauser, J; Ignatenko, M; Jarvis, C; Plager, C; Rakness, G; Schlein, P; Tucker, J; Valuev, V; Wallny, R; Babb, J; Clare, R; Ellison, J; Gary, J W; Hanson, G; Jeng, G Y; Kao, S C; Liu, F; Liu, H; Luthra, A; Nguyen, H; Pasztor, G; Satpathy, A; Shen, B C; Stringer, R; Sturdy, J; Sumowidagdo, S; Wilken, R; Wimpenny, S; Andrews, W; Branson, J G; Dusinberre, E; Evans, D; Golf, F; Holzner, A; Kelley, R; Lebourgeois, M; Letts, J; Mangano, B; Muelmenstaedt, J; Padhi, S; Palmer, C; Petrucciani, G; Pi, H; Pieri, M; Ranieri, R; Sani, M; Sharma, V; Simon, S; Tu, Y; Vartak, A; Würthwein, F; Yagil, A; Barge, D; Blume, M; Campagnari, C; D'Alfonso, M; Danielson, T; Garberson, J; Incandela, J; Justus, C; Kalavase, P; Koay, S A; Kovalskyi, D; Krutelyov, V; Lamb, J; Lowette, S; Pavlunin, V; Rebassoo, F; Ribnik, J; Richman, J; Rossin, R; Stuart, D; To, W; Vlimant, J R; Witherell, M; Bornheim, A; Bunn, J; Gataullin, M; Kcira, D; Litvine, V; Ma, Y; Newman, H B; Rogan, C; Shin, K; Timciuc, V; Veverka, J; Wilkinson, R; Yang, Y; Zhu, R Y; Akgun, B; Carroll, R; Ferguson, T; Jang, D W; Jun, S Y; Paulini, M; Russ, J; Terentyev, N; Vogel, H; Vorobiev, I; Cumalat, J P; Dinardo, M E; Drell, B R; Ford, W T; Heyburn, B; Luiggi Lopez, E; Nauenberg, U; Smith, J G; Stenson, K; Ulmer, K A; Wagner, S R; Zang, S L; Agostino, L; Alexander, J; Blekman, F; Chatterjee, A; Das, S; Eggert, N; Fields, L J; Gibbons, L K; Heltsley, B; Hopkins, W; Khukhunaishvili, A; Kreis, B; Kuznetsov, V; Nicolas Kaufman, G; Patterson, J R; Puigh, D; Riley, D; Ryd, A; Shi, X; Sun, W; Teo, W D; Thom, J; Thompson, J; Vaughan, J; Weng, Y; Wittich, P; Biselli, A; Cirino, G; Winn, D; Abdullin, S; Albrow, M; Anderson, J; Apollinari, G; Atac, M; Bakken, J A; Banerjee, S; Bauerdick, L A T; Beretvas, A; Berryhill, J; Bhat, P C; Bloch, I; Borcherding, F; Burkett, K; Butler, J N; Chetluru, V; Cheung, H W K; Chlebana, F; Cihangir, S; Demarteau, M; Eartly, D P; Elvira, V D; Fisk, I; Freeman, J; Gao, Y; Gottschalk, E; Green, D; Gutsche, O; Hahn, A; Hanlon, J; Harris, R M; James, E; Jensen, H; Johnson, M; Joshi, U; Khatiwada, R; Kilminster, B; Klima, B; Kousouris, K; Kunori, S; Kwan, S; Limon, P; Lipton, R; Lykken, J; Maeshima, K; Marraffino, J M; Mason, D; McBride, P; McCauley, T; Miao, T; Mishra, K; Mrenna, S; Musienko, Y; Newman-Holmes, C; O'Dell, V; Popescu, S; Pordes, R; Prokofyev, O; Saoulidou, N; Sexton-Kennedy, E; Sharma, S; Smith, R P; Soha, A; Spalding, W J; Spiegel, L; Tan, P; Taylor, L; Tkaczyk, S; Uplegger, L; Vaandering, E W; Vidal, R; Whitmore, J; Wu, W; Yumiceva, F; Yun, J C; Acosta, D; Avery, P; Bourilkov, D; Chen, M; Di Giovanni, G P; Dobur, D; Drozdetskiy, A; Field, R D; Fu, Y; Furic, I K; Gartner, J; Kim, B; Klimenko, S; Konigsberg, J; Korytov, A; Kotov, K; Kropivnitskaya, A; Kypreos, T; Matchev, K; Mitselmakher, G; Pakhotin, Y; Piedra Gomez, J; Prescott, C; Remington, R; Schmitt, M; Scurlock, B; Sellers, P; Wang, D; Yelton, J; Zakaria, M; Ceron, C; Gaultney, V; Kramer, L; Lebolo, L M; Linn, S; Markowitz, P; Martinez, G; Mesa, D; Rodriguez, J L; Adams, T; Askew, A; Chen, J; Diamond, B; Gleyzer, S V; Haas, J; Hagopian, S; Hagopian, V; Jenkins, M; Johnson, K F; Prosper, H; Sekmen, S; Veeraraghavan, V; Baarmand, M M; Guragain, S; Hohlmann, M; Kalakhety, H; Mermerkaya, H; Ralich, R; Vodopiyanov, I; Adams, M R; Anghel, I M; Apanasevich, L; Bazterra, V E; Betts, R R; Callner, J; Cavanaugh, R; Dragoiu, C; Garcia-Solis, E J; Gerber, C E; Hofman, D J; Khalatian, S; Lacroix, F; Shabalina, E; Smoron, A; Strom, D; Varelas, N; Akgun, U; Albayrak, E A; Bilki, B; Cankocak, K; Clarida, W; Duru, F; Lae, C K; McCliment, E; Merlo, J-P; Mestvirishvili, A; Moeller, A; Nachtman, J; Newsom, C R; Norbeck, E; Olson, J; Onel, Y; Ozok, F; Sen, S; Wetzel, J; Yetkin, T; Yi, K; Barnett, B A; Blumenfeld, B; Bonato, A; Eskew, C; Fehling, D; Giurgiu, G; Gritsan, A V; Guo, Z J; Hu, G; Maksimovic, P; Rappoccio, S; Swartz, M; Tran, N V; Whitbeck, A; Baringer, P; Bean, A; Benelli, G; Grachov, O; Murray, M; Radicci, V; Sanders, S; Wood, J S; Zhukova, V; Bandurin, D; Bolton, T; Chakaberia, I; Ivanov, A; Kaadze, K; Maravin, Y; Shrestha, S; Svintradze, I; Wan, Z; Gronberg, J; Lange, D; Wright, D; Baden, D; Boutemeur, M; Eno, S C; Ferencek, D; Hadley, N J; Kellogg, R G; Kirn, M; Mignerey, A; Rossato, K; Rumerio, P; Santanastasio, F; Skuja, A; Temple, J; Tonjes, M B; Tonwar, S C; Twedt, E; Alver, B; Bauer, G; Bendavid, J; Busza, W; Butz, E; Cali, I A; Chan, M; D'Enterria, D; Everaerts, P; Gomez Ceballos, G; Goncharov, M; Hahn, K A; Harris, P; Kim, Y; Klute, M; Lee, Y-J; Li, W; Loizides, C; Luckey, P D; Ma, T; Nahn, S; Paus, C; Roland, C; Roland, G; Rudolph, M; Stephans, G S F; Sumorok, K; Sung, K; Wenger, E A; Wyslouch, B; Xie, S; Yilmaz, Y; Yoon, A S; Zanetti, M; Cole, P; Cooper, S I; Cushman, P; Dahmes, B; De Benedetti, A; Dudero, P R; Franzoni, G; Haupt, J; Klapoetke, K; Kubota, Y; Mans, J; Rekovic, V; Rusack, R; Sasseville, M; Singovsky, A; Cremaldi, L M; Godang, R; Kroeger, R; Perera, L; Rahmat, R; Sanders, D A; Sonnek, P; Summers, D; Bloom, K; Bose, S; Butt, J; Claes, D R; Dominguez, A; Eads, M; Keller, J; Kelly, T; Kravchenko, I; Lazo-Flores, J; Lundstedt, C; Malbouisson, H; Malik, S; Snow, G R; Baur, U; Iashvili, I; Kharchilava, A; Kumar, A; Smith, K; Strang, M; Zennamo, J; Alverson, G; Barberis, E; Baumgartel, D; Boeriu, O; Reucroft, S; Swain, J; Wood, D; Zhang, J; Anastassov, A; Kubik, A; Ofierzynski, R A; Pozdnyakov, A; Schmitt, M; Stoynev, S; Velasco, M; Won, S; Antonelli, L; Berry, D; Hildreth, M; Jessop, C; Karmgard, D J; Kolb, J; Kolberg, T; Lannon, K; Lynch, S; Marinelli, N; Morse, D M; Ruchti, R; Slaunwhite, J; Valls, N; Warchol, J; Wayne, M; Ziegler, J; Bylsma, B; Durkin, L S; Gu, J; Killewald, P; Ling, T Y; Williams, G; Adam, N; Berry, E; Elmer, P; Gerbaudo, D; Halyo, V; Hunt, A; Jones, J; Laird, E; Lopes Pegna, D; Marlow, D; Medvedeva, T; Mooney, M; Olsen, J; Piroué, P; Stickland, D; Tully, C; Werner, J S; Zuranski, A; Acosta, J G; Huang, X T; Lopez, A; Mendez, H; Oliveros, S; Ramirez Vargas, J E; Zatzerklyaniy, A; Alagoz, E; Barnes, V E; Bolla, G; Borrello, L; Bortoletto, D; Everett, A; Garfinkel, A F; Gecse, Z; Gutay, L; Jones, M; Koybasi, O; Laasanen, A T; Leonardo, N; Liu, C; Maroussov, V; Merkel, P; Miller, D H; Neumeister, N; Potamianos, K; Shipsey, I; Silvers, D; Yoo, H D; Zablocki, J; Zheng, Y; Jindal, P; Parashar, N; Cuplov, V; Ecklund, K M; Geurts, F J M; Liu, J H; Morales, J; Padley, B P; Redjimi, R; Roberts, J; Betchart, B; Bodek, A; Chung, Y S; de Barbaro, P; Demina, R; Flacher, H; Garcia-Bellido, A; Gotra, Y; Han, J; Harel, A; Miner, D C; Orbaker, D; Petrillo, G; Vishnevskiy, D; Zielinski, M; Bhatti, A; Demortier, L; Goulianos, K; Hatakeyama, K; Lungu, G; Mesropian, C; Yan, M; Atramentov, O; Gershtein, Y; Gray, R; Halkiadakis, E; Hidas, D; Hits, D; Lath, A; Rose, K; Schnetzer, S; Somalwar, S; Stone, R; Thomas, S; Cerizza, G; Hollingsworth, M; Spanier, S; Yang, Z C; York, A; Asaadi, J; Eusebi, R; Gilmore, J; Gurrola, A; Kamon, T; Khotilovich, V; Montalvo, R; Nguyen, C N; Pivarski, J; Safonov, A; Sengupta, S; Toback, D; Weinberger, M; Akchurin, N; Bardak, C; Damgov, J; Jeong, C; Kovitanggoon, K; Lee, S W; Mane, P; Roh, Y; Sill, A; Volobouev, I; Wigmans, R; Yazgan, E; Appelt, E; Brownson, E; Engh, D; Florez, C; Gabella, W; Johns, W; Kurt, P; Maguire, C; Melo, A; Sheldon, P; Velkovska, J; Arenton, M W; Balazs, M; Buehler, M; Conetti, S; Cox, B; Hirosky, R; Ledovskoy, A; Neu, C; Yohay, R; Gollapinni, S; Gunthoti, K; Harr, R; Karchin, P E; Mattson, M; Milstène, C; Sakharov, A; Anderson, M; Bachtis, M; Bellinger, J N; Carlsmith, D; Dasu, S; Dutta, S; Efron, J; Gray, L; Grogg, K S; Grothe, M; Herndon, M; Klabbers, P; Klukas, J; Lanaro, A; Lazaridis, C; Leonard, J; Lomidze, D; Loveless, R; Mohapatra, A; Polese, G; Reeder, D; Savin, A; Smith, W H; Swanson, J; Weinberg, M
2010-07-16
Bose-Einstein correlations have been measured using samples of proton-proton collisions at 0.9 and 2.36 TeV center-of-mass energies, recorded by the CMS experiment at the CERN Large Hadron Collider. The signal is observed in the form of an enhancement of pairs of same-sign charged particles with small relative four-momentum. The size of the correlated particle emission region is seen to increase significantly with the particle multiplicity of the event.
Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hoch, Michael; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Kiesenhofer, Wolfgang; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; Ceard, Ludivine; De Wolf, Eddi A.; Hashemi, Majid; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; Blyweert, Stijn; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Maes, Michael; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Villella, Ilaria; Chabert, Eric Christian; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Marage, Pierre Edouard; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Costantini, Silvia; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Grégoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Militaru, Otilia; Ovyn, Severine; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Alves, Gilvan; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Carvalho, Wagner; Melo Da Costa, Eliza; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Oguri, Vitor; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Ferreira Dias, Marco Andre; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Stoykova, Stefka; Sultanov, Georgi; Trayanov, Rumen; Vankov, Ivan; Dyulendarova, Milena; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Marinova, Evelina; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Wang, Jian; Wang, Xianyou; Wang, Zheng; Yang, Min; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Hu, Zhen; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Gomez Moreno, Bernardo; Ocampo Rios, Alberto Andres; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Nicolaou, Charalambos; Papadakis, Antonakis; Ptochos, Fotios; Razis, Panos A.; Rykaczewski, Hans; Tsiakkouri, Demetra; Zinonos, Zinonas; Mahmoud, Mohammed; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Müntel, Mait; Raidal, Martti; Rebane, Liis; Azzolini, Virginia; Eerola, Paula; Czellar, Sandor; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Descamps, Julien; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, François-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, André; Rousseau, Delphine; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Elgammal, Sherif; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Kalinowski, Artur; Miné, Philippe; Paganini, Pascal; Sabes, David; Sirois, Yves; Thiebaux, Christophe; Zabi, Alexandre; Agram, Jean-Laurent; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Karim, Mehdi; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Speck, Joaquim; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Baty, Clement; Beaupere, Nicolas; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Actis, Oxana; Ata, Metin; Bender, Walter; Biallass, Philipp; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Kirsch, Matthias; Klimkovich, Tatsiana; Kreuzer, Peter; Lanske, Dankfried; Magass, Carsten; Merschmeyer, Markus; Meyer, Arnd; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Sowa, Michael; Steggemann, Jan; Teyssier, Daniel; Zeidler, Clemens; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flügge, Günter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Borras, Kerstin; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Olzem, Jan; Parenti, Andrea; Raspereza, Alexei; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Tomaszewska, Justyna; Volyanskyy, Dmytro; Wissing, Christoph; Autermann, Christian; Draeger, Jula; Eckstein, Doris; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schröder, Matthias; Schum, Torben; Schwandt, Joern; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Buege, Volker; Cakir, Altan; Chwalek, Thorsten; Daeuwel, Daniel; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Renz, Manuel; Sabellek, Andreas; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Gouskos, Loukas; Katsas, Panagiotis; Panagiotou, Apostolos; Evangelou, Ioannis; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Sharma, Richa; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Chauhan, Sushil; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Shilpi; Jain, Sandhya; Kumar, Ashok; Ranjan, Kirti; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Fahim, Ali; Jafari, Abideh; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pierro, Giuseppe Antonio; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Trentadue, Raffaello; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Broccolo, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Di Matteo, Leonardo; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Miccio, Vincenzo; Moroni, Luigi; Negri, Pietro; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Salerno, Roberto; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Taroni, Silvia; Buontempo, Salvatore; Cimmino, Anna; De Cosa, Annapaola; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Bisello, Dario; Carlin, Roberto; Checchia, Paolo; Conti, Enrico; De Mattia, Marco; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Giubilato, Piero; Gresele, Ambra; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Mazzucato, Mirco; Meneguzzo, Anna Teresa; Nespolo, Massimo; Perrozzi, Luca; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zumerle, Gianni; Baesso, Paolo; Berzano, Umberto; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Valdata, Marisa; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Castaldi, Rino; Tito DAgnolo, Raffaele; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Montanino, Damiana; Penzo, Aldo; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kim, Ji Eun; Kong, Dae Jung; Park, Hyangkyu; Son, Dong-Chul; Kim, Jaeho; Kim, Jae Yool; Song, Sanghyeon; Hong, Byung-Sik; Kim, Hyunchul; Kim, Ji Hyun; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Sim, Kwang Souk; Choi, Minkyoo; Kang, Seokon; Kim, Hyunyong; Park, Chawon; Park, Inkyu; Park, Sangnam; Choi, Suyong; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; De La Cruz Burelo, Eduard; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Villaseñor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A.; Allfrey, Philip; Krofcheck, David; Tam, Jason; Butler, Philip H.; Signal, Tony; Williams, Jennifer C.; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Mini, Giuliano; Musella, Pasquale; Nayak, Aruna; Raposo, Luis; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Soares, David; Varela, Joao; Wöhri, Hermine Katharina; Altsybeev, Igor; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger Jr., Michael; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Bondar, Nikolai; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Ilina, Natalia; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Kuleshov, Sergey; Oulianov, Alexei; Safronov, Grigory; Semenov, Sergey; Shreyber, Irina; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Datsko, Kirill; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Sytine, Alexandre; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Krpic, Dragomir; Maletic, Dimitrije; Milosevic, Jovan; Puzovic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Diaz Merino, Irma; Diez Gonzalez, Carlos; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Lobelle Pardo, Patricia; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Rodrigo, Teresa; Ruiz Jimeno, Alberto; Scodellaro, Luca; Sobron Sanudo, Mar; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Beaudette, Florian; Bellan, Riccardo; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bocci, Andrea; Bolognesi, Sara; Breuker, Horst; Brona, Grzegorz; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cattai, Ariella; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Curé, Benoît; Dahms, Torsten; De Roeck, Albert; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gennai, Simone; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gomez-Reino Garrido, Robert; Gowdy, Stephen; Guiducci, Luigi; Hansen, Magnus; Hartl, Christian; Harvey, John; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Innocente, Vincenzo; Janot, Patrick; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Mavromanolakis, Georgios; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Nesvold, Erik; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Racz, Attila; Rolandi, Gigi; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stöckli, Fabian; Traczyk, Piotr; Tropea, Paola; Tsirou, Andromachi; Veres, Gabor Istvan; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Caminada, Lea; Chen, Zhiling; Cittolin, Sergio; Dissertori, Günther; Dittmar, Michael; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hervé, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Meridiani, Paolo; Milenovic, Predrag; Moortgat, Filip; Nardulli, Alessandro; Nef, Pascal; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann - Karin; Sawley, Marie-Christine; Schinzel, Dietrich; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Ivova Rikova, Mirena; Millan Mejias, Barbara; Regenfus, Christian; Robmann, Peter; Rommerskirchen, Tanja; Schmidt, Alexander; Tsirigkas, Dimitrios; Wilke, Lotte; Chang, Yuan-Hann; Chen, Kuan-Hsin; Chen, Wan-Ting; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Lu, Yun-Ju; Wu, Jing-Han; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lin, Sheng-Wen; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Ueno, Koji; Wang, Chin-chi; Wang, Minzu; Wei, Jui-Te; Adiguzel, Aytul; Ayhan, Aydin; Bakirci, Mustafa Numan; Cerci, Salim; Demir, Zahide; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gökbulut, Gül; Güler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Kayis Topaksu, Aysel; Nart, Alisah; Önengüt, Gülsen; Ozdemir, Kadri; Ozturk, Sertac; Polatöz, Ayse; Sahin, Ozge; Sengul, Ozden; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yildirim, Eda; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gülmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Özbek, Melih; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Cussans, David; Frazier, Robert; Goldstein, Joel; Hansen, Maria; Heath, Greg P.; Heath, Helen F.; Hill, Christopher; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Mackay, Catherine Kirsty; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Belyaev, Alexander; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Davies, Gavin; Della Negra, Michel; Foudas, Costas; Fulcher, Jonathan; Futyan, David; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Stoye, Markus; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Reid, Ivan; Teodorescu, Liliana; Bose, Tulika; Clough, Andrew; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sulak, Lawrence; Andrea, Jeremy; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Speer, Thomas; Tsang, Ka Vang; Borgia, Maria Assunta; Breedon, Richard; Calderon De La Barca Sanchez, Manuel; Cebra, Daniel; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Schwarz, Thomas; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Deisher, Amanda; Erhan, Samim; Farrell, Chris; Felcini, Marta; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Wallny, Rainer; Babb, John; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Pasztor, Gabriella; Satpathy, Asish; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tu, Yanjun; Vartak, Adish; Würthwein, Frank; Yagil, Avraham; Barge, Derek; Blume, Michael; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Garberson, Jeffrey; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lamb, James; Lowette, Steven; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Witherell, Michael; Bornheim, Adolf; Bunn, Julian; Gataullin, Marat; Kcira, Dorian; Litvine, Vladimir; Ma, Yousi; Newman, Harvey B.; Rogan, Christopher; Shin, Kyoungha; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Jang, Dong Wook; Jun, Soon Yung; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Blekman, Freya; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Fields, Laura Johanna; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Kuznetsov, Valentin; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Puigh, Darren; Riley, Daniel; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Vaughan, Jennifer; Weng, Yao; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Green, Dan; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Khatiwada, Rakshya; Kilminster, Benjamin; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Pordes, Ruth; Prokofyev, Oleg; Saoulidou, Niki; Sexton-Kennedy, Elizabeth; Sharma, Seema; Smith, Richard P.; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Pakhotin, Yuriy; Piedra Gomez, Jonatan; Prescott, Craig; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Sellers, Paul; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Mesa, Dalgis; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Veeraraghavan, Venkatesh; Baarmand, Marc M.; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Mermerkaya, Hamit; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatian, Samvel; Lacroix, Florent; Shabalina, Elizaveta; Smoron, Agata; Strom, Derek; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bandurin, Dmitry; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Mignerey, Alice; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; D'Enterria, David; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Wyslouch, Bolek; Xie, Si; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Sonnek, Peter; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Strang, Michael; Zennamo, Joseph; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Reucroft, Steve; Swain, John; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Ofierzynski, Radoslaw Adrian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Killewald, Phillip; Ling, Ta-Yung; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatzerklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, Karolos; Shipsey, Ian; Silvers, David; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Flacher, Henning; Garcia-Bellido, Aran; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Hatakeyama, Kenichi; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hits, Dmitry; Lath, Amitabh; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Toback, David; Weinberger, Michael; Akchurin, Nural; Bardak, Cemile; Damgov, Jordan; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Mane, Poonam; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Appelt, Eric; Brownson, Eric; Engh, Daniel; Florez, Carlos; Gabella, William; Johns, Willard; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sheldon, Paul; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Gunthoti, Kranti; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Milstène, Caroline; Sakharov, Alexandre; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Dutta, Suchandra; Efron, Jonathan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Herndon, Matthew; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Polese, Giovanni; Reeder, Don; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc
2010-01-01
Bose-Einstein correlations have been measured using samples of proton-proton collisions at 0.9 and 2.36 TeV center-of-mass energies, recorded by the CMS experiment at the CERN Large Hadron Collider. The signal is observed in the form of an enhancement of pairs of same-sign charged particles with small relative four-momentum. The size of the correlated particle emission region is seen to increase significantly with the particle multiplicity of the event.
DEFF Research Database (Denmark)
Qiao, Jixin; Hou, Xiaolin; Steier, Peter
2015-01-01
An automated analytical method implemented in a flow injection (FI) system was developed for rapid determination of 236U in 10 L seawater samples. 238U was used as a chemical yield tracer for the whole procedure, in which extraction chromatography (UTEVA) was exploited to purify uranium, after...... experimental parameters affecting the analytical effectiveness were investigated and optimized in order to achieve high chemical yields and simple and rapid analysis as well as low procedure background. Besides, the operational conditions for the target preparation prior to the AMS measurement were optimized......, on the basis of studying the coprecipitation behavior of uranium with iron hydroxide. The analytical results indicate that the developed method is simple and robust, providing satisfactory chemical yields (80−100%) and high analysis speed (4 h/sample), which could be an appealing alternative to conventional...
Energy Technology Data Exchange (ETDEWEB)
Geraldo, Bianca
2012-07-01
Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)
Mironov, Vladislav P; Matusevich, Janna L; Kudrjashov, Vladimir P; Boulyga, Sergei F; Becker, J Sabine
2002-12-01
This work presents experimental results on the distribution of irradiated reactor uranium from fallout after the accident at Chernobyl Nuclear Power Plant (NPP) in comparison to natural uranium distribution in different soil types. Oxidation processes and vertical migration of irradiated uranium in soils typical of the 30 km relocation area around Chernobyl NPP were studied using 236U as the tracer for irradiated reactor uranium and inductively coupled plasma mass spectrometry as the analytical method for uranium isotope ratio measurements. Measurements of natural uranium yielded significant variations of its concentration in upper soil layers from 2 x 10(-7) g g(-1) to 3.4 x 10(-6) g g(-1). Concentrations of irradiated uranium in the upper 0-10 cm soil layers at the investigated sampling sites varied from 5 x 10(-12) g g(-1) to 2 x 10(-6) g g(-1) depending on the distance from Chernobyl NPP. In the majority of investigated soil profiles 78% to 97% of irradiated "Chernobyl" uranium is still contained in the upper 0-10 cm soil layers. The physical and chemical characteristics of the soil do not have any significant influence on processes of fuel particle destruction. Results obtained using carbonate leaching of 236U confirmed that more than 60% of irradiated "Chernobyl" uranium is still in a tetravalent form, ie. it is included in the fuel matrix (non-oxidized fuel UO2). The average value of the destruction rate of fuel particles determined for the Western radioactive trace (k = 0.030 +/- 0.005 yr(-1)) and for the Northern radioactive trace (k = 0.035 + 0.009 yr(-1)) coincide within experimental errors. Use of leaching of fission products in comparison to leaching of uranium for study of the destruction rate of fuel particles yielded poor coincidence due to the fact that use of fission products does not take into account differences in the chemical properties of fission products and fuel matrix (uranium).
International Nuclear Information System (INIS)
Desideri, D.; Meli, M.A.; Roselli, C.; Testa, C.; Boulyga, S.F.; Becker, J.S.
