
Sample records for curium 236

  1. Infrared spectrum of curium-244

    International Nuclear Information System (INIS)

    Conway, J.G.; Blaise, J.; Verges, J.


    The spectrum of curium-244 has been observed on the high resolution Fourier-transform spectrometer at Laboratoire Aime Cotton. An electrodeless lamp containing 50 μg of CmI 3 was run for 12 hours and 800,000 points were taken. A total of 1743 lines have been ascribed to curium and 87 percent of the lines have been assigned to transitions between known energy levels

  2. Measurement of curium in marine samples (United States)

    Schneider, D. L.; Livingston, H. D.


    Measurement of environmentally small but detectable amounts of curium requires reliable, accureate, and sensitive analytical methods. The radiochemical separation developed at Woods Hole is briefly reviewed with specific reference to radiochemical interferences in the alpha spectrometric measurement of curium nuclides and to the relative amounts of interferences expected in different oceanic regimes and sample types. Detection limits for 242 Cm and 244 Cm are ultimately limited by their presence in the 243Am used as curium yield monitor. Environmental standard reference materials are evaluated with regard to curium. The marine literature is reviewed and curium measurements are discussed in relation to their source of introduction to the environment. Sources include ocean dumping of low-level radioactive wastes and discharges from nuclear fuel reporcessing activities, In particular, the question of a detectable presence of 244Cm in global fallout from nuclear weapons testing is addressed and shown to be essentially negligible. Analyses of Scottish coastal sedimantes show traces of 242Cm and 244Cm activity which are believed to originate from transport from sources in the Irish Sea.

  3. Biological transport of curium-243 in dairy animals

    International Nuclear Information System (INIS)

    Sutton, W.W.; Patzer, R.G.; Hahn, P.B.; Potter, G.D.


    Lactating cows and goats were used to examine the biological transport of curium-243 in dairy animals. After either single oral or intravenous nuclide doses were administered, samples of milk, urine, blood, and feces were taken over a 144-hr priod, and the curium concentrations were determined by gamma counting. Gastrointestinal uptake of curium was estimated to be 0.02 and 0.006% of the oral dose for cows and goats, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.6 x 10 -4 and 1.9 x 10 -3 , respectively, for a cow and 2.7 x 10 -4 and 1.6 x 10 -4 , respectively, for goats. Plasma concentrations of curium decreased rapidly following all intravenous injections. The average percentage of injected curium transferred to milk, urine, and feces was 2, 8, and 1, respectively, for a cow and 2, 5, and 5, respectively, for goats. All animals were sacrificed one week after dosing. Bovine bone retained the greatest fraction of the administered dose and the next highest was the liver. However, in all three intravenously dosed goats the liver contained the greatest amount of curium. Nuclide deposition in bone and liver was essentially equal for two of the three orally dosed goats while the skeleton contained the most curium in the other animal. Comparisons are presented between curium-243 and americium-241 transport in dairy cows

  4. Americium/curium bushing melter drain tests

    International Nuclear Information System (INIS)

    Smith, M.E.; Hardy, B.J.; Smith, M.E.


    Americium and curium were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. They have been stored in a nitric acid solution in an SRS reprocessing facility for a number of years. Vitrification of the americium/curium (Am/Cm) solution will allow the material to be safely stored or transported to the DOE Oak Ridge Reservation. Oak Ridge is responsible for marketing radionuclides for research and medical applications. The bushing melter technology being used in the Am/Cm vitrification research work is also under consideration for the stabilization of other actinides such as neptunium and plutonium. A series of melter drain tests were conducted at the Savannah River Technology Center to determine the relationship between the drain tube assembly operating variables and the resulting pour initiation times, glass flowrates, drain tube temperatures, and stop pour times. Performance criteria such as ability to start and stop pours in a controlled manner were also evaluated. The tests were also intended to provide support of oil modeling of drain tube performance predictions and thermal modeling of the drain tube and drain tube heater assembly. These drain tests were instrumental in the design of subsequent melter drain tube and drain tube heaters for the Am/Cm bushing melter, and therefore in the success of the Am/Cm vitrification and plutonium immobilization programs


    Baybarz, R.D.; Lloyd, M.H.


    This invention relates to methods of separating americium and curium values from rare earth values. In accordance with the invention americium, curium, and rare earth values are sorbed on an anion exchange resin. A major portion of the rare earth values are selectively stripped from the resin with a concentrated aqueous solution of lithium chloride, and americium, curium, and a minor portion of rare earth values are then stripped from the resin with a dilute aqueous solution of lithium chloride. The americium and curium values are further purified by increasing the concentration of lithium chloride in the solution to at least 8 molar and selectively extracting rare earth values from the resulting solution with a monoalkylphosphoric acid. (AEC)

  6. Americium/Curium Disposition Life Cycle Planning Study

    International Nuclear Information System (INIS)

    Jackson, W.N.; Krupa, J.; Stutts, P.; Nester, S.; Raimesch, R.


    At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS)

  7. Americium-curium vitrification process development

    International Nuclear Information System (INIS)

    Fellinger, A.P.; Baich, M.A.; Hardy, B.J


    The successful demonstration of sequentially drying, calcining and vitrifying an oxalate slurry in the Drain Tube Test Stand (DTTS) vessel provided the process basis for testing on a larger scale in a cylindrical induction heated melter. A single processing issue, that of batch volume expansion, was encountered during the initial stage of testing. The increase in batch volume centered on a sintered frit cap and high temperature bubble formation. The formation of a sintered frit cap expansion was eliminated with the use of cullet. Volume expansions due to high temperature bubble formation (oxygen liberation from cerium reduction) were mitigated in the DTTS melter vessel through a vessel temperature profile that effectively separated the softening point of the glass cullet and the evolving oxygen from cerium reduction. An increased processing temperature of 1,470 C and a two hour hold time to find any remaining bubbles successfully reduced bubbles in the poured glass to an acceptable level. The success of the preliminary process demonstrations provided a workable process basis that was directly applicable to the newly installed Cylindrical Induction Melter (CIM) system, making the batch flowsheet the preferred option for vitrification of the americium-curium surrogate feed stream

  8. Sorption of curium by silica colloids: Effect of humic acid

    International Nuclear Information System (INIS)

    Kar, Aishwarya Soumitra; Kumar, Sumit; Tomar, B.S.; Manchanda, V.K.


    Sorption of curium by silica colloids has been studied as a function of pH and ionic strength using 244 Cm as a tracer. The sorption was found to increase with increasing pH and reach a saturation value of ∼95% at pH beyond 5.3. The effect of humic acid on the sorption of 244 Cm onto silica was studied by changing the order of addition of the metal ion and humic acid. In general, in the presence of humic acid (2 mg/L), the sorption increased at lower pH (<5) while it decreased in the pH range 6.5-8 and above pH 8, the sorption was found to increase again. As curium forms strong complex with humic acid, its presence results in the enhancement of curium sorption at lower pH. At higher pH the humic acid present in the solution competes with the surface sites for curium thus decreasing the sorption. The decrease in the Cm sorption in presence of humic acid was found to be less when humic acid was added after the addition of curium. Linear additive model qualitatively reproduced the profile of the Cm(III) sorption by silica in presence of humic acid at least in the lower pH region, however it failed to yield quantitative agreement with the experimental results. The results of the present study evidenced the incorporation of Cm into the silica matrix.

  9. A contribution to preparative micro-chemistry and structural chemistry of element 96, curium

    International Nuclear Information System (INIS)

    Kohl, R.


    Ternary oxides of curium are analyzed by preparing a spectrum of different phases and characterizing it by radiography. Physical and thermodynamic data are established on curium trihalogenides. Particular interest is taken in experiments for preparing curium of the higher valency stages IV, V, and VI. (orig./PW) [de

  10. Process for the recovery of curium-244 from nuclear waste

    International Nuclear Information System (INIS)

    Posey, J.C.


    A process has been designed for the recovery of curium from purex waste. Curium and americium are separated from the lanthanides by a TALSPEAK extraction process using differential extraction. Equations were derived for the estimation of the economically optimum conditions for the extraction using laboratory batch extraction data. The preparation of feed for the extraction involves the removal of nitric acid from the Purex waste by vaporization under reduced pressure, the leaching of soluble nitrates from the resulting cake, and the oxalate precipitation of a pure lanthanide-actinide fraction. Final separation of the curium from americium is done by ion-exchange. The steps of the process, except ion-exchange, were tested on a laboratory scale and workable conditions were determined

  11. The biokinetics and radiotoxicology of curium: A comparison with americium

    Energy Technology Data Exchange (ETDEWEB)

    Menetrier, F. [CEA, Fontenay-aux-Roses (France); Taylor, D.M. [School of Chemistry, Cardiff University, Cardiff CF10 3AT (United Kingdom)], E-mail:; Comte, A. [CEA, Fontenay-aux-Roses (France)


    The human and animal data on the biokinetics of {sup 242}Cm and {sup 244}Cm are reviewed and shown to be very similar to those for {sup 241}Am. Liver and skeleton are the main organs of deposition and the retention of curium in the skeleton is very prolonged in all the species examined. Retention of both curium and americium in the liver appears to be species-dependent, being relatively rapidly removed from the liver of rats, and probably humans, but being tenaciously retained in dogs and some other species. The radiotoxicity of curium is also reviewed and it is shown that, as with {sup 241}Am, lung and bone tumour induction are the major hazards from inhaled and systemically deposited {sup 244}Cm. The use of chelating agents for the treatment of accidental contamination of the human body with {sup 242,244}Cm is also discussed.

  12. Subcellular distribution of curium in beagle liver

    International Nuclear Information System (INIS)

    Bruenger, F.W.; Grube, B.J.; Atherton, D.R.; Taylor, G.N.; Stevens, W.


    The subcellular distribution of curium ( 243 244 Cm) was studied in canine liver from 2 hr to 47 days after injection of 3 μCi 243 244 Cm/kg of body weight. The pattern of distribution for Cm was similar to other trivalent actinide elements studied previously (Am, Cf). Initially (2 hr), most of the nuclide was found in the cytosol and at least 90 percent was protein bound. About 70 percent of the Cm was bound to ferritin, approximately 5 percent was associated with a protein of MW approximately 200,000, and approximately 25 percent was found in the low-molecular-weight region (approximately 5000). The decrease in the Cm content of cytosol, nuclei, and microsomes coincided with an increase in the amount associated with mitochondria and lysosomes. The concentration of the Cm in the mitochondrial fraction was higher than it was in the lysosomal fraction at each time studied. In the mitochondrial fraction approximately 30 percent of the Cm was bound to membranous or granular material, and 70 percent was found in the soluble fraction. The Cm concentration initially associated with cell nuclei was high but had diminished to 20 percent of the 2 hr concentration by 20 days post injection (PI). The subcellular distribution of Cm in the liver of a dog which had received the same dose and was terminated because of severe liver damage was studied at 384 days PI. The liver weighed 130 g and contained approximately 30 percent of the injected Cm. In contrast, a normal liver weighs 280 g and at 2 hr PI contains approximately 40 percent of the injected dose. The subcellular distribution of Cm in this severely damaged liver differed from the pattern observed at earlier times after injection. The relative concentration of Cm in the cytosol was doubled; it was higher in the nuclei-debris fraction; and it was lower in the mitochondrial and lysosomal fractions when compared to earlier times

  13. Modelling of curium and americium behaviour during separation with displacing complexing chromatography

    International Nuclear Information System (INIS)

    Chuveleva, Eh.A.; Kharitonov, O.V.; Firsova, L.A.


    Certain heavy rare earths, curium and americium were separated by the method of displacement complexing chromatography using DTPA solutions and solutions containing DTPA and citric acid as eluents. Separation factors of rare earths and curium (americium) were calculated. Imitators for curium and americium separation were suggested: thulium for curium elution using 0.025 mol/l DTPA, holmium-for curium elution using 0.025 mol/l DTPA in the presence of 0.025 mol/l citric acid; terbium can serve as the imitator in both cases. 5 refs., 5 figs

  14. Calculation of prompt neutron spectra for curium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Ohsawa, Takaaki [Kinki Univ., Higashi-Osaka, Osaka (Japan). Atomic Energy Research Inst.


    With the aim of checking the existing evaluations contained in JENDL-3.2 and providing new evaluations based on a methodology proposed by the author, a series of calculations of prompt neutron spectra have been undertaken for curium isotopes. Some of the evaluations in JENDL-3.2 was found to be unphysically hard and should be revised. (author)

  15. Determination of plutonium, americium and curium in the marine environment

    International Nuclear Information System (INIS)

    Grenaut, CLaude; Germain, Pierre; Miramand, Pierre.


    The method used in the Laboratory for plutonium, americium and curium determination in marine samples (water, sediments, animals, plants) is presented. It is a modification of a procedure based on adsorption on ion exchange resins developed by other authors. The preliminary preparation of the samples, the radiochemical procedures and electrodeposition are described so as to be used as a practical handbook [fr

  16. Thermodynamic systematics of oxides of americium, curium, and neighboring elements

    International Nuclear Information System (INIS)

    Morss, L.R.


    Recently-obtained calorimetric data on the sesquioxides and dioxides of americium and curium are summarized. These data are combined with other properties of the actinide elements to elucidate the stability relationships among these oxides and to predict the behavior of neighboring actinide oxides. 45 references, 4 figures, 5 tables

  17. The curium tagging approach for enhanced safeguards for spent fuel handling and reprocessing

    International Nuclear Information System (INIS)

    Menlove, H.O.; Beddingfield, D.H.; Rinard, P.M.; Wenz, T.R.


    Because of the intense neutron emission rate from curium, it can be a useful signature to measure and track special nuclear material in spent fuel and waste. By measuring the concentration of curium as well as plutonium and uranium in spent fuel streams, the ratio of curium to plutonium, uranium or other actinides can be used for waste assay. The quantity of special nuclear material in the waste streams such as the leached hulls and vitrified high-level waste can be calculated from the ratio of the curium to the plutonium, etc. The quantity of curium can be measured from the neutron emission rate from the various waste streams in the presence of the high-level gamma-ray backgrounds from fission products. Examples of using the curium ratio technique for measuring plutonium in leached hulls and vitrified waste canisters are presented in this paper. (author)

  18. Extraction separation of americium and curium. A review

    International Nuclear Information System (INIS)

    Petrzilova, H.


    A survey is given of extraction systems suitable for transplutonium element separation and preparation as well as for the practical application of their nuclear properties. Methods are discussed in detail of separating the actinide and the lanthanide fractions from fission and corrosion products and of separating americium from curium. The description is completed with flowsheets showing the separation of transplutonium elements from irradiated targets and waste solutions after spent fuel reprocessing. (L.K.)

  19. Gut uptake factors for plutonium, americium and curium

    International Nuclear Information System (INIS)

    Harrison, J.D.


    Data on estimates of the absorption of plutonium, americium and curium from the human gut based on measurements of uptake in other mammalian species are reviewed. It is proposed that for all adult members of the public ingesting low concentrations of plutonium in food and water, 0.05% would be an appropriate value of absorption except when the conditions of exposure are known and a lower value can be justified. For dietary intakes of americium and curium, the available data do not warrant a change from the ICRP value of 0.05%. For newborn children ingesting americium, curium and soluble forms of plutonium, a value of 1% absorption is proposed for the first 3 months of life during which the infant is maintained on a milk diet. It is proposed that a value of 0.5% should be used for the first year of life to take account of the gradual maturation of the gut. In considering the ingestion of insoluble oxides of plutonium by infants, it is proposed that absorption is taken as 0.1% for the first 3 months and 0.05% for the first year. (author)

  20. Plant uptake of americium, curium, and the chemical analog neodymium

    International Nuclear Information System (INIS)

    Weimer, W.C.; Laul, J.C.; Kutt, J.C.; Bondietti, E.A.


    The plant uptake from several bulk soils has been determined for neodymium, a chemical analog to the transuranium elements americium and curium, and several other native rare earth elements as well. These investigations have demonstrated that neodymium, which has very similar chemical properties to amercium and curium and should have a similar environmental behavior, does behave indistinguishably under both laboratory and field conditions. The uptake of the weathered or mobile forms of these elements from soils is expected to be governed primarily by their identical oxidation states and nearly identical ionic radii. This hypothesis is strongly supported by the chondritic (primordial) normalized rare earth element patterns in several plants. In these samples, the entire series of rare earth elements behaves as a smooth function of the REE ionic radii, as is also seen in the contiguous soils. This behavior suggests that the plant uptake of other ions with similar chemical properties (i.e., americium and curium) would also be governed by ionic size and charge

  1. Analytical separation of americium and curium, using high performance liquid chromatography

    International Nuclear Information System (INIS)

    Billon, A.