2002-01-01
It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products ( 236 U, 239 Pu, 240 Pu, 241 Am, and 237 Np) in the ammunition. In this work the analysis of actinides by α-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. 242 Pu and 243 Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri-n-octylamine (TNOA), with a decontamination factor higher than 10 6 ; after elution plutonium was determined by ICP-MS ( 239 Pu and 240 Pu) and α-spectrometry ( 239+240 Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10 -12 g g -1 and 2 x 10 -11 g g -1 . The 240 Pu/ 239 Pu isotope ratio in one penetrator sample (0.12±0.04) was significantly lower than the 240 Pu/ 239 Pu ratios found in two soil samples from Kosovo (0.35±0.10 and 0.27±0.07). 241 Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 10 7 . The concentration of 241 Am in the penetrator samples was 2.7 x 10 -14 g g -1 and -15 g g -1 . In addition 237 Np was detected at ultratrace levels. In general, ICP-MS and α-spectrometry results were in good agreement.The presence of anthropogenic radionuclides ( 236 U, 239 Pu, 240 Pu, 241 Am, and 237 Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of radionuclides are very low, their radiotoxicological effect is negligible. (orig.)
Desideri, D; Meli, M A; Roselli, C; Testa, C; Boulyga, S F; Becker, J S
2002-11-01
It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products ((236)U, (239)Pu, (240)Pu, (241)Am, and (237)Np) in the ammunition. In this work the analysis of actinides by alpha-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. (242)Pu and (243)Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri- n-octylamine (TNOA), with a decontamination factor higher than 10(6); after elution plutonium was determined by ICP-MS ((239)Pu and (240)Pu) and alpha-spectrometry ((239+240)Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10(-12) g g(-1) and 2 x 10(-11) g g(-1). The (240)Pu/(239)Pu isotope ratio in one penetrator sample (0.12+/-0.04) was significantly lower than the (240)Pu/(239)Pu ratios found in two soil samples from Kosovo (0.35+/-0.10 and 0.27+/-0.07). (241)Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 10(7). The concentration of (241)Am in the penetrator samples was 2.7 x 10(-14) g g(-1) and <9.4 x 10(-15) g g(-1). In addition (237)Np was detected at ultratrace levels. In general, ICP-MS and alpha-spectrometry results were in good agreement. The presence of anthropogenic radionuclides ((236)U, (239)Pu,(240)Pu, (241)Am, and (237)Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of radionuclides are very low, their radiotoxicological effect is negligible.
Vollmer, Martin K.; Miller, Benjamin R.; Rigby, Matthew; Reimann, Stefan; Mühle, Jens; Krummel, Paul B.; O'Doherty, Simon; Kim, Jooil; Rhee, Tae Siek; Weiss, Ray F.; Fraser, Paul J.; Simmonds, Peter G.; Salameh, Peter K.; Harth, Christina M.; Wang, Ray H. J.; Steele, L. Paul; Young, Dickon; Lunder, Chris R.; Hermansen, Ove; Ivy, Diane; Arnold, Tim; Schmidbauer, Norbert; Kim, Kyung-Ryul; Greally, Brian R.; Hill, Matthias; Leist, Michael; Wenger, Angelina; Prinn, Ronald G.
2011-04-01
We report on ground-based atmospheric measurements and emission estimates of the four anthropogenic hydrofluorocarbons (HFCs) HFC-365mfc (CH3CF2CH2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). In situ measurements are from the global monitoring sites of the Advanced Global Atmospheric Gases Experiment (AGAGE), the System for Observations of Halogenated Greenhouse Gases in Europe (SOGE), and Gosan (South Korea). We include the first halocarbon flask sample measurements from the Antarctic research stations King Sejong and Troll. We also present measurements of archived air samples from both hemispheres back to the 1970s. We use a two-dimensional atmospheric transport model to simulate global atmospheric abundances and to estimate global emissions. HFC-365mfc and HFC-245fa first appeared in the atmosphere only ˜1 decade ago; they have grown rapidly to globally averaged dry air mole fractions of 0.53 ppt (in parts per trillion, 10-12) and 1.1 ppt, respectively, by the end of 2010. In contrast, HFC-227ea first appeared in the global atmosphere in the 1980s and has since grown to ˜0.58 ppt. We report the first measurements of HFC-236fa in the atmosphere. This long-lived compound was present in the atmosphere at only 0.074 ppt in 2010. All four substances exhibit yearly growth rates of >8% yr-1 at the end of 2010. We find rapidly increasing emissions for the foam-blowing compounds HFC-365mfc and HFC-245fa starting in ˜2002. After peaking in 2006 (HFC-365mfc: 3.2 kt yr-1, HFC-245fa: 6.5 kt yr-1), emissions began to decline. Our results for these two compounds suggest that recent estimates from long-term projections (to the late 21st century) have strongly overestimated emissions for the early years of the projections (˜2005-2010). Global HFC-227ea and HFC-236fa emissions have grown to average values of 2.4 kt yr-1
International Nuclear Information System (INIS)
Sowinski, M.
1975-05-01
The energy distributions and relative intensities of protons, deuterons, tritons and alpha-particles emitted along the fission axis during thermal neutron fission of 236 U are measured simultaneously with the energies of the two fission fragments. The mass distributions of the fragments, the total kinetic energy (TKE), the dependence of the mean TKE on the fragment mass, as well as the mean kinetic energy dependence of polar particles on the fragment mass and energy are deduced from these data. Although some experimental results agree remarkably well with the hypothesis that polar particles are evaporated in-flight from fission fragments, the general conclusion is that these particles are emitted according to some other mechanism
Results of Am isotopic ratio analysis in irradiated MOX fuels
Energy Technology Data Exchange (ETDEWEB)
Koyama, Shin-ichi; Osaka, Masahiko; Mitsugashira, Toshiaki; Konno, Koichi [Power Reactor and Nuclear Fuel Development Corp., Oarai, Ibaraki (Japan). Oarai Engineering Center; Kajitani, Mikio
1997-04-01
For analysis of a small quantity of americium, it is necessary to separate from curium which has similar chemical property. As a chemical separation method for americium and curium, the oxidation of americium with pentavalent bismuth and subsequent co-precipitation of trivalent curium with BIP O{sub 4} were applied to analyze americium in irradiated MOX fuels which contained about 30wt% plutonium and 0.9wt% {sup 241}Am before irradiation and were irradiated up to 26.2GWd/t in the experimental fast reactor Joyo. The purpose of this study is to measure isotopic ratio of americium and to evaluate the change of isotopic ratio with irradiation. Following results are obtained in this study. (1) The isotopic ratio of americium ({sup 241}Am, {sup 242m}Am and {sup 243}Am) can be analyzed in the MOX fuels by isolating americium. The isotopic ratio of {sup 242m}Am and {sup 243}Am increases up to 0.62at% and 0.82at% at maximum burnup, respectively, (2) The results of isotopic analysis indicates that the contents of {sup 241}Am decreases, whereas {sup 242m}Am, {sup 243}Am increase linearly with increasing burnup. (author)
Alpha self irradiation effects in nuclear borosilicate glass
International Nuclear Information System (INIS)
Peuget, S.; Roudil, D.; Deschanels, X.; Jegou, C.; Broudic, V.; Bart, J.M.
2004-01-01
The properties of actinide glasses are studied in the context of high-level waste management programs. Reprocessing high burnup fuels in particular will increase the minor actinide content in the glass package, resulting in higher cumulative alpha decay doses in the glass, and raising the question of the glass matrix behavior and especially its containment properties. The effect of alpha self-irradiation on the glass behavior is evaluated by doping the glass with a short-lived actinide ( 244 Cm) to reach in several years the alpha dose received by the future glass packages over several thousand years. 'R7T7' borosilicate glasses were doped with 3 different curium contents (0.04, 0.4 and 1.2 wt% 244 CmO 2 ). The density and mechanical properties of the curium-doped glasses were characterized up to 2. 10 18 α/g, revealing only a slight evolution of the macroscopic behavior of R7T7 glass in this range. The leaching behavior of curium-doped glass was also studied by Soxhlet tests. The results do not show any significant evolution of the initial alteration rate with the alpha dose. (authors)
International Nuclear Information System (INIS)
Ageyev, V.A.; Sajeniouk, A.D.
2005-01-01
Routine analytical procedures have been developed for the reliable simultaneous determination of 90 Sr, 238 Pu, 239+240 Pu, 241 Am and 242-244 Cm, Chernobyl derived radioisotopes and fallout after nuclear weapon tests in a wide range of environmental samples: soil (100-200 g), sediments, aerosols, water and vegetation. This procedure has been applied to thousands of soil and sediment samples and hundreds of biological and water samples taken in the exclusive zone of Chernobyl NPP and different regions of Ukraine from 1989 to the present. After the sample has been properly prepared and isotopic tracers added, plutonium, americium and curium are precipitated with calcium oxalate and then lanthanum fluoride. Plutonium is separated from americium and curium by anion-exchange. Americium and curium are separated from rare earths by cation-exchange with gradient elute α-hydroxy-iso-butyric acid. During projects by AQCS IAEA 'Evaluation of Methods for 90 Sr in a Mineral Matrix' and 'Proficiency Test for 239 Pu, 241 Pu and 241 Am Measurement in a Mineral Matrix' accuracy and precision for 90 Sr, 239 Pu and 241 Am by present procedure was evaluated. Advantages, difficulties and limitations of the method are discussed. (author)
Tank 241-TX-118, core 236 analytical results for the final report
International Nuclear Information System (INIS)
ESCH, R.A.
1998-01-01
This document is the analytical laboratory report for tank 241-TX-118 push mode core segments collected between April 1, 1998 and April 13, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-TX-118 Push Mode Core sampling and Analysis Plan (TSAP) (Benar, 1997), the Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995), the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al, 1995) and the Historical Model Evaluation Data Requirements (Historical DQO) (Sipson, et al., 1995). The analytical results are included in the data summary table (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Benar, 1997). One sample exceeded the Total Alpha Activity (AT) analysis notification limit of 38.4microCi/g (based on a bulk density of 1.6), core 236 segment 1 lower half solids (S98T001524). Appropriate notifications were made. Plutonium 239/240 analysis was requested as a secondary analysis. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and are not considered in this report
Magnetic susceptibility of curium pnictides
International Nuclear Information System (INIS)
Nave, S.E.; Huray, P.G.; Peterson, J.R.; Damien, D.A.; Haire, R.G.
1981-09-01
The magnetic susceptibility of microgram quantities of 248 CmP and 248 CmSb has been determined with the use of a SQUID micromagnetic susceptometer over the temperature range 4.2 to 340 K and in the applied magnetic field range of 0.45 to 1600 G. The fcc (NaCl-type) samples yield magnetic transitions at 73K and 162 K for the phosphide and antimonide, respectively. Together with published magnetic data for CmN and CmAs, these results indicate spatially extended exchange interactions between the relatively localized 5f electrons of the metallic actinide atoms
Charged particle multiplicities in pp interactions at sqrt(s) = 0.9, 2.36, and 7 TeV
Energy Technology Data Exchange (ETDEWEB)
Khachatryan, V. [Yerevan Physics Institute (Aremenia); et al.,
2011-01-01
Measurements of primary charged hadron multiplicity distributions are presented for non-single-diffractive events in proton-proton collisions at centre-of-mass energies of sqrt(s) = 0.9, 2.36, and 7 TeV, in five pseudorapidity ranges from |eta|<0.5 to |eta|<2.4. The data were collected with the minimum-bias trigger of the CMS experiment during the LHC commissioning runs in 2009 and the 7 TeV run in 2010. The multiplicity distribution at sqrt(s) = 0.9 TeV is in agreement with previous measurements. At higher energies the increase of the mean multiplicity with sqrt(s) is underestimated by most event generators. The average transverse momentum as a function of the multiplicity is also presented. The measurement of higher-order moments of the multiplicity distribution confirms the violation of Koba-Nielsen-Olesen scaling that has been observed at lower energies.
Charged particle multiplicities in pp interactions at $\\sqrt{s}$ = 0.9, 2.36, and 7 TeV
Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hartl, Christian; Hoch, Michael; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Kiesenhofer, Wolfgang; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; Ceard, Ludivine; Cerny, Karel; De Wolf, Eddi A.; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Maes, Michael; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Hreus, Tomas; Marage, Pierre Edouard; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Costantini, Silvia; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Grégoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Ovyn, Severine; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Alves, Gilvan; De Jesus Damiao, Dilson; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Carvalho, Wagner; Da Costa, Eliza Melo; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Nogima, Helio; Oguri, Vitor; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Ferreira Dias, Marco Andre; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Trayanov, Rumen; Vankov, Ivan; Dyulendarova, Milena; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Marinova, Evelina; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Wang, Jian; Wang, Jian; Wang, Xianyou; Wang, Zheng; Yang, Min; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Li, Wenbo; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Cabrera, Andrés; Gomez Moreno, Bernardo; Ocampo Rios, Alberto Andres; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A.; Rykaczewski, Hans; Assran, Yasser; Mahmoud, Mohammed; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Müntel, Mait; Raidal, Martti; Rebane, Liis; Azzolini, Virginia; Eerola, Paula; Czellar, Sandor; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, François-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, André; Shreyber, Irina; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Beaudette, Florian; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Ochando, Christophe; Paganini, Pascal; Porteboeuf, Sarah; Sabes, David; Salerno, Roberto; Sirois, Yves; Thiebaux, Christophe; Wyslouch, Bolek; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Karim, Mehdi; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Baty, Clement; Beaupere, Nicolas; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Falkiewicz, Anna; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Ata, Metin; Bender, Walter; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Klimkovich, Tatsiana; Klingebiel, Dennis; Kreuzer, Peter; Lanske, Dankfried; Magass, Carsten; Masetti, Gianni; Merschmeyer, Markus; Meyer, Arnd; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flügge, Günter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Rennefeld, Jörg; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Borras, Kerstin; Cakir, Altan; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Eckstein, Doris; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Olzem, Jan; Parenti, Andrea; Raspereza, Alexei; Raval, Amita; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Tomaszewska, Justyna; Volyanskyy, Dmytro; Walsh, Roberval; Wissing, Christoph; Autermann, Christian; Bobrovskyi, Sergei; Draeger, Jula; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Pietsch, Niklas; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schröder, Matthias; Schum, Torben; Schwandt, Joern; Srivastava, Ajay Kumar; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Buege, Volker; Chwalek, Thorsten; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heindl, Stefan Michael; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Renz, Manuel; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Gouskos, Loukas; Mertzimekis, Theodoros; Panagiotou, Apostolos; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Sandhya; Jain, Shilpi; Kumar, Ashok; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Hashemi, Majid; Jafari, Abideh; Khakzad, Mohsen; Mohammadi, Abdollah; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pierro, Giuseppe Antonio; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Trentadue, Raffaello; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Di Matteo, Leonardo; Ghezzi, Alessio; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Buontempo, Salvatore; Carrillo Montoya, Camilo Andres; Cimmino, Anna; De Cosa, Annapaola; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Merola, Mario; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Biasotto, Massimo; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Conti, Enrico; De Mattia, Marco; Dorigo, Tommaso; Fanzago, Federica; Gasparini, Fabrizio; Giubilato, Piero; Gresele, Ambra; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Meneguzzo, Anna Teresa; Nespolo, Massimo; Perrozzi, Luca; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Ventura, Sandro; Zotto, Pierluigi; Zumerle, Gianni; Baesso, Paolo; Berzano, Umberto; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Taroni, Silvia; Valdata, Marisa; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Sarkar, Subir; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Montanino, Damiana; Penzo, Aldo; Heo, Seong Gu; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kim, Ji Eun; Kong, Dae Jung; Park, Hyangkyu; Son, Dohhee; Son, Dong-Chul; Kim, Jaeho; Kim, Jae Yool; Song, Sanghyeon; Choi, Suyong; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Ji Hyun; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Seo, Eunsung; Shin, Seungsu; Sim, Kwang Souk; Choi, Minkyoo; Kang, Seokon; Kim, Hyunyong; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Bilinskas, Mykolas Jurgis; Grigelionis, Ignas; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; De La Cruz Burelo, Eduard; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A.; Allfrey, Philip; Krofcheck, David; Tam, Jason; Butler, Philip H.; Doesburg, Robert; Silverwood, Hamish; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Sá Martins, Pedro; Musella, Pasquale; Nayak, Aruna; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Varela, Joao; Wöhri, Hermine Katharina; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger Jr., Michael; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Bondar, Nikolai; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Lychkovskaya, Natalia; Safronov, Grigory; Semenov, Sergey; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Korablev, Andrey; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; Codispoti, Giuseppe; de Trocóniz, Jorge F; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Vizan Garcia, Jesus Manuel; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chamizo Llatas, Maria; Chuang, Shan-Huei; Duarte Campderros, Jordi; Felcini, Marta; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Lobelle Pardo, Patricia; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz Jimeno, Alberto; Scodellaro, Luca; Sobron Sanudo, Mar; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Baillon, Paul; Ball, Austin; Barney, David; Bell, Alan James; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bocci, Andrea; Bolognesi, Sara; Breuker, Horst; Brona, Grzegorz; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Curé, Benoît; D'Enterria, David; Dahms, Torsten; De Roeck, Albert; Duarte Ramos, Fernando; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gennai, Simone; Georgiou, Georgios; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gomez-Reino Garrido, Robert; Gouzevitch, Maxime; Govoni, Pietro; Gowdy, Stephen; Guiducci, Luigi; Hansen, Magnus; Harvey, John; Hegeman, Jeroen; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Innocente, Vincenzo; Janot, Patrick; Karavakis, Edward; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Nesvold, Erik; Nguyen, Matthew; Orimoto, Toyoko; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Polese, Giovanni; Racz, Attila; Rolandi, Gigi; Rommerskirchen, Tanja; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stöckli, Fabian; Stoye, Markus; Tropea, Paola; Tsirou, Andromachi; Tsyganov, Andrey; Veres, Gabor Istvan; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Bortignon, Pierluigi; Caminada, Lea; Chen, Zhiling; Cittolin, Sergio; Dissertori, Günther; Dittmar, Michael; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hervé, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Martinez Ruiz del Arbol, Pablo; Meridiani, Paolo; Milenovic, Predrag; Moortgat, Filip; Nef, Pascal; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann - Karin; Sawley, Marie-Christine; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Aguiló, Ernest; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Favaro, Carlotta; Ivova Rikova, Mirena; Millan Mejias, Barbara; Regenfus, Christian; Robmann, Peter; Schmidt, Alexander; Snoek, Hella; Wilke, Lotte; Chang, Yuan-Hann; Chen, Kuan-Hsin; Chen, Wan-Ting; Dutta, Suchandra; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Liu, Zong-kai; Lu, Yun-Ju; Wu, Jing-Han; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wang, Minzu; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gökbulut, Gül; Güler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Kayis Topaksu, Aysel; Nart, Alisah; Önengüt, Gülsen; Ozdemir, Kadri; Ozturk, Sertac; Polatöz, Ayse; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yildirim, Eda; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gülmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Özbek, Melih; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Clement, Emyr; Cussans, David; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Hansen, Maria; Hartley, Dominic; Heath, Greg P.; Heath, Helen F.; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Poll, Anthony; Senkin, Sergey; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Belyaev, Alexander; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Davies, Gavin; Della Negra, Michel; Fulcher, Jonathan; Futyan, David; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Martin, William; Reid, Ivan; Teodorescu, Liliana; Hatakeyama, Kenichi; Bose, Tulika; Carrera Jarrin, Edgar; Clough, Andrew; Fantasia, Cory; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; Sulak, Lawrence; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Ferapontov, Alexey; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Segala, Michael; Speer, Thomas; Tsang, Ka Vang; Borgia, Maria Assunta; Breedon, Richard; Calderon De La Barca Sanchez, Manuel; Cebra, Daniel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Schwarz, Thomas; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Deisher, Amanda; Duris, Joseph; Erhan, Samim; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Babb, John; Clare, Robert; Ellison, John Anthony; Gary, J William; Giordano, Ferdinando; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Pasztor, Gabriella; Satpathy, Asish; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tu, Yanjun; Vartak, Adish; Würthwein, Frank; Yagil, Avraham; Barge, Derek; Bellan, Riccardo; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Geffert, Paul; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lowette, Steven; Mccoll, Nickolas; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Gataullin, Marat; Kcira, Dorian; Litvine, Vladimir; Ma, Yousi; Mott, Alexander; Newman, Harvey B.; Rogan, Christopher; Timciuc, Vladlen; Traczyk, Piotr; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Jun, Soon Yung; Liu, Yueh-Feng; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Edelmaier, Christopher; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Fields, Laura Johanna; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Kuznetsov, Valentin; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Puigh, Darren; Riley, Daniel; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Vaughan, Jennifer; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Green, Dan; Gunthoti, Kranti; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; Hirschauer, James; Hooberman, Benjamin; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Khatiwada, Rakshya; Kilminster, Benjamin; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Pordes, Ruth; Prokofyev, Oleg; Saoulidou, Niki; Sexton-Kennedy, Elizabeth; Sharma, Seema; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Goldberg, Sean; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Muniz, Lana; Pakhotin, Yuriy; Prescott, Craig; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Sellers, Paul; Skhirtladze, Nikoloz; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bandurin, Dmitry; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Veeraraghavan, Venkatesh; Baarmand, Marc M.; Dorney, Brian; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bai, Yuting; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Lacroix, Florent; O'Brien, Christine; Silvestre, Catherine; Smoron, Agata; Strom, Derek; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Noonan, Daniel; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Makouski, Mikhail; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Lu, Ying; Mignerey, Alice; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; Dutta, Valentina; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Xie, Si; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Godshalk, Andrew; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Chasco, Matthew; Kaadze, Ketino; Reucroft, Steve; Swain, John; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Odell, Nathaniel; Ofierzynski, Radoslaw Adrian; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Hill, Christopher; Killewald, Phillip; Kotov, Khristian; Ling, Ta-Yung; Rodenburg, Marissa; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hebda, Philip; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatserklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, Karolos; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Boulahouache, Chaouki; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Flacher, Henning; Garcia-Bellido, Aran; Goldenzweig, Pablo; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Barker, Anthony; Duggan, Daniel; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hits, Dmitry; Lath, Amitabh; Panwalkar, Shruti; Patel, Rishi; Richards, Alan; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Tatarinov, Aysen; Toback, David; Weinberger, Michael; Akchurin, Nural; Bardak, Cemile; Damgov, Jordan; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Mane, Poonam; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Appelt, Eric; Brownson, Eric; Engh, Daniel; Florez, Carlos; Gabella, William; Johns, Willard; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sheldon, Paul; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Boutle, Sarah; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Francis, Brian; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Milstène, Caroline; Sakharov, Alexandre; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Efron, Jonathan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Parker, William; Reeder, Don; Ross, Ian; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc
2011-01-01
Measurements of primary charged hadron multiplicity distributions are presented for non-single-diffractive events in proton-proton collisions at centre-of-mass energies of sqrt(s) = 0.9, 2.36, and 7 TeV, in five pseudorapidity ranges from |eta|<0.5 to |eta|<2.4. The data were collected with the minimum-bias trigger of the CMS experiment during the LHC commissioning runs in 2009 and the 7 TeV run in 2010. The multiplicity distribution at sqrt(s) = 0.9 TeV is in agreement with previous measurements. At higher energies the increase of the mean multiplicity with sqrt(s) is underestimated by most event generators. The average transverse momentum as a function of the multiplicity is also presented. The measurement of higher-order moments of the multiplicity distribution confirms the violation of Koba-Nielsen-Olesen scaling that has been observed at lower energies.
Managing radioactive wastes of nuclear power plants in operation and site decommissioning phases
International Nuclear Information System (INIS)
Ardalani, E.; Khadivi, S.
2008-01-01
A large nuclear reactor annually produces about 25-50 tons consumed Uranium. These consumed materials consist of Uranium and also Plutonium and Curium. In total, about three percent of these materials are remained from fission. Existing actinides (Uranium, Plutonium, and Curium) cause long-term and short-term radiation that could have harmful effects on the environment. In order to reduce the diverse effects of radioactive wastes in Nuclear Power Plants, different procedures are employed such as compaction, chemical treatment, vitrification, canning and sealing with concrete and safe storage. In this paper, the harmful effects of nuclear wastes on the environment are introduced and a management procedure is presented to minimize its diverse effects
Misra, S K; Andronenko, S I; Tipikin, D; Freed, J H; Somani, V; Prakash, Om
2016-03-01
Detailed EPR investigations on as-grown and annealed TiO 2 nanoparticles in the anatase and rutile phases were carried out at X-band (9.6 GHz) at 77, 120-300 K and at 236 GHz at 292 K. The analysis of EPR data for as-grown and annealed anatase and rutile samples revealed the presence of several paramagnetic centers: Ti 3+ , O - , adsorbed oxygen (O 2 - ) and oxygen vacancies. On the other hand, in as-grown rutile samples, there were observed EPR lines due to adsorbed oxygen (O 2 - ) and the Fe 3+ ions in both Ti 4+ substitutional positions, with and without coupling to an oxygen vacancy in the near neighborhood. Anatase nanoparticles were completely converted to rutile phase when annealed at 1000° C, exhibiting EPR spectra similar to those exhibited by the as-grown rutile nanoparticles. The high-frequency (236 GHz) EPR data on anatase and rutile samples, recorded in the region about g = 2.0 exhibit resolved EPR lines, due to O - and O 2 - ions enabling determination of their g-values with higher precision, as well as observation of hyperfine sextets due to Mn 2+ and Mn 4+ ions in anatase.
Collet, Florence
2017-01-01
The work of the RILEM Technical Committee (TC -236 BBM) was dedicated to the study of construction materials made from plant particles. It considered the question whether building materials containing as main raw material recyclable and easily available plant particles are renewable. This book includes a state-of-the-art report and an appendix. The state-of-the-art report relates to the description of vegetal aggregates. Then, hygrothermal properties, fire resistance, durability and finally the impact of the variability of the method of production of bio-based concrete are assessed. The appendix is a TC report which presents the experience of a working group. The goal was to define testing methods for the measurement of water absorption, bulk density, particle size distribution, and thermal conductivity of bio aggregates. The work is based on a first round robin test of the TC-BBM where the protocols in use by the different laboratories (labs) are compared. .
Functions and requirements for Project W-236B, Initial Pretreatment Module: Revision 1
International Nuclear Information System (INIS)
Swanson, L.M.
1994-01-01
Hanford Site tank waste supernatants will be pretreated to separate the low-level and high-level fractions. The low-level waste fraction, containing the bulk of the chemical constituents, must be processed into a vitrified waste product which will be disposed of onsite, in a safe, environmentally sound, and cost effective manner. The high-level waste fraction separated during supernatant pretreatment (primarily cesium) will be recombined with an additional high-level waste fraction generated from pretreatment of the tank waste sludges and solids. This combined high-level waste fraction will be immobilized as glass and disposed in a geological repository. The purpose of this document is to establish the functional requirements baseline for Project W-236B, Initial Pretreatment Module, by defining the level 5 and 6 functions and requirements for the project. A functional analysis approach has been used to break down the program functions and associated physical requirements that each function must meet. As the systems engineering process evolves, the design requirements document will replace this preliminary functions and requirements document. The design requirements document (DRD) will identify key decisions and associated uncertainties that impact the project. A revision of this document to a DRD is not expected to change the performance requirements or open issues. However, additional requirements and issues may be identified
Energy Technology Data Exchange (ETDEWEB)
Desideri, D.; Meli, M.A.; Roselli, C.; Testa, C. [General Chemistry Institute, Urbino University, Urbino (Italy); Boulyga, S.F.; Becker, J.S. [Central Department of Analytical Chemistry, Research Centre Juelich, Juelich (Germany)
2002-11-01
It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products ({sup 236}U, {sup 239}Pu, {sup 240}Pu, {sup 241}Am, and {sup 237}Np) in the ammunition. In this work the analysis of actinides by {alpha}-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. {sup 242}Pu and {sup 243}Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri-n-octylamine (TNOA), with a decontamination factor higher than 10{sup 6}; after elution plutonium was determined by ICP-MS ({sup 239}Pu and {sup 240}Pu) and {alpha}-spectrometry ({sup 239+240}Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10{sup -12} g g{sup -1} and 2 x 10{sup -11} g g{sup -1}. The {sup 240}Pu/{sup 239}Pu isotope ratio in one penetrator sample (0.12{+-}0.04) was significantly lower than the {sup 240}Pu/{sup 239}Pu ratios found in two soil samples from Kosovo (0.35{+-}0.10 and 0.27{+-}0.07). {sup 241}Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 10{sup 7}. The concentration of {sup 241}Am in the penetrator samples was 2.7 x 10{sup -14} g g{sup -1} and <9.4 x 10{sup -15} g g{sup -1}. In addition {sup 237}Np was detected at ultratrace levels. In general, ICP-MS and {alpha}-spectrometry results were in good agreement.The presence of anthropogenic radionuclides ({sup 236}U, {sup 239}Pu,{sup 240}Pu, {sup 241}Am, and {sup 237}Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of
Effect translational invariance in low-lying electric dipole excitations in 236U and 238U
International Nuclear Information System (INIS)
Ertugral, F.
2005-01-01
In this paper the translational invariant QRPA approach suggested by Pyatov [1] for the spherical nuclei has been extended to describe the 1 - states in deformed nuclei. The role of spurious centre-of-motion state on the Pygmy dipole resonance (PDR) has been investigated in the deformed 236 U and 238 U nuclei. It has been shown that the effect of taking into account the translational invariance of the Hamiltonians in the QRPA with separation of zero energy spurious solutions are noticeable in both the low energy density of 1 - states and in the PDR. Present investigation demonstrates the advantage of the translational invariant QRPA over the non translational invariant one. Within the translational invariant model the effect of removing spurious states on the E1 strength distribution is stronger than in none invariant QRPA (∼20%) for the states up to the neutron binding energy. It is found that the spurious state is spread over many levels, the largest admixture being situated in the region of the energy spacing between nuclear shells o w h . The giant resonance states contain, as a rule, very small admixtures of the spurious state
Chemistry of pyroprocessing for nuclear waste transmutation
Energy Technology Data Exchange (ETDEWEB)
Ackerman, J.P. [Argonne National Laboratory, IL (United States)
1995-10-01
Pyrochemical treatment of spent nuclear fuel is an attractive approach for separating the transuranium (TRU) elements neptunium, plutonium, americium, and curium because of its simplicity, diversion resistance, and potentially low cost.
International Nuclear Information System (INIS)
Awadalla, N.G.
1994-01-01
Project W-236a, Multi-function waste Tank Facility (MWTF), was initiated to increase the safe waste storage capacity for the Tank Waste Remediation System (TWRS) by building two new one million gallon underground storage tanks in the 200 West Area and four tanks in the 200 East Area. Construction of the tanks was scheduled to begin in September 1994 with operations beginning in calendar year (CY) 1998. However, recent reviews have raised several issues regarding the mission, scope, and schedule of the MWTF. The decision to build new tanks must consider several elements, such as: Operational risk and needs -- Operational risk and flexibility must be managed such that any identified risk is reduced as soon as practicable; The amount of waste that will be generated in the future -- Additional needed tank capacity must be made available to support operations and maintain currently planned safety improvement activities; Safety issues -- The retrieval of waste from single-shell tanks (SSTs) and watch list tanks will add to the total amount of waste that must be stored in a double-shell tank (DST); Availability of existing DSTs -- The integrity of the 28 existing DSTs must be continuously managed; and Affect on other projects and programs -- Because MWTF systems have been integrated with other projects, a decision on one project will affect another. In addition the W-236a schedule is logically tied to support retrieval and safety program plans. Based on the above, two new tanks are needed for safe waste storage in the 200 West Area, and they need to be built as soon as practicable. Design should continue for the tanks in the 200 East Area with a decision made by September, on whether to construct them. Construction of the cross-site transfer line should proceed as scheduled. To implement this recommendation several actions need to be implemented
International Nuclear Information System (INIS)
Werner, H.
1976-12-01
A conversion ratio of near 1.0 can be achieved in a pebble-bed reactor using the OTTO (once through then out) loading scheme, having an economic burn-up of the fuel, an economic power density and a moderation ratio, which is considered realistically for the future. The flexibility of the reactor concept and of the fuel element design allows to recycle the fuel during full-power operation. In the present report first the criteria are shown, which are necessary to reach a high conversion ratio. Further it is presented that the conversion ratio increases considerably by closing the fuel cycle in consequence of the building-up of U-233. In this way the fuel inventory and the fuel consumption can considerably be diminished. It is demonstrated that the building-up and the accumulation of U-236 effects an important deterioration of the neutron economy. By taking the reprocessed uranium through an isotope separation (for example: ultra-gas-centrifugation) and by separation of U-236 from the other uranium isotopes it is possible to reduce the fuel consumption considerably. The expenditure and the cost which are necessary for the isotope separation are presented. (orig.) [de
Report on the scientifical feasibility of advanced separation
International Nuclear Information System (INIS)
2001-01-01
The advanced separation process Purex has been retained for the recovery of neptunium, technetium and iodine from high level and long lived radioactive wastes. Complementary solvent extraction processes will be used for the recovery of americium, curium and cesium from the high activity effluents of the spent fuel reprocessing treatment. This document presents the researches carried out to demonstrate the scientifical feasibility of the advanced separation processes: the adaptation of the Purex process would allow the recovery of 99% of the neptunium, while the association of the Diamex and Sanex (low acidity variant) processes, or the Paladin concept (single cycle with selective de-extraction of actinides) make it possible the recovery of 99.8% of the actinides III (americium and curium) with a high lanthanides decontamination factor (greater than 150). The feasibility of the americium/curium separation is demonstrated with the Sesame process (extraction of americium IV after electrolytic oxidation). Iodine is today recovered at about 99% with the Purex process and the dissolved fraction of technetium is also recovered at 99% using an adaptation of the Purex process. The non-dissolved fraction is retained by intermetallic compounds in dissolution residues. Cesium is separable from other fission products with recovery levels greater than 99.9% thanks to the use of functionalized calixarenes. The scientifical feasibility of advanced separation is thus demonstrated. (J.S.)
International Nuclear Information System (INIS)
Garcia-Torano, E.
1990-01-01
A set of numerical methods to analize alpha spectra measured with semiconductor detectors are presented. The methods can be divided in two groups, the first being based in the X 2 minimization ands the second in the use of the Fourier Transform. The methods based in the minimization of X 2 can, in turn, be divided according to the model used to fit the spectra. Some of them use a monoenergetic line for the intercomparison with the other peaks in the same spectrum. The others take into account the analytical function developed to represent an alpha line. Both allow the determination of positions and areas of the components, as well as the uncertainties of the results. The Fast Fourier Transform is applied to the second group of methods, which include the smoothing of experimental data, and the deconvolution of spectra. Examples are given of the application of these methods to real spectra. The alpha spectra of 237 Np and 236 Np are studied by using some of the methods described in this work. (Author)
International Nuclear Information System (INIS)
Volkov, N.G.; Emel'yanov, V.M.; Krajnov, V.P.
1979-01-01
In a statistical fission model calculated are charge distributions of fission fragments (CDFF) of a 236 U* nucleus and their dispersions as the functions of excitation energy and angular momentum (AM) of a compound nucleus as well as the effect of one-particle potential parameter on CDFF. The potential of two-center oscillator was choosen as the one-particle potential. The function of fissioning nucleus level density, which is necessary for calculations in the statistical approach, has been determined from one-particle spectrum. The scheme of calculations is realized with a computer. Presented are the results of calculating the dependence of a neutron gap size on nuclear temperature for various projections of total AM; CDFF for different values of E* excitation energy of AM projection and others. Calculated CDFF and experimental data were compared. Notwithstanding the availability of many parameters and a large volume of numerical calculations the model under consideration permits to describe many common regularities of heavy nucleus CDFF (experimental yields of charges, dispersion dependence on excitation energies and masses of nuclear fragments)
Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV
International Nuclear Information System (INIS)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1991-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233, 234, 236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for 235 U(n,f). 6 refs., 1 fig
Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV
International Nuclear Information System (INIS)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1992-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233,234,236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most of the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n, f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n, f) at 14.1 MeV which will allow us to obtain cross section values from the ratio data and our values for 235 U(n, f). (orig.)
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
Energy Technology Data Exchange (ETDEWEB)
Timothy A. Hyde
2012-06-01
The United States Department of Energy, seeks to develop and demonstrate the technologies needed to transmute the long-lived transuranic actinide isotopes contained in spent nuclear fuel into shorter lived fission products, thereby decreasing the volume of material requiring disposal and reducing the long-term radiotoxicity and heat load of high-level waste sent to a geologic repository. This transmutation of the long lived actinides plutonium, neptunium, americium and curium can be accomplished by first separating them from spent Light Water Reactor fuel using a pyro-metalurgical process, then reprocessing them into new fuel with fresh uranium additions, and then transmuted to short lived nuclides in a liquid metal cooled fast reactor. An important component of the technology is developing actinide-bearing fuel forms containing plutonium, neptunium, americium and curium isotopes that meet the stringent requirements of reactor fuels and materials.
On possibility of transuranium element by the method of transport reactions
International Nuclear Information System (INIS)
Sinitsyna, G.S.; Krashenitsyn, G.N.; Shestakov, B.I.
1983-01-01
A possibility to use chemical transport reaction for separation of uranium, plutonium and some transplutonium elements is shown. The method is based on the use of the known plutonium property to form tetrachloride existing only in the gaseous phase in chlorine atmosphere, which is transported ever the temperature gradiept. Two ways of transport reaction realization - the method of flow and the method of diffusion in closed volume are tested. The experiments are made using specially synthesized plutonium dioxide, containing uranium, americium, curium, lanthanum, terbium, barium. Chlorination is realized by the mixture of chlorine and carbon tetrachloride at temperatures 723-953 K. Plutonium trichloride is deposited in the range 613-653 K, uranium - in the range 473-523 K, curium, americium, lanthanum, terbium, barium remain in the start zone if its temperature does not exceed 873 K
Project W-236A, work plan for preparation of a design requirements document
International Nuclear Information System (INIS)
Groth, B.D.
1995-01-01
This work plan outlines the tasks necessary, and defines the organizational responsibilities for preparing a Design Requirements Document (DRD) for project W-236A, Multi-Function Waste Tank Facility (MWTF). A DRD is a Systems Engineering document which bounds, at a high level, the requirements of a discrete system element of the Tank Waste Remediation System (TWRS) Program. This system element is usually assigned to a specific project, in this case the MWTF. The DRD is the document that connects the TWRS program requirements with the highest level projects requirements and provides the project's link to the overall TWRS mission. The MWTF DRD effort is somewhat unique in that the project is already in detailed design, whereas a DRO is normally prepared prior to preliminary design. The MWTF design effort was initiated with a Functional Design Criteria (FDC) and a Supplemental Design Requirements Document (SDRD) bounding the high level requirements. Another unique aspect of this effort is that some of the TWRS program requirements are still in development. Because of these unique aspects of the MWTF DRD development, the MWTF will be developed from existing TWRS Program requirements and project specific requirements contained in the FDC and SDRD. The following list describes the objectives of the MWTF DRD: determine the primary functions of the tanks through a functional decomposition of the TWRS Program high level functions; allocate the primary functions to a sub-system architecture for the tanks; define the fundamental design features in terms of performance requirements for the system and subsystems; identify system interfaces and design constraints; and document the results in a DRD
Quantum-chemical consideration of extermal valent forms of actinides
International Nuclear Information System (INIS)
Ionova, G.V.; Pershina, V.G.; Spitsyn, V.I.
1982-01-01
Stability of valent forms of actinides that has not yet studied experimentally, is considered within the framework of quantum-chemical considerations. Oxidizing potentials E 0 for actinide elements are determined theoretically. A dependence of the definite valent state stability on relativistic effect is shown. A conclusion is made that oxidizing potential E 0 (4-5) for americium should be higher than E 0 (4-5) for plutonium. A relatively small oxidizing potential E 0 (4-5) for curium speaks about principle possibility of production of five-valent curium in solution, though it is less stable than the six-valent one. Oxidizing potential corresponding to transition of three-valent californium into the four-valent state should be less than the value adopted in literature. A relatively small oxidizing potential of californium E 0 (4-5) speaks about possible existence of five-valent californium in solution
The ATLAS collaboration
2010-01-01
In December 2009 data at the centre-of-mass energy of sqrt(s) = 2.36 TeV were recorded with the ATLAS detector. This was the first time the LHC had been operated at this beam energy and stable beam conditions were not declared. Therefore, to ensure detector safety, the silicon strip detector was in standby mode with reduced sensor bias voltage, which makes track reconstruction more difficult. Two complementary methods were developed to measure the charged particle multiplicity distributions and, in particular, estimate the track reconstruction efficiency under these challenging conditions. The first uses the full Inner Detector information and corrects the efficiency from the simulation using a data-driven technique. The second uses tracks reconstructed from pixel detector information only. The charged particle multiplicity and its dependence on transverse momentum and pseudorapidity are measured for events with at least one charged particle in the kinematic range |eta| 500 MeV. The average charged particle m...
Cylindrical Induction Melter Modicon Control System
International Nuclear Information System (INIS)
Weeks, G.E.
1998-04-01
In the last several years an extensive R ampersand D program has been underway to develop a vitrification system to stabilize Americium (Am) and Curium (Cm) inventories at SRS. This report documents the Modicon control system designed for the 3 inch Cylindrical Induction Melter (CIM)
Analysis of large soil samples for actinides
Maxwell, III; Sherrod, L [Aiken, SC
2009-03-24
A method of analyzing relatively large soil samples for actinides by employing a separation process that includes cerium fluoride precipitation for removing the soil matrix and precipitates plutonium, americium, and curium with cerium and hydrofluoric acid followed by separating these actinides using chromatography cartridges.
Fission cross section ratios for sup 233,234,236 U relative to sup 235 U from 0. 5 to 400 MeV
Energy Technology Data Exchange (ETDEWEB)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J. (Los Alamos National Lab., NM (USA)); Carlson, A.D.; Wasson, O.A. (National Inst. of Standards and Technology, Gaithersburg, MD (USA)); Hill, N.W. (Oak Ridge National Lab., TN (USA))
1991-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of {sup 233, 234, 236}U relative to {sup 235}U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for {sup 235}U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for {sup 235}U(n,f). 6 refs., 1 fig.
International Nuclear Information System (INIS)
Saturnin, A.; Sarrat, P.; Hancok, H.; Milot, J.-F.; Duret, B.; Jasserand, F.; Fillastre, E.; Giffard, F.-X.; Chabert, C.; Van Den Durpel, L.; Caron-Charles, M.; Lefevre, J.C.; Carlier, B.; Arslan, M.; Favet, D.; Garzenne, C.; Barbrault, P.
2013-01-01
Conclusions: First detailed assessment of plants and transportation in various transmutation scenarios. In case of curium transmutation: large difficulties and uncertainties requiring whole new technology development (more pronounced for ADS option). For Am transmutation: more feasible, still to be demonstrated on specific points for industrial extrapolation
Removal of actinides from high-level wastes generated in the reprocessing of commercial fuels
International Nuclear Information System (INIS)
Bond, W.D.; Leuze, R.E.
1975-09-01
Progress is reported on a technical feasibility study of removing the very long-lived actinides (uranium, neptunium, plutonium, americium, and curium) from high-level wastes generated in the commercial reprocessing of spent nuclear fuels. The study was directed primarily at wastes from the reprocessing of light water reactor (LWR) fuels and specifically to developing satisfactory methods for reducing the actinide content of these wastes to values that would make 1000-year-decayed waste comparable in radiological toxicity to natural uranium ore deposits. Although studies are not complete, results thus far indicate the most promising concept for actinide removal includes both improved recovery of actinides in conventional fuel reprocessing and secondary processing of the high-level wastes. Secondary processing will be necessary for the removal of americium and curium and perhaps some residual plutonium. Laboratory-scale studies of separations methods that appear most promising are reported and conceptual flowsheets are discussed. (U.S.)
International Nuclear Information System (INIS)
Ashwood, T.L.; Marsh, J.D. Jr.
1994-04-01
This report presents a compilation of groundwater monitoring data from Solid Waste Storage Area (SWSA) 5 North at Oak Ridge National Laboratory (ORNL) between November 1989 and September 1993. Monitoring data were collected as part of the Active Sites Environmental Monitoring Program that was implemented in 1989 in response to DOE Order 5820.2A. SWSA 5 North was established for the retrievable storage of transuranic (TRU) wastes in 1970. Four types of storage have been used within SWSA 5 North: bunkers, vaults, wells, and trenches. The fenced portion of SWSA 5 North covers about 3.7 ha (9 acres) in the White Oak Creek watershed south of ORNL. The area is bounded by White Oak Creek and two ephemeral tributaries of White Oak Creek. Since 1989, groundwater has been monitored in wells around SWSA 5 North. During that time, elevated gross alpha contamination (reaching as high as 210 Bq/L) has consistently been detected in well 516. This well is adjacent to burial trenches in the southwest corner of the area. Water level measurements in wells 516 and 518 suggest that water periodically inundates the bottom of some of those trenches. Virtually all of the gross alpha contamination is generated by Curium 244 and Americium 241. A special geochemical investigation of well 516 suggests that nearly all of the Curium 44 and Americium 241 is dissolved or associated with dissolved organic matter. These are being transported at the rate of about 2 m/year from the burial trenches, through well 516, to White Oak Creek, where Curium 244 has been detected in a few bank seeps. Concentrations at these seeps are near detection levels (<1 Bq/L)
Energy Technology Data Exchange (ETDEWEB)
Ashwood, T.L.; Marsh, J.D. Jr.
1994-04-01
This report presents a compilation of groundwater monitoring data from Solid Waste Storage Area (SWSA) 5 North at Oak Ridge National Laboratory (ORNL) between November 1989 and September 1993. Monitoring data were collected as part of the Active Sites Environmental Monitoring Program that was implemented in 1989 in response to DOE Order 5820.2A. SWSA 5 North was established for the retrievable storage of transuranic (TRU) wastes in 1970. Four types of storage have been used within SWSA 5 North: bunkers, vaults, wells, and trenches. The fenced portion of SWSA 5 North covers about 3.7 ha (9 acres) in the White Oak Creek watershed south of ORNL. The area is bounded by White Oak Creek and two ephemeral tributaries of White Oak Creek. Since 1989, groundwater has been monitored in wells around SWSA 5 North. During that time, elevated gross alpha contamination (reaching as high as 210 Bq/L) has consistently been detected in well 516. This well is adjacent to burial trenches in the southwest corner of the area. Water level measurements in wells 516 and 518 suggest that water periodically inundates the bottom of some of those trenches. Virtually all of the gross alpha contamination is generated by Curium 244 and Americium 241. A special geochemical investigation of well 516 suggests that nearly all of the Curium 44 and Americium 241 is dissolved or associated with dissolved organic matter. These are being transported at the rate of about 2 m/year from the burial trenches, through well 516, to White Oak Creek, where Curium 244 has been detected in a few bank seeps. Concentrations at these seeps are near detection levels (<1 Bq/L).
International Nuclear Information System (INIS)
Assefa, Zerihun; Haire, Richard G.; Sykora, Richard E.
2008-01-01
We have prepared Cm[Au(CN) 2 ] 3 .3H 2 O and Cm[Ag(CN) 2 ] 3 .3H 2 O as a part of our continuing investigations into the chemistry of the 5f-elements' dicyanometallates. Single crystals of Cm[Au(CN) 2 ] 3 .3H 2 O were obtained from the reaction of CmCl 3 and KAu(CN) 2 under mild hydrothermal conditions. Due to similarities in size, the related praseodymium compounds were also synthesized and characterized for comparison with the actinide systems. The compounds crystallize in the hexagonal space group P6 3 /mcm, where the curium and the transition metals interconnect through cyanide bridging. Crystallographic data (Mo Kα, λ=0.71073 A): Cm[Au(CN) 2 ] 3 .3H 2 O (1), a=6.6614(5) A, c=18.3135(13) A, V=703.77(9), Z=2; Pr[Au(CN) 2 ] 3 .3H 2 O (3), a=6.6662(8) A, c=18.497(3) A, V=711.83(17), Z=2; Pr[Ag(CN) 2 ] 3 .3H 2 O (4), a=6.7186(8) A, c=18.678(2) A, V=730.18(14), Z=2. The Cm 3+ and/or Pr 3+ ions are coordinated to six N-bound CN - groups resulting in a trigonal prismatic arrangement. Three oxygen atoms of coordinated water molecules tricap the trigonal prismatic arrangement providing a coordination number of nine for the f-elements. The curium ions in both compounds exhibit a strong red emission corresponding to the 6 D 7/2 → 8 S 7/2 transition. This transition is observed at 16,780 cm -1 , with shoulders at 17,080 and 16,840 cm -1 for the Ag complex, while the emission is red shifted by ∼100 cm -1 in the corresponding gold complex. The Pr systems also provide well-resolved emissions upon f-f excitation. - Graphical abstract: Coordination polymeric compounds between a trans-plutonium element, curium and transition metal ions, gold(I) and silver(I), were prepared using the hydrothermal synthetic procedure. The curium ion and the transition metals are interconnected through cyanide bridging. The Cm ion has a tricapped trigonal prismatic coordination environment with coordination number of nine. Detail photoluminescence studies of the complexes are also reported
DEFF Research Database (Denmark)
Kjellsson, Gøsta; Damgaard, Christian; Strandberg, Morten Tune
2004-01-01
"DMU finder at det nye materiale om den molekulære karakterisering af 281-24-236x3006-210-23 bomulden, ikke giver anledning til at ændre den tidligere riskovurdering. Vedr. spørgsmål 1 er det i svaret fra anmelderen blevet tilfredsstillende redegjort for hvilket materiale der blev anvendt. Vedr s...
International Nuclear Information System (INIS)
Kraft-Bermuth, S.
2004-01-01
In the thesis presented here, calorimetric low temperature detectors were for the first time applied in accelerator mass spectrometry (AMS) to determine the isotope ratio of 236 U to 238 U in several samples of natural uranium. The detectors consist of a superconducting aluminium film deposited onto a sapphire absorber which is used as thermistor. An energetic heavy ion deposits its kinetic energy as heat in the absorber. The temperature rise is detected by the resistance change of the superconductor. The AMS experiments were performed at the tandem accelerator VERA of the ''Institut fuer Isotopenforschung und Kernphysik'' of the University of Vienna. In an energy range of 10-60 MeV, a relative energy resolution of ΔE/E=7.10 -3 could be achieved, one order of magnitude better than with conventional ionization detectors. Improving thermal and electronic noise yielded in a second experiment for uranium ions with E=17 MeV a relative energy resolution of ΔE/E=4.6.10 -3 . The energy response of the detectors was linear over the whole energy range and independent of the ion mass. Down to a level of 0.1%, no pulse height defect was observed. With the energy resolution obtained it is possible to determine the isotope ratio of 236 U/ 238 U for several samples of natural uranium. With the resolution achieved it is possible furthermore to apply the detectors in several test experiments for direct mass identification of heavy ions using a combined energy/time of flight measurement. In these first tests, a mass resolution of ΔM/M=(8.5-11.0).10 -3 was achieved. In a first test to apply the detectors for detection of so called ''super heavy elements (Z>=112)'', the large dynamic range allowed to identify the reaction products and their alpha decays simultaneously and time dependent. (orig.)
Multiple recycling of plutonium in advanced PWRs
International Nuclear Information System (INIS)
Kloosterman, J.L.
1998-04-01
The influence of the moderator-to-fuel ratio in MOX fueled PWRs on the moderator void coefficient, the fuel temperature coefficient, the moderator temperature coefficient, the boron reactivity worth, the critical boron concentration, the mean neutron generation time and the effective delayed neutron fraction has been assessed. Increasing the moderator-to-fuel ratio to values larger than three, gives a moderator void coefficient sufficiently large to recycle the plutonium at least four times. Scenario studies show that four times recycling of plutonium in PWRs reduces the plutonium mass produced with a factor of three compared with a reference once-through reactor park, but that the americium and curium production triple. If the minor actinides and the remaining plutonium after four times recycling are disposed of, the reduction of the radiotoxicity reaches only a factor of two. This factor increases to five at the maximum when the plutonium is further recycled. Recycling of americium and curium is needed to further reduce the radiotoxicity of the spent fuel. 4 refs
EPISODIC STAR FORMATION COUPLED TO REIGNITION OF RADIO ACTIVITY IN 3C 236
International Nuclear Information System (INIS)
Tremblay, Grant R.; O'Dea, Christopher P.; Baum, Stefi A.; Koekemoer, Anton M.; Sparks, William B.; De Bruyn, Ger; Schoenmakers, Arno P.