    Americium and curium are separated on a column of cation exchange resin (Aminex) using hydroxyisobutyric acid (α HIBA) as eluent, at a temperature of 80 0 C. Americium and curium were detected in line using their α emission: the separation was performed in a shielded glove box whose setting-up is given. Finally, the time necessary for a separation is comprised between 30 min and 1 hr. The purity of separated fractions was assayed by mass-spectrometry. An application in the determination of isotopic composition of americium and curium in fuels is described

  2. Americium/Curium Vitrification Pilot Tests - Part II

    International Nuclear Information System (INIS)

    Marra, J.E.; Baich, M.A.; Fellinger, A.P.; Hardy, B.J.; Herman, D.T.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T. K.; Stone, M.E.


    Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. A previous paper described operation results from the Am-Cm Melter 2A pilot system, a full-scale non-radioactive pilot facility. This paper presents the results from continued testing in the Pilot Facility and also describes efforts taken to look at alternative vitrification process operations and flowsheets designed to address the problems observed during melter 2A pilot testing

  3. Pretreatment of americium/curium solutions for vitrification

    International Nuclear Information System (INIS)

    Rudisill, T.S.


    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to the heavy isotope programs at Oak Ridge National Laboratory. Prior to vitrification, an in-tank oxalate precipitation and a series of oxalic/nitric acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Pretreatment development experiments were performed to understand the behavior of the lanthanides and the metal impurities during the oxalate precipitation and properties of the precipitate slurry. The results of these experiments will be used to refine the target glass composition allowing optimization of the primary processing parameters and design of the solution transfer equipment

  4. Remote micro-encapsulation of curium-gold cermets

    International Nuclear Information System (INIS)

    Coops, M.S.; Voegele, A.L.; Hayes, W.N.; Sisson, D.H.


    A technique is described for fabricating minature, high-density capsules of curium-244 oxide contained in three concentric jackets of metallic gold (or silver), with the outer surface being free of alpha contamination. The completed capsules are right circular cylinders 0.2500-inch diameter and 0.125-inch tall, with each level of containment soldered (or brazed) closed. A typical capsule would contain approx. 70 mg of 244 Cm (5.7 Ci) mixed with 120 mg of gold powder in the form of a cermet wafer clad in three concentric, 0.010-inch thick, liquid tight jackets. This method of fabrication eliminates voids between the jackets and produces a minimum size, maximum density capsule. Cermet densities of 11.5 g/cc were obtained, with an overall density of 17.3 g/cc for the finished capsule

  5. Density of simulated americium/curium melter feed solution

    International Nuclear Information System (INIS)

    Rudisill, T.S.


    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70 degrees C. The measured density decreased linearly at a rate of 0.0007 g/cm3/degree C from an average value of 1.2326 g/cm 3 at 20 degrees C to an average value of 1.1973g/cm 3 at 70 degrees C

  6. Americium/Curium Melter 2A Pilot Tests

    International Nuclear Information System (INIS)

    Smith, M.E.; Fellinger, A.P.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T.K.; Stone, M.E.; Witt, D.C.


    Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. To this end, the Am/Cm Melter 2A pilot system, a full-scale non- radioactive pilot plant of the system to be installed at the reprocessing facility, was designed, constructed and tested. The full- scale pilot system has a frit and aqueous feed delivery system, a dual zone bushing melter, and an off-gas treatment system. The main items which were tested included the dual zone bushing melter, the drain tube with dual heating and cooling zones, glass compositions, and the off-gas system which used for the first time a film cooler/lower melter plenum. Most of the process and equipment were proven to function properly, but several problems were found which will need further work. A system description and a discussion of test results will be given

  7. Density of simulated americium/curium melter feed solution

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.S.


    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70{degrees} C. The measured density decreased linearly at a rate of 0.0007 g/cm3/{degree} C from an average value of 1.2326 g/cm{sup 3} at 20{degrees} C to an average value of 1.1973g/cm{sup 3} at 70{degrees} C.

  8. Study of Reaction of Curium Oxy-Compound Formation in Molten Chlorides

    Energy Technology Data Exchange (ETDEWEB)

    Osipenko, A.G.; Mayorshin, A.A.; Bychkov, A.V. [Dimitrovgrad-10, Ulyanovsk region, 433510 (Russian Federation)


    The method of potentiometric titration using oxygen sensors with solid electrolyte membrane was applied for the study of the interaction of curium cations with oxygen anions in the molten alkali metal chlorides in the temperature range of 450-850 C degrees depending on oxy-acidity of the environment. Assumptions were made concerning ion and phase composition of the obtained high-temperature compounds and chemical reactions taking place in the melts. This scheme assumes that as the basicity of the melt increases, initially the formation of soluble curium oxychlorides takes place in the melt (presumably CmO{sup -}) that is followed by formation of solid CmOCl and finally sesquioxide Cm{sub 2}O{sub 3}. Basic thermodynamic values were calculated for the resultant curium oxy-compounds.

  9. The rapid determination of americium curium, and uranium in urine by ultrafiltration

    International Nuclear Information System (INIS)

    Stradling, G.N.; Popplewell, D.S.; Ham, G.J.; Griffin, R.


    The rapid ultrafiltration method developed for the assay of plutonium has been extended to the determination of americium, curium and uranium in urine. The limits of detection for americium and curium, and uranium are 0.09 and 0.12 dm -1 l -1 respectively, and the analysis time excluding counting less than 2 hours. The method can therefor be effectively used as a rapid screening procedure. When the reference level for plutonium is exceeded, the α activity may require to be characterised. The single ultrafiltration technique must be modified for turbid urine samples. The method is inappropriate, except for uranium, when the urine contains DTPA. (author)

  10. National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242

    International Nuclear Information System (INIS)

    Adams, J.P.


    This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 ( 242 Cm). This report also includes discussions about waste types and forms in which 242 Cm can be found and 242 Cm behavior in the environment and in the human body

  11. Final report on the decontamination of the Curium Source Fabrication Facility

    International Nuclear Information System (INIS)

    Schaich, R.W.


    The Curium Source Fabrication Facility (CSFF) at Oak Ridge National Laboratory (ORNL) was decontaminated to acceptable contamination levels for maintenance activities, using standard decontamination techniques. Solid and liquid waste volumes were controlled to minimize discharges to the ORNL waste systems. This program required two years of decontamination effort at a total cost of approximately $700K. 5 references, 7 figures, 2 tables

  12. National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242

    Energy Technology Data Exchange (ETDEWEB)

    Adams, J.P.


    This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 ({sup 242}Cm). This report also includes discussions about waste types and forms in which {sup 242}Cm can be found and {sup 242}Cm behavior in the environment and in the human body.

  13. Safety analysis report for packaging (SARP) of the Oak Ridge National Laboratory. TRU curium shipping container

    International Nuclear Information System (INIS)

    Box, W.D.; Klima, B.B.; Seagren, R.D.; Shappert, L.B.; Aramayo, G.A.


    An analytical evaluation of the Oak Ridge National Laboratory Transuranium (TRU) Curium Shipping Container was made to demonstrate its compliance with the regulations governing offsite shipment of packages containing radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of the evaluation show that the container complies with the applicable regulations

  14. Solubility of Plutonium (IV) Oxalate During Americium/Curium Pretreatment

    International Nuclear Information System (INIS)

    Rudisill, T.S.


    Approximately 15,000 L of solution containing isotopes of americium and curium (Am/Cm) will undergo stabilization by vitrification at the Savannah River Site (SRS). Prior to vitrification, an in-tank pretreatment will be used to remove metal impurities from the solution using an oxalate precipitation process. Material balance calculations for this process, based on solubility data in pure nitric acid, predict approximately 80 percent of the plutonium in the solution will be lost to waste. Due to the uncertainty associated with the plutonium losses during processing, solubility experiments were performed to measure the recovery of plutonium during pretreatment and a subsequent precipitation process to prepare a slurry feed for a batch melter. A good estimate of the plutonium content of the glass is required for planning the shipment of the vitrified Am/Cm product to Oak Ridge National Laboratory (ORNL).The plutonium solubility in the oxalate precipitation supernate during pretreatment was 10 mg/mL at 35 degrees C. In two subsequent washes with a 0.25M oxalic acid/0.5M nitric acid solution, the solubility dropped to less than 5 mg/mL. During the precipitation and washing steps, lanthanide fission products in the solution were mostly insoluble. Uranium, and alkali, alkaline earth, and transition metal impurities were soluble as expected. An elemental material balance for plutonium showed that greater than 94 percent of the plutonium was recovered in the dissolved precipitate. The recovery of the lanthanide elements was generally 94 percent or higher except for the more soluble lanthanum. The recovery of soluble metal impurities from the precipitate slurry ranged from 15 to 22 percent. Theoretically, 16 percent of the soluble oxalates should have been present in the dissolved slurry based on the dilution effects and volumes of supernate and wash solutions removed. A trace level material balance showed greater than 97 percent recovery of americium-241 (from the beta dec

  15. Quantitative determination of americium and curium in solutions using potassium tungstophosphate

    International Nuclear Information System (INIS)

    Chistyakov, V.M.; Baranov, A.A.; Erin, E.A.; Timoaeev, G.A.


    Two methods of americium (4) and curium (4) titration-replacement and redox ones - have been considered. According to the replacement method thorium nitrate solution was used as a titrant and the final point of titration was determined spectophotometrically. Using the method developed, on the basis of experimental data, the composition of thorium (4) complex with potassium tungstophosphate was determined. In case of the redox titration sodium nitrite was used, and the final titration point was indicated either spectrophotometrically or potentiometrically

  16. In vitro dissolution of curium oxide using a phagolysosomal simulant solvent system

    International Nuclear Information System (INIS)

    Helfinstine, S.Y.; Guilmette, R.A.; Schlapper, G.A.


    Detailed study of actinide oxide behavior in alveolar macrophages (AM) in vitro is limited because of the short life span of these cells in culture. We created an in vitro dissolution system that could mimic the acidic phagolysosomal environment for the actinide and be maintained for an indefinite period so that dissolution of more insoluble materials could be measured. The dissolution system for this investigation, consisting of nine different solutions of HCl and the chelating agent diethylenetriamine pentaacetate (DTPA) in distilled water, is called the phagolysosomal simulant solvent (PSS). In this system, both the pH and the amount of DTPA were varied. We could observe the effect of altering pH within a range of 4.0-6.0 (similar to that of the phagolysosome) and the effect of the molar ratio of DTPA to curium at 1000: 1, 100;1, or 10:1. We chose curium sesquioxide ( 244 Cm 2 O 3 ) to validate the PSS for actinide dissolution versus that occurring in AM in vitro because it dissolves significantly in less than 1 week. The polydisperse 244 Cm 2 O 3 aerosol was generated, collected on filters, resuspended, and added to the PSS solutions and to cultured canine AM. By comparing dissolution in the two systems directly, we hoped to arrive at an optimum PSS for future dissolution studies. PSS and cell culture samples were taken daily for 7 days after exposure and tested for the solubilized curium. The amount of soluble material was determined by ultracentrifugation to separate the insoluble CM 2 O 3 from the soluble curium in the PSS solutions and filtration for the cell-containing material. After separating the soluble and insoluble fractions, the samples were analyzed using alpha liquid scintillation counting. Time-dependent dissolution measurements from the PSS/AM showed that the CM 2 O 3 dissolution was similar for both the PSS solutions and the cultured AM. 13 refs., 4 tabs

  17. Spectroscopic and redox properties of curium and californium ions in concentrated aqueous carbonate-bicarbonate media

    International Nuclear Information System (INIS)

    Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.


    Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed

  18. Development of analytical methods for the separation of plutonium, americium, curium and neptunium from environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Salminen, S.


    In this work, separation methods have been developed for the analysis of anthropogenic transuranium elements plutonium, americium, curium and neptunium from environmental samples contaminated by global nuclear weapons testing and the Chernobyl accident. The analytical methods utilized in this study are based on extraction chromatography. Highly varying atmospheric plutonium isotope concentrations and activity ratios were found at both Kurchatov (Kazakhstan), near the former Semipalatinsk test site, and Sodankylae (Finland). The origin of plutonium is almost impossible to identify at Kurchatov, since hundreds of nuclear tests were performed at the Semipalatinsk test site. In Sodankylae, plutonium in the surface air originated from nuclear weapons testing, conducted mostly by USSR and USA before the sampling year 1963. The variation in americium, curium and neptunium concentrations was great as well in peat samples collected in southern and central Finland in 1986 immediately after the Chernobyl accident. The main source of transuranium contamination in peats was from global nuclear test fallout, although there are wide regional differences in the fraction of Chernobyl-originated activity (of the total activity) for americium, curium and neptunium. The separation methods developed in this study yielded good chemical recovery for the elements investigated and adequately pure fractions for radiometric activity determination. The extraction chromatographic methods were faster compared to older methods based on ion exchange chromatography. In addition, extraction chromatography is a more environmentally friendly separation method than ion exchange, because less acidic waste solutions are produced during the analytical procedures. (orig.)

  19. Curium Management Studies in France, Japan and USA. A Report by the WPFC Expert Group on Chemical Partitioning of the NEA Nuclear Science Committee - April 2011

    International Nuclear Information System (INIS)

    Yamagishi, Isao; Choi, Yong-Joon; Glatz, Jean-Paul; Hyland, Bronwyn; Uhlir, Jan; Baron, Pascal; Warin, Dominique; DE ANGELIS, Giorgio; LUCE, Alfredo; Inoue, Tadashi; Morita, Yasuji; Minato, Kazuo; Lee, Han Soo; Ignatiev, Victor V.; Kormilitsyn, Mikhail V.; Caravaca, Concepcion; Lewin, Robert g.; Taylor, Robin J.; Collins, Emory D.; Laidler, James J.


    Curium is closely associated with americium in irradiated fuels because of their chemical similarity with regard to potential separation requirements, and because americium also requires special shielding and handling requirements due to its gamma radiation emission. Americium is produced in greater mass than curium in irradiated nuclear fuels and the mass ratio can grow exponentially with decay time because of the simultaneous decay of 244 Cm and in-growth of 241 Am from decay of 241 Pu (half-life = 14.4 years). For these reasons, curium management is challenging. Countries that are now engaged in or planning future fuel recycle operations, are considering methods to manage the curium produced and minimise the shielding and handling requirements, as well as the reprocessing requirements for separation of curium from americium France, Japan, and the USA have begun curium management studies. Curium management methods under consideration include (1) separation of curium from americium and storage of curium for several decades to allow 244 Cm to decay substantially to 240 Pu, while moving ahead to recycle americium; (2) recycling of americium and curium without separation; and (3) waiting several decades to reprocess used nuclear fuels, allowing decay minimisation of curium emissions and the requirement for separation of curium from americium, and allowing an alteration of the subsequent transmutation path to reduce the production of curium in recycled used fuels. In this report, recent curium management studies in France, Japan, and the USA have been described. The French studies included scenarios that compared the recycle of ail minor actinides (neptunium, americium, and curium) with the recycle of only neptunium and americium in radial blankets of sodium-cooled fast reactors (SFR). In the latter scenario, curium is separated from americium during used fuel reprocessing and stored for 5000 years to allow 244 Cm to decay to 240 Pu which is then recycled. Even though

  20. 49 CFR 236.563 - Delay time. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Delay time. 236.563 Section 236.563 Transportation... Cab Signal Systems Rules and Instructions; Locomotives § 236.563 Delay time. Delay time of automatic... requirements of § 236.24 shall take into consideration the delay time. ...

  1. 49 CFR 236.588 - Periodic test. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Periodic test. 236.588 Section 236.588..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.588 Periodic test. Except as provided in § 236.586, periodic test of the automatic train stop, train control, or cab signal apparatus...

  2. Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986

    International Nuclear Information System (INIS)

    Love, G.L.; Butler, H.M.; Duncan, D.T.; Oakes, T.W.


    This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances

  3. Cleanex process: a versatile solvent extraction process for recovery and purification of lanthanides, americium, and curium

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Collins, E.D.; King, L.J.


    At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter

  4. Vitrification of F-area americium/curium: feasibility study and preliminary process recommendation

    International Nuclear Information System (INIS)

    Ramsey, W.G.; Miller, D.; Minichan, R.; Coleman, L.; Schumacher, R.; Hardy, B.; Jones, R.


    Work was performed to identify a process to vitrify the contents of F- canyon Tank 17.1. Tank 17.1 contains the majority of americium (Am) and curium (Cm) contained in the DOE Complex. Oak Ridge National Laboratory (ORNL) has made a formal request for this material as fuel for production of Cf252 and other transplutonium actinides. The Am and Cm (and associated lanthanide fission products) are currently in nitric acid solution. Transportation of the intensely radioactive Am/Cm in liquid form is not considered possible. As a result, the material will either be solidified and shipped to ORNL or discarded to the Tank Farm. Nuclear Materials Processing Technology (NMPT), therefore, requested Defense Waste Processing Technology (DWPT) to determine if the Tank 17.1 material could be vitrified, and if it was vitrified could the americium and curium be successfully recovered. Research was performed to determine if the Tank 17.1 contents could indeed be mixed with glass formers and vitrified. Additional studies identified critical process parameters such as heat loading, melter requirements, off-gas evolution, etc. Discussions with NMPT personnel were initiated to determine existing facilities where this work could be accomplished safely. A process has been identified which will convert the Am/Cm material into approximately 300kg of glass

  5. 49 CFR 236.705 - Bar, locking. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Bar, locking. 236.705 Section 236.705..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.705 Bar, locking. A bar in an interlocking machine to which the locking dogs are attached. ...