2010-01-01
We present Hubble Space Telescope Advanced Camera for Surveys and STIS FUV/NUV/optical imaging of the radio galaxy 3C 236, whose relic ∼4 Mpc radio jet lobes and inner 2 kpc compact steep spectrum (CSS) radio source are evidence of multiple epochs of active galactic nucleus (AGN) activity. Consistent with previous results, our data confirm the presence of four bright knots of FUV emission in an arc along the edge of the inner circumnuclear dust disk in the galaxy's nucleus, as well as FUV emission cospatial with the nucleus itself. We interpret these to be sites of recent or ongoing star formation. We present photometry of these knots, as well as an estimate for the internal extinction in the source using line ratios from archival ground-based spectroscopy. We estimate the ages of the knots by comparing our extinction-corrected photometry with stellar population synthesis models. We find the four knots cospatial with the dusty disk to be young, of order ∼10 7 yr old. The FUV emission in the nucleus, to which we do not expect scattered light from the AGN to contribute significantly, is likely due to an episode of star formation triggered ∼10 9 yr ago. We argue that the young ∼10 7 yr old knots stem from an episode of star formation that was roughly coeval with the event resulting in reignition of radio activity, creating the CSS source. The ∼10 9 yr old stars in the nucleus may be associated with the previous epoch of radio activity that generated the 4 Mpc relic source, before being cut off by exhaustion or interruption. The ages of the knots, considered in the context of both the disturbed morphology of the nuclear dust and the double-double morphology of the 'old' and 'young' radio sources, present evidence for an AGN/starburst connection that is possibly episodic in nature. We suggest that the AGN fuel supply was interrupted for ∼10 7 yr due to a minor merger event and has now been restored. The resultant nonsteady flow of gas in the disk is likely
Energy Technology Data Exchange (ETDEWEB)
Raison, Ph.; Albiot, T
2000-07-01
This paper deals with the minor actinides transmutation and the scientific contribution of the ORNL and the JAERI. It presents researches on the Am-Zr-Y-O system in the framework of the heterogeneous reprocessing, the curium and pyrochlore structures, with the ORNL contribution and phase diagrams, data of Thermodynamics, actinides nitrides, with the JAERI. (A.L.B.)
International Nuclear Information System (INIS)
Raison, Ph.; Albiot, T.
2000-01-01
This paper deals with the minor actinides transmutation and the scientific contribution of the ORNL and the JAERI. It presents researches on the Am-Zr-Y-O system in the framework of the heterogeneous reprocessing, the curium and pyrochlore structures, with the ORNL contribution and phase diagrams, data of Thermodynamics, actinides nitrides, with the JAERI. (A.L.B.)
Historical review of californium-252 discovery and development
International Nuclear Information System (INIS)
Stoddard, D.H.
1985-01-01
This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed
Neutron resonance parameters of CM isotopes
International Nuclear Information System (INIS)
Belanova, T.S.; Kolesov, A.G.; Poruchikov, V.A.
1977-01-01
The total neutron cross sections of isotopes 244, 245, 246, 248 Curium have been measured on reactor CM-2 using the time-of-flight method. Single-level Breit-Wigner resonance parameters: energy E 0 , neutron width 2g GITAn, total width GITA, total neutron cross section in resonance sigma 0 have been obtained by the shape and area methods
Interaction of europium and curium with alpha-amylase
Energy Technology Data Exchange (ETDEWEB)
Barkleit, Astrid [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Div. Chemistry of the F-Elements; Heller, Anne [Technische Univ. Dresden (Germany). Inst. for Zoology, Molecular Cell Physiology and Endocrinology; Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Div. Biogeochemistry
2016-07-01
Time-resolved laser-induced fluorescence spectroscopy (TRLFS) revealed that Eu(III) and Cm(III) form two dominant species with the protein α-amylase (Amy): one with the coordination of a single carboxylate group of the protein and the other with three coordinating carboxylate groups.
Gastrointestinal absorption of neptunium and curium in humans
International Nuclear Information System (INIS)
Popplewell, D.S.; Harrison, J.D.; Ham, G.J.
1991-01-01
The gastrointestinal absorption of Np and Cm has been determined in five male adult volunteers. The Np and Cm, which were in citrate solution, were taken with food. An initial experiment with each individual determined the fraction of each element excreted in the urine following intravenous administration. Subsequently, the results for urinary excretion for the two routes of administration were used to calculate the fractional absorption (f1) of ingested Np and Cm. The mean f1 values were: Np (2.0 +/- 0.2) X 10 - 4 , range (1.2-2.9) X 10 - 4 , and Cm (1.7 +/- 0.3) X 10 - 4 , range (0.95-3.0) X 10 - 4 , the quoted uncertainties being the standard error of the means. Currently, the International Commission on Radiological Protection recommends a value of 10 - 3 for both elements. Cumulative urinary excretion over 1 wk after intravenous injection accounted for about 20%-40% of administered Np and 7%-10% of Cm. At the conclusion of the experiment, the total committed effective dose equivalent for each volunteer was calculated to be in the range 130-250 microSv, based on the individual f1 values, and, in some cases, a knowledge of the rate of clearance of 239 Np through the gut as measured by whole-body counting
Actinide production from xenon bombardments of curium-248
International Nuclear Information System (INIS)
Welch, R.B.
1985-01-01
Production cross sections for many actinide nuclides formed in the reaction of 129 Xe and 132 Xe with 248 Cm at bombarding energies slightly above the coulomb barrier were determined using radiochemical techniques to isolate these products. These results are compared with cross sections from a 136 Xe + 248 Cm reaction at a similar energy. When compared to the reaction with 136 Xe, the maxima in the production cross section distributions from the more neutron deficient projectiles are shifted to smaller mass numbers, and the total cross section increases for the production of elements with atomic numbers greater than that of the target, and decreases for lighter elements. These results can be explained by use of a potential energy surface (PES) which illustrates the effect of the available energy on the transfer of nucleons and describes the evolution of the di-nuclear complex, an essential feature of deep-inelastic reactions (DIR), during the interaction. The other principal reaction mechanism is the quasi-elastic transfer (QE). Analysis of data from a similar set of reactions, 129 Xe, 132 Xe, and 136 Xe with 197 Au, aids in explaining the features of the Xe + Cm product distributions, which are additionally affected by the depletion of actinide product yields due to deexcitation by fission. The PES is shown to be a useful tool to predict the general features of product distributions from heavy ion reactions
International Nuclear Information System (INIS)
Mount, M.E.; Layton, D.W.; Hamilton, T.F.; Lynn, M.
1999-01-01
Between 1965 and 1981, five objects and six naval reactor pressure vessels (RPVs) from four former Soviet Union submarines and a special container from the icebreaker Lenin, all containing damaged spent nuclear fuel (SNF) were dumped in a variety of containments, at four sites in the Kara Sea. The International Atomic Energy Agency initiated the International Arctic Seas Assessment Project (IASAP) to study the possible health and environmental effects from disposal of these objects. One outcome of the IASAP was an estimation of the radionuclide inventory and their release rates from these objects. A follow-on concern is the ability to detect the radionuclides released into the water column. The work reported here is the feasibility of using the long-lived radionuclides 59 Ni, 99 Tc, and 236 U encased within these objects, to monitor the breakdown of the containments due to corrosion
International Nuclear Information System (INIS)
Plischke, P.
1981-01-01
With the proton beam of the Hamburg isochronous cyclotron (HAIZY) thin uranium targets with the mass numbers 235, 236, and 238 were bombarded. Both fragments from the fission of the Np reaction systems and the neutrons coincident with the fragments were detected in the plane perpendicular to the beam direction. Measured and stored event by event were for all particles the times of flight. The detection of the neutron succeeded in conventional time-of-flight technique with NE213 liquid scintillators. A fission detector system with plastic scintillator foils was developed. It permits high event rates over long measuring times and allows the choice of so long neutron flight paths that a neutron energy resolution between 2% and 4% could be reached. The determination of the fragment masses is in spite of the short flight paths of 15 respectively 21 cm possible to +-2 amu. The isotropic component das discussed under the assumption that it is composed of prefission and scission neutrons which were emitted befor fission respectively during the fragmentation. From the post fission results the distribution of the excitation energy to both fragments was determined in dependence of Esup(*) and the fragment mass. (orig./HSI) [de
Fuel selection for radioisotope thermoelectric generators
International Nuclear Information System (INIS)
Menezes, A.
1988-06-01
The availability of Radioisotope Thermoeletric Generator fuels is evaluated based on the amount of fuel discharged from selected power reactors. In general, the best alternatives are either to use Plutonium-238 produced by irradiation of Neptunium-237 generated in typical thermal reactors or to use Curium-244 directly separated from the discharged fuels of fast or thermal reactors. (author) [pt
Tamburini, Fabrizio; Licata, Ignazio
2017-09-01
The search for dark matter (DM) is one of the most active and challenging areas of current research. Possible DM candidates are ultralight fields such as axions and weak interacting massive particles (WIMPs). Axions piled up in the center of stars are supposed to generate matter/DM configurations with oscillating geometries at a very rapid frequency, which is a multiple of the axion mass m B (Brito et al (2015); Brito et al (2016)). Borra and Trottier (2016) recently found peculiar ultrafast periodic spectral modulations in 236 main sequence stars in the sample of 2.5 million spectra of galactic halo stars of the Sloan Digital Sky Survey (˜1% of main sequence stars in the F-K spectral range) that were interpreted as optical signals from extraterrestrial civilizations, suggesting them as possible candidates for the search for extraterrestrial intelligence (SETI) program. We argue, instead, that this could be the first indirect evidence of bosonic axion-like DM fields inside main sequence stars, with a stable radiative nucleus, where a stable DM core can be hosted. These oscillations were not observed in earlier stellar spectral classes probably because of the impossibility of starting a stable oscillatory regime due to the presence of chaotic motions in their convective nuclei. The axion mass values, (50< {m}B< 2.4× {10}3) μ {eV}, obtained from the frequency range observed by Borra and Trottier, (0.6070< f< 0.6077) THz, agree with the recent theoretical results from high-temperature lattice quantum chromodynamics (Borsanyi et al (2016); Borsanyi et al (2016b)).
Rapid column extraction method for actinides and strontium in fish and other animal tissue samples
International Nuclear Information System (INIS)
Maxwell III, S.L.; Faison, D.M.
2008-01-01
The analysis of actinides and radiostrontium in animal tissue samples is very important for environmental monitoring. There is a need to measure actinide isotopes and strontium with very low detection limits in animal tissue samples, including fish, deer, hogs, beef and shellfish. A new, rapid separation method has been developed that allows the measurement of plutonium, neptunium, uranium, americium, curium and strontium isotopes in large animal tissue samples (100-200 g) with high chemical recoveries and effective removal of matrix interferences. This method uses stacked TEVA Resin R , TRU Resin R and DGA Resin R cartridges from Eichrom Technologies (Darien, IL, USA) that allows the rapid separation of plutonium (Pu), neptunium (Np), uranium (U), americium (Am), and curium (Cm) using a single multi-stage column combined with alphaspectrometry. Strontium is collected on Sr Resin R from Eichrom Technologies (Darien, IL, USA). After acid digestion and furnace heating of the animal tissue samples, the actinides and 89/90 Sr are separated using column extraction chromatography. This method has been shown to be effective over a wide range of animal tissue matrices. Vacuum box cartridge technology with rapid flow rates is used to minimize sample preparation time. (author)
International Nuclear Information System (INIS)
Daniel, W.E.; Best, D.R.
1995-01-01
Vitrification has been identified as one potential option for the e materials such as Americium (Am), Curium (Cm), Neptunium (Np), and Plutonium (Pu). A process is being developed at the Savannah River Site to safely vitrify all of the highly radioactive Am/Cm material and a portion of the fissile (Pu) actinide materials stored on site. Vitrification of the Am/Cm will allow the material to be transported and easily stored at the Oak Ridge National Laboratory. The Am/Cm glass has been specifically designed to be (1) highly durable in aqueous environments and (2) selectively attacked by nitric acid to allow recovery of the valuable Am and Cm isotopes. A similar glass composition will allow for safe storage of surplus plutonium. This paper will address the composition, relative durability, and dissolution rate characteristics of the actinide glass, Loeffler Target, that will be used in the Americium/Curium Vitrification Project at Westinghouse Savannah River Company near Aiken, South Carolina. The first part discusses the tests performed on the Loeffler Target Glass concerning instantaneous dissolution rates. The second part presents information concerning pseudo-activation energy for the one week glass dissolution process
International Nuclear Information System (INIS)
Von Baeckmann, A.; Neuber, J.
1975-01-01
In analyzing fissile and/or fertile materials in the thorium, uranium, neptunium, plutonium, americium and curium group, time and accuracy are significant factors. An automated system for rapidly analyzing these materials includes: sample preparation device in which aliquots of sample are weighed and mixed with known amounts of solution; x-ray fluorescence spectrometer; and, a central control system for controlling the operation and analyzing the data. (auth)
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
Radioactivity studies. Progress report. Volume II
International Nuclear Information System (INIS)
Cohen, N.
1981-09-01
The metabolism of 243 244 Cm in nine adult female baboons following intravenous injection was studied. Curium-243,244 was administered as a single injection of curium citrate in dosages of 0.053 to 0.220 μCi/kg. The behavior of 243 244 Cm at these low dosages was quantitated by external whole-body and partial-body counting, bioassay of blood, urine and feces samples, liver biopsies, and post-mortem tissues analysis. Curium-243,244 rapidly passed from the blood to other tissues. At 1 and 24 h after injection, the amounts circulating were 10% and 1%, respectively. At 24 h after injection 70% of the 243 244 Cm was located within soft tissues, probably associated with extracellular fluid; the liver alone contained 32% of the injected activity. During the first weeks the content of 243 244 Cm in soft tissues decreased sharply. As time progressed, significant deposition was noted in the liver and the skeleton. Approximately 20% of the injected activity was in the liver at 1 month with a 40 day half-time. The skeleton reached a maximum burden of 57% by 100 days; the half-time observed in bone was 4 to 16 y. During the first 24 h, 10% of the injected activity appeared in the urine decreasing to 0.1%/day at 30 days and 0.01%/day at 200 days. Fecal excretion increased reaching a maximum level at four weeks. The amount of 243 244 Cm excreted in the feces during the initial 4 to 5 months (approx. 20%) and the rate of elimination in the feces after the first month paralleled the retention in the liver indicating an hepatic-biliary-fecal pathway. A model illustrating the interaction of seven internal compartments with respect to the translocation kinetics of 243 244 Cm was derived based upon this data. Solutions of the model were derived for two specific time-related exposures
New Developments in Actinides Burning with Symbiotic LWR-HTR-GCFR Fuel Cycles
International Nuclear Information System (INIS)
Bomboni, Eleonora
2008-01-01
The long-term radiotoxicity of the final waste is currently the main drawback of nuclear power production. Particularly, isotopes of Neptunium and Plutonium along with some long-lived fission products are dangerous for more than 100000 years. 96% of spent Light Water Reactor (LWR) fuel consists of actinides, hence it is able to produce a lot of energy by fission if recycled. Goals of Generation IV Initiative are reduction of long-term radiotoxicity of waste to be stored in geological repositories, a better exploitation of nuclear fuel resources and proliferation resistance. Actually, all these issues are intrinsically connected with each other. It is quite clear that these goals can be achieved only by combining different concepts of Gen. IV nuclear cores in a 'symbiotic' way. Light-Water Reactor - (Very) High Temperature Reactor ((V)HTR) - Fast Reactor (FR) symbiotic cycles have good capabilities from the viewpoints mentioned above. Particularly, HTR fuelled by Plutonium oxide is able to reach an ultra-high burn-up and to burn Neptunium and Plutonium effectively. In contrast, not negligible amounts of Americium and Curium build up in this core, although the total mass of Heavy Metals (HM) is reduced. Americium and Curium are characterised by an high radiological hazard as well. Nevertheless, at least Plutonium from HTR (rich in non-fissile nuclides) and, if appropriate, Americium can be used as fuel for Fast Reactors. If necessary, dedicated assemblies for Minor Actinides (MA) burning can be inserted in Fast Reactors cores. This presentation focuses on combining HTR and Gas Cooled Fast Reactor (GCFR) concepts, fuelled by spent LWR fuel and depleted uranium if need be, to obtain a net reduction of total mass and radiotoxicity of final waste. The intrinsic proliferation resistance of this cycle is highlighted as well. Additionally, some hints about possible Curium management strategies are supplied. Besides, a preliminary assessment of different chemical forms of
Charged particle multiplicities at {radical}(s)=0.9, 2.36 and 7.0 TeV with the CMS detector at LHC
Energy Technology Data Exchange (ETDEWEB)
Rougny, Romain [Universiteit Antwerpen, Gratiekapelstraat 10, BE-2000 Antwerpen (Belgium); De Wolf, E.A.; Janssen, X.; Mucibello, L.; Van Remortel, N.; Lee, Y.J.; Busza, Wit
2010-07-01
The charged particle multiplicity, n, is an essential observable in hadron collisions. It is the result of the counting of all charged particles produced by the primary proton-proton interaction. In particular, the events collected by minimum bias triggers contain soft interactions and produce mostly particles with low transverse momenta. The shape of the charged particle multiplicity spectrum is sensitive to the particle production mechanism of these soft interactions which are described by non-perturbative models, inspired by QCD. The correlations between produced hadrons are reflected in the shape of the multiplicity spectrum, while the mean multiplicity increases with the center of mass energy of the collision. We present the measurement of the charged particle multiplicity distributions, 1/s d{sigma}/dn, in increasing sub-domains of pseudorapidity and transverse momentum acceptance, for non single diffractive interactions. The data are further corrected for the trigger and event selection efficiency and the effects of tracking inefficiency and secondary tracks originating from the decay of long lived particles and products of interaction with the beam pipe and the detector material. This measurement is based on minimum bias data collected by the CMS detector at {radical}(s) = 0.9, 2.36 and 7 TeV. The data were collected during the LHC commissioning run in 2009 and at the beginning of 2010. (authors)
On the Use of 233U-236U Double-Spike for TIMS Measurements of Uranium Isotopes: A Simulation Study
International Nuclear Information System (INIS)
Williams, R W
2004-01-01
Synthetic ion beams with instantaneous and temporal characteristics appropriate to thermal ionization mass spectrometry (TIMS) were mathematically generated and analyzed to determine the effects of using a mixed 233 U- 236 U spike (double-spike) in the analysis of uranium isotopes. The instantaneous beam characteristics are the intensities (e.g., counts per second) modeled with a Poisson distribution plus a component of random noise that simulates the detection processes. Several beam intensity and mass fractionation vs. time functions were modeled to simulate a range of sample sizes and the commonly employed methods of data collection. These beam profiles were also generated with different noise levels, and signal-to-noise vs. analytical precision diagrams are presented. Modeling focused on natural uranium, where 238 U/ 235 U = 137.88, and on the ability of a given method to determine precisely and accurately small variations in this ratio. Practical limits on precision were determined to be 20-30 ppm, which is consistent with precision seen for other elements by state-of-the-art TIMS. The TIMS total evaporation method was compared directly with the double-spike method. While similar analytical precisions are obtained with either method, the double-spike method of correcting for analytical bias gives more accurate results. The results of a total evaporation analysis will deviate from true by more than the analytical precision if as little as 0.05% of the signal is not integrated, whereas the accuracy and precision of the double-spiked analyses are always linked
Removal of americium and curium from high-level wastes
International Nuclear Information System (INIS)
Bond, W.D.; Leuze, R.E.
1979-01-01
The DHDECMP process was demonstrated to give a 99.5% removal of actinides from actual HLLW in small-scale, batch extraction tests. Results from cold tests indicate that it may be possible to carry out the oxalate precipitation step of the OPIX process continuously. About 90% recovery of the trivalent actinides and lanthanides can be achieved in the continuous precipitation. the presence of zirconium impurity in feed solutions to Talspeak process at concentrations of 10 -4 M (0.5% of the Zr in the original waste) affected phase separations but equipment could be operated satisfactory in cold tests. Zirconium concentrations of 10 -3 M seriously affected phase separations and substantial quantities of interfacial cruds were formed. Modest concentrations (0.006 M or less) of H 2 MEHP, a suspected degradation product of HDEHP, did not effect separation factors. The presence of impurities derived from the thermal degradation of DHDECMP did not inhibit the loading of the trivalent actinide and lanthanide elements in the cation exchange chromatographic process for their separation. It appears that the biodentate (DHDECMP) solvent extraction process and the OPIX process are the leading candidate process for the co-removal of trivalent actinide and lanthanide elements from HLLW. The cation exchange chromatography and the Talspeak processes, are the leading candidate processes for the subsequent separation of actinides and lanthanides. The bidentate and cation exchange processes are further along in their development than the other processes and are currently considered the reference processes for the partitioning of Am-Cm from HLLW. 4 figures, 4 tables
A bioassay method for americium and curium in feces
International Nuclear Information System (INIS)
Alexandre Gagne; Dominic Lariviere; Joel Surette; Sheila Kramer-Tremblay; Xiongxin Dai; Candice Didychuk
2013-01-01
Fecal radiobioassay is an essential and sensitive tool to estimate the internal intake of actinides after a radiological incident. A new fecal analysis method, based on lithium metaborate fusion of fecal ash for complete sample dissolution followed by sequential column chromatography separation of actinides, has been developed for the determination of low-level Am and Cm in a large size sample. Spiked synthetic fecal samples were analyzed to evaluate method performance against the acceptance criteria for radiobioassay as defined by ANSI N13.30; both satisfactory accuracy and repeatability were achieved. This method is a promising candidate for reliable dose assessment of low level actinide exposure to meet the regulatory requirements of routine radiobioassay for nuclear workers and the public. (author)
Computation of actinide pourbaix diagrams at 298 K and 550 K (U,Np,Pu,Am,Cm - H{sub 2}O)
Energy Technology Data Exchange (ETDEWEB)
Piro, M.H.; Bruni, G.M.F.; Lewis, B.J.; Thompson, W.T., E-mail: thompson-w@rmc.ca [Royal Military College of Canada, Dept. of Chemistry and Chemical Engineering, Kingston, Ontario (Canada); Iglesias, F.C. [Candesco Corp., Toronto, Ontario (Canada); Guoping, M.A.; Nashiem, R. [Bruce Power Limited., Tiverton, Ontario (Canada); Roberts, J.G. [Cantech Associates Limited, Burlington, Ontario (Canada)
2011-07-01
Pourbaix diagrams for the actinides ranging from uranium to curium have been developed from the enthalpy of formation, entropy and heat capacity (or estimates thereof) for the phases and aqueous species. Emphasis has been given to the region between hydrogen and oxygen gas saturation.Additional thermodynamic computations illustrate how the data may be employed in better understanding the chemical behaviour of fuel debris circulating in CANDU reactor coolant. (author)
Analog elements for transuranic chemistries
International Nuclear Information System (INIS)
Weimer, W.C.
1982-01-01
The analytical technique for measuring trace concentrations of the analog rare earth elements has been refined for optimal detection. The technique has been used to determine the rare earth concentrations in a series of geological and biological materials, including samples harvested from controlled lysimeter investigations. These studies have demonstrated that any of the trivalent rare earth elements may be used as analog elements for the trivalent transuranics, americium and curium
International Nuclear Information System (INIS)
Holden, N.E.; Zucker, M.S.
1984-01-01
In response to a need of the safeguards community, we have begun an evaluation effort to upgrade the recommended values of the prompt neutron emission multiplicity distribution, P/sub nu/ and its average value, nubar. This paper will report on progress achieved thus far. The evaluation of the uranium, plutonium, americium and curium nuclide's nubar values will be presented. The recommended values will be given and discussed. 61 references
The uptake of radionuclides by plants
International Nuclear Information System (INIS)
Cawse, P.A.; Turner, G.S.
1982-02-01
A review of the literature, since 1970, on the research into the uptake of radionuclides by plants, with references to earlier soil and plant studies on the fate of nuclear weapons fallout. Experimental data on the uptake of plutonium isotopes, americium 241, cesium 137, radium 226, curium 244 and neptunium 237 and details of the chemical form of the radionuclide, soil type and plant growth period are tabulated. (U.K.)
NEW METHOD FOR DETERMINATION OF ACTINIDES AND STRONTIUM IN ANIMAL TISSUE
Energy Technology Data Exchange (ETDEWEB)
Maxwell, S; Jay Hutchison, J; Don Faison, D
2007-05-07
The analysis of actinides in animal tissue samples is very important for environmental monitoring. There is a need to measure actinide isotopes with very low detection limits in animal tissue samples, including fish, deer, hogs, beef and shellfish. A new, rapid actinide separation method has been developed and implemented that allows the measurement of plutonium, neptunium, uranium, americium, curium and strontium isotopes in large animal tissue samples (100-200 g) with high chemical recoveries and effective removal of matrix interferences. This method uses stacked TEVA Resin{reg_sign}, TRU Resin{reg_sign} and DGA-Resin{reg_sign} cartridges from Eichrom Technologies (Darien, IL, USA) that allows the rapid separation of plutonium (Pu), neptunium (Np), uranium (U), americium (Am), and curium (Cm) using a single multi-stage column combined with alpha spectrometry. Sr-90 is collected on Sr Resin{reg_sign} from Eichrom Technologies (Darien, IL, USA). After acid digestion and furnace heating of the animal tissue samples, the actinides and Sr-89/90 are separated using column extraction chromatography. This method has been shown to be effective over a wide range of animal tissue matrices. By using vacuum box cartridge technology with rapid flow rates, sample preparation time is minimized.
First calorimetric determination of heat of extraction of 248Cm in a bi-phasic system
International Nuclear Information System (INIS)
Martin, Leigh R.; Zalupski, Peter R.
2011-01-01
This report presents a summary of the work performed to meet FCR and D level 2 milestone M21SW050201, 'Complete the first calorimetric determination of heat of extraction of 248Cm in a bi-phasic system'. This work was carried out under the auspices of the Thermodynamics and Kinetics FCR and D work package. To complement previous work undertaken under this work package we have extended out heat of extraction studies by di-2-ethyl-hexyl-phosphoric acid to curium. This report also details the heat of extraction of samarium in the same system. This work was performed to not only test the methodology but also to check for consistency with the heats of extraction obtained with those in the prior literature. The heat of extraction for samarium that was obtained in this study was -9.6 kJ mol-1, which is in reasonable agreement with the previously obtained value of -10.9 kJ mol-1. The curium heat of extraction was performed under two sets of conditions and the obtained heats of extraction were in reasonable agreement with each other at -16.0 ± 1.1 and -16.8 ± 1.5 kJ mol-1.
State-of-art technology of fuels for burning minor actinides. An OECD/NEA study
International Nuclear Information System (INIS)
Ogawa, Toru; Konings, R.J.M.; Pillon, S.; Schram, R.P.C.; Verwerft, M.; Wallenius, J.
2005-01-01
At OECD/NEA, Working Party on Scientific Issues in Partitioning and Transmutation was formed for 2000-2004, which studied the status and trends of scientific issues in Partitioning and Transmutation (P and T). The study included the scientific and technical issues of fuels and materials, which are related to dedicated systems for transmutation. This paper summarizes the state-of-art technology of the fuels for burning minor actinides (neptunium, americium and curium). (author)
Directory of Open Access Journals (Sweden)
Rufus W Ojewola
2013-01-01
Full Text Available Aims and Objective: This study aims at correlating different digital rectal examination (DRE abnormalities with histopathological results in patients with prostatic diseases. Materials and Methods: A prospective study of 236 patients who underwent prostate needle biopsy (PNB. Inclusion criteria were presence of abnormal DRE findings or elevated prostate specific antigen above 4 ng/ml or both. They all had 10-core extended transrectal biopsy and specimens were sent for histopathological examination. Correlations were made between DRE findings and histopathology results. Two separate multivariate logistic regression models were created; the first evaluated the relationship of predictors (DRE findings to the likelihood of detecting cancer and the second explored predictors of high-grade cancer on PNB. Results: Two hundred and thirty-six patients were enrolled with a mean age of 66.9 years and range of 43-90 years. Histopathology results were malignant in 102 (43.2% and benign in 134 (56.8%. Ninety-one (38.6% and 145 (61.4% had normal DRE and abnormal DRE findings with cancer detection rates of 23.1% and 55.8% respectively. Nodular prostate is the most common abnormality in 63.4% patients with abnormal DRE. Each sign of DRE had different predictive value with enhanced positive predictive value when combinations of abnormalities are present. Abnormal DRE is an independent predictor of high-grade tumor. Mean Gleason scores were 4.7 and 7.1 in patients with normal and abnormal DRE respectively. Conclusion: DRE is a useful and important tool in assessing patients with suspected prostate diseases who need prostate biopsy. An abnormal DRE correlated well with prostate cancer and independently predicted high-grade disease in these men.
Analysis of Americium in Transplutonium Process Solutions
International Nuclear Information System (INIS)
Ferguson, R.B.
2001-01-01
One of the more difficult analyses in the transplutonium field is the determination of americium at trace levels in a complex matrix such as a process dissolver solution. Because of these conditions a highly selective separation must precede the measurement of americium. The separation technique should be mechanically simple to permit remote operation with master-slave manipulators. For subsequent americium measurement by the mass spectroscopic isotopic-dilution technique, plutonium and curium interferences must also have been removed
Recent solvent extraction experience at Savannah River
International Nuclear Information System (INIS)
Gray, L.W.; Burney, G.A.; Gray, J.H.; Hodges, M.E.; Holt, D.L.; Macafee, I.M.; Reif, D.J.; Shook, H.E.
1986-01-01
Tributyl phosphate-based solvent extraction processes have been used at Savannah River for more than 30 years to separate and purify thorium, uranium, neptunium, plutonium, americium, and curium isotopes. This report summarizes the advancement of solvent extraction technology at Savannah River during the 1980's. Topics that are discussed include equipment improvements, solvent treatment, waste reduction, and an improved understanding of the various chemistries in the process streams entering, within, and leaving the solvent extraction processes
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
Marshalkin, V. Ye.; Povyshev, V. M.
2017-12-01
It is shown for a closed thorium-uranium-plutonium fuel cycle that, upon processing of one metric ton of irradiated fuel after each four-year campaign, the radioactive wastes contain 54 kg of fission products, 0.8 kg of thorium, 0.10 kg of uranium isotopes, 0.005 kg of plutonium isotopes, 0.002 kg of neptunium, and "trace" amounts of americium and curium isotopes. This qualitatively simplifies the handling of high-level wastes in nuclear power engineering.
1985-01-01
thle early life * of" the system. Figure 4-2 shows the variation in power output for polonium - 210 (Po- 210 ) with a 138-day half-life, curium-242 (Cm...miles above the earth’s surface. Above this altitude they must take everything they need with them. The environment will supply them with neither food ...can move large payloads through space. The radioisotope heat cycle engines use high-energy particle sources such as plutonium and polonium . The walls
International Nuclear Information System (INIS)
Meadows, J.W.
1986-12-01
The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs
Fission-product yields for thermal-neutron fission of curium-243
International Nuclear Information System (INIS)
Breederland, D.G.
1982-01-01
Cumulative fission yields for 25 gamma rays emitted during the decay of 23 fission products produced by thermal-neutron fission of 243 Cm have been determined. Using Ge(Li) spectroscopy, 33 successive pulse-height spectra of gamma rays emitted from a 77-ng sample of 243 Cm over a period of approximately two and one-half months were analyzed. Reduction of these spectra resulted in the identification and matching of gamma-ray energies and half-lives to specific radionuclides. Using these results, 23 cumulative fission-product yields were calculated. Only those radionuclides having half-lives between 6 hours and 65 days were observed. Prior to this experiment, no fission-product yields had been recorded for 243 Cm
LARGE SCALE METHOD FOR THE PRODUCTION AND PURIFICATION OF CURIUM
Higgins, G.H.; Crane, W.W.T.
1959-05-19
A large-scale process for production and purification of Cm/sup 242/ is described. Aluminum slugs containing Am are irradiated and declad in a NaOH-- NaHO/sub 3/ solution at 85 to 100 deg C. The resulting slurry filtered and washed with NaOH, NH/sub 4/OH, and H/sub 2/O. Recovery of Cm from filtrate and washings is effected by an Fe(OH)/sub 3/ precipitation. The precipitates are then combined and dissolved ln HCl and refractory oxides centrifuged out. These oxides are then fused with Na/sub 2/CO/sub 3/ and dissolved in HCl. The solution is evaporated and LiCl solution added. The Cm, rare earths, and anionic impurities are adsorbed on a strong-base anfon exchange resin. Impurities are eluted with LiCl--HCl solution, rare earths and Cm are eluted by HCl. Other ion exchange steps further purify the Cm. The Cm is then precipitated as fluoride and used in this form or further purified and processed. (T.R.H.)
Americium-Curium Stabilization - 5'' Cylindrical Induction Melter System Design Basis
International Nuclear Information System (INIS)
Witt, D.C.
1999-01-01
Approximately 11,000 liters (3,600) gallons of solution containing isotopes of Am and Cm are currently stored in F-Canyon Tank 17.1. These isotopes were recovered during plutonium-242 production campaigns in the mid- and late-1970s. Experimental work for the project began in 1995 by the Savannah River Technology Center (SRTC). Details of the process are given in the various sections of this document
International Nuclear Information System (INIS)
Demaziere, C.
1999-01-01
This report is a part of the project titled 'Boiling Water Reactors With Uranium-Plutonium Mixed Oxide (MOx) Fuel'. The aim of this study is to model the impact of a core loading pattern containing MOx bundles upon the main characteristics of a BWR (reactivity coefficients, stability, etc.). The tools that are available to perform a modeling in the Department of Reactor Physics in Chalmers are CASMO-4/TABLES-3/SIMULATE-3 from Studsvik of America. These CMS (Core Management System) programs have been extensively compared with both measurements and reference codes. Nevertheless some data are proprietary in particular the comparison of the calculated nuclide concentrations versus experiments (because of the cost of this kind of experimental study). This is why this report describes such a comparative investigation carried out with a General Electric 7x7 BWR bundle. Unfortunately, since some core history parameters were unknown, a lot of hypotheses have been adopted. This invokes sometimes a significant discrepancy in the results without being able to determine the origin of the differences between calculations and experiments. Yet one can assess that, except for four nuclides - Plutonium-238, Curium-243, Curium-244 and Cesium-135 - for which the approximate power history (history effect) can be invoked, the accuracy of the calculated nuclide concentrations is rather good if one takes the numerous approximations into account
A warning on fission resonance intergrals: Caveat utor
International Nuclear Information System (INIS)
Holden, N.E.
1988-01-01
A common error is made in defining the resonance integral in most tabulations and handbooks. Although it has a minor effect on the capture resonance integral and on the fission resonance integral for the fissile nuclides, it leads to gross errors in the fission resonance integral for the fertile nuclides. The errors in the fission resonance integral for fertile nuclides of the elements from thorium through curium in the ENDF/B-V library will be presented. Let the user beware
Sorption and chromatographic techniques for processing liquid waste of nuclear fuel cycle
International Nuclear Information System (INIS)
Gelis, V.M.; Milyutin, V.V.; Chuveleva, E.A.; Maslova, G.B.; Kudryavtseva, S.P.; Firsova, L.A.; Kozlitin, E.A.
2000-01-01
In the spent nuclear fuel processing procedures the significant quantity of high level liquid waste containing long-lived high toxic radionuclides of cesium, strontium, promethium, americium, curium, etc. is generated. Separation of those radionuclides from the waste not merely simplifies the further safe waste handling but also reduces the waste processing operation costs due to the market value of certain individual radionuclide preparations. Recovery and separation of high grade pure long-lived radionuclide preparations is frequently performed by means of chromatographic techniques. (authors)
Nuclear data needs for subcritical reactors with heavy-metal coolant
International Nuclear Information System (INIS)
Ignatyuk, A.V.
2001-01-01
Requests on improvement of evaluated data files for minor actinides (MA) are briefly reviewed. New evaluations of neutron cross sections for Np-237, Am-241 and Am-243 after the corresponding tests and verifications should satisfy the required accuracies of data for developing MA-burners. More difficult problems arise for curium isotopes, evaluated data of which are strongly divergent. International expertise of available evaluations could be very desirable. Needs in data improvements for perspective heavy-metal liquid coolants are outlined. (author)
Actinide nuclides in environmental air and precipitation samples after the Chernobyl accident
International Nuclear Information System (INIS)
Rosner, G.; Hoetzl, H.; Winkler, R.
1988-01-01
The present paper describes the analysis of isotopes of uranium, neptunium, plutonium, americium and curium, in air and deposition samples taken at our laboratory site 10 km north of Munich, subsequent to the Chernobyl accident. Uranium-234, 237 U, 238 U, 239 Np, 238 Pu, 239+240 Pu and 242 Cm have been identified and upper limits of detection have been established for 241 Am and 244 Cm. Deposition and air concentration values are discussed. 12 refs., 1 fig., 2 tabs
Partitioning of minor actinides: research at Juelich and Karlsruhe Research Centres
International Nuclear Information System (INIS)
Geist, A.; Weigl, M.; Gompper, K.; Modolo, G.
2007-01-01
Full text of publication follows. The work on minor actinide (MA) partitioning carried out at Karlsruhe and Juelich is integrated in the EC FP6 programme, EUROPART. Studies include the DIAMEX process (co-extraction of MA and lanthanides from PUREX raffinate) and the SANEX process (separation of MA from lanthanides). Aspects ranging from developing and improving highly selective and efficient extraction reagents, to fundamental structural studies, to process development and testing are covered. SANEX is a challenge in separation chemistry because of the chemical similarity of trivalent actinides and lanthanides. The extracting agents 2,6-di(5,6-di-propyl-1,2,4-triazine-3-yl)pyridine (n-Pr-BTP), developed at Karlsruhe, and the synergetic mixture of di(chloro-phenyl)di-thio-phosphinic acid (R2PSSH) with tri-n-octyl-phosphine oxide (TOPO), developed at Juelich, are considered a breakthrough because of their high separation efficiency in acidic systems. Separation factors for americium over lanthanides of more than 30 (R2PSSH+TOPO) and 130 (n-Pr-BTP) are achieved. To gain understanding of these selectivities, comparative investigations on the structures of curium and europium complexed with these SANEX ligands were performed at Karlsruhe. Extended X-ray absorption fine structure (EXAFS) analysis revealed distinct structural differences between curium and europium complexed with R2PSSH + TOPO, though no such differences were found for n-Pr-BTP. These investigations were therefore complemented by time-resolved laser fluorescence spectroscopic investigations (TRLFS), showing complex stabilities and speciation to differ between n-Pr-BTP complexes of curium and europium. Kinetics of mass transfer was studied for both R2PSSH+TOPO and n-Pr-BTP systems. For the R2PSSH + TOPO system, diffusion was identified to control extraction rates. For the n-Pr-BTP system, a slow chemical reaction was identified as the rate-controlling process. These results were implemented into computer
International Nuclear Information System (INIS)
Doxtader, M.M.; Beitz, J.V.; Reed, D.T.; Bates, J.K.
1988-02-01
Two ultrasensitive laser techniques, laser photoacoustic spectroscopy (LPAS) and laser-induced fluorescence (LIF), are being developed for the detection and speciation of trace levels of actinides in solutions typical of those expected in a high-level waste repository. An LPAS system was set up for these studies. Experiments were carried out to determine the detection limits of plutonium and americium in solution. Concurrently with the LPAS work, LIF studies were carried out on uranyl ion and curium in solution. 32 refs., 35 figs., 8 tabs
Jin, Yutaka
2008-01-01
Inhalation therapy of diethylene-triamine-penta-acetate (DTPA) should be initiated immediately to workers who have significant incorporation of plutonium, americium or curium in the nuclear fuel reprocessing plant. A newly designed electric mesh nebulizer is a small battery-operated passive vibrating mesh device, in which vibrations in an ultrasonic horn are used to force drug solution through a mesh of micron-sized holes. This nebulizer enables DTPA administration at an early stage in the event of a radiation emergency from contamination from the above radioactive metals.
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Objectives, Strategies, and Challenges for the Advanced Fuel Cycle Initiative
International Nuclear Information System (INIS)
Steven Piet; Brent Dixon; David Shropshire; Robert Hill; Roald Wigeland; Erich Schneider; J. D. Smith
2005-01-01
This paper will summarize the objectives, strategies, and key chemical separation challenges for the Advanced Fuel Cycle Initiative (AFCI). The major objectives are as follows: Waste management--defer the need for a second geologic repository for a century or more, Proliferation resistance--be more resistant than the existing PUREX separation technology or uranium enrichment, Energy sustainability--turn waste management liabilities into energy source assets to ensure that uranium ore resources do not become a constraint on nuclear power, and Systematic, safe, and economic management of the entire fuel cycle. There are four major strategies for the disposal of civilian spent fuel: Once-through--direct disposal of all discharged nuclear fuel, Limited recycle--recycle transuranic elements once and then direct disposal, Continuous recycle--recycle transuranic elements repeatedly, and Sustained recycle--same as continuous except previously discarded depleted uranium is also recycled. The key chemical separation challenges stem from the fact that the components of spent nuclear fuel vary greatly in their influence on achieving program objectives. Most options separate uranium to reduce the weight and volume of waste and the number and cost of waste packages that require geologic disposal. Separated uranium can also be used as reactor fuel. Most options provide means to recycle transuranic (TRU) elements--plutonium (Pu), neptunium (Np), americium (Am), curium (Cm). Plutonium must be recycled to obtain repository, proliferation, and energy recovery benefits. U.S. non-proliferation policy forbids separation of plutonium by itself; therefore, one or more of the other transuranic elements must be kept with the plutonium; neptunium is considered the easiest option. Recycling neptunium also provides repository benefits. Americium recycling is also required to obtain repository benefits. At the present time, curium recycle provides relatively little benefit; indeed, recycling
Impact of Transmutation Scenarios on Fuel Transportation
International Nuclear Information System (INIS)
Saturnin, A.; Duret, B.; Allou, A.; Jasserand, F.; Fillastre, E.; Giffard, F.X.; Chabert, C.; Caron-Charles, M.; Garzenne, C.; Laugier, F.
2015-01-01
Minor actinides transmutation scenarios have been studied in the frame of the French Sustainable Radioactive Waste Management Act of 28 June 2006. Transmutation scenarios supposed the introduction of a sodium-cooled fast reactor fleet using homogeneous or heterogeneous recycling modes for the minor actinides. Americium, neptunium and curium (MA) or americium alone (Am) can be transmuted together in a homogeneous way embedded in FR-MOX fuel or incorporated in MA or Am-Bearing radial Blankets (MABB or AmBB). MA transmutation in Accelerator Driven System has also been studied while plutonium is being recycled in SFR. Assessments and comparisons of these advanced cycles have been performed considering technical and economic criteria. Transportation needs for fresh and used transmutation fuels is one of these criteria. Transmutation fuels have specific characteristics in terms of thermal load and neutron emissions. Thermal, radiation and criticality constraints have been taken into account in this study to suggest cask concepts for routine conditions of transport, to estimate the number of assemblies to be transported in a cask and the number of annual transports. Comparison with the no transmutation option, i.e. management of uranium and plutonium in SFRs, is also presented. Regarding these matters, no high difficulties appear for assemblies with limited content of Am (homogeneous or heterogeneous recycling modes). When fuels contain curium, technical transport uncertainties increase because of the important heat release requiring dividing fresh fuels and technological innovations development (MABB and ADS). (authors)
Validation of KENOREST with LWR-PROTEUS phase II samples
Energy Technology Data Exchange (ETDEWEB)
Wagner, M.; Kilger, R.; Pautz, A.; Zwermann, W. [GRS, Garching (Germany); Grimm, P.; Vasiliev, A.; Ferroukhi, H. [Paul Scherrer Institut, Villigen (Switzerland)
2012-11-01
In order to broaden the validation basis of the reactivity and nuclide inventory code KENOREST two samples of the LWR-PROTEUS phase II program have been calculated and compared to the experimental results. In general most nuclides are reproduced very well and agree within about ten percent with the experiment. Some already known problems, the overprediction of metallic fission products and the underprediction of the higher curium isotopes, have been confirmed. One of the largest uncertainties in the calculation was the burnup of the samples due to differences between a core simulation of the fuel vendor and the burnup determined from the measured values of the burnup indicator Nd-148. Two different models taking into account the environment for a peripheral fuel rod have been studied. The more detailed model included the three direct neighbor fuel assemblies depleted along with the fuel rod of interest. The influence on the results has been found to be very small. Compared to the uncertainties from the burnup, this effect can be considered negligible. The reason for the low influence was basically that the spectrum did not get considerably harder with increasing burnup beyond about 20GWd/tHM. Since the sample reached burnups far beyond that value, an effect could not be seen. In the near future an update of the used libraries is planned and it will be very interesting to study the effect on the results, especially for Curium. (orig.)
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
International Nuclear Information System (INIS)
Schwoebel, R.L.; Northrup, C.J.
1978-01-01
Abstracts and visual aids from the following talks are presented: removal of radionuclides from Hanford defense waste solutions; waste management programs at Savannah River Plant; application of defense waste decontamination; americium and curium recovery from nuclear waste using inorganic ion exchanger materials; removal of trace 106 Ru in nuclear waste processing; and titanate characterization and consolidation processes. Copies of three memos are included: 90 Sr radiation effects on sodium titanate loaded macroreticular resin; 238 239 Pu content in defense waste; and preparation and physical properties of sodium titanate in ion exchange resin
Ground depositions and air concentrations of Chernobyl fallout radionuclides at Munich-Neuherberg
Energy Technology Data Exchange (ETDEWEB)
Hoetzl, H.; Rosner, G.; Winkler, R.
1987-01-01
Southern Bavaria has received a comparatively high deposition of fallout radionuclides from the reactor accident at Chernobyl. As a result, in addition to the measurement of numerous gamma emitting nuclides and of strontium isotopes, the determination of several actinides, including isotopes of uranium, neptunium, plutonium and curium was possible. The observed radionuclide composition of the fallout and the time course of ground deposition and air concentration at the site of the Gesellschaft fuer Strahlen- und Umweltforschung (GSF) at Neuherberg, 10 km north of Munich, are reported and discussed.
Ground depositions and air concentrations of Chernobyl fallout radionuclides at Munich-Neuherberg
International Nuclear Information System (INIS)
Hoetzl, H.; Rosner, G.; Winkler, R.
1987-01-01
Southern Bavaria has received a comparatively high deposition of fallout radionuclides from the reactor accident at Chernobyl. As a result, in addition to the measurement of numerous gamma emitting nuclides and of strontium isotopes, the determination of several actinides, including isotopes of uranium, neptunium, plutonium and curium was possible. The observed radionuclide composition of the fallout and the time course of ground deposition and air concentration at the site of the Gesellschaft fuer Strahlen- und Umweltforschung (GSF) at Neuherberg, 10 km north of Munich, are reported and discussed. (orig.)
Actinide nuclides in environmental air and precipitation samples after the Chernobyl accident
Energy Technology Data Exchange (ETDEWEB)
Rosner, G.; Hoetzl, H.; Winkler, R. (Gesellschaft fuer Strahlen- und Umweltforschung mbH Muenchen (West Germany))
1988-01-01
The present paper describes the analysis of isotopes of uranium, neptunium, plutonium, americium and curium, in air and deposition samples taken at our laboratory site 10 km north of Munich, subsequent to the Chernobyl accident. Uranium-234, {sup 237}U, {sup 238}U, {sup 239}Np, {sup 238}Pu, {sup 239+240}Pu and {sup 242}Cm have been identified and upper limits of detection have been established for {sup 241}Am and {sup 244}Cm. Deposition and air concentration values are discussed. 12 refs., 1 fig., 2 tabs.
Researches on nuclear criticality safety evaluation
Energy Technology Data Exchange (ETDEWEB)
Okuno, Hiroshi; Suyama, Kenya; Nomura, Yasushi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
2003-10-01
For criticality safety evaluation of burnup fuel, the general-purpose burnup calculation code, SWAT, was revised, and its precision was confirmed through comparison with other results from OECD/NEA's burnup credit benchmarks. Effect by replacing the evaluated nuclear data from JENDL-3.2 to ENDF/B-VI and JEF-2.2 was also studied. Correction factors were derived for conservative evaluation of nuclide concentrations obtained with the simplified burnup code ORIGEN2.1. The critical masses of curium were calculated and evaluated for nuclear criticality safety management of minor actinides. (author)
Researches on nuclear criticality safety evaluation
International Nuclear Information System (INIS)
Okuno, Hiroshi; Suyama, Kenya; Nomura, Yasushi
2003-01-01
For criticality safety evaluation of burnup fuel, the general-purpose burnup calculation code, SWAT, was revised, and its precision was confirmed through comparison with other results from OECD/NEA's burnup credit benchmarks. Effect by replacing the evaluated nuclear data from JENDL-3.2 to ENDF/B-VI and JEF-2.2 was also studied. Correction factors were derived for conservative evaluation of nuclide concentrations obtained with the simplified burnup code ORIGEN2.1. The critical masses of curium were calculated and evaluated for nuclear criticality safety management of minor actinides. (author)
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
Energy Technology Data Exchange (ETDEWEB)
Lee, Hwachol; Sukegawa, Hiroaki, E-mail: sukegawa.hiroaki@nims.go.jp; Mitani, Seiji; Hono, Kazuhiro [National Institute for Materials Science (NIMS), Sengen 1-2-1, Tsukuba, Ibaraki 305-0047 (Japan)
2015-07-21
We study the relationship between long range order parameters and the magnetocrystalline anisotropy of off-stoichiometric D0{sub 22} Mn{sub 2.36}Ga (MnGa) epitaxial films grown on MgO (001) and SrTiO{sub 3} (STO) (001) single crystalline substrates. MnGa films deposited on MgO (001) show rather large irregular variation in magnetization with increasing substrate temperature in spite of the improved long range order of total atomic sites. The specific site long range order of Mn-I site characterized in the [101] orientation revealed the fluctuation of the occupation fraction of two Mn atomic sites with elevated substrate temperature, which appears more relevant to the observed magnetization change than the long range order of the total atomic sites. In case of MnGa films grown on the lattice-matched STO (001), high long range order of the total atomic sites in spite of the existence of secondary phase represents that the lattice mismatch plays a crucial role in determining the atomic arrangement of Mn and Ga atoms in the off-stoichiometric compositional case of MnGa.
International Nuclear Information System (INIS)
Bergman, A.; Bamford, I.; Wachtmeister, C.A.
1981-01-01
[ 14 C]Aniline hydrogen sulphate was acetylated, and the acetanilide obtained was chlorinated with N-chlorosuccinimide to 2-chloro, 4-chloro- and 2,4-dichloroacet[ 14 C]anilide. The labelled 2- and 4-chloroacet[ 14 C]anilides were hydrolyzed and treated with aluminium chloride, hydrogen chloride and chlorine in dry dichloromethane to give the major products 2,5-dichloro-and 3,4-dichloro[ 14 C]aniline. The labelled 2,3-dichloro- and 2,3,6-trichloroanilines were obtained as minor products from the chlorination of 2-chloro[ 14 C]aniline, likewise 2,4,5-trichloroaniline was obtained from 4-chloro[ 14 C]aniline. The [ 14 C]anilines prepared were coupled with benzene, 1,4-dichloro-, 1,2-dichloro- or 1,3-dichlorobenzene to give 4-chloro-, 2,3',4',5-tetrachloro-, 2,3,3',4'-tetrachloro-, 3,3',4,4'-tetrachloro-, 2,2',5,5'-tetrachloro-, 2,2',3,3'-tetrachloro-, 2,2',3,5',6-pentachloro-, 2,2',4,4',5-pentachloro- and 2,3',4,5,5'-pentachloro[ 14 C]biphenyl. 3,4-Dichloro[ 14 C]aniline and biphenyls prepared from this aniline were found to be contaminated by bromoanalogues. The origin of these have been studied. (author)
Analysis and application of heavy isotopes in the environment
Steier, Peter; Dellinger, Franz; Forstner, Oliver; Golser, Robin; Knie, Klaus; Kutschera, Walter; Priller, Alfred; Quinto, Francesca; Srncik, Michaela; Terrasi, Filippo; Vockenhuber, Christof; Wallner, Anton; Wallner, Gabriele; Wild, Eva Maria
2010-04-01
A growing number of AMS laboratories are pursuing applications of actinides. We discuss the basic requirements of the AMS technique of heavy (i.e., above ˜150 amu) isotopes, present the setup at the Vienna Environmental Research Accelerator (VERA) which is especially well suited for the isotope 236U, and give a comparison with other AMS facilities. Special emphasis will be put on elaborating the effective detection limits for environmental samples with respect to other mass spectrometric methods. At VERA, we have carried out measurements for radiation protection and environmental monitoring ( 236U, 239,240,241,242,244Pu), astrophysics ( 182Hf, 236U, 244Pu, 247Cm), nuclear physics, and a search for long-lived super-heavy elements ( Z > 100). We are pursuing the environmental distribution of 236U, as a basis for geological applications of natural 236U.