  6. 49 CFR 236.516 - Power supply. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Power supply. 236.516 Section 236.516..., Train Control and Cab Signal Systems Standards § 236.516 Power supply. Automatic cab signal, train stop, or train control device hereafter installed shall operate from a separate or isolated power supply...

  7. 36 CFR 2.36 - Gambling. (United States)


    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Gambling. 2.36 Section 2.36 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.36 Gambling. (a) Gambling in any form, or the operation of gambling...

  8. 8 CFR 236.13 - Ineligible aliens. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 236.13 Section 236.13 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE AND DEPORTABLE ALIENS; REMOVAL OF ALIENS ORDERED REMOVED Family Unity Program § 236...

  9. 49 CFR 236.105 - Electric lock. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock. 236.105 Section 236.105 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION...: All Systems Inspections and Tests; All Systems § 236.105 Electric lock. Electric lock, except forced...

  10. 42 CFR 438.236 - Practice guidelines. (United States)


    ... 42 Public Health 4 2010-10-01 2010-10-01 false Practice guidelines. 438.236 Section 438.236 Public... Improvement Standards § 438.236 Practice guidelines. (a) Basic rule: The State must ensure, through its...) Adoption of practice guidelines. Each MCO and, when applicable, each PIHP and PAHP adopts practice...

  11. 49 CFR 236.718 - Chart, dog. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Chart, dog. 236.718 Section 236.718 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.718 Chart, dog. A...

  12. 49 CFR 236.742 - Dog, locking. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Dog, locking. 236.742 Section 236.742 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.742 Dog...

  13. 49 CFR 236.743 - Dog, swing. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Dog, swing. 236.743 Section 236.743 Transportation... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.743 Dog, swing. A locking dog mounted in such a manner that it is free to rotate on a trunnion which is riveted to a locking...

  14. 49 CFR 236.712 - Brake pipe. (United States)


    ... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.712 Brake pipe. A pipe running from the engineman's brake valve through the train, used for the transmission of air under... 49 Transportation 4 2010-10-01 2010-10-01 false Brake pipe. 236.712 Section 236.712 Transportation...

  15. 49 CFR 236.384 - Cross protection. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Cross protection. 236.384 Section 236.384 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... and Tests § 236.384 Cross protection. Cross protection shall be tested at least once every six months...

  16. 24 CFR 236.901 - Audit. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Audit. 236.901 Section 236.901... AND INTEREST REDUCTION PAYMENT FOR RENTAL PROJECTS Audits § 236.901 Audit. Where a State or local... mortgagor of a mortgage insured or held by the Commissioner under this part, it shall conduct audits in...

  17. 49 CFR 236.587 - Departure test. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Departure test. 236.587 Section 236.587..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.587 Departure test. (a) The...: (1) Operation over track elements; (2) Operation over test circuit; (3) Use of portable test...

  18. 24 CFR 236.60 - Excess Income. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Excess Income. 236.60 Section 236... § 236.60 Excess Income. (a) Definition. Excess Income consists of cash collected as rent from the... Rent. The unit-by-unit requirement necessitates that, if a unit has Excess Income, the Excess Income...

  19. 49 CFR 236.717 - Characteristics, operating. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Characteristics, operating. 236.717 Section 236.717 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.717 Characteristics, operating. The measure of electrical values at which electrical or electronic...

  20. 49 CFR 236.721 - Circuit, control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Circuit, control. 236.721 Section 236.721..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.721 Circuit, control. An electrical circuit between a source of electric energy and a device which it operates. ...

  1. 49 CFR 236.777 - Operator, control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Operator, control. 236.777 Section 236.777..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.777 Operator, control. An employee assigned to operate the control machine of a traffic control system. ...

  2. 49 CFR 236.814 - Station, control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Station, control. 236.814 Section 236.814..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.814 Station, control. The place where the control machine of a traffic control system is located. ...

  3. 49 CFR 236.771 - Machine, control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Machine, control. 236.771 Section 236.771..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.771 Machine, control. An assemblage of manually operated devices for controlling the functions of a traffic...

  4. 49 CFR 236.708 - Block. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Block. 236.708 Section 236.708 Transportation... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.708 Block. A length of track of defined limits, the use of which by trains is governed by block signals, cab signals, or both. ...

  5. 49 CFR 236.801 - Shoe, latch. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Shoe, latch. 236.801 Section 236.801 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.801...

  6. The use of curium neutrons to verify plutonium in spent fuel and reprocessing wastes

    International Nuclear Information System (INIS)

    Miura, N.


    For safeguards verification of spent fuel, leached hulls, and reprocessing wastes, it is necessary to determine the plutonium content in these items. We have evaluated the use of passive neutron multiplicity counting to determine the plutonium content directly and also to measure the 240 Pu/ 244 Cm ratio for the indirect verification of the plutonium. Neutron multiplicity counting of the singles, doubles, and triples neutrons has been evaluated for measuring 240 Pu, 244 Cm, and 252 Cf. We have proposed a method to establish the plutonium to curium ratio using the hybrid k-edge densitometer x-ray fluorescence instrument plus a neutron coincidence counter for the reprocessing dissolver solution. This report presents the concepts, experimental results, and error estimates for typical spent fuel applications

  7. Transmutation of americium and curium incorporated in zirconia-based host materials

    International Nuclear Information System (INIS)

    Raison, P.E.


    Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO 2 -ZrO 2 -Y 2 O 3 . It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO 2 content. The Cm 2 O 3 -ZrO 2 system was also investigated. It was found that at 25 mol% of CmO 1.5 , the Cm(III) stabilized zirconia in its cubic form (a = 5.21 ±0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO 1.5 , a pyrochlore oxide - Cm 2 Zr 2 O 7 - is formed (a = 10.63 ±0.02 Angstrom). (author)

  8. Application of curium measurements for safeguarding at reprocessing plants. Study 1: High-level liquid waste and Study 2: Spent fuel assemblies and leached hulls

    International Nuclear Information System (INIS)

    Rinard, P.M.; Menlove, H.O.


    In large-scale reprocessing plants for spent fuel assemblies, the quantity of plutonium in the waste streams each year is large enough to be important for nuclear safeguards. The wastes are drums of leached hulls and cylinders of vitrified high-level liquid waste. The plutonium amounts in these wastes cannot be measured directly by a nondestructive assay (NDA) technique because the gamma rays emitted by plutonium are obscured by gamma rays from fission products, and the neutrons from spontaneous fissions are obscured by those from curium. The most practical NDA signal from the waste is the neutron emission from curium. A diversion of waste for its plutonium would also take a detectable amount of curium, so if the amount of curium in a waste stream is reduced, it can be inferred that there is also a reduced amount of plutonium. This report studies the feasibility of tracking the curium through a reprocessing plant with neutron measurements at key locations: spent fuel assemblies prior to shearing, the accountability tank after dissolution, drums of leached hulls after dissolution, and canisters of vitrified high-level waste after separation. Existing pertinent measurement techniques are reviewed, improvements are suggested, and new measurements are proposed. The authors integrate these curium measurements into a safeguards system

  9. 236-Z canyon utilization study

    International Nuclear Information System (INIS)

    Dixon, D.R.


    The 236-Z canyon contains equipment for repurification of plutonium and recovery of plutonium from scrap material. To meet production requirements of Fast Flux Test Facility/Clinch River Breeder Reactor oxide with the existing plant, several new pieces of equipment will be needed in the future. More storage space and a better accountability system are needed to support this increased production. The available canyon space needs to be utilized to its fullest in order to accommodate the new equipment. The purpose of this document is to identify the new pieces of equipment, show how they fit into the flowsheet, and locate them in the canyon

  10. A time-resolved laser fluorescence spectroscopy (TRLFS) study of the interaction of trivalent actinides (curium(III)) with calcite

    International Nuclear Information System (INIS)

    Stumpf, Th.; Fanghaenel, Th.


    Cm(III) interaction with calcite was investigated in the trace concentration range. Two different Cm(III)/calcite sorption species were found. The first Cm(III) sorption species consists of a curium ion that is bonded onto the calcite surface. The second Cm(III) sorption species has lost its complete hydration sphere and is incorporated into the calcite bulk structure /1/. (orig.)

  11. Gas-Phase Energetics of Actinide Oxides: An Assessment of Neutral and Cationic Monoxides and Dioxides from Thorium to Curium (United States)

    Marçalo, Joaquim; Gibson, John K.


    An assessment of the gas-phase energetics of neutral and singly and doubly charged cationic actinide monoxides and dioxides of thorium, protactinium, uranium, neptunium, plutonium, americium, and curium is presented. A consistent set of metal-oxygen bond dissociation enthalpies, ionization energies, and enthalpies of formation, including new or revised values, is proposed, mainly based on recent experimental data and on correlations with the electronic energetics of the atoms or cations and with condensed-phase thermochemistry.

  12. Interactions of Microbes found at Aespoe Underground Lab with Actinides such as Curium, Plutonium and Uranium

    Energy Technology Data Exchange (ETDEWEB)

    Moll, H.; Merroun, M.; Geipel, G.; Rossberg, A.; Hennig, C.; Selenska-Pobell , S.; Bernhard, G. [Forschungszentrum Dresden-Rossendorf e.V., Inst. fuer Radioc hemie, 01314 Dresden (Germany)]. e-mail:; Stumpf, Th. [Forschungszentru m Karlsruhe, Inst. fuer Nukleare Entsorgung, 76021 Karlsruhe (Germany)


    Sulfate-reducing bacteria (SRB) frequently occur in the deep granitic rock aquifers at the Aespoe Hard Rock Laboratory (Aespoe HRL), Sweden. The new SRB strain Desulfovibrio aespoeensis could be isolated. Results describing the basic interaction mechanisms of uranium, curium, and plutonium with cells of D. aespoeensis DSM 10631T will be presented. The interaction experiments with the actinides showed that the cells are able to remove all three actinides from the surrounding solution. The amount of removed actinide and the interaction mechanism varied among the different actinides. The main U(VI) removal occurred after the first 24 h. The contact time, pH and [U(VI)]initial influence the U removal efficiency. The presence of uranium caused a damaging of the cell membranes. TEM revealed an accumulation of U inside the bacterial cell. D. aespoeensis are able to form U(IV). A complex interaction mechanism takes place consisting of biosorption, bioreduction and bioaccumulation. In the case of {sup 242}Pu, solvent extractions, UV-vis- and XANES spectroscopy were used to determine the speciation of the Pu oxidation states. In the first step, the Pu(VI) and Pu(IV)-polymers are bound to the biomass. Solvent extractions showed that 97 % of the initially present Pu(VI) is reduced to Pu(V) due to the activity of the cells within the first 24 h. Most of the formed Pu(V) dissolves from the cell envelope back to the aqueous solution due to the weak complexing properties of this plutonium oxidation state. In the case of curium at a much lower metal concentration of 3x10{sup -7} M, a pure biosorption of Cm(III) on the cell envelope forming an inner-sphere surface complex most likely with organic phosphate groups was detected. To summarize, the strength of the interaction of D. aespoeensis with the selected actinides at pH 5 and actinide concentrations = 10 mg/L ([Cm] 0.07 mg/L) follows the pattern: Cm > U > Pu >> Np.

  13. 49 CFR 236.765 - Locking, mechanical. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, mechanical. 236.765 Section 236.765 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Locking, mechanical. An arrangement of locking bars, dogs, tappets, cross locking and other apparatus by...

  14. 49 CFR 236.776 - Movement, trailing. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Movement, trailing. 236.776 Section 236.776 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Movement, trailing. The movement of a train over the points of a switch which face in the direction in...

  15. 49 CFR 236.774 - Movement, facing. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Movement, facing. 236.774 Section 236.774 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Movement, facing. The movement of a train over the points of a switch which face in a direction opposite to...

  16. 49 CFR 236.702 - Arm, semaphore. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Arm, semaphore. 236.702 Section 236.702 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., semaphore. The part of a semaphore signal displaying an aspect. It consists of a blade fastened to a...

  17. 49 CFR 236.707 - Blade, semaphore. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Blade, semaphore. 236.707 Section 236.707 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Blade, semaphore. The extended part of a semaphore arm which shows the position of the arm. ...

  18. 48 CFR 552.236-80 - Heat. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Heat. 552.236-80 Section... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.236-80 Heat. As prescribed in 536.570-11, insert the following clause: Heat (APR 1984) Unless otherwise specified or unless already...

  19. 49 CFR 236.761 - Locking, electric. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, electric. 236.761 Section 236.761 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Locking, electric. The combination of one or more electric locks and controlling circuits by means of...

  20. 49 CFR 236.757 - Lock, electric. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Lock, electric. 236.757 Section 236.757... Lock, electric. A device to prevent or restrict the movement of a lever, a switch or a movable bridge, unless the locking member is withdrawn by an electrical device, such as an electromagnet, solenoid or...

  1. 28 CFR 2.36 - Rescission guidelines. (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Rescission guidelines. 2.36 Section 2.36... guidelines. (a) The following guidelines shall apply to the sanctioning of disciplinary infractions or new... such period of confinement has resulted from initial parole to a detainer). These guidelines specify...

  2. 49 CFR 236.787 - Protection, cross. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Protection, cross. 236.787 Section 236.787 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Protection, cross. An arrangement to prevent the improper operation of a signal, switch, movable-point frog...

  3. 49 CFR 236.768 - Locking, time. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, time. 236.768 Section 236.768... Locking, time. A method of locking, either mechanical or electrical, which, after a signal has been caused to display an aspect to proceed, prevents, until after the expiration of a predetermined time...

  4. 49 CFR 236.790 - Release, time. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Release, time. 236.790 Section 236.790... Release, time. A device used to prevent the operation of an operative unit until after the expiration of a predetermined time interval after the device has been actuated. ...

  5. 15 CFR 23.6 - Definitions. (United States)


    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions. 23.6 Section 23.6 Commerce and Foreign Trade Office of the Secretary of Commerce USE OF PENALTY MAIL IN THE LOCATION AND... entities outside the Office of the Secretary charged with carrying out specified substantive functions (i.e...

  6. 49 CFR 236.791 - Release, value. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Release, value. 236.791 Section 236.791 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Release, value. The electrical value at which the movable member of an electromagnetic device will move to...

  7. 8 CFR 236.14 - Filing. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Filing. 236.14 Section 236.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE... initial denial, to allow the alien the opportunity to file a new Form I-817 application in order to...

  8. 49 CFR 236.806 - Signal, home. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, home. 236.806 Section 236.806 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Signal, home. A roadway signal at the entrance to a route or block to govern trains in entering and using...

  9. 49 CFR 236.804 - Signal, block. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, block. 236.804 Section 236.804 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Signal, block. A roadway signal operated either automatically or manually at the entrance to a block. ...

  10. 48 CFR 53.236-1 - Construction. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Construction. 53.236-1... AND FORMS FORMS Prescription of Forms 53.236-1 Construction. The following forms are prescribed, as stated below, for use in contracting for construction, alteration, or repair, or dismantling, demolition...

  11. 48 CFR 552.236-72 - Specialist. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Specialist. 552.236-72... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.236-72 Specialist. As prescribed in 536.570-3, insert the following clause: Specialist (APR 1984) The term “Specialist...

  12. Preparation of curium-americium oxide microspheres by resin-bead loading

    International Nuclear Information System (INIS)

    Chattin, F.R.; Benker, D.E.; Lloyd, M.H.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.


    Resin-bead loading and calcination techniques have been used to produce all curium and americium oxide feed material (about 2.2 kg) for HFIR targets since 1971. The process based on Dowex 50W resin has progressed from a series of test runs, through special production runs, into routine production in permanent equipment beginning in 1975. Key attributes of this process are its reliability, high yields, and ease of operation. The process is suited for remote operation in hot cells. Yields approaching 95% are routinely obtained and only one unacceptable product has been generated during routine production operations. There have been no problems in fabricating targets from this oxide or in the subsequent irradiation of these targets. The present scale of production of 150 to 250 g/y supplies the present need and is comparable with the level of other chemical process operations at TRU. Since the annual production is accomplished in two 8 to 12 day periods, there has been no reason to consider further scale-up. However, the rate of production could easily be doubled by simply adding a second set of calcination equipment

  13. Transmutation of americium and curium incorporated in zirconia-based host materials

    Energy Technology Data Exchange (ETDEWEB)

    Raison, P.E. [CEA Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. d' Etudes des Combustibles; Haire, R.G. [Oak Ridge National Lab., TN (United States)


    Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO{sub 2}-ZrO{sub 2}-Y{sub 2}O{sub 3}. It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO{sub 2} content. The Cm{sub 2}O{sub 3}-ZrO{sub 2} system was also investigated. It was found that at 25 mol% of CmO{sub 1.5}, the Cm(III) stabilized zirconia in its cubic form (a = 5.21 {+-}0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO{sub 1.5}, a pyrochlore oxide - Cm{sub 2}Zr{sub 2}O{sub 7} - is formed (a = 10.63 {+-}0.02 Angstrom). (author)

  14. Transport of plutonium, americium, and curium from soils into plants by roots

    International Nuclear Information System (INIS)

    Pimpl, M.; Schuettelkopf, H.