Analysis and application of heavy isotopes in the environment
International Nuclear Information System (INIS)
Steier, Peter; Dellinger, Franz; Forstner, Oliver; Golser, Robin; Knie, Klaus; Kutschera, Walter; Priller, Alfred; Quinto, Francesca; Srncik, Michaela; Terrasi, Filippo; Vockenhuber, Christof; Wallner, Anton; Wallner, Gabriele; Wild, Eva Maria
2010-01-01
A growing number of AMS laboratories are pursuing applications of actinides. We discuss the basic requirements of the AMS technique of heavy (i.e., above ∼150 amu) isotopes, present the setup at the Vienna Environmental Research Accelerator (VERA) which is especially well suited for the isotope 236 U, and give a comparison with other AMS facilities. Special emphasis will be put on elaborating the effective detection limits for environmental samples with respect to other mass spectrometric methods. At VERA, we have carried out measurements for radiation protection and environmental monitoring ( 236 U, 239,240,241,242,244 Pu), astrophysics ( 182 Hf, 236 U, 244 Pu, 247 Cm), nuclear physics, and a search for long-lived super-heavy elements (Z > 100). We are pursuing the environmental distribution of 236 U, as a basis for geological applications of natural 236 U.
The speciation of dissolved elements in aquatic solution. Radium and actinides
International Nuclear Information System (INIS)
Haesaenen, E.
1994-01-01
In the publication, the chemistry and speciation of radium, thorium, protactinium, uranium, neptunium, lutonium, americium and curium in ground-water environment is reviewed. Special attention is given to the transuranium elements, which have a central role in the repository of nuclear wastes. The most important methods used in the speciation of these elements is presented. The laser-induced methods, developed in the 1980's, are especially discussed. These have made it possible, e.g., to speciate the transuranium elements in their very low, actual repository ground-water concentrations (10-100 ng/l). (54 refs., 10 figs., 3 tabs.)
International Nuclear Information System (INIS)
Anon.
1999-01-01
These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)
Analogs for transuranic elements
International Nuclear Information System (INIS)
Weimer, W.C.; Laul, J.C.; Kutt, J.C.
1981-01-01
A combined theoretical and experimental approach is being used to estimate the long-term environmental and biogeochemical behaviors of selected transuranic elements. The objective of this research is to estimate the effect that long-term (hundreds of years) environmental weathering has on the behavior of the transuranic elements americium and curium. This is achieved by investigating the actual behavior of naturally occurring rare earth elements, especially neodymium, that serve as transuranic analogs. Determination of the analog element behavior provides data that can be used to estimate the ultimate availability to man of transuranic materials released into the environment
Helium behaviour in nuclear glasses
International Nuclear Information System (INIS)
Fares, T.
2011-01-01
The present thesis focuses on the study of helium behavior in R7T7 nuclear waste glass. Helium is generated by the minor actinides alpha decays incorporated in the glass matrix. Therefore, four types of materials were used in this work. These are non radioactive R7T7 glasses saturated with helium under pressure, glasses implanted with 3 He + ions, glasses doped with curium and glasses irradiated in nuclear reactor. The study of helium solubility in saturated R7T7 glass has shown that helium atoms are inserted in the glass free volume. The results yielded a solubility of about 10 16 at. cm -3 atm. -1 . The incorporation limit of helium in this type of glass has been determined; its value amounted to about 2*10 21 at. cm -3 , corresponding to 2.5 at.%. Diffusion studies have shown that the helium migration is controlled by the single population dissolved in the glass free volume. An ideal diffusion model was used to simulate the helium release data which allowed to determine diffusion coefficients obeying to the following Arrhenius law: D = D 0 exp(-E a /kBT), where D 0 = 2.2*10 -2 and 5.4*10 -3 cm 2 s -1 and E a = 0.61 eV for the helium saturated and the curium doped glass respectively. These results reflect a thermally activated diffusion mechanism which seems to be not influenced by the glass radiation damage and helium concentrations studied in the present work (up to 8*10 19 at. g -1 , corresponding to 0.1 at.%). Characterizations of the macroscopic, structural and microstructural properties of glasses irradiated in nuclear reactor did not reveal any impact associated with the presence of helium at high concentrations. The observed modifications i.e. a swelling of 0.7 %, a decrease in hardness by 38 %, an increase between 8 and 34 % of the fracture toughness and a stabilization of the glass structure under irradiation, were attributed to the glass nuclear damage induced by the irradiation in reactor. Characterizations by SEM and TEM of R7T7 glasses implanted
The effect of transport density and gender on stress indicators and carcass and meat quality in pigs
Energy Technology Data Exchange (ETDEWEB)
Pereira, T.L.; Corassa, A.; Komiyama, C. M.; Araújo, C.V.; Kataoka, A.
2015-07-01
A total of 168 finishing pigs were used to investigate the effects of gender (barrows and gilts) and transport densities for slaughter (236, 251, and 275 kg/m²) on stress indicators and carcass and pork quality. The animals transported at 251 kg/m² (T251) presented cortisol values below those at 236 kg/m2 (T236), but no different from those at 275 kg/m2 (T275). The lactate dehydrogenase (LDH) values in pigs transported at T236 were the lowest. The blood components did not differ between T236 and T275. The pH values at 45 min (pH45) and at 24 h (pH24) postmortem were higher for pigs subjected to T236. However, the pH45 was higher at T251 than at T275, but pH24 was lower at T251 than at T275. The lightness values in the muscles of the pigs transported at T236 and T251 were higher than those at T275. Lower drip loss values were observed in the muscle of animals at T251. Carcasses of pigs at T236 contained more 1–5 cm lesions while those at T275 contained more 5–10 cmlesions in sections of loin. No significant effects of gender were found on the stress indicators, blood components, pH45, pH24, color, drip loss or carcass lesions in general. These results indicate that the pre-slaughter transport of pigs at densities of 251 kg/m² generates less physiological damage and smaller losses on carcass and pork quality irrespective of gender. (Author)
Total and spontaneous fission half-lives of the americium and curium nuclides
International Nuclear Information System (INIS)
Holden, N.E.
1984-01-01
The total half-life and the half-life for spontaneous fission are evaluated for the various long-lived nuclides of interest. Recommended values are presented for 241 Am, /sup 242m/Am, 243 Am, 242 Cm, 243 Cm, 244 Cm, 245 Cm, 246 Cm, 247 Cm, 248 Cm, and 250 Cm. The uncertainties are provided at the 95% confidence limit for each of the recommended values
Hou, Ling; Li, Wei-Dong; Wang, Fangwei; Eriksson, Olle; Wang, Bao-Tian
2017-12-01
We present a systematic investigation of the structural, magnetic, electronic, mechanical, and thermodynamic properties of CmO2 with the local density approximation (LDA)+U and the generalized gradient approximation (GGA)+U approaches. The strong Coulomb repulsion and the spin-orbit coupling (SOC) effects on the lattice structures, electronic density of states, and band gaps are carefully studied, and compared with other A O2 (A =U , Np, Pu, and Am). The ferromagnetic configuration with half-metallic character is predicted to be energetically stable while a charge-transfer semiconductor is predicted for the antiferromagnetic configuration. The elastic constants and phonon spectra show that the fluorite structure is mechanically and dynamically stable. Based on the first-principles phonon density of states, the lattice vibrational energy is calculated using the quasiharmonic approximation. Then, the Gibbs free energy, thermal expansion coefficient, specific heat, and entropy are obtained and compared with experimental data. The mode Grüneisen parameters are presented to analyze the anharmonic properties. The Slack relation is applied to obtain the lattice thermal conductivity in temperature range of 300-1600 K. The phonon group velocities are also calculated to investigate the heat transfer. For all these properties, if available, we compare the results of CmO2 with other A O2 .
Assessment of Neptunium, Americium, and Curium in the Savannah River Site Environment
International Nuclear Information System (INIS)
Carlton, W.H.
1997-01-01
A series of documents has been published in which the impact of various radionuclides released to the environment by Savannah River Site (SRS) operations has been assessed. The quantity released, the disposition of the radionuclides in the environment, and the dose to offsite individuals has been presented for activation products, carbon cesium, iodine, plutonium, selected fission products, strontium, technetium, tritium, uranium, and the noble gases. An assessment of the impact of nonradioactive mercury also has been published.This document assesses the impact of radioactive transuranics released from SRS facilities since the first reactor became operational late in 1953. The isotopes reported here are 239Np, 241Am, and 244Cm
Search for EC-decayed neutron-deficient actinide isotopes using gas-jet coupled JAERI-ISOL
Energy Technology Data Exchange (ETDEWEB)
Tsukada, Kazuaki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1997-07-01
To study the nuclear properties of unknown neutron deficient actinide isotopes which decay mainly via orbital electron capture (EC), we have developed a composite system consisting of a gas-jet transport apparatus and a thermal ion-source at the JAERI-ISOL. With this system, search for {sup 236}Am produced in the {sup 235}U({sup 6}Li, 5n) reaction has been performed. Pu KX-rays associated with the EC decay of {sup 236}Am are observed at the mass-236 fraction. The half-life of {sup 236}Am is evaluated to be 4.4min. The outline of the gas-jet coupled JAERI-ISOL system and typical performance are given. (author)
Effect of dietary supplements in American bullfrogs reared in low and high stocking densities
Directory of Open Access Journals (Sweden)
Jorgina Juliana Gradisse Freitas
2017-11-01
Full Text Available The aim of this study was to evaluate the effect of the probiotic Bacillus subtillis and beta-glucan from the fungus Agaricus blazei on survival, growth and immunological capacity in bullfrogs (Lithobates catesbeianus cultured in low and high stocking densities. Animals weighing 24.3 ± 2.38 g were randomly distributed into four treatments with four simultaneous replicates: D100: 100 frogs/m2 (control; D236: 236 frogs/m2; D236 + Prob.: 236 frogs/m2 supplemented with probiotic; and D236 + BG: 236 frogs/m2 supplemented with beta-glucan. The parameters evaluated were weight gain, survival, plasma corticosterone (CORT, phagocytic capacity (PC and phagocytic index (PI, at 24 h and 15 and 30 days. There is significant interaction between treatments and time for CORT levels. At 30 days, these values were very close for the D100 (control and D236 + BG groups. Meanwhile, no statistical differences were observed between treatments for PC and PI. These results indicate that beta-glucan reduced the effects of stress caused by high density in bullfrogs, but the probiotic did not reduce these effects. Both compounds are not efficient at increasing survival rates, weight gain and neither immune response of animals. Thus, the use of commercial food additives may not have the favorable impact desired by the farmer. Their use in aquaculture should be further studied in experiments involving a longer trial period and taking into account the cost of their use.
324 Building Baseline Radiological Characterization
International Nuclear Information System (INIS)
Reeder, R.J.; Cooper, J.C.
2010-01-01
This report documents the analysis of radiological data collected as part of the characterization study performed in 1998. The study was performed to create a baseline of the radiological conditions in the 324 Building. A total of 85 technical (100 square centimeter (cm 2 )) smears were collected from the Room 147 hoods, the Shielded Materials Facility (SMF), and the Radiochemical Engineering Cells (REC). Exposure rate readings (window open and window closed) were taken at a distance of 2.5 centimeters (cm) and 30 cm from the surface of each smear. Gross beta-gamma and alpha counts of each smear were also performed. The smear samples were analyzed by gamma energy analysis (GEA). Alpha energy analysis (AEA) and strontium-90 analysis were also performed on selected smears. GEA results for one or more samples reported the presence of manganese-54, cobalt-60, silver-108m antimony-125, cesium-134, cesium-137, europium-154, europium-155, and americium-241. AEA results reported the presence of plutonium-239/240, plutonium-238/ 241 Am, curium-243/244, curium-242, and americium-243. Tables 5 through 9 present a summary by location of the estimated maximum removable and total contamination levels in the Room 147 hoods, the SMF, and the REC. The smear sample survey data and laboratory analytical results are presented in tabular form by sample in Appendix A. The Appendix A tables combine survey data documented in radiological survey reports found in Appendix B and laboratory analytical results reported in the 324 Building Physical and Radiological Characterization Study (Berk, Hill, and Landsman 1998), supplemented by the laboratory analytical results found in Appendix C.
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-10-01
Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated
Critical Masses for Unreflected Metal Spheres
International Nuclear Information System (INIS)
Westfall, Robert Michael; Wright, Richard Q.
2009-01-01
Calculated critical masses of bare metal spheres for 28 actinide isotopes, using the SCALE/XSDRNPM one-dimensional, discrete-ordinates system, are presented. ENDF/B-VI, ENDF/B-VII, and JENDL-3.3 cross sections were used in the calculations. Results are given for isotopes of uranium, neptunium, plutonium, americium, curium, californium, and for one isotope of einsteinium. Calculated k values for these same nuclides are also given. We show that, for non-threshold or low-threshold fission nuclides, a good approximation for the nuclide k is the value of nubar at 1 MeV. A plot of the critical mass versus k values is given for 19 nuclides with A-numbers between 232 and 250. The peaks in the critical mass curve (for seven nuclides) correspond to dips in the k curve. For the seven cases with the largest critical mass, six are even-even nuclides. Neptunium-237, with a critical mass of about 62.7 kg (ENDF/B-VI calculation), has an odd number of protons and an even number of neutrons. However, two cases with quite small critical masses, 232U and 236Pu, are also even-even. These two nuclides do not exhibit threshold fission behavior like most other even-even nuclides. The largest critical mass is 208.8 kg for 243Am and the smallest is 2.44 kg for 251Cf. The calculated k values vary from 1.5022 for 234U to 4.4767 for 251Cf. A correlation between the calculated critical mass (kg) and the fission spectrum averaged value of is given for the elements U, Np, Pu, Am, Cm, and Cf. For each of the five elements, a fit to the data for that element is provided. In each case the fit employs a negative exponential of the form mass = exp(A + B ∼ ln). The values of A and B are element dependent and vary slightly for each of the five elements. The method described here is mainly applicable for non-threshold fission nuclides (15 of the 28 nuclides considered in this paper). There are three exceptions, 238Pu, 244Cm, and 250Cf, which all exhibit threshold fission behavior.
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
Thermodynamics of carbothermic synthesis of actinide mononitrides
International Nuclear Information System (INIS)
Ogawa, T.; Shirasu, Y.; Minato, K.; Serizawa, H.
1997-01-01
Carbothermic synthesis will be further applied to the fabrication of nitride fuels containing minor actinides (MA) such as neptunium, americium and curium. A thorough understanding of the carbothermic synthesis of UN will be beneficial in the development of the MA-containing fuels. Thermodynamic analysis was carried out for conditions of practical interest in order to better understand the recent fabrication experiences. Two types of solution phases, oxynitride and carbonitride phases, were taken into account. The Pu-N-O ternary isotherm was assessed for the modelling of M(C, N, O). With the understanding of the UN synthesis, the fabrication problems of Am-containing nitrides are discussed. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Meadows, J.W.
1986-12-01
The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.
Ebner, Jennifer; Aşçı Arslan, Ayşe; Fedorova, Maria; Hoffmann, Ralf; Küçükçetin, Ahmet; Pischetsrieder, Monika
2015-03-18
Kefir has a long tradition in human nutrition due to its presupposed health promoting effects. To investigate the potential contribution of bioactive peptides to the physiological effects of kefir, comprehensive analysis of the peptide profile was performed by nano-ESI-LTQ-Orbitrap MS coupled to nano-ultrahigh-performance liquid chromatography. Thus, 257 peptides were identified, mainly released from β-casein, followed by αS1-, κ-, and αS2-casein. Most (236) peptides were uniquely detected in kefir, but not in raw milk indicating that the fermentation step does not only increase the proteolytic activity 1.7- to 2.4-fold compared to unfermented milk, but also alters the composition of the peptide fraction. The influence of the microflora was determined by analyzing kefir produced from traditional kefir grains or commercial starter culture. Kefir from starter culture featured 230 peptide sequences and showed a significantly, 1.4-fold higher proteolytic activity than kefir from kefir grains with 127 peptides. A match of 97 peptides in both varieties indicates the presence of a typical kefir peptide profile that is not influenced by the individual composition of the microflora. Sixteen of the newly identified peptides were previously described as bioactive, including angiotensin-converting enzyme (ACE)-inhibitory, antimicrobial, immunomodulating, opioid, mineral binding, antioxidant, and antithrombotic effects. The present study describes a comprehensive peptide profile of kefir comprising 257 sequences. The peptide list was used to identify 16 bioactive peptides with ACE-inhibitory, antioxidant, antithrombotic, mineral binding, antimicrobial, immunomodulating and opioid activity in kefir. Furthermore, it was shown that a majority of the kefir peptides were not endogenously present in the raw material milk, but were released from milk caseins by proteases of the microbiota and are therefore specific for the product. Consequently, the proteolytic activity and the
2010-01-01
... analysis to determine the most economical approach. (5) To foster greater economy and efficiency, grantees... characteristics and standards to which it must conform if it is to satisfy its intended use. Detailed product... grantee or subgrantee desires to have the review accomplished after a solicitation has been developed, the...
BDML Metadata: 236 [SSBD[Archive
Lifescience Database Archive (English)
Full Text Available BY-NC-SA 0.150 0ec11f69-8817-4c7f-94cf-8973a5da1081 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_W06F12.1a_070215_02/ http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_W06F12.1a_070215_02.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/C...e_KK_P002.pdpml0.05.xml http://ssbd.qbic.riken.jp/search/0ec11f69-8817-4c7f-94cf-8973a5da1081/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-168 ...
2010-10-01
... circuit, except circuits which include any track rail and except the common return wires of single-wire, single-break, signal control circuits using a grounded common, and alternating current power distribution...
2010-10-01
... the site-specific application programs, run timers, read inputs, drive outputs, perform self... validation process is to determine “whether the correct product was built.” Verification means the process of... established at the start of that phase. The goal of the verification process is to determine “whether the...
49 CFR 236.1003 - Definitions.
2010-10-01
... auxiliary or industry tracks, a segment or route of railroad tracks: (1) Of a Class I railroad, as.... Tourist, scenic, historic, or excursion operations as defined in part 238 of this chapter are not...
Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems
National Research Council Canada - National Science Library
Gui, Fulin
1996-01-01
..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...
International Nuclear Information System (INIS)
Mireshghi, A.
1982-12-01
We have searched for back-decay gamma rays from the shape isomeric states in 235 U, 236 U, and 238 U possibly excited in muon radiationless transition. The energies and intensities of gamma rays following muon atomic capture were measured as a function of time after muon stopping. Background was suppressed by requiring that the candidate gamma ray be followed by another gamma ray (μ-capture gamma ray). The prompt gamma-ray spectra included the U-muonic x rays. The measured 235 U and 238 U x-ray energies were in good agreement with previously reported results. The x-ray spectrum from 236 U has not been previously reported. The 236 U spectrum is very similar to that of 238 U, except that the K x-rays exhibit an isotope shift of approximately 20 keV, the 236 U energies being higher. In the analysis of the delayed spectra of 236 U and 238 U using the GAMANL peak searching program, and with an effective lower-limit detection efficiency of .15% per stopping muon, no candidate gamma rays for the back decay transitions from the shape isomeric state were observed
International Nuclear Information System (INIS)
Gurdale-Tack, K.; Aubert, M.; Chartier, F.
2000-01-01
For an accurate determination of the isotopic and elemental composition of americium (Am), curium (Cm), neodymium (Nd) and cesium (Cs) in spent nuclear fuels, performed by Thermal Ionization Mass Spectrometry (TIMS) and Inductively Coupled Plasma Mass Spectrometry (ICP-MS), it is necessary to separate these elements before analysis. This separation is mandatory because of isobaric interferences between americium and curium, neodymium and samarium (Sm) and between cesium and barium (Ba). This is the reason why Ba and Sm are analyzed with the other four elements. Separation is carried out by cation-exchange chromatography on a silica-based stationary phase in the presence of a complexing eluent. The complexing agent is 2-hydroxy-2-methyl butanoic acid (HMB), a monoprotic acid (HL) with a pK a of 3.6. Cations (M n+ ) interact with it to form ML y (n-y)+ complexes. Optimization of chromatographic separation conditions requires monitoring of the pH and eluent composition. The influence of each parameter on metal ion retention and on selectivity was investigated. The first studies on standard solutions with Sm(III), Nd(III), Cs(I) and Ba(II) showed that four conditions allow efficient separation. However, only one allows good separation with a real solution of spent nuclear fuels. This condition is a chelating agent concentration of 0.1 mol.l -1 and a pH of 4.2. With the other conditions, co-elution is observed for Cs(I) and Am(III). The overall results were used to study the retention mechanisms. The aim of this modeling is a closer knowledge of the form in which (M n+ and/or ML y (n-y)+ ...) each cationic element is extracted into the stationary phase. In fact, while cations can exist in the eluent in various forms depending on the analytical conditions, their forms may be different in the stationary phase. (authors)
Deprese v dětství a její vztah k problémům chování
Czech Academy of Sciences Publication Activity Database
Čermák, Ivo; Klimusová, Helena; Vízdalová, H.
2005-01-01
Roč. 49, 223-236 (2005), s. 223-236 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : child´s depression * behavior disorder s * CBCL * CDI Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005
International Nuclear Information System (INIS)
Pimpl, M.; Schmidt, W.
1984-01-01
The root-uptake of Np, Pu, Am, and Cm from three different artificially contaminated soils in grass, maize, spring wheat, and potatoes was investigated under greenhouse conditions in pots filled with 9 kg contaminated soil and in lysimeters with a surface area of 0,5 m 2 containing the soils in undisturbed profils up to a depth of 80 cm. Only the plough layer of 30 cm was contaminated with Np, Pu, Am, and Cm. Crop cultivation was done corresponding to usual practice in agriculture. Results of the 1st vegetation period are represented. Transfer factors obtained deviate considerably from those which are recommended for the estimation of long-term exposure of man in the Federal Republic of Germany. (orig.)
Multi-recycling of plutonium and incineration of americium, curium, and technetium in PWRs
International Nuclear Information System (INIS)
Golfier, H.; Bergeron, J.; Puill, A.; Rohart, M.
2000-01-01
The future of nuclear power requires a clear strategy for radwaste and Plutonium management. Pressurized water reactors (PWR) and the associated fuel cycle installations represent the largest part of the French power plants (and are partly paid off). The reactors in service produce an annual 10 tons of Pu, 1.4 tons of minor actinides (MA), and 3.8 tons of long-lived fission products (LLFP). The spent fuel is reprocessed in La Hague plant to recover the energetic elements U and Pu. The latter was initially dedicated to power Fast Breeder Reactors that converted the depleted and reprocessed, thus ensuring a significant part of the French national energy resources. The shut-down of Super-Phenix, the postponement of building of Fast Breeder Reactors (FBR) and the relaxed need for stretching natural U resources raise the issue of Pu management. In fact, the Pu mono-recycling practiced in France since 1987 (St Laurent B1) only slows down the Pu accumulation in spent nuclear fuel, yet it is unable to stabilize the Pu inventory. Beyond the cooperation with its industrial partners, CEA investigates solutions for short and medium term Pu management thus contributing to research required for keeping nuclear power as an energy option. The range of these investigations shall cover both adaptations for light water reactors to facilitate Pu recycling and more innovative solutions concerning reactors, fuel and fuel cycle. The aim of using Pu more efficiently in PWR has led, not only for economic and non-proliferation reasons, but also for considerations related to the optimization of Pu and MA management. The mastery of Pu inventory is a requirement for all long-lived radwaste management methods. In this context, the potential of innovative PWRs has been investigated to control the Pu fluxes and to make them a milestone on the way to clean nuclear power. This paper presents the most recent results related to Pu utilization and MA and LLFP incineration like (Am+Cm) and Tc. To determine the influence of the Pu fluxes, a 1450 MWe PWR with one standard and one innovative concept (code named APA for Advanced Plutonium fuel Assembly) have been performed. A multi-recycling scenario is simulated with a 400 TWhe power plant park. (authors)
Ichikawa, S; Asai, M; Haba, H; Sakama, M; Kojima, Y; Shibata, M; Nagame, Y; Oura, Y; Kawade, K
2002-01-01
A multiple target He/PbI sub 2 aerosol jet system coupled with a thermal ion source was installed in the isotope separator on line (JAERI-ISOL) at the JAERI tandem accelerator facility. The neutron-deficient americium and curium isotopes produced in the sup 2 sup 3 sup 3 sup , sup 2 sup 3 sup 5 U( sup 6 Li, xn) and sup 2 sup 3 sup 7 Np( sup 6 Li, xn) reactions were successfully mass-separated and the overall efficiency including the ionization of Am atoms was evaluated to be 0.3-0.4%. The identification of a new isotope sup 2 sup 3 sup 7 Cm with the present system is reported.
International Nuclear Information System (INIS)
Kaminski, Michael D.
2005-01-01
The US Department of Energy is developing an integrated nuclear fuel cycle technology under its Advanced Fuel Cycle Initiative (AFCI). Under the AFCI, waste minimization is stressed. Engineered product storage materials will be required to store concentrated radioactive cesium, strontium, americium, and curium for periods of tens to hundreds of years. The fabrication of such engineered products has some precedence but the concept is largely novel. We thus present a theoretical model used to calculate the maximum radial dimensions of right cylinder storage forms under several scenarios. Maximum dimensions are small, comparable to nuclear fuel pins in some cases, to avoid centerline melting temperatures; this highlights the need for a careful strategy for engineered product storage fabrication and storage
Trivalent lanthanide/actinide separation in the spent nuclear fuel wastes' reprocessing
International Nuclear Information System (INIS)
Narbutt, J.; Krejzler, J.