    For assessing the dose from radionuclides in agricultural products by ingestion it is necessary to know the soil to plant transfer factors. The literature was entirely investigated, in order to judge the size of the soil to plant transfer factors. In total, 92 publications - from 1948 to 1978 -have been evaluated. As result, transfer factors from 10 -9 to 10 -3 have been found for Plutonium, and from 10 -6 to 1 for Americium. For Curium only few data are available in literature. The considerable variation of the measured transfer factors is based on the dependence of these transfer factors from the ion exchange capacity of soils, from the amount of organic materials, from the pH-value, and from the mode of contamination. There are, in any case, contradictory data, although there has been detected a dependence of the transfer factors from these parameters. Chelating agenst increase the transfer factors to approximately 1300. As well, fertilizers have an influence on the size of the transfer factors - however, the relationships have been scarcely investigated. The distribution of actinides within the individual parts of plants has been investigated. The highest concentrations are in the roots; in the plant parts above ground the concentration of actinides decreases considerably. The most inferior transfer factors were measured for the respective seed or fruits. The soil to plant transfer factors of actinides are more dependend on the age of the plants within one growing period. At the beginning of the period, the transfer factor is considerably higher than at the end of this period. With respect to plants with a growing period of several years, correlations are unknown. (orig.) [de

  15. Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms

    International Nuclear Information System (INIS)

    Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z.; Gillow, J.B.; Francis, A.J.


    We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K d ) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N H 2 O ) and the degree of strength of ligand field (R E/M ) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K d of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K d , indicating that an exchange with Na + on the functional groups was involved in their sorption. The ΔN H 2 O (= 9 - N H 2 O ) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R E/M for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)

  16. Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z. [Advanced Science Research Center, Japan Atomic Energy Research Inst., Ibaraki (Japan); Gillow, J.B.; Francis, A.J. [Environmental Sciences Dept., Brookhaven National Lab., Upton, NY (United States)


    We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K{sub d}) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N{sub H{sub 2}O}) and the degree of strength of ligand field (R{sub E/M}) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K{sub d} of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K{sub d}, indicating that an exchange with Na{sup +} on the functional groups was involved in their sorption. The {delta}N{sub H{sub 2}O} (= 9 - N{sub H{sub 2}O}) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R{sub E/M} for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)

  17. Behavior of americium, curium, and certain fission products in fluoride melts in the presence of s olid extraction agents

    International Nuclear Information System (INIS)

    Alekseev, V.A.; Klokman, V.R.; Morozova, Z.E.; Ziv, V.S.


    The authors consider the behavior of americium, curium, and certain fission products (europium, cerium, yttrium, and strontium) in fluoride and chlode-fluoride melts in the presence of nonisomorphous solid phases: calcium fluoride and lanthanum and zirconium oxides. It is shown that the trace components enter the solid calcium fluoride in a regular fashion only in the presence of an adequate amount of oxygen in the melt. The effect of oxygen on the coprecipitation with calcium fluoride occurs because oxygen compounds of the elements must be formed in the melt, and these are then coprecipitated with the calcium fluoride

  18. The effect of temperature on the sorption of technetium, uranium, neptunium and curium on bentonite, tuff and granodiorite

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; Tweed, C.J.; Yui, M.


    A study of the sorption of the radioelements technetium; uranium; neptunium; and curium onto geological materials has been carried out as part of the PNC program to increase confidence in the performance assessment for a high-level radioactive waste repository in Japan. Batch sorption experiments have been performed in order to study the sorption of the radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water under strongly-reducing conditions at both room temperature and at 60 C. Mathematical modelling using the geochemical speciation program HARPHRQ in conjunction with the HATCHES database has been undertaken in order to interpret the experimental results

  19. Determination of americium and curium using ion-exchange in the nitric-acid-methanol medium for environmental analysis

    International Nuclear Information System (INIS)

    Holm, E.; Fukai, R.


    While transplutonic elements are only slightly sorbed to anion exchangers from hydrochloric or nitric acid media, the presence of alcohol enhances the anionic exchange of these elements, especially in nitric and sulfuric solutions. In the present work a method has been developed for determining americium and curium in environmental samples, on the basis of the difference between the sorption characteristics to anion exchangers in the acid-methanol system of these transplutonic elements and those of plutonium, polonium and thorium. The method also permits us to perform sequential determination of plutonium, when necessary

  20. Electrochemistry of oxygen-free curium compounds in fused NaCl-2CsCl eutectic

    International Nuclear Information System (INIS)

    Osipenko, A.; Maershin, A.; Smolenski, V.; Novoselova, A.; Kormilitsyn, M.; Bychkov, A.


    This work presents the electrochemical study of Cm(III) in fused NaCl-2CsCl eutectic in the temperature range 823-1023 K. Transient electrochemical techniques such as cyclic, differential pulse and square wave voltammetry, and chronopotentiometry have been used in order to investigate the reduction mechanism of curium ions up to the metal. The results obtained show that the reduction reaction takes place in a single step Cm(III)+3e-bar →Cm(0). The diffusion coefficient of [CmCl 6 ] 3- complex ions was determined by cyclic voltammetry at different temperatures by applying the Berzins-Delahay equation. The validity of the Arrhenius law was also verified and the activation energy for diffusion was found to be 44.46 kJ/mol. The apparent standard electrode potential of the redox couple Cm(III)/Cm(0) was found by chronopotentiometry at several temperatures. The thermodynamic properties of curium trichloride have also been calculated.

  1. 48 CFR 236.604 - Performance evaluation. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance evaluation... Architect-Engineer Services 236.604 Performance evaluation. (a) Preparation of performance reports. Use DD Form 2631, Performance Evaluation (Architect-Engineer), instead of SF 1421. (2) Prepare a separate...

  2. Resolved resonance parameters for 236Np

    International Nuclear Information System (INIS)

    Morogovskij, G.B.; Bakhanovich, L.A.


    Multilevel Breit-Wigner parameters were obtained for fission cross-section representation in the 0.01-33 eV energy region from evaluation of a 236 Np experimental fission cross-section in the resolved resonance region. (author)

  3. Reference: 236 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 236 Dharmasiri...5 Jul Developmental cell Dharmasiri Nihal|Dharmasiri Sunethra|Ehrismann Jasmin S|Estelle Mark|Hobbie Lawrence|J端rgens Gerd|Lechner Esther|Weijers Dolf|Yamada Masashi

  4. Experimental and in situ investigations on americium, curium and plutonium behaviour in marine benthic species: transfer from water or sediments

    International Nuclear Information System (INIS)

    Miramand, P.


    The tranfer of transuranic elements -americium, curium and plutonium- from the sediments containing them to some marine benthic species (endofauna and epifauna) was studied with a twofold approach - laboratory and in-situ investigation. The experimental investigations, divided into three parts, made it possible to specify concentration factors (F.C.), transfer factors (F.T.) and to understand the process involved for 5 benthic species. The result were refined by an in-situ study that brought new data on the marine distribution of the transuranic elements released by the La Hague plant. Finally, the localization of americium and plutonium in the tissues and cells of these species was determined by autoradiography [fr

  5. 49 CFR 236.809 - Signal, slotted mechanical. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, slotted mechanical. 236.809 Section 236.809 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.809 Signal, slotted mechanical. A mechanically operated signal with an electromagnetic device...

  6. 49 CFR 236.52 - Relayed cut-section. (United States)


    ..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Rules and Instructions: All Systems Track Circuits § 236.52 Relayed cut-section. Where relayed cut-section is used in... 49 Transportation 4 2010-10-01 2010-10-01 false Relayed cut-section. 236.52 Section 236.52...

  7. 46 CFR 169.236 - Inspection and testing required. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection and testing required. 169.236 Section 169.236... Inspection and Certification Repairs and Alterations § 169.236 Inspection and testing required. (a) The... involving riveting, welding, burning, or other fire-producing actions may be made— (1) Within or on the...

  8. 48 CFR 552.236-77 - Specifications and Drawings (United States)


    ... Drawings 552.236-77 Section 552.236-77 Federal Acquisition Regulations System GENERAL SERVICES....236-77 Specifications and Drawings As prescribed in 536.570-8, insert the following clause: Specifications and Drawings (SEP 1999) The requirements of the clause entitled “Specifications and Drawings for...

  9. 48 CFR 52.236-6 - Superintendence by the Contractor. (United States)


    ... Contractor. 52.236-6 Section 52.236-6 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....236-6 Superintendence by the Contractor. As prescribed in 36.506, insert the following clause: Superintendence by the Contractor (APR 1984) At all times during performance of this contract and until the work...

  10. 48 CFR 852.236-78 - Government supervision. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government supervision. 852.236-78 Section 852.236-78 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.236-78 Government supervision. As prescribed in...

  11. Radiation-chemical behaviour of neptunium ions in nitric acid solutions in the presence of curium-244

    International Nuclear Information System (INIS)

    Frolova, L.M.; Frolov, A.A.; Vasil'ev, V.Ya.


    Radiation-chemical behaviour of neptunium ions in nitric acid solutions is studied under the action of intensive internal alpha-irradiation conditioned by curium nuclides. In 0.3-1.1 mol/l solutions of nitric acid radiation-chemical oxidation of neptunium (4) and reduction of neptunium (6) is obeyed to the first order law of reaction rate in respect to neptunium concentration. Effective constants of neptunium (4) oxidation rates and neptuniumi(6) reduction rates are not dependent on neptunium ion in1tial concentration and increase with a growth of a dose rate of alpha-irradiation of solution. In equilibrium only neptunium (5) and neptunium (6) are present in solutions with HNO 3 concentration less than 1 mol/l. In more concentrated solutions equilibrium between sexa-, penta- and tetravalent neptunium forms is established. Equilibrium concentrations of neptunium valent forms are not dependent on neptunium initial oxidation state under the same initial conditions (dose rate, neptunium concentration and acidity. It is shown form experimental data that under the action of alpha-irradiation neptunium (5) both is oxidated to neptunium (6) and is reduced to neptunium (4)

  12. Use of radioanalytical methods for determination of uranium, neptunium, plutonium, americium and curium isotopes in radioactive wastes

    International Nuclear Information System (INIS)

    Geraldo, Bianca


    Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)

  13. 49 CFR Appendix A to Part 236 - Civil Penalties 1 (United States)


    ... 1,000 2,000 236.329Bolt lock 1,000 2,000 236.330Locking dog of switch and lock movement 1,000 2,000....338Mechanical locking required in accordance with locking sheet and dog chart 1,000 2,000 236.339Mechanical... next available point of communication after automatic train stop, train control, or cab signal device...

  14. 7 CFR 205.236 - Origin of livestock. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Origin of livestock. 205.236 Section 205.236... livestock. (a) Livestock products that are to be sold, labeled, or represented as organic must be from livestock under continuous organic management from the last third of gestation or hatching: Except, That: (1...

  15. 7 CFR 2.36 - Director, Office of Communications. (United States)


    ... are made by the Secretary of Agriculture to Director, Office of Communications: (1) Related to public...) Organize and direct the activities of a public affairs office to include press relations of the secretary... 7 Agriculture 1 2010-01-01 2010-01-01 false Director, Office of Communications. 2.36 Section 2.36...

  16. 49 CFR 236.825 - System, automatic train control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false System, automatic train control. 236.825 Section..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.825 System, automatic train control. A system so arranged that its operation will automatically...

  17. 49 CFR 236.813a - State, most restrictive. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false State, most restrictive. 236.813a Section 236.813a Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... State, most restrictive. The mode of an electric or electronic device that is equivalent to a track...

  18. 49 CFR 236.766 - Locking, movable bridge. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, movable bridge. 236.766 Section 236.766... Locking, movable bridge. The rail locks, bridge locks, bolt locks, circuit controllers, and electric locks used in providing interlocking protection at a movable bridge. ...

  19. 8 CFR 236.5 - Fingerprints and photographs. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Fingerprints and photographs. 236.5 Section... to Order of Removal § 236.5 Fingerprints and photographs. Every alien 14 years of age or older... photographs shall be made available to Federal, State, and local law enforcement agencies upon request to the...

  20. 8 CFR 236.2 - Confined aliens, incompetents, and minors. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Confined aliens, incompetents, and minors. 236.2 Section 236.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE AND DEPORTABLE ALIENS; REMOVAL OF ALIENS ORDERED REMOVED Detention...

  1. 49 CFR 236.102 - Semaphore or searchlight signal mechanism. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Semaphore or searchlight signal mechanism. 236.102... Instructions: All Systems Inspections and Tests; All Systems § 236.102 Semaphore or searchlight signal mechanism. (a) Semaphore signal mechanism shall be inspected at least once every six months, and tests of...

  2. 49 CFR 236.810 - Spectacle, semaphore arm. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Spectacle, semaphore arm. 236.810 Section 236.810 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Spectacle, semaphore arm. That part of a semaphore arm which holds the roundels and to which the blade is...

  3. 49 CFR 236.527 - Roadway element insulation resistance. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Roadway element insulation resistance. 236.527 Section 236.527 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... element insulation resistance. Insulation resistance between roadway inductor and ground shall be...

  4. 27 CFR 24.236 - Losses of spirits. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses of spirits. 24.236... OF THE TREASURY LIQUORS WINE Spirits § 24.236 Losses of spirits. Losses by theft or any other cause... the losses are discovered. A physical inventory of the spirits storage tanks will be taken at the...

  5. 49 CFR 236.786 - Principle, closed circuit. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Principle, closed circuit. 236.786 Section 236.786 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Principle, closed circuit. The principle of circuit design where a normally energized electric circuit which...

  6. 49 CFR 236.1043 - Task analysis and basic requirements. (United States)


    ... Train Control Systems § 236.1043 Task analysis and basic requirements. (a) Training structure and... classroom, simulator, computer-based, hands-on, or other formally structured training designed to impart the... 49 Transportation 4 2010-10-01 2010-10-01 false Task analysis and basic requirements. 236.1043...

  7. 49 CFR 236.923 - Task analysis and basic requirements. (United States)


    ... for Processor-Based Signal and Train Control Systems § 236.923 Task analysis and basic requirements... structured training designed to impart the knowledge, skills, and abilities identified as necessary to... 49 Transportation 4 2010-10-01 2010-10-01 false Task analysis and basic requirements. 236.923...

  8. 49 CFR 236.1033 - Communications and security requirements. (United States)


    ... Train Control Systems § 236.1033 Communications and security requirements. (a) All wireless... 49 Transportation 4 2010-10-01 2010-10-01 false Communications and security requirements. 236.1033... exceeding the security strength required to protect the data as defined in the railroad's PTCSP and required...

  9. 7 CFR 58.236 - Pasteurization and heat treatment. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pasteurization and heat treatment. 58.236 Section 58... Service 1 Operations and Operating Procedures § 58.236 Pasteurization and heat treatment. All milk and... is handled according to sanitary conditions approved by the Administrator. (a) Pasteurization. (1...

  10. 49 CFR 236.18 - Software management control plan. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Software management control plan. 236.18 Section... Instructions: All Systems General § 236.18 Software management control plan. (a) Within 6 months of June 6, 2005, each railroad shall develop and adopt a software management control plan for its signal and train...

  11. Excess of {sup 236}U in the northwest Mediterranean Sea

    Energy Technology Data Exchange (ETDEWEB)

    Chamizo, E., E-mail: [Centro Nacional de Aceleradores, Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía, Thomas Alva Edison 7, 41092 Seville (Spain); López-Lora, M., E-mail: [Centro Nacional de Aceleradores, Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía, Thomas Alva Edison 7, 41092 Seville (Spain); Bressac, M., E-mail: [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco); Institute for Marine and Antarctic Studies, University of Tasmania, Hobart, TAS (Australia); Levy, I., E-mail: [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco); Pham, M.K., E-mail: [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco)


    In this work, we present first {sup 236}U results in the northwestern Mediterranean. {sup 236}U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25′N, 07°52′E). The obtained {sup 236}U/{sup 238}U atom ratios in the dissolved phase, ranging from about 2 × 10{sup −9} at 100 m depth to about 1.5 × 10{sup −9} at 2350 m depth, indicate that anthropogenic {sup 236}U dominates the whole seawater column. The corresponding deep-water column inventory (12.6 ng/m{sup 2} or 32.1 × 10{sup 12} atoms/m{sup 2}) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5 ng/m{sup 2} or 13 × 10{sup 12} atoms/m{sup 2}), evidencing the influence of local or regional {sup 236}U sources in the western Mediterranean basin. On the other hand, the input of {sup 236}U associated to Saharan dust outbreaks is evaluated. An additional {sup 236}U annual deposition of about 0.2 pg/m{sup 2} based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that {sup 236}U stays in solution in seawater. Overall, this source accounts for about 0.1% of the {sup 236}U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. - Highlights: • First {sup 236}U results in the northwest Mediterranean Sea are reported. • Anthropogenic {sup 236}U dominates the whole seawater column at DYFAMED station. • {sup 236}U deep-water column inventory exceeds by a factor of 2.5 the global fallout one. • Saharan dust intrusions are responsible for an annual

  12. Determination of C0-60 in Cobalt Slugs and Slabs and Radionuclides in Curium Sampler Slugs L-Reactor Disassembly Basin

    International Nuclear Information System (INIS)

    Casella, V.R.


    Co-60 was historically produced in the SRS reactors. Cobalt slugs were irradiated in the early 1970s. Post-production, remaining cobalt slugs (including slab form) were consolidated for storage. There are approximately nine hundred cobalt slugs currently stored awaiting final disposition. These slugs had historically incomplete documentation for activity rates; therefore, assaying was required in order to determine their activity levels. Since the gamma dose rate from these slugs is extremely high, the most cost effective way to shield a source of this magnitude from personnel and the radiation detector was to use the basin water in which the slugs are stored as the shield. A sodium iodide gamma detector was placed above a specially designed air collimator assembly, so that slug was at least eight feet from the detector and was shielded by the basin water. Using a sodium iodide detector and multichannel analyzer system and an underwater collimator assembly, Co-60 concentrations we re determined for Disassembly Basin cobalt slugs and slabs and 18 curium sampler slugs. The total activity of all of the assayed slugs summed to 31,783 curies. From the Co-60 concentrations of the curium sampler slugs, the irradiation flux was determined for the known irradiation time. The amounts of Pu-238, 239, 240, 241, 242; Am-241, 243; and Cm-242, 244 produced were then obtained based on the original amount of Pu-239 irradiated

  13. Co-ordination properties of diglycol-amide (DGA) to trivalent curium and lanthanides studied by XAS, XRD and XPS methods

    International Nuclear Information System (INIS)

    Yaita, T.; Hirata, M.; Narita, H.; Tachimori, S.; Yamamoto, H.; Edelstein, N.M.; Bucher, J.J.; Shuh, D.K.; Rao, L.


    Co-ordination properties of diglycol-amide (DGA) to trivalent curium and to the trivalent lanthanides were studied by the EXAFS, the XRD and the XPS methods. The structural determinations by both the crystal XRD and the solution EXAFS methods showed that the DGA co-ordinated to the trivalent lanthanide ion in a tridentate fashion: co-ordination of three oxygen atoms of each ligand to the metal ion. The bond distances of Er-O (carbonyl) and Er-O (ether) in the Er-DGA complex were 2.35 Angstrom, and 2.46 Angstrom, respectively, while the atom distances of Cm-O (carbonyl) and Cm-O (ether) in the Cm-DGA complex were 2.42 Angstrom and 3.94 Angstrom, respectively from the EXAFS data for the Cm-DGA complex. Accordingly, the DGA would behave only as a semi-tridentate in the co-ordination to trivalent curium in solution. We determined the valence band structures of the Er-DGA complex by the XPS in order to clarify the bond properties of the complex, and assigned the XPS spectrum by using the DV-DS molecular orbital calculation method. (authors)

  14. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    International Nuclear Information System (INIS)

    Okuno, Hiroshi


    Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  15. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)


    Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  16. Phenotype abnormality: 236 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 236 decreased susceptibility... in response to organism Agrobacterium ... Agrobacterium ... decreased susceptibility toward ...

  17. 48 CFR 852.236-89 - Buy American Act. (United States)


    ... contained in this clause 852.236-89 are waived for World Trade Organization (WTO) Government Procurement... not anticipate accepting an offer that includes foreign construction material, other than WTO GPA...

  18. Dicty_cDB: SFH236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC

  19. 48 CFR 252.236-7000 - Modification proposals-price breakdown. (United States)


    ...-price breakdown. 252.236-7000 Section 252.236-7000 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.236-7000 Modification proposals—price breakdown. As prescribed in 236.570(a), use the following clause: Modification Proposals—Price Breakdown (DEC 1991) (a) The...

  20. Thermodynamics of curium(III) in concentrated electrolyte solutions: formation of sulfate complexes in NaCl/Na2SO4 solutions

    International Nuclear Information System (INIS)

    Paviet, P.; Fanghaenel, T.; Klenze, R.; Kim, J.I.


    The formation of sulfate complexes of Curium in aqueous solutions is studied by time resolved laser fluorescence spectroscopy (TRLFS) at 25 C. The species Cm 3+ , Cm(SO 4 ) - , Cm(SO 4 ) - 2 and Cm(SO 4 ) 3- 3 are quantified spectroscopically in the trace concentration range by peak deconvolution of fluorescence emission spectra. The complex formation equilibria are measured in NaCl/ Na 2 SO 4 solutions of constant ionic strength (3 molal) as a function of the sulfate concentration. The stability constants of Cm(SO 4 ) + and Cm(SO 4 ) - 2 are determined to be log β 1 = 0.93±0.08 and log β 2 = 0.61±0.08, respectively. The complex Cm(SO 4 ) 3- 3 is found to be stable only at very high sulfate concentrations (above 1 molal) and therefore not considered for further evaluation. (orig.)

  1. Natural and anthropogenic {sup 236}U in environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Steier, Peter [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)], E-mail:; Bichler, Max [Atominstitut der Osterreichischen Universitaeten, Technische Universitaet Wien, Stadionallee 2, Wien A-1020 (Austria); Keith Fifield, L. [Department of Nuclear Physics, RSPhysSE, Australian National University, Canberra, ACT 0200 (Australia); Golser, Robin; Kutschera, Walter; Priller, Alfred [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Quinto, Francesca [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Richter, Stephan [Euopean Commission, Directorate-General Joint Research Centre, Institute for Reference Materials and Measurements (IRMM), Retieseweg 111, B-2440 Geel (Belgium); Srncik, Michaela [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Terrasi, Philippo [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Wacker, Lukas [Institute for Particle Physics, HPK H25, Schafmattstrasse 20, CH-8093 Zuerich (Switzerland); Wallner, Anton [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Wallner, Gabriele [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Wilcken, Klaus M. [Scottish Universities Environmental Research Centre, Scottish Enterprise Technology Park, East Kilbride G75 OQF (United Kingdom); Maria Wild, Eva [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)


    The interaction of thermal neutrons with {sup 235}U results in fission with a probability of {approx}85% and in the formation of {sup 236}U (t{sub 1/2} = 2.3 x 10{sup 7} yr) with a probability of {approx}15%. While anthropogenic {sup 236}U is, therefore, present in spent nuclear fuel at levels of {sup 236}U/U up to 10{sup -2}, the expected natural ratios in the pre-anthropogenic environment range from 10{sup -14} to 10{sup -10}. At VERA, systematic investigations suggest a detection limit below {sup 236}U/U = 5 x 10{sup -12} for samples of 0.5 mg U, while chemistry blanks of {approx}2 x 10{sup 7} atoms {sup 236}U per sample limit the sensitivity for smaller samples. We have found natural isotopic ratios in uranium reagents separated before the onset of human nuclear activities, in uranium ores from various origins and in water from a subsurface well in Bad Gastein, Austria. Anthropogenic contamination was clearly visible in soil and rivulet samples from Salzburg, Austria, whereas river sediments from Garigliano river (Southern Italy) were close to the detection limit. Finally, our natural in-house standard Vienna-KkU was calibrated against a certified reference material (IRMM REIMEP-18 A)

  2. Plutonium-236 traces determination in plutonium-238 by α spectrometry

    International Nuclear Information System (INIS)

    Acena, M.L.; Pottier, R.; Berger, R.


    Two methods are described in this report for the determination of plutonium-236 traces in plutonium-238 by a spectrometry using semi-conductor detectors. The first method involves a direct comparison of the areas under the peaks of the α spectra of plutonium-236 and plutonium-238. The electrolytic preparation of the sources is carried out after preliminary purification of the plutonium. The second method makes it possible to determine the 236 Pu/ 238 Pu ratio by comparing the areas of the α peaks of uranium-232 and uranium-234, which are the decay products of the two plutonium isotopes respectively. The uranium in the source, also deposited by electrolysis, is separated from a 1 mg amount of plutonium either by a T.L.A. extraction, or by the use of ion-exchange resins. The report ends with a discussion of the results obtained with plutonium of two different origins. (authors) [fr

  3. Spectroscopic and thermodynamic studies on the complexation of trivalent curium with inorganic ligands at increased temperatures; Spektroskopische und thermodynamische Untersuchungen zur Komplexierung von trivalentem Curium mit anorganischen Liganden bei erhoehten Temperaturen

    Energy Technology Data Exchange (ETDEWEB)

    Skerencak, Andrej


    The subject of the present investigation is the complexation of trivalent actinides at elevated temperatures. The objective of this work is to broaden the comprehension of the geochemical processes relevant for the migration of radionuclides in the near-field of a nuclear waste repository. Depending on the disposed nuclear waste, the temperature in the direct vicinity of a nuclear waste repository may reach up to 200 C. The result is a distinct change of the geochemistry of the actinides. Many of these processes have already been studied in detail at room temperature. Yet, data at elevated temperature are rare. However, a comprehensive long term safety analysis of a nuclear waste repository requires the precise thermodynamic description of the relevant geochemical processes at room as well as at elevated temperatures. The present work is focused on the investigation of the complexation of trivalent curium (Cm(III)) with different inorganic ligands at elevated temperatures. Due to its outstanding spectroscopic properties, Cm(III) is chosen as a representative for trivalent actinides. The studied ligand systems are nitrate (NO{sub 3}{sup -}), fluoride (F{sup -}), sulphate (SO{sub 4}{sup 2-}) and chloride (Cl{sup -}). The main analytical method employed is the ''time resolved laser fluorescence spectroscopy'' (TRLFS). The experiments with nitrate, sulphate and chloride were carried out in a custom-built high temperature cell, enabling spectroscopic studies at temperatures up to 200 C. The Cm(III)-fluoride-system was studied in a cuvette (quartz glass) in the temperature range from 20 to 90 C. Supplementary structural studies were performed using EXAFS (Extended X-Ray Absorption Fine Structure) spectroscopy and supported by quantum chemical calculations at DFT (Density Functional Theory) level. The results of the TRLFS studies show a general shift of the chemical equilibrium towards the complexed species with increasing temperature. For instance

  4. Buildup of 236U in the gaseous diffusion plant product

    International Nuclear Information System (INIS)

    Ford, J.S.


    A generalized projection of the average annual 236 U concentration that can be expected in future enriched uranium product from the US-ERDA gaseous diffusion plants when reprocessed fuels become available for cascade feeding is given. It is concluded that the buildup of 236 U is not an ever-increasing function, but approaches a limiting value. Projected concentrations result in only slight separative work losses and present no operational problem to ERDA in supplying light water reactor requirements. The use of recycle uranium from power reactor spent fuels will result in significant savings in natural uranium feed

  5. 48 CFR 52.236-17 - Layout of Work. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Layout of Work. 52.236-17... Layout of Work. As prescribed in 36.517, insert the following clause in solicitations and contracts when... need for accurate work layout and for siting verification during work performance: Layout of Work (APR...

  6. 27 CFR 46.236 - Articles in a warehouse. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles in a warehouse... Tubes Held for Sale on April 1, 2009 Filing Requirements § 46.236 Articles in a warehouse. (a) Articles... articles will be offered for sale. (b) Articles offered for sale at several locations must be reported on a...

  7. 49 CFR 236.51 - Track circuit requirements. (United States)


    ...: All Systems Track Circuits § 236.51 Track circuit requirements. Track relay controlling home signals shall be in deenergized position, or device that functions as a track relay controlling home signals... conditions exist: (a) When a rail is broken or a rail or switch-frog is removed except when a rail is broken...

  8. 48 CFR 552.236-74 - Working Hours. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Working Hours. 552.236-74... Hours. As prescribed in 536.570-5, insert the following clause: Working Hours (APR 1984) (a) It is contemplated that all work will be performed during the customary working hours of the trades involved unless...

  9. 49 CFR 236.919 - Operations and Maintenance Manual. (United States)


    ..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Standards for Processor-Based Signal and Train Control Systems § 236.919 Operations and Maintenance Manual. (a... identify all software versions, revisions, and revision dates. Plans must be legible and correct. (c...

  10. 49 CFR 236.1039 - Operations and Maintenance Manual. (United States)


    ..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Positive Train Control Systems § 236.1039 Operations and Maintenance Manual. (a) The railroad shall catalog and... software versions, revisions, and revision dates. Plans must be legible and correct. (c) Hardware, software...

  11. 48 CFR 52.236-13 - Accident Prevention. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Accident Prevention. 52....236-13 Accident Prevention. As prescribed in 36.513, insert the following clause: Accident Prevention... contracts for construction or dismantling, demolition, or removal of improvements, the Contractor shall— (1...

  12. Mass and abundance {sup 236}U sensitivities at CIRCE

    Energy Technology Data Exchange (ETDEWEB)

    De Cesare, M., E-mail: [Department of Nuclear Physics, Research School of Physics and Engineering, Australian National University, ACT 0200 Canberra (Australia); CIRCE and Dipartimento di Matematica e Fisica, Seconda Universitá di Napoli, via Vivaldi 43, 81100 Caserta (Italy); De Cesare, N.; D’Onofrio, A. [CIRCE and Dipartimento di Matematica e Fisica, Seconda Universitá di Napoli, via Vivaldi 43, 81100 Caserta (Italy); INFN Sezione di Napoli, via Cintia, Edificio G, 80126 Napoli (Italy); Fifield, L.K. [Department of Nuclear Physics, Research School of Physics and Engineering, Australian National University, ACT 0200 Canberra (Australia); Gialanella, L.; Terrasi, F. [CIRCE and Dipartimento di Matematica e Fisica, Seconda Universitá di Napoli, via Vivaldi 43, 81100 Caserta (Italy); INFN Sezione di Napoli, via Cintia, Edificio G, 80126 Napoli (Italy)


    The actinides (e.g. {sup 236}U and {sup x}Pu isotopes) are present in environmental samples at the ultra trace level since atmospheric tests of NWs (Nuclear Weapons) performed in the past, deliberate dumping of nuclear waste, nuclear fuel reprocessing, on a large scale and operation of NPPs (Nuclear Power Plants) on a small scale have led to the release of a wide range of radioactive nuclides in the environment. Their detection requires the most sensitive AMS (Accelerator Mass Spectrometry) techniques and at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy, an upgraded actinide AMS system, based on a 3-MV pelletron tandem accelerator, has been operated. In this paper the progress made in order to push the {sup 236}U mass sensitivity and {sup 236}U/{sup 238}U isotopic ratio down to the natural levels is reported. A uranium contamination mass of about 0.05 μg and a {sup 236}U/{sup 238}U isotopic ratio sensitivities at the level of 3.2 × 10{sup −13} are presently achievable.

  13. Mass and abundance 236U sensitivities at CIRCE (United States)

    De Cesare, M.; De Cesare, N.; D'Onofrio, A.; Fifield, L. K.; Gialanella, L.; Terrasi, F.


    The actinides (e.g. 236U and xPu isotopes) are present in environmental samples at the ultra trace level since atmospheric tests of NWs (Nuclear Weapons) performed in the past, deliberate dumping of nuclear waste, nuclear fuel reprocessing, on a large scale and operation of NPPs (Nuclear Power Plants) on a small scale have led to the release of a wide range of radioactive nuclides in the environment. Their detection requires the most sensitive AMS (Accelerator Mass Spectrometry) techniques and at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy, an upgraded actinide AMS system, based on a 3-MV pelletron tandem accelerator, has been operated. In this paper the progress made in order to push the 236U mass sensitivity and 236U/238U isotopic ratio down to the natural levels is reported. A uranium contamination mass of about 0.05 μg and a 236U/238U isotopic ratio sensitivities at the level of 3.2 × 10-13 are presently achievable.

  14. 27 CFR 40.236 - Release from customs custody. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Release from customs... on Tobacco Products § 40.236 Release from customs custody. The release of tobacco products from customs custody, in bond, for transfer to the premises of a tobacco products factory, shall be in...