2006-01-01
Separation of trivalent actinides, in particular americium and curium, from lanthanides is an important step in an advanced partitioning process for future reprocessing of spent nuclear fuels. Since the trivalent actinides and lanthanides have similar chemistries, it is rather difficult to separate them from each other. The aim of presented work was to study solvent extraction of Am(III) and Eu(III) in a system containing diethylhemi-BTP (6-(5,6-diethyl-1,2,4-triazin-3-yl)-2,2'-bipyridine) and COSAN (protonated bis(chlorodicarbollido)cobalt(III)). The system was chosen by several groups working in the integrated EC research Project EUROPART. Several physicochemical properties of the extraction system were analyzed and discussed
Studies of high-level radioactive waste form performance at Japan Atomic Energy Research Institute
International Nuclear Information System (INIS)
Banba, Tsunetaka; Kamizono, Hiroshi; Mitamura, Hisayoshi
1992-02-01
The recent studies of high-level radioactive waste form at Japan Atomic Energy Research Institute can be classified into the following three categories; (1) Study on the leaching behavior of the nuclear waste glass placing the focus on the alteration layer and the chemical composition of leachant for the prediction of the long-term corrosion of the waste glass. (2) Study on the radiation (alpha-radiation) effects which have relation to the long-term stability of the nuclear waste glass. (3) Study on the long-term self-irradiation damage of a SYNROC waste form using a curium-doped sample. In the present report, the recent results corresponding to the above categories are described. (author)
Final report on fabrication and study of SYNROC containing radioactive waste elements
International Nuclear Information System (INIS)
Reeve, K.D.; Levins, D.M.; Seatonberry, B.W.; Ryan, R.K.; Hart, K.P.; Stevens, G.T.
1987-01-01
Two facilities for the fabrication and testing of Synroc samples containing separate additions of the transuranic actinides americium, plutonium, curium and neptunium, a fission product solution, and two radioisotopes of caesium and strontium were designed, built and operated by the AAEC at the Lucas Heights Research Laboratories. Twenty-one 75 g batches of radioactive Synroc were made and representative samples were characterised by alpha track etching, scanning electron microscopy and aqueous leach testing, mostly at 70 deg C. Where comparisons were possible, radioactive fission products behaved as expected from non-radioactive tests. The leaching behaviour of the actinides was complex but as a group they were the least leachable of all the elements studied
Actinide elements in aquatic and terrestrial environments
International Nuclear Information System (INIS)
Bondietti, E.A.
1978-01-01
Progress is reported in terrestrial ecology studies with regard to plutonium in biota from the White Oak Creek forest; comparative distribution of plutonium in two forest ecosystems; an ecosystem model of plutonium dynamics; actinide element metabolism in cotton rats; and crayfish studies. Progress is reported in aquatic studies with regard to transuranics in surface waters, frogs, benthic algae, and invertebrates from pond 3513; and radioecology of transuranic elements in cotton rats bordering waste pond 3513. Progress is also reported in stability of trivalent plutonium in White Oak Lake water; chemistry of plutonium, americium, curium, and uranium in pond water; uranium, thorium, and plutonium in small mammals; and effect of soil pretreatment on the distribution of plutonium
Major Rehabilitation of the Jetty System at the Mouth of the Columbia River
2012-06-01
coriacea (Testadines: Dermochelyidae) en playa Gandoca, Costa Rica (1990 a 1997). Revista de Biologia Tropical 47 (1-2):225-236. Chaloupka, M. 2001...coriacea (Testadines: Dermochelyidae) en playa Gandoca, Costa Rica (1990 a 1997). Revista de Biologia Tropical 47 145 (1-2):225-236. Chaloupka
Comparison of fission and capture cross sections of minor actinides
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Iwamoto, Osamu
2003-01-01
The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)
Full Text Available ... Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. TheLankyLefty27 101,237 views 7:36 6 Best CPAP Masks 2017 - Duration: 2:58. ... 2:58 Donn's Sleep Apnea Story - Duration: 2:36. schneiderjobs 7,691 views 2:36 Loading more ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1405 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-1405 ref|NP_477758.1| wsv236 [Shrimp white spot syndrome virus] gb|AAL...33240.1| wsv236 [shrimp white spot syndrome virus] gb|AAL89160.1| WSSV292 [shrimp white spot syndrome virus] NP_477758.1 2.4 29% ...
2010-04-26
... CFR part 236, as detailed below. [Docket Number FRA-2010-0081] Applicant: Mr. D. C. Francis, Canadian..., Illinois 60430. The Canadian National--North America (CN) seeks temporary relief from Sec. 236.301, where signals shall be provided, relative to CN's EJ&E Griffith Connection project involving the Matteson...
48 CFR 636.513 - Accident prevention.
2010-10-01
... CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Contract Clauses 636.513 Accident prevention. (a) In... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Accident prevention. 636... contracting activities shall insert DOSAR 652.236-70, Accident Prevention, in lieu of FAR clause 52.236-13...
Energy Technology Data Exchange (ETDEWEB)
Walsh, Jr., Richard M.; Polizzi, Samuel J.; Kadirvelraj, Renuka; Howard, Wesley W.; Wood, Zachary A. [Georgia
2015-03-17
The man o’ war (mow) phenotype in zebrafish is characterized by severe craniofacial defects due to a missense mutation in UDP-α-D-xylose synthase (UXS), an essential enzyme in proteoglycan biosynthesis. The mow mutation is located in the UXS dimer interface ~16 Å away from the active site, suggesting an indirect effect on the enzyme mechanism. We have examined the structural and catalytic consequences of the mow mutation (R236H) in the soluble fragment of human UXS (hUXS), which shares 93% sequence identity with the zebrafish enzyme. In solution, hUXS dimers undergo a concentration-dependent association to form a tetramer. Sedimentation velocity studies show that the R236H substitution induces the formation of a new hexameric species. Using two new crystal structures of the hexamer, we show that R236H and R236A substitutions cause a local unfolding of the active site that allows for a rotation of the dimer interface necessary to form the hexamer. The disordered active sites in the R236H and R236A mutant constructs displace Y231, the essential acid/base catalyst in the UXS reaction mechanism. The loss of Y231 favors an abortive catalytic cycle in which the reaction intermediate, UDP-α-D-4-keto-xylose, is not reduced to the final product, UDP-α-D-xylose. Surprisingly, the mow-induced hexamer is almost identical to the hexamers formed by the deeply divergent UXS homologues from Staphylococcus aureus and Helicobacter pylori (21% and 16% sequence identity, respectively). The persistence of a latent hexamer-building interface in the human enzyme suggests that the ancestral UXS may have been a hexamer.
Global weather variability affects avian phenology: a long-term analysis, 1881-2001
Czech Academy of Sciences Publication Activity Database
Hubálek, Zdeněk
2004-01-01
Roč. 53, č. 3 (2004), s. 227-236 ISSN 0139-7893 R&D Projects: GA AV ČR(CZ) KSK6005114 Keywords : migratory birds * spring arrival * North Atlantic Oscillation Subject RIV: EG - Zoology Impact factor: 0.536, year: 2004 http://www.ivb.cz/folia/53/3/227-236.pdf
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
International Nuclear Information System (INIS)
Galle, P.
1982-01-01
The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr
Bondarkov, Mikhail D; Zheltonozhsky, Viktor A; Zheltonozhskaya, Maryna V; Kulich, Nadezhda V; Maksimenko, Andrey M; Farfán, Eduardo B; Jannik, G Timothy; Marra, James C
2011-10-01
Fuel-containing materials sampled from within the Chernobyl Nuclear Power Plant (ChNPP) Unit 4 Confinement Shelter were spectroscopically studied for gamma and alpha content. Isotopic ratios for cesium, europium, plutonium, americium, and curium were identified, and the fuel burn-up in these samples was determined. A systematic deviation in the burn-up values based on the cesium isotopes in comparison with other radionuclides was observed. The studies conducted were the first ever performed to demonstrate the presence of significant quantities of 242Cm and 243Cm. It was determined that there was a systematic underestimation of activities of transuranic radionuclides in fuel samples from inside of the ChNPP Confinement Shelter, starting from 241Am (and going higher) in comparison with the theoretical calculations.
International Nuclear Information System (INIS)
Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu
2010-01-01
Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)
International Nuclear Information System (INIS)
Boulyga, S.F.; Becker, J.S.
2000-01-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236 U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on inductively coupled plasma quadrupole mass spectrometry with a hexapole collision cell (HEX-ICP-QMS). The figures of merit of the HEX-ICP-QMS were studied with a plasma-shielded torch using different nebulizers (such as an ultrasonic nebulizer (USN) and Meinhard nebulizer) for solution introduction. A 238 U + ion intensity of up to 27000 MHz/ppm in HEX-ICP-QMS with USN was observed by introducing helium into the hexapole collision cell as the collision gas at a flow rate of 10 ml min -1 . The formation rate of uranium hydride ions UH + /U + of 2 x 10 -6 was obtained by using USN with a membrane desolvator. The limit of 236 U/ 238 U ratio determination in 10 μg 1 -1 uranium solution was 3 x 10 -7 corresponding to the detection limit for 236 U of 3 pg 1 -1 . The precision of uranium isotopic ratio measurements in 10 μg 1 -1 laboratory uranium isotopic standard solution was 0.13% ( 235 U/ 238 U) and 0.33% ( 236 U/ 238 U) using a Meinhard nebulizer and 0.45% ( 235 U/ 238 U) and 0.88% ( 236 U/ 238 U) using a USN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236 U/ 238 U ratio ranged from 10 -5 to 10 -3 . (orig.)
Determination of irradiated uranium in far-field contaminated areas of Belarus
International Nuclear Information System (INIS)
Mironov, V.; Pribylev, S.; Hotchkis, M.; Child, D.
2006-01-01
The possibility of using U 236 as an indicator for irradiated uranium is shown. The sensitivity of AMS is high enough for measurements of 236 U/ 238 U ratios down to 10 -9 on micrograms of uranium and therefore for the detection of Chernobyl originated uranium in the remote regions of radioactive fallout. (authors)
The actinide beamline - A new AMS facility at ANTARES
International Nuclear Information System (INIS)
Hotchkis, M.A.C.; Lee, P.J.; Mino, N.
1998-01-01
At the ANTARES accelerator a new beamline has been commissioned, incorporating new magnetic and electrostatic analysers, to optimise the efficiency for Actinides detection by Accelerator Mass Spectrometry. The detection of Actinides, particularly the isotopic ratios of uranium and plutonium, provide unique signatures for nuclear safeguards purposes. We are currently engaged in a project to evaluate the application of AMS to the measurement of Actinides in environmental samples for nuclear safeguards. Measurement of 236 U is of particular interest as a means of tracing the anthropogenic component of uranium. 236 U is expected to be present in natural samples at an extremely low level ( 236 U: 238 U ratio ∼10 -10 ). It has recently been demonstrated that AMS has sufficient sensitivity to detect 236 U at this level. The principal components of the new beamline include: an electrostatic quadrupole, a 12 deg electrostatic deflector, a 90 deg electrostatic analyser, a multi-isotope detection system including ion counters and Faraday cups. The beamline was completed in September 1998 and initial tests have been performed with iodine samples
Energy Technology Data Exchange (ETDEWEB)
Higginson, Matthew A.; Livens, Francis R.; Heath, Sarah L. [Manchester Univ. (United Kingdom). Centre for Radiochemistry Research; Thompson, Paul; Marsden, Olivia J. [AWE, Aldermaston, Reading (United Kingdom); Harwood, Laurence M.; Hudson, Michael J. [Reading Univ. (United Kingdom). Dept. of Chemistry; Lewis, Frank W. [Reading Univ. (United Kingdom). Dept. of Chemistry; Northumbria Univ., Newcastle upon Tyne (United Kingdom). Dept. of Chemical and Forensic Sciences
2015-07-01
In analysis of complex nuclear forensic samples containing lanthanides, actinides and matrix elements, rapid selective extraction of Am/Cm for quantification is challenging, in particular due the difficult separation of Am/Cm from lanthanides. Here we present a separation process for Am/Cm(III) which is achieved using a combination of AG1-X8 chromatography followed by Am/Cm extraction with a triazine ligand. The ligands tested in our process were CyMe{sub 4}-BTPhen, CyMe{sub 4}-BTBP, CA-BTP and CA-BTPhen. Our process allows for purification and quantification of Am and Cm (recoveries 80% - 100%) and other major actinides in < 2 d without the use of multiple columns or thiocyanate. The process is unaffected by high level Ca(II)/Fe(III)/Al(III) (10 mg mL{sup -1}) and thus requires little pre-treatment of samples.
Sorption of plutonium and curium on ion exchange resins in mixed aqueous organic solutions
International Nuclear Information System (INIS)
Haidvogel, N.; Reitsamer, G.; Grass, F.
1974-12-01
The sorption of the sulfate and nitrate-complexes of the actinides Pu(III), Pu(IV), Pu(VI), Am(III) and Om(III) on the ion-exchange-resins Dowex 1X8 and Dowex 50 WX8 is investigated. The strong sorbability of these actinide ions in solvents with high content of alcohol is explained by the existence of anionic complexes like Pu(III) (SO 4 ) 2 - , Pu(IV) (SO 4 ) 3 2 - , Pu(VI)O 2 (SO 4 ) 2 2 - , Am(SO 4 ) 2 - respectively Am(NO 3 ) 4 - and Om(NO 3 ) 4 - . The taking of autoradiographs from the thin-layer chromatograms by the aid of a special device and the evaluation of the autoradiographs by a particular photodensitometer are described. The measurement of the radioactivity of the α-emitting nuclides Pu 239, Am 241 and Om 242 are done by liquid-scintillation spectrometry. (author)
Incorporation of plutonium, americium and curium into the Irish Sea seabed by biological activity
Energy Technology Data Exchange (ETDEWEB)
Kershaw, P J; Swift, D J; Pentreath, R J; Lovett, M B
1984-12-01
Bioturbation was considered as a potentially significant mechanism for the incorporation of long-lived radionuclides into the seabed and in particular the activities of a large echiuran Maximulleria lankesteri. Radionuclides of the transuranium elements plutonium, americium and cirium are discharged into the Irish Sea under authorization as part of the low-level liquid effluent from the British Nuclear Fuels plc reprocessing plant at Sellafield, Cumbria, England. The distribution of Pu-239, 240, Pu-238, Am-241, Cm-244 and Cm-242 concentrations and the Pu-239, 240/Pu-238 quotient in samples taken in April and May 1983 from the sediment surface, burrow linings, sediments adjacent to burrows, and the gut contents and body of a large M. lankesteri clearly indicate that bioturbation is responsible, at least in part, for the incorporation of these radionuclides to depths of up to 140 cm. This area of sediments represents a significant present-day sink, but the permanence of this sink and the likelihood that radioactivity will be remobilized and be returned to man, depends on a large number of factors. 15 references, 18 figures.
Energy Technology Data Exchange (ETDEWEB)
Schreckhise, R E; Cline, J F [Battelle Pacific Northwest Labs., Richland, WA (USA)
1980-05-01
Uptake of the nitrate forms of /sup 238/Pu, /sup 239/Pu, /sup 241/Am, /sup 244/Cm and /sup 237/Np from soil into selected parts of four different plant species grown under field conditions was compared Alfalfa, barley, peas and cheatgrass were grown outdoors in small weighing lysimeters filled with soil containing these radionuclides. The plants were harvested at maturity, divided into selected components and radiochemically analyzed by alpha-energy analysis. Soil concentration did not appear to affect the plant uptake of /sup 238/Pu, /sup 239/Pu, /sup 241/Am or /sup 244/Cm for the two levels utilized. The relative plant uptake of the five different transuranics was /sup 237/Np>/sup 244/Cm approximately equal /sup 241/Am>/sup 239/Pu approximately equal/sup 238/Pu. Relative uptake values of Np for various plant parts ranged from 2200 to 45,000 times as great as for Pu, while Am and Cm values were 10-20 times as great. The values for seeds were significantly lower than those for the other aboveground plant parts for all four transuranic elements. The legumes accumulated approx. 10 times more than the grasses. A comparison of the postulated radionuclide content of plants grown in soil contaminated with material from spent liquid metal fast breeder reactor fuels indicated that concentrations of isotopes of Am, Cm and Np would exceed /sup 239/Pu values.
Czech Academy of Sciences Publication Activity Database
Brauner, Petr; Flachs, Pavel; Horáková, Olga; Pecina, Petr; Franssen-van Hal, N.; Rossmeisl, Martin; Keijer, J.; Houštěk, Josef; Kopecký, Jan
2005-01-01
Roč. 48, Supp.1 (2005), A236-A236 ISSN 0012-186X. [EASD Annual meting /41./. 10.09.2005-15.09.2005, Athens] R&D Projects: GA ČR GA303/05/2580; GA AV ČR KJB5011303 Institutional research plan: CEZ:AV0Z50110509 Keywords : biochemistry Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition
24 CFR 236.710 - Qualified tenant.
2010-04-01
..., the income of the individual or family must be determined to be too low to permit the individual or... consent forms for the obtaining of wage and claim information from State Wage Information Collection...
Publications | Page 236 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... of Nicaragua) (restricted access). Over the last two decades indigenous peoples in the Latin American region have been struggling for state recognition of cultural difference and for the granting of collective rights. This dissertation explores the activism of indigenous women and their participation within indigenous socio-.
49 CFR 236.792 - Reservoir, equalizing.
2010-10-01
... Reservoir, equalizing. An air reservoir connected with and adding volume to the top portion of the equalizing piston chamber of the automatic brake valve, to provide uniform service reductions in brake pipe...
49 CFR 236.741 - Distance, stopping.
2010-10-01
... portion of railroad at its maximum authorized speed, will travel during a full service application of the brakes, between the point where such application is initiated and the point where the train comes to a...
17 CFR 256.236 - Taxes accrued.
2010-04-01
... credited with the amount of taxes accrued during the accounting period, corresponding debits being made to... be kept so as to show for each class of taxes the amount accrued, the basis for the accrual, the...
2010-10-01
... TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING THE INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Interlocking Rules and Instructions... derail and displaying an aspect indicating stop cannot be operated to display a less restrictive aspect...
2010-01-01
..., that uses or intends to use live animals in research, tests, experiments, or for teaching. Each... names and the numbers of animals upon which teaching, research, experiments, or tests were conducted... animals upon which experiments, teaching, research, surgery, or tests were conducted involving...
Determination of enrichment of recycle uranium fuels for different burnup values
International Nuclear Information System (INIS)
Zabunoglu, Okan H.
2008-01-01
Uranium (U) recovered from spent LWR fuels by reprocessing, which contains small amounts of U-236, is to be enriched before being re-irradiated as the recycle U. During the enrichment of recovered U in U-235, the mass fraction of U-236 also increases. Since the existence of U-236 in the recycle U has a negative effect on neutron economy, a greater enrichment of U-235 in the recycle U is required for reaching the same burnup as can be reached by the fresh U fuel. Two burnup values play the most important role in determining the enrichment of recycle U: (1) discharge burnup of spent fuel from which the recycle U is obtained and (2) desired discharge burnup of the recycle U fuel. A step-by-step procedure for calculating the enrichment of the recycle U as a function of these two burnup values is introduced. The computer codes MONTEBURNS and ORIGEN-S are made use of and a three-component (U-235, U-236, U-238) enrichment scheme is applied for calculating the amount of U-236 in producing the recycle U from the recovered U. As was aimed, the resulting expression is simple enough for quick/hand calculations of the enrichment of the recycle U for any given discharge burnup of spent fuel and for any desired discharge burnup of the recycle U fuel, most accurately within the range of 33,000-50,000 MWd/tonU
Gclust Server: 93636 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 93636 OSA_Os02g0125100 Cluster Sequences Related Sequences(236) 514 no annotation 1... 1.00e-28 14.29 0.0 0.0 0.0 0.0 0.0 Show 93636 Cluster ID 93636 Sequence ID OSA_Os02g0125100 Link to cluster... sequences Cluster Sequences Link to related sequences Related Sequences(236) Sequence length 514 Representa
Impact of partitioning and transmutation in radioactive waste management
International Nuclear Information System (INIS)
Magill, J.
2006-01-01
Nuclear energy provides a significant contribution to the overall energy supply in Europe. With 148 reactors in 13 of the 25 Member States producing a total power of 125 G We, the resulting energy generation of 850 TWh per year provides 35% of the total electrical energy requirements in the European Union. Worldwide, 441 commercial reactors operate in 31 countries and provide 17% of the electrical requirements. Currently 32 nuclear reactors are being built worldwide mostly in India, China and in neighbouring countries. The used fuel discharged from nuclear power plants constitutes the main contribution to nuclear waste in countries which do not undertake reprocessing. As such, its disposal requires isolation from the biosphere in stable deep geological formations for long periods of time (some hundred thousand years) until its radioactivity decreases through the process of radioactive decay. Ways for significantly reducing the volumes and radio toxicities of the waste and to shorten the very long times for which the waste must be stored safely are being investigated. This is the motivation behind the partitioning and transmutation (P and T) activities worldwide. Most of the hazard from the spent fuel stems from only a few chemical elements, namely plutonium, neptunium, americium, curium, and some long-lived fission products such as iodine, caesium and technetium. At present approximately 2500 t of spent fuel are produced annually in the EU, containing about 25 t of plutonium, and 3.5 t of the minor actinides neptunium, americium and curium, and about 3 t of long-lived fission products. These radioactive by-products, although present in relatively low concentrations in the used fuel, are a hazard to life forms when released into the environment. This paper addresses the potential impact of P and T on the long-term disposal of nuclear waste. In particular, it evaluates how realistic P and T scenarios can lead to a reduction in the time required for the waste to be
Quasar-Lyman α forest cross-correlation from BOSS DR11: Baryon Acoustic Oscillations
Energy Technology Data Exchange (ETDEWEB)
Font-Ribera, Andreu [Institute of Theoretical Physics, University of Zurich, Winterthurerstrasse 190, 8057 Zurich (Switzerland); Kirkby, David; Blomqvist, Michael [Department of Physics and Astronomy, University of California, 4129 Frederick Reines Hall, Irvine, CA, 92697 (United States); Busca, Nicolas; Aubourg, Éric; Bautista, Julian [APC, Université Paris Diderot-Paris 7, CNRS/IN2P3, CEA, Observatoire de Paris, 10, rue A. Domon and L. Duquet, Paris (France); Miralda-Escudé, Jordi [Institut de Ciències del Cosmos (IEEC/UB), Martí i Franquès 1, Barcelona, 08028 Catalonia (Spain); Ross, Nicholas P.; Bailey, Stephen; Beutler, Florian; Carithers, Bill [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA (United States); Slosar, Anže [Brookhaven National Laboratory, Blgd 510, Upton, NY, 11375 (United States); Rich, James; Delubac, Timothée [CEA, Centre de Saclay, IRFU, Gif-sur-Yvette, 91191 France (France); Bhardwaj, Vaishali; Bizyaev, Dmitry [Department of Astronomy, University of Washington, Box 351580, Seattle, WA, 98195 (United States); Brewington, Howard; Brinkmann, Jon [Apache Point Observatory and New Mexico State University, P.O. Box 59, Sunspot, NM, 88349-0059 (United States); Brownstein, Joel R.; Dawson, Kyle S., E-mail: font@physik.uzh.ch [Department of Physics and Astronomy, University of Utah, 115 S 1400 E, Salt Lake City, UT, 84112 (United States); and others
2014-05-01
We measure the large-scale cross-correlation of quasars with the Lyα forest absorption, using over 164,000 quasars from Data Release 11 of the SDSS-III Baryon Oscillation Spectroscopic Survey. We extend the previous study of roughly 60,000 quasars from Data Release 9 to larger separations, allowing a measurement of the Baryonic Acoustic Oscillation (BAO) scale along the line of sight c/(H(z = 2.36)r{sub s}) = 9.0±0.3 and across the line of sight D{sub A}(z = 2.36)/r{sub s} = 10.8±0.4, consistent with CMB and other BAO data. Using the best fit value of the sound horizon from Planck data (r{sub s} = 147.49 Mpc), we can translate these results to a measurement of the Hubble parameter of H(z = 2.36) = 226±8 km s{sup −1} Mpc{sup −1} and of the angular diameter distance of D{sub A}(z = 2.36) = 1590±60 Mpc. The measured cross-correlation function and an update of the code to fit the BAO scale (baofit) are made publicly available.
AMS detection of actinides at high mass separation
Energy Technology Data Exchange (ETDEWEB)
Steier, Peter; Lachner, Johannes; Priller, Alfred; Winkler, Stephan; Golser, Robin [University of Vienna, Faculty of Physics, Vienna (Austria); Eigl, Rosmarie [Hiroshima University, Earth and Planetary Systems Science, Hiroshima (Japan); Quinto, Francesca [Institut fuer Nukleare Entsorgung, KIT, Eggenstein-Leopoldshafen (Germany); Sakaguchi, Aya [University of Tsukuba, Center for Research in Isotopes and Environmental Dynamics, Tsukuba (Japan)
2015-07-01
AMS is the mass spectrometric method with the highest abundance sensitivity, which is a prerequisite for measurement of the long-lived radioisotope {sup 236}U (t{sub 1/2}=23.4 million years). The most successful application so far is oceanography, since anthropogenic {sup 236}U is present in the world oceans at {sup 236}U:{sup 238}U from 10{sup -11} to 10{sup -8}. We have explored methods to increase the sensitivity and thus to reduce the water volume required to 1 L or less, which significantly reduces the sampling effort. High sensitivity is also necessary to address the expected typical natural isotopic ratios on the order {sup 236}U:{sup 238}U = 10{sup -13}, with potential applications in geology. With a second 90 analyzer magnet and a new Time-of-Flight beam line, VERA is robust against chemical impurities in the background, which e.g. allows measuring Pu isotopes directly in a uranium matrix. This simplifies chemical sample preparation for actinide detection, and may illustrate why AMS reaches lower detection limits than other mass spectrometric methods with nominally higher detection efficiency.
International Nuclear Information System (INIS)
Ruff, Christian M.; Muelllich, Udo; Geist, Andreas; Panak, Petra J.
2012-01-01
Reduction of the radiotoxicity and thermal output of radioactive wastes prior to their permanent disposal is a topic of extreme interest for the issue of final nuclear waste disposal. One possibility to this end is a process referred to as actinide separation. This process can be optimised by means of a newly developed water-soluble molecule, as has been shown in studies on the molecule's complex chemistry using ultra-modern laser-based spectroscopy methods under process-relevant reaction conditions. Through the use of curium (III) and europium (III), which as members of the trivalent actinides and lanthanides family have excellent spectroscopic properties, it has been possible to generate spectroscopic and thermodynamic data which will facilitate our understanding of the complex chemistry and extraction chemistry of this molecule family.
International Nuclear Information System (INIS)
Ackermann, R.J.; Chandrasekharaiah, M.S.