  15. 48 CFR 1852.236-73 - Hurricane plan. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Hurricane plan. 1852.236-73... Hurricane plan. As prescribed in 1836.570(c), insert the following clause: Hurricane Plan (DEC 1988) In the event of a hurricane warning, the Contractor shall— (a) Inspect the area and place all materials...

  16. 48 CFR 852.236-74 - Inspection of construction. (United States)


    ...: (a) Inspection of materials and articles furnished under this contract will be made at the site by... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Inspection of construction... CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.236-74...

  17. 24 CFR 236.253 - Premiums-operating loss loans. (United States)


    ... Obligations for Mortgage Insurance § 236.253 Premiums—operating loss loans. All of the provisions of § 207.252a of this chapter relating to mortgage insurance premiums on operating loss loans shall apply to... Act the mortgage insurance premiums due in accordance with § 207.252a shall be calculated on the basis...

  18. 48 CFR 53.236 - Construction and architect-engineer contracts. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Construction and architect-engineer contracts. 53.236 Section 53.236 Federal Acquisition Regulations System FEDERAL ACQUISITION...-engineer contracts. ...

  19. 49 CFR 236.338 - Mechanical locking required in accordance with locking sheet and dog chart. (United States)


    ... locking sheet and dog chart. 236.338 Section 236.338 Transportation Other Regulations Relating to... in accordance with locking sheet and dog chart. Mechanical locking shall be in accordance with locking sheet and dog chart currently in effect. ...

  20. 48 CFR 452.236-74 - Control of Erosion, Sedimentation, and Pollution. (United States)


    ..., Sedimentation, and Pollution. 452.236-74 Section 452.236-74 Federal Acquisition Regulations System DEPARTMENT OF....236-74 Control of Erosion, Sedimentation, and Pollution. As prescribed in 436.574, insert the following clause: Control of Erosion, Sedimentation, and Pollution (NOV 1996) (a) Operations shall be...

  1. 33 CFR 2.36 - Navigable waters of the United States, navigable waters, and territorial waters. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Navigable waters of the United States, navigable waters, and territorial waters. 2.36 Section 2.36 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL JURISDICTION Jurisdictional Terms § 2.36 Navigable waters...

  2. 49 CFR 236.312 - Movable bridge, interlocking of signal appliances with bridge devices. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Movable bridge, interlocking of signal appliances with bridge devices. 236.312 Section 236.312 Transportation Other Regulations Relating to... SYSTEMS, DEVICES, AND APPLIANCES Interlocking Standards § 236.312 Movable bridge, interlocking of signal...

  3. 48 CFR 52.236-23 - Responsibility of the Architect-Engineer Contractor. (United States)


    ... Architect-Engineer Contractor. 52.236-23 Section 52.236-23 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.236-23 Responsibility of the Architect-Engineer Contractor. As prescribed in 36.609-2(b), insert the following clause: Responsibility of the Architect-Engineer Contractor (APR 1984) (a...

  4. 48 CFR 236.602 - Selection of firms for architect-engineer contracts. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Selection of firms for architect-engineer contracts. 236.602 Section 236.602 Federal Acquisition Regulations System DEFENSE... ARCHITECT-ENGINEER CONTRACTS Architect-Engineer Services 236.602 Selection of firms for architect-engineer...

  5. 48 CFR 952.236-71 - Inspection in architect-engineer contracts. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Inspection in architect-engineer contracts. 952.236-71 Section 952.236-71 Federal Acquisition Regulations System DEPARTMENT OF....236-71 Inspection in architect-engineer contracts. As prescribed at 936.609-3 insert the following...

  6. 48 CFR 853.236 - Construction and architect-engineer contracts. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Construction and architect-engineer contracts. 853.236 Section 853.236 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS FORMS Prescription of Forms 853.236 Construction and architect-engineer...

  7. 48 CFR 52.236-24 - Work Oversight in Architect-Engineer Contracts. (United States)


    ... Architect-Engineer Contracts. 52.236-24 Section 52.236-24 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.236-24 Work Oversight in Architect-Engineer Contracts. As prescribed in 36.609-3, insert the following clause: Work Oversight in Architect-Engineer Contracts (APR 1984) The extent and...

  8. 49 CFR 236.330 - Locking dog of switch-and-lock movement. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locking dog of switch-and-lock movement. 236.330 Section 236.330 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Rules and Instructions § 236.330 Locking dog of switch-and-lock movement. Locking dog of switch-and-lock...

  9. 29 CFR 1952.236 - Where the plan may be inspected. (United States)


    ... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.236 Section 1952.236..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Kentucky § 1952.236...

  10. 24 CFR 236.755 - Housing owner's obligation under contract to report tenant income increase. (United States)


    ... FOR RENTAL PROJECTS Rental Assistance Payments § 236.755 Housing owner's obligation under contract to... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Housing owner's obligation under contract to report tenant income increase. 236.755 Section 236.755 Housing and Urban Development...

  11. The recycling of the actinides neptunium, americium and curium in a fast power reactor to reduce the long term activity in a final store

    International Nuclear Information System (INIS)

    Beims, H.D.


    The starting point for the considerations and calculations given in this dissertation is the inevitable production of radioactive materials in the use of nuclear energy, which creates a considerable potential danger in a final store for a very long period. As one possibility of alleviating this problem, a concept for recycling the waste actinides neptunium, americium and curium was proposed. The waste actinides are separated in the reprocessing of burnt-up fuel elements and reach a further irradiation circuit. There they pass through the stages 'manufacture of irradiation elements', 'use in a fast power reactor' and reprocessing of irradiation elements' several times. In each irradiation and subsequent storage, about 17% of the waste actinides are removed by fission or by conversion into nuclides which can be reused as fuel, so that during the life of 40 years of the fast recycling reacor, the waste actinides can be reduced in mass by one half. In order to determine this mass reduction effect, a model calculation was developed, which includes the representation of the neutron physics and thermal properties of the reactor core and the storage and reprocessing of the irradiation elements. (orig./RB) [de

  12. Type B accident investigation board report of the July 2, 1997 curium intake by shredder operator at Building 513 Lawrence Livermore National Laboratory, Livermore, California. Final report

    International Nuclear Information System (INIS)


    On July 2, 1997 at approximately 6:00 A.M., two operators (Workers 1 and 2), wearing approved personal protective equipment (PPE), began a shredding operation of HEPA filters for volume reduction in Building 513 (B-513) at Lawrence Livermore National Laboratory (LLNL). The waste requisitions indicated they were shredding filters containing ≤ 1 μCi of americium-241 (Am-241). A third operator (Worker 3) provided support to the shredder operators in the shredding area (hot area) from a room that was adjacent to the shredding area (cold area). At Approximately 8:00 A.M., a fourth operator (Worker 4) relieved Worker 2 in the shredding operation. Sometime between 8:30 A.M. and 9:00 A.M., Worker 3 left the cold area to make a phone call and set off a hand and foot counter in Building 514. Upon discovering the contamination, the shredding operation was stopped and surveys were conducted in the shredder area. Surveys conducted on the workers found significant levels of contamination on their PPE and the exterior of their respirator cartridges. An exit survey of Worker 1 was conducted at approximately 10:05 A.M., and found contamination on his PPE, as well as on the exterior and interior of his respirator. Contamination was also found on his face, chest, back of neck, hair, knees, and mustache. A nose blow indicated significant contamination, which was later determined to be curium-244

  13. Shape Isomer in 236U Populated by Thermal Neutron Capture

    DEFF Research Database (Denmark)

    Andersen, Verner; Christensen, Carl Jørgen; Borggreen, J.


    The 116 ns shape isomer in 236U was populated by thermal neutron capture. Conversion electrons and X-rays were detected simultaneously in delayed coincidence with fission. The ratio of delayed to prompt fission was measured with the result, σIIf/σf = (1.0±0.2) × 10−5. A branching of the isomeric ...... decay σIIγ/σIIf = 7±2 was deduced from this number. No definite electron line structure was observed....

  14. Update neutron nuclear data evaluation for 236,238Np

    International Nuclear Information System (INIS)

    Chen, Guochang; Wang, Jimin; Yu, Baosheng; Cao, Wentian; Tang, Guo-you


    The nuclear data with high accuracy for actinides play an important role in nuclear technology applications, including reactor design and operation, fuel cycle, estimation of the amount of minor actinides (MAs) in high burnup reactors and to research to transmute the MAs to short half-lived nuclides or stable ones. The nuclides of 236 Np are generated via the α-decay of 240 Am or 237 Np(n, 2n) and 237 Np(d, t) reactions. And the nuclides of 238 Np are generated via the α-decay of 242 Am or 237 Np(n, γ) and 237 Np(d, p) reactions. In the present work, according to the systematic trend of the total cross section and elastic cross section etc. of different Np isotopes, and based on the neutron optical model parameters (OMP) of 237 Np, a new set of neutron optical model parameters were obtained for 236,238 Np. Based on the new set OMP and the systematic trend of the cross sections of different Np isotopes, a full set of 236,238 Np neutron nuclear data has been updated and improved by theoretical calculation. The present result has significant improvements over the data in CENDL-3.1

  15. Determination of Neptunium, Americium and Curium in Spent Nuclear Fuel Samples by Alpha Spectrometry Using 239Np and 243Am as a Spike and a Tracer

    International Nuclear Information System (INIS)

    Jeo, Kih-Soo; Song, Byung-Chul; Kim, Young-Bok; Han, Sun-Ho; Jeon, Young-Shin; Jung, Euo-Chang; Jee, Kwang-Yong


    Determination of actinide elements and fission products in spent nuclear fuels is of importance for a burnup determination and source term evaluation. Especially, the amounts of uranium and plutonium isotopes are used for the evaluation of a burnup credit in spent nuclear fuels. Additionally, other actinides such as Np, Am and Cm in spent nuclear fuel samples is also required for the purposes mentioned above. In this study, 237 Np, 241 Am and 244 Cm were determined by an alpha spectrometry for the source term data for high burnup spent nuclear fuels ranging from 37 to 62.9 GWD/MtU as a burnup. Generally, mass spectrometry has been known as the most powerful method for isotope determinations such as high concentrations of uranium and plutonium. However, in the case of minor actinides such as Np, Am and Cm, alpha spectrometry would be recommended instead. Determination of the transuranic elements in spent nuclear fuel samples is different from that for environmental samples because the amount of each nuclide in the spent fuel samples is higher and the relative ratios between each nuclide are also different from those for environmental samples. So, it is important to select an appropriate tracer and an optimum sample size depending on the nuclides and analytical method. In this study 237 Np was determined by an isotope dilution alpha(gamma) spectrometry using 239 Np as a spike, and 241 Am and curium isotopes were determined by alpha spectrometry using 243 Am as a tracer. The content of each nuclide was compared with that by the Origen-2 code

  16. Electric resistivity of 241-americium and 244-curium metals. Creation of defects and isochronous annealing of 241-americium metal after self-irradiation

    International Nuclear Information System (INIS)

    Schenkel, R.


    The temperature dependence of the electrical resistivity of thin films of bulk 241 Am metal were measured between 300 and 4.5 K. The room temperature resistivity was found to be 68.90μΩcm. At room temperature the electrical resistivity of americium increases with pressure (3% up to 13 kbar). The application of 13 kbar pressure did not change the low temperature power law in the electrical resistivity. The resistivity vs temperature curve can be explained by assuming s-d scattering of conduction electrons. The localized 5f electrons are considered to be about 5eV below the Fermi level. Americium therefore should be the first lanthanide-like element in the actinide series. The defect production due to self-irradiation damage was studied by measuring the increase of the resistivity at 4.2 K over a period of 738 h. A saturation resistivity of 16.036 μΩcm was found corresponding to a defect concentration of about 0.22 a/o. After isochronal annealing two recovery stages were observed at about 65 and 145 K. The two stages shift with increasing initial defect concentration to lower temperatures. Estimates of the activation energies and the reaction order were made and possible defect reactions suggested. The magnetic contribution to the electrical resistivity of curium, which shows an antiferromagnetic transition at 52.5 k, was obtained by subtracting the resistivity of americium (to be considered as phonon part). Comparison with theoretical models were made. At low temperatures the measurements are strongly affected by self-irradiation damage [drho/dt(t=0)=9.8μΩcm/h

  17. Separation and activity determination of 239+240Pu, 241Am and Curium (242and244Cm) in evaporator concentrate by Alpha Spectrometry

    International Nuclear Information System (INIS)

    Reis Junior, Aluisio S.; Temba, Eliane S.C.; Kastner, Geraldo F.; Monteiro, Roberto P.G.


    Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241 Am, 242 Cm and 24 3 ,244 Cm isotopes is possible using the 243 Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238 Pu, 243 Am, 244 Cm and 232 U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241 Am it was (1,040 ± 160 mBqKg -1 ), relative standard deviation 15.38%, and for 239+240 Pu it was (551 +- 44 mBqKg -1 ), relative standard deviation 7.98%. In addition, for the 242 Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg -1 ), with the relative standard deviation 30.67% higher than for 241 Am and 239+240 Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg -1 . (author)

  18. Safe handling of kilogram amounts of fuel-grade plutonium and of gram amounts of plutonium-238, americium-241 and curium-244

    International Nuclear Information System (INIS)

    Louwrier, K.P.; Richter, K.


    During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239 Pu containing 8-12% 240 Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241 Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241 Am, 243 Am and 244 Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241 Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)

  19. Fast radiochemical procedure to measure neptunium, plutonium, americium and curium in environmental samples for application in environmental monitoring and in radioecology research

    International Nuclear Information System (INIS)

    Pimpel, M.; Schuettelkopf, H.


    A radiochemical method is described by which Np, Pu, Am and Cm in environmental samples can be determined. The transuranium elements are dissolved with acids out of the ashed material. Np/Pu is separated from Am/Cm by sequential extraction using TOPO/cyclohexane. The two fractions are radiochemically purified. Np-237, Pu-239+240, Pu-238 and Pu-236 as well as Am-243, Am-241, Cm-244 and Cm-242 are measured by alpha spectrometery. Pu-236, Am-243 and Np-239 are used to determine the respective yields. A fast method of Np-239 preparation is described. The chemical yields range from 60 to 90%. The detection limit attained per nuclide is 10 fCi/sample. 20 reference, 1 table

  20. Anthropogenic 236U recorded in annually banded coral skeleton at Majuro atoll, the equatorial Pacific

    International Nuclear Information System (INIS)

    Sakaguchi, Aya; Eto, Asuka; Takahashi, Yoshio; Steier, Peter; Yamazaki, Atsuko; Watanabe, Tsuyoshi; Sasaki, Keiichi; Yamano, Hiroya


    Historical 236 U/ 238 U atom ratio and concentration of 236 U were determined by Accelerator Mass Spectrometry (AMS) in skeletons of dated modern coral core sample collected from Majuro atoll, equatorial Pacific, to reconstruct anthropogenic 236 U inputs to the Equatorial Pacific. The maximum hydrogen bomb-pulses of 236 U/ 238 U and 236 U concentration, 2.83x10 -9 and 1.85x10 7 atom/g, in an annually resolved coral core were captured in 1954 (Operation Castle at Bikini and Enewetok atolls). The values were abruptly decreased in a few years, and they have been gradually decreased over time. Our results allow studies of not only the present distribution pattern, but gives access to the temporal evolution of 236 U in surface seawater of North Equatorial Current which is introduced to the Japan Sea and the North West Pacific Ocean as Kuroshio and Tsushima currents over the past decades. (author)

  1. Anthropogenic 236U in Danish Seawater: Global Fallout versus Reprocessing Discharge

    DEFF Research Database (Denmark)

    Qiao, Jixin; Steier, Peter; Nielsen, Sven Poul


    This work focuses on the occurrence of 236U in seawater along Danish coasts, which is the sole water-exchange region between the North Sea-Atlantic Ocean and the Baltic Sea. Seawater collected in 2013 and 2014 were analyzed for 236U (as well as 238U and 137Cs). Our results indicate that 236U...... seawater. However, unexpectedly high 236U/238U ratios as well as high 236U concentrations were observed at low-salinity locations of the Baltic Sea. While this feature might be interpreted as a clue for another significant 236U input in the Baltic Sea, it may also be caused by the complexity of water...... currents or slow turnover rate....

  2. Anthropogenic 236U in Danish Seawater: Global Fallout versus Reprocessing Discharge. (United States)

    Qiao, Jixin; Steier, Peter; Nielsen, Sven; Hou, Xiaolin; Roos, Per; Golser, Robin


    This work focuses on the occurrence of 236 U in seawater along Danish coasts, which is the sole water-exchange region between the North Sea-Atlantic Ocean and the Baltic Sea. Seawater collected in 2013 and 2014 were analyzed for 236 U (as well as 238 U and 137 Cs). Our results indicate that 236 U concentrations in Danish seawater are distributed within a relatively narrow range of (3.6-8.2) × 10 7 atom/L and, to a certain extent, independent of salinity. 236 U/ 238 U atomic ratios in Danish seawater are more than 4 times higher than the estimated global fallout value of 1× 10 -9 . The levels of 236 U/ 238 U atomic ratios obtained are comparable to those reported for the open North Sea and much higher than several other open oceans worldwide. This indicates that besides the global fallout input, the discharges from the two major European nuclear reprocessing plants are dominating sources of 236 U in Danish seawater. However, unexpectedly high 236 U/ 238 U ratios as well as high 236 U concentrations were observed at low-salinity locations of the Baltic Sea. While this feature might be interpreted as a clue for another significant 236 U input in the Baltic Sea, it may also be caused by the complexity of water currents or slow turnover rate.