1975-01-01
The thermodynamic data for the actinide metals and oxides (thorium to curium ) have been assessed, examined for consistency, and compared with the lanthanides. Correlations relating the enthalpies of formation of the solid oxides with the corresponding aquo ions make possible the estimation of the thermodynamic properties of AmO 2 (s) and Am 2 O 3 (s) which are in accordance with vaporization data. The known thermodynamic properties of the substoichiometric dioxides MOsub(2-x)(s) at high temperatures demonstrate the relative stabilities of valence states less than 4+ and lead to the examination of stability requirements for the sesquioxides M 2 O 3 (s) and the monoxides MO(s). Sequential trends in the gaseous metals, monoxides and dioxides are examined, compared, and contrasted with the lanthanides. (author)
The analysis and handling concept of minor actinides of NPP’s waste by using Ads technology
International Nuclear Information System (INIS)
Silakhuddin
2008-01-01
The contents of minor actinide elements (americium, neptunium and curium) on the spent fuel inventory from PWR operation of NPP have been calculated using Vista program. The calculation used parameters: enrichment 3.968%, power 1000 M We and burn-up is 60 M Wd/kg. The result of calculation showed that the arising of minor actinide elements on the spent fuel is 16.205 kg/year and 43.471 kg/year for PWR-UOX and PWR-MOX respectively. It is also discussed a concept of the use of ADS technology for transmuting the minor actinide elements contained in spent fuels. The result of the discussion showed that an ADS of 400 M Wth will serve 7 PWRs-UOX, and on the PWR system using UOX and MOX fuels an ADS will serve 3 PWRs. (author)
Potentialities of innovating concepts for the management of radioactive wastes
International Nuclear Information System (INIS)
Boullis, B.
2001-01-01
Nuclear energy has very good assets for the future: economic competitiveness, respect of the environment (no emission of greenhouse gas) and preservation of natural resources (breeding capacity). The main challenge concerns nuclear fuel cycle back-end that is the future of spent fuel but in fact all the cycle is involved because new reactor concepts and multi-recycle strategies can be defined to reduce the amount of high level radioactive wastes. Studies confirm that for an annual production of 400 TWh, it is possible to get a drastic reduction of radiotoxicity of wastes: of about a 3 to 5 ratio by multi-recycling plutonium, of about a 10 to 20 ratio by multi-recycling both plutonium and americium, of about a 100 ratio by multi-recycling plutonium, americium and curium. (A.C.)
International Nuclear Information System (INIS)
Koehler, S.; Albus, F.; Dibenberger, R.; Erdmann, N.; Funk, H.; Hasse, H.; Herrmann, G.; Huber, G.; Kluge, H.; Nunnemann, M.; Passler, G.; Rao, P.M.; Riegel, J.; Trautmann, N.; Urban, F.
1995-01-01
Resonance ionization mass spectroscopy (RIMS) is used for the precise determination of the first ionization potential of transuranium elements. The first ionization potentials (IP) of americium and curium have been measured for the first time to IP Am =5.9738(2) and IP Cm =5.9913(8) eV, respectively, using only 10 12 atoms of 243 Am and 248 Cm. The same technique was applied to thorium, neptunium, and plutonium yielding IP T H =6.3067(2), IP N P =6.2655(2), and IP Pu =6.0257(8) eV. The good agreement of our results with the literature data proves the precision of the method which was additionally confirmed by the analysis of Rydberg seris of americium measured by RIMS. copyright American Institute of Physics 1995
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
Liu, Xu; Li, Xiaoming; Gao, Lixin; Cui, Chuanming; Li, Chunshun; Li, Jia; Wang, Bingui
2011-05-01
Previously, we had characterized several structurally interesting brominated phenols from the marine red alga Symphyocladia latiuscula collected from various sites. However, Phytochemical investigations on this species collected from the Weihai coastline of Shandong Province remains blank. Therefore, we characterized the chemical constituents of individuals of this species collected from the region. Eight bromophenols were isolated and identified. Using detailed spectroscopic techniques and comparisons with published data, these compounds were identified as 2,3-dibromo-4,5-dihydroxybenzyl methyl ether ( 1), 3,5-dibromo-4-hydroxybenzoic acid ( 2), 2,3,6-tribromo-4,5-dihydroxymethylbenzene ( 3), 2,3,6-tribromo-4,5-dihydroxybenzaldehyde ( 4), 2,3,6-tribromo-4,5-dihydroxybenzyl methyl ether ( 5), bis(2,3,6-tribromo-4,5-dihydroxyphenyl)methane ( 6), 1,2-bis(2,3,6-tribromo-4,5-dihydroxyphenyl)-ethane ( 7), and 1-(2,3,6-tribromo-4,5-dihydroxybenzyl)-pyrrolidin-2-one ( 8). Among these compounds, 1 and 2 were isolated for the first time from S. latiuscula. Each compound was evaluated on the ability to inhibit protein tyrosine phosphatase 1B (PTP1B), which is a potential therapeutic target in the treatment of type 2 diabetes. Bromophenols 5, 6, and 7 showed strong activities with IC50 values of 3.9, 4.3, and 3.5 μmol/L, respectively. This study provides further evidence that bromophenols are predominant among the chemical constituents of Symphyocladia, and that some of these compounds may be candidates for the development of anti-diabetes drugs.
International Nuclear Information System (INIS)
1998-01-01
ER-20-6number s ign1 was cored to determine fracture and lithologic properties proximal to the BULLION test cavity. Selected samples from ER-20-6number s ign1 were subjected to matrix and/or fracture diffusion experiments to assess solute movement in this environment. Micrographic analysis of these samples suggests that the similarity in bulk chemical composition results in very similar mineral assemblages forming along natural fractures. These samples are all part of the mafic-poor Calico Hills Formation and exhibit fracture-coating mineral assemblages dominated by mixed illite/smectite clay and illite, with local opaline silica (2,236 and 2, 812 feet), and zeolite (at 2,236 feet). Based on this small sample population, the magnitude to which secondary phases have formed on fracture surfaces bears an apparently inverse relationship to the competency of the host lithology, reflected by variations in the degree of fracturing and the development of secondary phases on fracture surfaces. In the flow breccia at 2,851 feet, thinly developed, localized coatings are developed along persistent open fracture apertures in this competent rock type. Fractures in the devitrified lava from 2,812 feet are irregular, and locally blocked by secondary mineral phases. Natural fractures on the zeolitized tuff from 2,236 feet are discontinuous and irregular and typically obstructed with secondary mineral phases. There are also a second set of clean fractures in the 2,236 foot sample which lack secondary mineral phases and are interpreted to have been induced by the BULLION test. Based on these results, it is expected that matrix diffusion will be enhanced in samples where potentially transmissive fractures exhibit the greatest degree of obstruction (2,236>2,812=2,835>2,851). It is unclear what influence the induced fractures observed at 2,236 feet may have on diffusion given the lack of knowledge on their extent. It is assumed that the bulk matrix diffusion characteristics of the
Energy Technology Data Exchange (ETDEWEB)
Boulyga, S.F. [Forschungszentrum Juelich GmbH (Germany). Zentralabteilung fuer Chemische Analysen]|[Radiation Physics and Chemistry Problems Inst., Minsk (Belarus); Becker, J.S. [Forschungszentrum Juelich GmbH (Germany). Zentralabteilung fuer Chemische Analysen
2000-11-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The {sup 236}U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on inductively coupled plasma quadrupole mass spectrometry with a hexapole collision cell (HEX-ICP-QMS). The figures of merit of the HEX-ICP-QMS were studied with a plasma-shielded torch using different nebulizers (such as an ultrasonic nebulizer (USN) and Meinhard nebulizer) for solution introduction. A {sup 238}U{sup +} ion intensity of up to 27000 MHz/ppm in HEX-ICP-QMS with USN was observed by introducing helium into the hexapole collision cell as the collision gas at a flow rate of 10 ml min{sup -1}. The formation rate of uranium hydride ions UH{sup +}/U{sup +} of 2 x 10{sup -6} was obtained by using USN with a membrane desolvator. The limit of {sup 236}U/{sup 238}U ratio determination in 10 {mu}g 1{sup -1} uranium solution was 3 x 10{sup -7} corresponding to the detection limit for {sup 236}U of 3 pg 1{sup -1}. The precision of uranium isotopic ratio measurements in 10 {mu}g 1{sup -1} laboratory uranium isotopic standard solution was 0.13% ({sup 235}U/{sup 238}U) and 0.33% ({sup 236}U/{sup 238}U) using a Meinhard nebulizer and 0.45% ({sup 235}U/{sup 238}U) and 0.88% ({sup 236}U/{sup 238}U) using a USN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the {sup 236}U/{sup 238}U ratio ranged from 10{sup -5} to 10{sup -3}. (orig.)
Anomalous isotope effects in the U(IV)-U(VI) exchange system
International Nuclear Information System (INIS)
Fujii, Yasuhiko; Nomura, Masao; Okamoto, Makoto; Onitsuka, Hatsuki; Nakanishi, Takashi.
1992-01-01
In previous papers, the enrichment of 236 U in the U(IV) - U(VI) chemical exchange system was found to be significantly smaller than the value estimated by the normal mass dependence enrichment of 235 U. Further experiments have been carried out in the present work to confirm the strange phenomenon of the isotopic anomaly in uranium enrichment. The results have indicated that the separation coefficient of 236 U is the same value as one previously reported. To confirm the anomaly of uranium isotope separation, α-ray spectrometry was implemented to check the enrichment behavior of 234 U. Although no theoretical explanation is given for the isotopic anomaly, this is favorable phenomenon for the re-enrichment of recycled uranium which contains isotopes 232 U and 236 U. (author)
We Bomb, Therefore We Are: The Evolution of Terrorist Group Life Cycles
1994-03-24
34 Political Socialization in Left-Wing Underground Organizations: Biographies of Italian and German Militants," International Social Movement Research... Political Socialization of Terrorist Groups in West Germany," Journal of Political and Military Sociology, v. 11, n. 2, Fall 1983, 236. See also Giorgio...Love?, 30-31. 7 Quoted in Wasmund, " Political Socialization ," 236. 88Irving L. Horowitz, "The Routinization of Terrorism and Its Unanticipated
Järve Keskus : Tallinn, Pärnu mnt. 236 = Järve Centre : 236 Pärnu Rd., Tallinn / Jaak Huimerind
Huimerind, Jaak, 1957-
2003-01-01
Projekteerija: Arhitektuuribüroo Studio Paralleel. Arhitektid Jaak Huimerind, Indrek Saarepera. Kaastöötajad Kristi Põldme, Indrek Laos, Reet Viigipuu. Avalike ruumide sisekujundus: Mari Kurismaa. Konstruktiivne osa: E-Inseneribüroo. Projekt 2000-2002, valmis 2002. Asendi-, I ja II korruse plaan, 6 vaadet
Prospects of Using Reprocessed Uranium in CANDU Reactors, in the U.S. GNEP Program
International Nuclear Information System (INIS)
Ellis, Ronald James
2007-01-01
Current Global Nuclear Energy Partnership (GNEP) plans envision reprocessing spent fuel (SF) with view to minimizing high-level waste (HLW) repository use and recovering actinides (U, Np, Pu, Am, and Cm) for transmutation in reactors as fuel and targets. The reprocessed uranium (RU), however, is to be disposed of. This paper presents a limited-scope analysis of possible reuse of RU in CANDU (Canada Deuterium Uranium) Reactors, within the context of the US GNEP program. Other papers on this topic submitted to this conference discuss the possibility of RU reuse in light-water reactors (LWRs) (with enrichment) and offer an independent economic analysis of RU reuse. A representative RU uranium 'vector', from reprocessed spent LWR fuel, comprises 98.538 wt% 238U, 0.46 wt% 236 U, 0.986 wt% 235 U, and 0.006 wt% 234 U. After multiple recyclings, the concentration of 234 U can approach 0.02 wt%. The presence of 234 U and 236 U in RU reduces the reactivity and fuel lifetime (exit burnup), which is particularly an issue in LWRs. While in PWR analyses, the burnup penalty caused by the concentration of 236 U in RU needs to be offset by additional 235 U enrichment in the amount of ∼25% to 30% of the weight percentage of the 236 U; however, the effect in CANDU is much smaller. Furthermore, since the 235 U content in RU exceeds that of natural uranium, CANDU offers the advantageous option of uranium recycling without reenrichment. The exit burnup of CANDU RU-derived fuel is considerably larger than that for natural uranium-fueled scenario, despite the presence of 234 U and 236 U.
Ternary fission of spontaneously fissile uranium isomers excited by neutrons
International Nuclear Information System (INIS)
Makarenko, V.E.; Molchanov, Y.D.; Otroshchenko, G.A.; Yan'kov, G.B.
1989-01-01
Spontaneously fissile isomers (SFI) of uranium were excited in the reactions 236,238 U(n,n') at an average neutron energy 4.5 MeV. A pulsed electrostatic accelerator and time analysis of the fission events were used. Fission fragments were detected by the scintillation method, and long-range particles from fission were detected by an ionization method. The relative probability of fission of nuclei through a spontaneously fissile isomeric state was measured: (1.30±0.01)·10 -4 ( 236 U) and (1.48±0.02)·10 -4 ( 238 U). Half-lives of the isomers were determined: 121±2 nsec (the SFI 236 U) and 267±13 nsec (the SFI 238 U). In study of the ternary fission of spontaneously fissile isotopes of uranium it was established that the probability of the process amounts to one ternary fission per 163±44 binary fissions of the SFI 236 U and one ternary fission per 49±14 binary fissions of the SFI 238 U. The substantial increase of the probability of ternary fission of SFI of uranium in comparison with the case of ternary fission of nuclei which are not in an isomeric state may be related to a special nucleon configuration of the fissile isomers of uranium
International Nuclear Information System (INIS)
Musikas, C.; Germain, M.; Bathellier, A.
1979-01-01
This paper deals with Am (VI) - Cm (III) separation in nitrate media. The kinetics of oxidation of Am (III) by sodium persulfate in the presence of Ag + ions were reinvestigated by studying the effect of additions of small amounts of reagents which do not drastically change the distribution coefficients of Am (VI) or Cm (III) ions. Organo phosphorus solvents were selected because they are radiation resistant, possess weak reductant properties and that their affinity for hexavalent ion is high. The operating procedure was selected by consideration of the results of the two previous investigations. This can be done by using a centrifugal contactor enabling in to set organic-aqueous phase contact time in accordance with the kinetics of extraction of Am (VI), oxidation of Am (III) in aqueous phase, and reduction of Am (VI) in organic phase
The design of the DUPIC spent fuel bundle counter
International Nuclear Information System (INIS)
Menlove, H.O.; Rinard, P.M.; Kroncke, K.E.; Lee, Y.G.
1997-05-01
A neutron coincidence detector had been designed to measure the amount of curium in the fuel bundles and associated process samples used in the direct use of plutonium in Canadian deuterium-uranium (CANDU) fuel cycle. All of the sample categories are highly radioactive from the fission products contained in the pressurized water reactor (PWR) spent fuel feed stock. Substantial shielding is required to protect the He-3 detectors from the intense gamma rays. The Monte Carlo neutron and photon calculational code has been used to design the counter with a uniform response profile along the length of the CANDU-type fuel bundle. Other samples, including cut PWR rods, process powder, waste, and finished rods, can be measured in the system. This report describes the performance characteristics of the counter and support electronics. 3 refs., 23 figs., 6 tabs
International Nuclear Information System (INIS)
Wrenn, M.E.
1981-01-01
The primary purpose of actinide chelation is to decrease the risk from radiation-induced cancer. While occupational exposures in the past have mainly involved low specific activity 239 Pu, future exposures will increasingly involve high specific activity plutonium, americium, and curium - all of which clear more rapidly from the lung. This will tend to shift the cancer risk from lung to bone and liver. Although therapy with Ca- or Zn-DTPA rapidly removes 241 Am from the canine, the sub-human primate, and the human liver, improved methods for removal from bone and lung are needed. DTPA can remove 241 Am more easily from the growing skeleton of a child than from the mature skeleton of an adult. Investigators at Karlsruhe are developing chelation agents for oral administration and are investigating the reduction in local dose to bone resulting from chelation therapy
Transuranic biokinetic parameters for marine invertebrates--a review.
Ryan, T P
2002-04-01
A catalogue of biokinetic parameters for the transuranic elements plutonium, americium, curium, neptunium, and californium in marine invertebrates is presented. The parameters considered are: the seawater-animal concentration factor (CF); the sediment-animal concentration ratio (CR); transuranic assimilation efficiency; transuranic tissue distribution and transuranic elimination rates. With respect to the seawater-animal CF, authors differ considerably on how they define this parameter and a seven-point reporting system is suggested. Transuranic uptake from sediment by animals is characterised by low CRs. The assimilation efficiencies of transuranic elements in marine invertebrates are high compared to vertebrates and mammals in general and the distribution of transuranics within the body tissue of an animal is dependent on the uptake path. The elimination of transuranics from most species examined conformed to a standard biphasic exponential model though some examples with three elimination phases were identified.
Influence of FIMA burnup on actinides concentrations in PWR reactors
Directory of Open Access Journals (Sweden)
Oettingen Mikołaj
2016-01-01
Full Text Available In the paper we present the study on the dependence of actinides concentrations in the spent nuclear fuel on FIMA burnup. The concentrations of uranium, plutonium, americium and curium isotopes obtained in numerical simulation are compared with the result of the post irradiation assay of two spent fuel samples. The samples were cut from the fuel rod irradiated during two reactor cycles in the Japanese Ohi-2 Pressurized Water Reactor. The performed comparative analysis assesses the reliability of the developed numerical set-up, especially in terms of the system normalization to the measured FIMA burnup. The numerical simulations were preformed using the burnup and radiation transport mode of the Monte Carlo Continuous Energy Burnup Code – MCB, developed at the Department of Nuclear Energy, Faculty of Energy and Fuels of AGH University of Science and Technology.
Review of Integral Experiments for Minor Actinide Management
International Nuclear Information System (INIS)
Gil, C.S.; Glinatsis, G.; Hesketh, K.; Iwamoto, O.; Okajima, S.; Tsujimoto, K.; Jacqmin, R.; Khomyakov, Y.; Kochetkov, A.; Kormilitsyn, M.; Palmiotti, G.; Salvatores, M.; Perret, G.; Rineiski, A.; Romanello, V.; Sweet, D.
2015-01-01
Spent nuclear fuel contains minor actinides (MAs) such as neptunium, americium and curium, which require careful management. This becomes even more important when mixed oxide (MOX) fuel is being used on a large scale since more MAs will accumulate in the spent fuel. One way to manage these MAs is to transmute them in nuclear reactors, including in light water reactors, fast reactors or accelerator-driven subcritical systems. The transmutation of MAs, however, is not straightforward, as the loading of MAs generally affects physics parameters, such as coolant void, Doppler and burn-up reactivity. This report focuses on nuclear data requirements for minor actinide management, the review of existing integral data and the determination of required experimental work, the identification of bottlenecks and possible solutions, and the recommendation of an action programme for international co-operation. (authors)
Minor actinides transmutation scenario studies with PWRs, FRs and moderated targets
International Nuclear Information System (INIS)
Grouiller, J.P.; Pillon, S.; Saint Jean, C. de; Varaine, F.; Leyval, L.; Vambenepe, G.; Carlier, B.
2003-01-01
Using current technologies, we have demonstrated in this study that it is theoretically possible to obtain different minor actinide transmutation scenarios with a significant gain on the waste radiotoxicity inventory. The handling of objects with Am+Cm entails the significant increase of penetrating radiation sources (neutron and γ) whatever mixed scenario is envisioned; the PWR and FR scenario involving the recycling of Am + Cm in the form of targets results in the lowest flow. In the light of these outcomes, the detailed studies has allowed to design a target sub assembly with a high fission rate (90%) and define a drawing up of reprocessing diagram with the plant head, the minor actinide separation processes (PUREX, DIAMEX and SANEX). Some technological difficulties appear in manipulating curium, principally in manufacturing where the wet process ('sol-gel') is not acquired for (Am+Cm). (author)
Energy Technology Data Exchange (ETDEWEB)
Fukahori, Tokio [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-03-01
Under International Science Research Center (ISTC) projects, JAERI Nuclear Data Center has been taking a role of collaborator and monitor for following items; (1) Measurement of the Fission Neutron Spectra of the Minor Actinides and Spontaneous Fission of Curium Isotopes (ISTC no. 183: V.I. Khlopin Radium Institute, KRI, St. Petersburg, Russia), (2) Measurement and Analysis of the Basic Nuclear Data for Minor Actinides (ISTC no. 304: Institute of Physics and Power Engineering, IPPE, Obninsk, Russia), and Evaluation of Actinide Nuclear Data (ISTC no. CIS-3: Radiation Physics and Chemistry Problems Institute, RPCPI, Minsk, Belarus). These are related to the Japanese OMEGA Project and expected to supply minor actinide (MA) nuclear data, since Russia has good quality MA samples, experimental technique and nuclear data evaluation experiences. In this report, out-line and some results of above three projects are reviewed. (author)
International Nuclear Information System (INIS)
Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.
2008-07-01
The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)
Mobility of U, Np, Pu, Am and Cm from spent nuclear fuel into bentonite clay
International Nuclear Information System (INIS)
Ramebaeck, H.; Skaalberg, M.; Eklund, U.B.; Kjellberg, L.; Werme, L.
1998-01-01
The mobility of uranium, neptunium, plutonium, americium and curium from spent nuclear fuel (UO 2 ) into compacted bentonite was studied. Pieces of spent BWR UO 2 fuel was embedded in a compacted bentonite clay/low saline synthetic groundwater system. After a contact time of six years the bentonite was sliced into 0.1 mm thick slices and analysed for its content of actinides. Radiometric as well as inductively coupled plasma mass spectrometry (ICP-MS) were used for the analysis. The influence on the mobility by the addition of metallic iron, metallic copper and vivianite (Fe(II)-mineral) to the bentonite clay was investigated. The results show a low mobility of actinides in bentonite clay. Except for uranium the mobility of the other actinides could, after six years of diffusion time, only be detected less than 1 mm from the spent fuel. (orig.)
International Nuclear Information System (INIS)
Bringer, O.
2007-10-01
This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241 Am and 237 Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241 Am isomeric branching ratio were precisely measured at thermal energy point. (author)
Am/Cm Vitrification Process: Pretreatment Material Balance Calculations
International Nuclear Information System (INIS)
Smith, F.G.
2001-01-01
This report documents material balance calculations for the pretreatment steps required to prepare the Americium/Curium solution currently stored in Tank 17.1 in the F-Canyon for vitrification. The material balance uses the latest analysis of the tank contents to provide a best estimate calculation of the expected plant operations during the pretreatment process. The material balance calculations primarily follow the material that directly leads to melter feed. Except for vapor products of the denitration reactions and treatment of supernate from precipitation and precipitate washing, the flowsheet does not include side streams such as acid washes of the empty tanks that would go directly to waste. The calculation also neglects tank heels. This report consolidates previously reported results, corrects some errors found in the spreadsheet and provides a more detailed discussion of the calculation basis
Conceptual methods for actinide partitioning
International Nuclear Information System (INIS)
Leuze, R.E.; Bond, W.D.; Tedder, D.W.
1978-01-01
The conceptual processing sequence under consideration is based on a combination of modified Purex processing and secondary processing of the high-level waste. In this concept, iodine will be removed from dissolver solution prior to extraction, and the Purex processing will be modified so that low- and intermediate-level wastes, all the way through final product purification, are recycled. A supplementary extraction is assumed to ensure adequate recovery of uranium, neptunium and possibly plutonium. Technetium may be removed from the high-level waste if a satisfactory method can be developed. Extraction into a quaternary amine is being evaluated for this removal. Methods that have been used in the past to recover americium and curium have some rather serious deficiencies, including inadequate recovery, solids formation and generation of large volumes of low- and intermediate-level wastes containing significant quantities of chemical reagents
Flammability Analysis For Actinide Oxides Packaged In 9975 Shipping Containers
Energy Technology Data Exchange (ETDEWEB)
Laurinat, James E.; Askew, Neal M.; Hensel, Steve J.
2013-03-21
Packaging options are evaluated for compliance with safety requirements for shipment of mixed actinide oxides packaged in a 9975 Primary Containment Vessel (PCV). Radiolytic gas generation rates, PCV internal gas pressures, and shipping windows (times to reach unacceptable gas compositions or pressures after closure of the PCV) are calculated for shipment of a 9975 PCV containing a plastic bottle filled with plutonium and uranium oxides with a selected isotopic composition. G-values for radiolytic hydrogen generation from adsorbed moisture are estimated from the results of gas generation tests for plutonium oxide and uranium oxide doped with curium-244. The radiolytic generation of hydrogen from the plastic bottle is calculated using a geometric model for alpha particle deposition in the bottle wall. The temperature of the PCV during shipment is estimated from the results of finite element heat transfer analyses.
Some neutron and gamma radiation characteristics of plutonium cermet fuel for isotopic power sources
Neff, R. A.; Anderson, M. E.; Campbell, A. R.; Haas, F. X.
1972-01-01
Gamma and neutron measurements on various types of plutonium sources are presented in order to show the effects of O-17, O-18 F-19, Pu-236, age of the fuel, and size of the source on the gamma and neutron spectra. Analysis of the radiation measurements shows that fluorine is the main contributor to the neutron yields from present plutonium-molybdenum cermet fuel, while both fluorine and Pu-236 daughters contribute significantly to the gamma ray intensities.
49 CFR 236.909 - Minimum performance standard.
2010-10-01
...://www.archives.gov/federal_register/code_of_federal_regulations/ibr_locations.html; (ii) The product is... exposure must be expressed as total train miles traveled per year over the relevant railroad infrastructure...
49 CFR 236.552 - Insulation resistance; requirement.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING THE INSTALLATION... resistance between wiring and ground of continuous inductive automatic cab signal system, automatic train...
48 CFR 852.236-87 - Accident prevention.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Accident prevention. 852... Accident prevention. As prescribed in 836.513, insert the following clause: Accident Prevention (SEP 1993) The Resident Engineer on all assigned construction projects, or other Department of Veterans Affairs...
33 CFR 236.5 - Policy and procedure.
2010-07-01
... manage when directly integrated with the implementation or management of the water resource development... created by a water resource development to be recommended for implementation by the Corps of Engineers. (3... DEFENSE WATER RESOURCE POLICIES AND AUTHORITIES: CORPS OF ENGINEERS PARTICIPATION IN IMPROVEMENTS FOR...
48 CFR 52.236-4 - Physical Data.
2010-10-01
..., such as surveys, auger borings, core borings, test pits, probings, test tunnels]. (b) Weather... fixed-price construction contract is contemplated and physical data (e.g., test borings, hydrographic...