  3. 236 children with developmental hydrocephalus: causes and clinical consequences (United States)

    Tully, Hannah M; Ishak, Gisele E; Rue, Tessa C; Dempsey, Jennifer C; Browd, Samuel R; Millen, Kathleen J; Doherty, Dan; Dobyns, William B


    Few systematic assessments of developmental forms of hydrocephalus exist. We reviewed MRIs and clinical records of patients with infancy-onset hydrocephalus. Among 411 infants, 236 had hydrocephalus with no recognizable extrinsic cause. These children were assigned to one of five subtypes and compared on the basis of clinical characteristics, developmental and surgical outcomes. At an average age of 5.3 years, 72% of children were walking independently and 87% could eat by mouth. 18% had epilepsy. Distinct patterns of associated malformations and syndromes were observed within each subtype. On average, children with aqueductal obstruction, cysts and encephaloceles had worse clinical outcomes than those with other forms of developmental hydrocephalus. 53% of surgically-treated patients experienced at least one shunt failure, but hydrocephalus associated with posterior fossa crowding required fewer shunt revisions. We conclude that each subtype of developmental hydrocephalus is associated with distinct clinical characteristics, syndromology, and outcomes, suggesting differences in underlying mechanisms. PMID:26184484

  4. Status of {sup 236}U analyses at ETH Zurich and the distribution of {sup 236}U and {sup 129}I in the North Sea in 2009

    Energy Technology Data Exchange (ETDEWEB)

    Christl, Marcus, E-mail: [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Casacuberta, Nuria; Lachner, Johannes; Maxeiner, Sascha; Vockenhuber, Christof; Synal, Hans-Arno [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Goroncy, Ingo; Herrmann, Jürgen [Bundesamt für Seeschifffahrt und Hydrographie, Hamburg (Germany); Daraoui, Abdelouahed; Walther, Clemens; Michel, Rolf [Institut für Radioökologie und Strahlenschutz, Leibniz Universität Hannover (Germany)


    Compact, low energy accelerator mass spectrometry (AMS) has evolved over the past years as one of the most sensitive, selective, and robust techniques for the analysis of heavy and long lived radionuclides. In this study, we will first focus on the analytical capabilities of the compact AMS system TANDY, mainly for {sup 236}U analyses, and then present a new dual tracer approach, that combines {sup 129}I and {sup 236}U. The measured {sup 129}I/{sup 236}U ratios of samples collected in the North Sea in 2009 are in reasonable agreement with the expectations from documented or estimated releases from the two major nuclear reprocessing plants located at Sellafield (GB) and La Hague (F), suggesting that the {sup 129}I/{sup 236}U ratio can be used as a water mass tag in the North Atlantic region. However, our results indicate that, in contrast to {sup 129}I, additional contributions of bomb produced {sup 236}U cannot be neglected in the North Sea region. This complicates the simple and straight forward use of the {sup 129}I/{sup 236}U ratio as a quantitative tool for the calculation of transport times of North Sea water in the Arctic Ocean.

  5. 49 CFR 236.74 - Protection of insulated wire; splice in underground wire. (United States)


    ... underground wire. 236.74 Section 236.74 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING... wire; splice in underground wire. Insulated wire shall be protected from mechanical injury. The...

  6. 42 CFR 435.236 - Individuals in institutions who are eligible under a special income level. (United States)


    ... a special income level. 435.236 Section 435.236 Public Health CENTERS FOR MEDICARE & MEDICAID... in institutions who are eligible under a special income level. (a) If the agency provides Medicaid... not institutionalized; but (2) Have income below a level specified in the plan under § 435.722. (See...

  7. 49 CFR 236.16 - Electric lock, main track releasing circuit. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock, main track releasing circuit. 236... Rules and Instructions: All Systems General § 236.16 Electric lock, main track releasing circuit. When an electric lock releasing circuit is provided on the main track to permit a train or an engine to...

  8. 48 CFR 952.236 - Construction and architect-engineer contracts. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Construction and architect-engineer contracts. 952.236 Section 952.236 Federal Acquisition Regulations System DEPARTMENT OF ENERGY... Construction and architect-engineer contracts. ...

  9. 48 CFR 853.236-70 - VA Form 10-6298, Architect-Engineer Fee Proposal. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA Form 10-6298, Architect-Engineer Fee Proposal. 853.236-70 Section 853.236-70 Federal Acquisition Regulations System DEPARTMENT OF...-Engineer Fee Proposal. VA Form 10-6298, Architect-Engineer Fee Proposal, shall be used as prescribed in 836...


    The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...

  11. 48 CFR 852.236-82 - Payments under fixed-price construction contracts (without NAS). (United States)


    ... manner; or (iv) Failure to comply in good faith with approved subcontracting plans, certifications, or... under other provisions of the contract or in accordance with the general law and regulations regarding... construction contracts (without NAS). 852.236-82 Section 852.236-82 Federal Acquisition Regulations System...

  12. 24 CFR 236.252 - First, second, and third mortgage insurance premiums. (United States)


    ... insurance premiums. 236.252 Section 236.252 Housing and Urban Development Regulations Relating to Housing... insurance premiums. All of the provisions of § 207.252 of this chapter governing the first, second, and third mortgage insurance premiums shall apply to mortgages insured under this subpart, except: (a) Where...

  13. Excess of "2"3"6U in the northwest Mediterranean Sea

    International Nuclear Information System (INIS)

    Chamizo, E.; López-Lora, M.; Bressac, M.; Levy, I.; Pham, M.K.


    In this work, we present first "2"3"6U results in the northwestern Mediterranean. "2"3"6U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25′N, 07°52′E). The obtained "2"3"6U/"2"3"8U atom ratios in the dissolved phase, ranging from about 2 × 10"−"9 at 100 m depth to about 1.5 × 10"−"9 at 2350 m depth, indicate that anthropogenic "2"3"6U dominates the whole seawater column. The corresponding deep-water column inventory (12.6 ng/m"2 or 32.1 × 10"1"2 atoms/m"2) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5 ng/m"2 or 13 × 10"1"2 atoms/m"2), evidencing the influence of local or regional "2"3"6U sources in the western Mediterranean basin. On the other hand, the input of "2"3"6U associated to Saharan dust outbreaks is evaluated. An additional "2"3"6U annual deposition of about 0.2 pg/m"2 based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that "2"3"6U stays in solution in seawater. Overall, this source accounts for about 0.1% of the "2"3"6U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. - Highlights: • First "2"3"6U results in the northwest Mediterranean Sea are reported. • Anthropogenic "2"3"6U dominates the whole seawater column at DYFAMED station. • "2"3"6U deep-water column inventory exceeds by a factor of 2.5 the global fallout one. • Saharan dust intrusions are responsible for an annual "2"3"6U flux of 0.02 pg/m"2. • Further studies are necessary to explain the

  14. Uranium-236 in light water reactor spent fuel recycled to an enriching plant

    International Nuclear Information System (INIS)

    de la Garza, A.


    The introduction of 236 U to an enriching plant by recycling spent fuel uranium results in enriched products containing 236 U, a parasitic neutron absorber in reactor fuel. Convenient approximate methodology determines 235 236 U, and total uranium flowsheets with associated separative work requirements in enriching plant operations for use by investigators of the light water reactor fuel cycle not having recourse to specialized multicomponent cascade technology. Application of the methodology has been made to compensation of an enriching plant product for 236 U content and to the value at an enriching plant of spent fuel uranium. The approximate methodology was also confirmed with more exact calculations and with some experience with 236 U in an enriching plant

  15. 49 CFR 236.401 - Automatic block signal system and interlocking standards applicable to traffic control systems. (United States)


    ... TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Traffic Control Systems Standards § 236.401 Automatic... 49 Transportation 4 2010-10-01 2010-10-01 false Automatic block signal system and interlocking standards applicable to traffic control systems. 236.401 Section 236.401 Transportation Other Regulations...

  16. Magnetic susceptibility of curium pnictides

    International Nuclear Information System (INIS)

    Nave, S.E.; Huray, P.G.; Peterson, J.R.; Damien, D.A.; Haire, R.G.


    The magnetic susceptibility of microgram quantities of 248 CmP and 248 CmSb has been determined with the use of a SQUID micromagnetic susceptometer over the temperature range 4.2 to 340 K and in the applied magnetic field range of 0.45 to 1600 G. The fcc (NaCl-type) samples yield magnetic transitions at 73K and 162 K for the phosphide and antimonide, respectively. Together with published magnetic data for CmN and CmAs, these results indicate spatially extended exchange interactions between the relatively localized 5f electrons of the metallic actinide atoms

  17. Neutron-Induced Fission Cross Section of Uranium, Americium and Curium Isotopes. Progress report - Research Contract 14485, Coordinated Research Project on Minor Actinide Neutron Reaction Data (MANREAD)

    International Nuclear Information System (INIS)

    Alekseev, A.A.; Bergman, A.A.; Berlev, A.I.; Koptelov, E.A.; Samylin, B.F.; Trufanov, A.M.; Fursov, B.I.; Shorin, V.S.


    This report contains brief description of the Lead Slowing Down Spectrometer and results of measurements of neutron-induced fission cross sections for 236 U, 242m Am, 243 Cm, 244 Cm, 245 Cm and 246 Cm done at this spectrometer. The work was partially supported through the IAEA research contract RC-14485-RD in the framework of the IAEA Coordinated Research Project 'Minor Actinide Neutron Reaction Data (MANREAD)'. The detailed description of the experimental set up, measurements procedure and data treatment can be found in the JIA-1182 (2007) and JIA-1212 (2009) reports from the Institute of Nuclear Research of the Russian Academy of Science published in Russian. Part 1 contains the first year report of the research contract and part 2 the second year report. (author)

  18. European roe deer antlers as an environmental archive for fallout 236U and 239Pu

    International Nuclear Information System (INIS)

    Froehlich, M.B.; Steier, P.; Wallner, G.; Fifield, L.K.


    Anthropogenic 236 U and 239 Pu were measured in European roe deer antlers hunted between 1955 and 1977 which covers and extends beyond the period of intensive nuclear weapons testing (1954–1962). The antlers were hunting trophies, and hence the hunting area, the year of shooting and the approximate age of each animal is given. Uranium and plutonium are known to deposit in skeletal tissue. Since antler histology is similar to bone, both elements were expected in antlers. Furthermore, roe deer shed their antlers annually, and hence antlers may provide a time-resolved environmental archive for fallout radionuclides. The radiochemical procedure is based on a Pu separation step by anion exchange (Dowex 1 × 8) and a subsequent U purification by extraction chromatography using UTEVA ® . The samples were measured by Accelerator Mass Spectrometry at the VERA facility (University of Vienna). In addition to the 236 U and 239 Pu concentrations, the 240 Pu/ 239 Pu isotopic ratios were determined with a mean value of 0.172 ± 0.023 which is in agreement with the ratio of global fallout (∼0.18). Rather high 236 U/ 238 U ratios of the order of 10 −6 were observed. These measured ratios, where the 236 U arises only from global fallout, have implications for the use of the 236 U/ 238 U ratio as a fingerprint for nuclear accidents or releases from nuclear facilities. Our investigations have shown the potential to use antlers as a temporally resolved archive for the uptake of actinides from the environment. - Highlights: • Roe deer antlers were studied as an environmental archive for the retrospective study of fallout isotopes 236 U and 239 Pu. • The rather high 236 U/ 238 U ratios of about 10 −6 suggest 236 U as a fingerprint tool for nuclear material releases. • The 240 Pu/ 239 Pu atom ratio underpins global fallout as the main anthropogenic contributor in antlers.

  19. First measurements of (236)U concentrations and (236)U/(239)Pu isotopic ratios in a Southern Hemisphere soil far from nuclear test or reactor sites. (United States)

    Srncik, M; Tims, S G; De Cesare, M; Fifield, L K


    The variation of the (236)U and (239)Pu concentrations as a function of depth has been studied in a soil profile at a site in the Southern Hemisphere well removed from nuclear weapon test sites. Total inventories of (236)U and (239)Pu as well as the (236)U/(239)Pu isotopic ratio were derived. For this investigation a soil core from an undisturbed forest area in the Herbert River catchment (17°30' - 19°S) which is located in north-eastern Queensland (Australia) was chosen. The chemical separation of U and Pu was carried out with a double column which has the advantage of the extraction of both elements from a relatively large soil sample (∼20 g) within a day. The samples were measured by Accelerator Mass Spectrometry using the 14UD pelletron accelerator at the Australian National University. The highest atom concentrations of both (236)U and (239)Pu were found at a depth of 2-3 cm. The (236)U/(239)Pu isotopic ratio in fallout at this site, as deduced from the ratio of the (236)U and (239)Pu inventories, is 0.085 ± 0.003 which is clearly lower than the Northern Hemisphere value of ∼0.2. The (236)U inventory of (8.4 ± 0.3) × 10(11) at/m(2) was more than an order of magnitude lower than values reported for the Northern Hemisphere. The (239)Pu activity concentrations are in excellent agreement with a previous study and the (239+240)Pu inventory was (13.85 ± 0.29) Bq/m(2). The weighted mean (240)Pu/(239)Pu isotopic ratio of 0.142 ± 0.005 is slightly lower than the value for global fallout, but our results are consistent with the average ratio of 0.173 ± 0.027 for the southern equatorial region (0-30°S). Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Chronology of Pu isotopes and 236U in an Arctic ice core. (United States)

    Wendel, C C; Oughton, D H; Lind, O C; Skipperud, L; Fifield, L K; Isaksson, E; Tims, S G; Salbu, B


    In the present work, state of the art isotopic fingerprinting techniques are applied to an Arctic ice core in order to quantify deposition of U and Pu, and to identify possible tropospheric transport of debris from former Soviet Union test sites Semipalatinsk (Central Asia) and Novaya Zemlya (Arctic Ocean). An ice core chronology of (236)U, (239)Pu, and (240)Pu concentrations, and atom ratios, measured by accelerator mass spectrometry in a 28.6m deep ice core from the Austfonna glacier at Nordaustlandet, Svalbard is presented. The ice core chronology corresponds to the period 1949 to 1999. The main sources of Pu and (236)U contamination in the Arctic were the atmospheric nuclear detonations in the period 1945 to 1980, as global fallout, and tropospheric fallout from the former Soviet Union test sites Novaya Zemlya and Semipalatinsk. Activity concentrations of (239+240)Pu ranged from 0.008 to 0.254 mBq cm(-2) and (236)U from 0.0039 to 0.053 μBq cm(-2). Concentrations varied in concordance with (137)Cs concentrations in the same ice core. In contrast to previous published results, the concentrations of Pu and (236)U were found to be higher at depths corresponding to the pre-moratorium period (1949 to 1959) than to the post-moratorium period (1961 and 1962). The (240)Pu/(239)Pu ratio ranged from 0.15 to 0.19, and (236)U/(239)Pu ranged from 0.18 to 1.4. The Pu atom ratios ranged within the limits of global fallout in the most intensive period of nuclear atmospheric testing (1952 to 1962). To the best knowledge of the authors the present work is the first publication on biogeochemical cycles with respect to (236)U concentrations and (236)U/(239)Pu atom ratios in the Arctic and in ice cores. Copyright © 2013 Elsevier B.V. All rights reserved.

  1. {sup 236}U and {sup 129}I as tracers of water masses in the Arctic Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Casacuberta, Nuria; Christl, Marcus; Vockenhuber, Christof; Synal, Hans-Arno [Laboratory of Ion Beam Physics, ETH-Zurich (Switzerland); Walther, Clemens [Institut fuer Radiooekologie und Strahlenschutz, Leibniz Universitaet Hannover (Germany); Loeff, Michiel van der [AWI-Geochemistry, Alfred Wegener Institut Fuer Polar und Meeresforshung, Bremerhaven (Germany); Masque, Pere [Institut de Ciencia i Tecnologia Ambientals, Universitat Autonoma de Barcelona, Bellaterra (Spain)


    Recently {sup 236}U attested to be a new transient oceanographic tracer: it is conservative in seawater and far from having reached steady state in the oceans. Its main sources in the North Atlantic are global fallout and European reprocessing plants. In this study, concentrations of {sup 236}U and {sup 129}I of eight deep profiles in the Arctic Ocean collected in 2011-2012 were determined with a compact ETH Zurich AMS system (TANDY). Results on {sup 236}U/{sup 238}U show a steep gradient, from the lowest ever-reported {sup 236}U/{sup 238}U atomic ratio in open ocean water (5±5) x 10{sup -12} up to (3700±80) x 10{sup -12}. Whereas the very low ratios are indicative for deep old waters, high ratios in shallow and surface waters show a clear signature of Atlantic Waters (AW) penetrating to the Arctic Ocean. The combination of {sup 236}U with {sup 129}I, both being released by the nuclear reprocessing plants of Sellafield and La Hague, with a distinct temporal input function, is used to estimate transit time of AW distributions in the Arctic Ocean.

  2. Chronology of Pu isotopes and {sup 236}U in an Arctic ice core

    Energy Technology Data Exchange (ETDEWEB)

    Wendel, C.C., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Oughton, D.H., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Lind, O.C., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Skipperud, L., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Fifield, L.K., E-mail: [Department of Nuclear Physics, Australian National University, Canberra ACT 0200 (Australia); Isaksson, E., E-mail: [Norwegian Polar Institute, Fram Centre, Hjalmar Johansens Gate 14, N9296 Tromsø (Norway); Tims, S.G., E-mail: [Department of Nuclear Physics, Australian National University, Canberra ACT 0200 (Australia); Salbu, B., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway)


    In the present work, state of the art isotopic fingerprinting techniques are applied to an Arctic ice core in order to quantify deposition of U and Pu, and to identify possible tropospheric transport of debris from former Soviet Union test sites Semipalatinsk (Central Asia) and Novaya Zemlya (Arctic Ocean). An ice core chronology of {sup 236}U, {sup 239}Pu, and {sup 240}Pu concentrations, and atom ratios, measured by accelerator mass spectrometry in a 28.6 m deep ice core from the Austfonna glacier at Nordaustlandet, Svalbard is presented. The ice core chronology corresponds to the period 1949 to 1999. The main sources of Pu and {sup 236}U contamination in the Arctic were the atmospheric nuclear detonations in the period 1945 to 1980, as global fallout, and tropospheric fallout from the former Soviet Union test sites Novaya Zemlya and Semipalatinsk. Activity concentrations of {sup 239+240}Pu ranged from 0.008 to 0.254 mBq cm{sup −2} and {sup 236}U from 0.0039 to 0.053 μBq cm{sup −2}. Concentrations varied in concordance with {sup 137}Cs concentrations in the same ice core. In contrast to previous published results, the concentrations of Pu and {sup 236}U were found to be higher at depths corresponding to the pre-moratorium period (1949 to 1959) than to the post-moratorium period (1961 and 1962). The {sup 240}Pu/{sup 239}Pu ratio ranged from 0.15 to 0.19, and {sup 236}U/{sup 239}Pu ranged from 0.18 to 1.4. The Pu atom ratios ranged within the limits of global fallout in the most intensive period of nuclear atmospheric testing (1952 to 1962). To the best knowledge of the authors the present work is the first publication on biogeochemical cycles with respect to {sup 236}U concentrations and {sup 236}U/{sup 239}Pu atom ratios in the Arctic and in ice cores. - Highlights: • Concentrations and atom ratios of Pu and {sup 236}U determined in an Arctic ice core. • Concentrations of U and Pu found to be higher pre- than post-moratorium. • U and Pu concentrations

  3. Recommendation on changing interfaces of W-058 and W-236A

    International Nuclear Information System (INIS)

    Light, J.M.


    This position paper recommends changes to improve the interface between the Cross-Site Transfer System (Project W-058) and the Multi-Function Waste Tank Facility (Project W-236A) to handle planned waste retrieval and storage operations. Appendix A includes cost estimates and schedule impacts for each project. The cost estimates, schedule impacts, and this position paper will be the basis for writing a change request to formally implement these changes on Project W-236A and Project W-058/W-028. Recommendations are made on pipeline rerouting, pump and configuration, and flushing configuration

  4. Use of radioanalytical methods for determination of uranium, neptunium, plutonium, americium and curium isotopes in radioactive wastes; Utilizacao de metodos radioanaliticos para a determinacao de isotopos de uranio, plutonio, americio e curio em rejeitos radioativos

    Energy Technology Data Exchange (ETDEWEB)

    Geraldo, Bianca


    Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)


    NARCIS (Netherlands)



    Bacteria from an anaerobic enrichment reductively removed chlorine from the ortho- position of 2,3,6-trichlorobenzoic acid (2,3,6-TBA) producing 2,5-dichlorobenzoate (2,5-DBA). The strictly aerobic bacterium Pseudomonas aeruginosa JB2 subsequently used 2,5-DBA as a growth substrate in the presence


    The report gives results of an evaluation of the shell-side heat transfer performance of hydrofluorocarbon (HFC)-236fa, which is considered to be a potential substitute for chlorofluorocarbon (CFC)-114 in Navy shipboard chillers, for both conventional finned [1024- and 1575-fpm (...


    The report gives results of an evaluation of the heat transfer performance of pure hydrofluorocarbon (HFC)-236ea for high performance enhanced tubes which had not been previously used in Navy shipboard chillers. Shell-side heat transfer coefficient data are presented for condensa...


    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...

  9. 49 CFR 236.335 - Dogs, stops and trunnions of mechanical locking. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Dogs, stops and trunnions of mechanical locking..., AND APPLIANCES Interlocking Rules and Instructions § 236.335 Dogs, stops and trunnions of mechanical locking. Driving pieces, dogs, stops and trunnions shall be rigidly secured to locking bars. Swing dogs...

  10. 49 CFR 236.207 - Electric lock on hand-operated switch; control. (United States)


    ..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.207 Electric lock on hand-operated switch; control. Electric lock on hand-operated switch shall be controlled so that it cannot be unlocked... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock on hand-operated switch; control...

  11. 48 CFR 652.236-71 - Foreign Service Buildings Act, as Amended. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Foreign Service Buildings....236-71 Foreign Service Buildings Act, as Amended. As prescribed in 636.570(a), insert the following provision: Foreign Service Buildings Act, as Amended (APR 2004) (a) This solicitation is subject to Section...

  12. 48 CFR 852.236-72 - Performance of work by the contractor. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance of work by the....236-72 Performance of work by the contractor. As prescribed in 836.501, insert the following clause: Performance of Work by the Contractor (JUL 2002) The clause entitled “Performance of Work by the Contractor...

  13. 48 CFR 52.236-1 - Performance of Work by the Contractor. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Performance of Work by the....236-1 Performance of Work by the Contractor. As prescribed in 36.501(b), insert the following clause... the work and customary or necessary specialty subcontracting (see 36.501(a)).] Performance of Work by...

  14. 49 CFR 236.206 - Battery or power supply with respect to relay; location. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Battery or power supply with respect to relay..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.206 Battery or power supply with respect to relay; location. The battery or power supply for each signal control relay circuit, where an open...

  15. 49 CFR 236.308 - Mechanical or electric locking or electric circuits; requisites. (United States)


    ..., AND APPLIANCES Interlocking Standards § 236.308 Mechanical or electric locking or electric circuits; requisites. Mechanical or electric locking or electric circuits shall be installed to prevent signals from... 49 Transportation 4 2010-10-01 2010-10-01 false Mechanical or electric locking or electric...

  16. 48 CFR 236.271 - Cost-plus-fixed-fee contracts. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-fixed-fee... CONTRACTS Special Aspects of Contracting for Construction 236.271 Cost-plus-fixed-fee contracts. Annual military construction appropriations acts restrict the use of cost-plus-fixed-fee contracts (see 216.306(c...

  17. 49 CFR 236.22 - Semaphore signal arm; clearance to other objects. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Semaphore signal arm; clearance to other objects... Rules and Instructions: All Systems Roadway Signals and Cab Signals § 236.22 Semaphore signal arm; clearance to other objects. At least one-half inch clearance shall be provided between semaphore signal arm...

  18. 48 CFR 53.236-2 - Architect-engineer services (SF's 252 and 330). (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Architect-engineer... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.236-2 Architect-engineer...-engineer and related services: (a) SF 252 (Rev. 10/83), Architect-Engineer Contract. SF 252 is prescribed...

  19. 17 CFR 230.236 - Exemption of shares offered in connection with certain transactions. (United States)


    ... Exemptions § 230.236 Exemption of shares offered in connection with certain transactions. Shares of stock or... securities in lieu of issuing fractional shares, script certificates or order forms, in connection with a stock dividend, stock split, reverse stock split, conversion, merger or similar transaction, shall be...

  20. 49 CFR 236.925 - Training specific to control office personnel. (United States)


    ... applicable to the train control system, including provision for movement and protection of roadway workers... 49 Transportation 4 2010-10-01 2010-10-01 false Training specific to control office personnel. 236... INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES...

  1. 49 CFR 236.1045 - Training specific to office control personnel. (United States)


    ... control system, including provision for movement and protection of roadway workers, unequipped trains... 49 Transportation 4 2010-10-01 2010-10-01 false Training specific to office control personnel. 236... INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES...

  2. 24 CFR 1000.236 - What are eligible administrative and planning expenses? (United States)


    ... administrative management; (2) Coordination monitoring and evaluation; (3) Preparation of the IHP including data... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false What are eligible administrative...) § 1000.236 What are eligible administrative and planning expenses? (a) Eligible administrative and...

  3. Radioisotope dilution analyses of geological samples using 236U and 229Th (United States)

    Rosholt, J.N.


    The use of 236U and 229Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: (1) these isotopes do not occur in terrestrial rocks, (2) they have negligible decay losses because of their long half lives, (3) they cause minimal recoil contamination to surface-barrier detectors, (4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and (5) they allow for simple and constant corrections for spectral inferences, 0.5% of the 238U activity is subtracted for the contribution of 235U in the 236U peak and 1% of the 229Th activity is subtracted from the 230Th activity. Disadvantages in using 236U and 229Th are: (1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, (2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and (3) separate calibrations of the 236U and 229Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. ?? 1984.

  4. Isotope shift of 234U, 236U, 238U in U I

    International Nuclear Information System (INIS)

    Gagne, J.M.; Nguyen Van, S.; Saint-Dizier, J.P.; Pianarosa, P.


    New and very accurate data of isotope shifts and relative isotope shifts in 234 U, 236 U, 238 U are presented. The invariance of the relative isotope shift, for the transitions we have investigated, supports the hypothesis that the so called specific mass effect is negligible in uranium

  5. Radioisotope dilution analyses of geological samples using 236U and 229Th

    International Nuclear Information System (INIS)

    Rosholt, J.N.


    The use of 236 U and 229 Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: 1) these isotopes do not occur in terrestrial rocks, 2) they have negligible decay losses because of their long half lives, 3) they cause minimal recoil contamination to surface-barrier detectors, 4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and 5) they allow for simple and constant corrections for spectral interferences, 0.5% of the 238 U activity is subtracted for the contribution of 235 U in the 236 U peak and 1% of the 229 Th activity is subtracted from the 230 Th activity. Disadvantages in using 236 U and 229 Th are: 1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, 2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and 3) separate calibrations of the 236 U and 229 Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. (orig.)

  6. A year-by-year record of 236-U/238-U in coral as a step towards establishing 236-U from nuclear weapons testing fall-out as oceanic tracer

    Energy Technology Data Exchange (ETDEWEB)

    Winkler, Stephan; Steier, Peter [University of Vienna, Faculty of Physics, Vienna (Austria); Carilli, Jessica [Australian Nuclear Science and Technology Organisation, Lucas Heights (Australia)


    Since uranium is known to behave conservatively in ocean waters, 236-U has great potential in application as oceanic tracer. 236-U (t1/2=23.4 Ma) was introduced into the oceans by atmospheric nuclear weapon testing with amount estimates ranging from 700 kg to 1500 kg. Thus a resulting initial average 236-U/238-U ratio of at least 5e-9 is expected for an oceanic mixed layer depth of 100 m. This ratio is already higher than the natural pre-nuclear background, which is expected to be at 10e-14 levels. Even the elevated ratios of global stratospheric fall-out are beyond the capabilities of ICPMS and TIMS methods. However, the exceptional sensitivity and ultra-low background for 236-U of the Vienna Environmental Research Accelerator's Accelerator Mass Spectrometry system allows us to measure down to 10-13 detection limits. We present a year-by-year record of 236-U/238-U for a Caribbean coral core covering years 1944 to 2006, thus allowing to us put constraints on the oceanic input of 236-U by atmospheric testing. Moreover modeling of the results also demonstrates the capabilities of 236-U as oceanic tracer.

  7. Neutron widths for 236U from high resolution transmission measurements at a 100M flightpath

    International Nuclear Information System (INIS)

    Carraro, G.; Brusegan, A.


    A series of neutron transmission measurements has been performed on 236 U aiming at a determination of the resonance parameters and their statistical properties. The analysis range covered neutron energies from 40eV to 4.1 keV. The experiments were carried out at about 100 m flightpath of the 80 MeV electron linear accelerator of CBNM using a 10 B slab-NaI detector and 2 236 U-oxyde samples on loan from the USAEC. A table displays the details of 6 experimental runs, 3 of which were arranged in such a way that the effect of the 235 U and 238 U impurities in the sample on the transmission was automatically compensated

  8. Study of 236U/238U ratio at CIRCE using a 16-strip silicon detector with a TOF system (United States)

    De Cesare, M.; De Cesare, N.; D'Onofrio, A.; Gialanella, L.; Terrasi, F.


    Accelerator Mass Spectrometry (AMS) is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and xPu isotopes. A new actinide AMS system, based on a 3-MV pelletron tandem accelerator, is operated at the Center for Isotopic Research on Cultural and Environmental Heritage (CIRCE) in Caserta, Italy. In this paper we report on the procedure adopted to increase the 236U abundance sensitivity as low as possible. The energy and position determinations of the 236U ions, using a 16-strip silicon detector have been obtained. A 236U/238U isotopic ratio background level of about 2.9×10-11 was obtained, summing over all the strips, using a Time of Flight-Energy (TOF-E) system with a 16-strip silicon detector (4.9×10-12 just with one strip).

  9. Study of 236U/238U ratio at CIRCE using a 16-strip silicon detector with a TOF system

    Directory of Open Access Journals (Sweden)

    De Cesare M.


    Full Text Available Accelerator Mass Spectrometry (AMS is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and xPu isotopes. A new actinide AMS system, based on a 3-MV pelletron tandem accelerator, is operated at the Center for Isotopic Research on Cultural and Environmental Heritage (CIRCE in Caserta, Italy. In this paper we report on the procedure adopted to increase the 236U abundance sensitivity as low as possible. The energy and position determinations of the 236U ions, using a 16-strip silicon detector have been obtained. A 236U/238U isotopic ratio background level of about 2.9×10−11 was obtained, summing over all the strips, using a Time of Flight-Energy (TOF-E system with a 16-strip silicon detector (4.9×10−12 just with one strip.

  10. Acinetobacter phage genome is similar to Sphinx 2.36, the circular DNA copurified with TSE infected particles. (United States)

    Longkumer, Toshisangba; Kamireddy, Swetha; Muthyala, Venkateswar Reddy; Akbarpasha, Shaikh; Pitchika, Gopi Krishna; Kodetham, Gopinath; Ayaluru, Murali; Siddavattam, Dayananda


    While analyzing plasmids of Acinetobacter sp. DS002 we have detected a circular DNA molecule pTS236, which upon further investigation is identified as the genome of a phage. The phage genome has shown sequence similarity to the recently discovered Sphinx 2.36 DNA sequence co-purified with the Transmissible Spongiform Encephalopathy (TSE) particles isolated from infected brain samples collected from diverse geographical regions. As in Sphinx 2.36, the phage genome also codes for three proteins. One of them codes for RepA and is shown to be involved in replication of pTS236 through rolling circle (RC) mode. The other two translationally coupled ORFs, orf106 and orf96, code for coat proteins of the phage. Although an orf96 homologue was not previously reported in Sphinx 2.36, a closer examination of DNA sequence of Sphinx 2.36 revealed its presence downstream of orf106 homologue. TEM images and infection assays revealed existence of phage AbDs1 in Acinetobacter sp. DS002.

  11. AMS measurements of global fallout U-236 and Pu in an ombrotrophic peat profile: evidence for their post depositional migration

    Energy Technology Data Exchange (ETDEWEB)

    Quinto, Francesca; Hrnecek, Erich; Krachler, Michael [European Commission Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Shotyk, William [Department of Renewable Resources, University of Alberta, 839 General Services Building, Edmonton, AB (Canada); Steier, Peter; Winkler, Stephan; Golser, Robin [VERA Laboratory, Faculty of Physics, University of Vienna, Waehringer Strasse 17, A-1090 Vienna (Austria)


    U-236, Pu-239, Pu-240, Pu-241 and Pu-242 were analysed in an ombrotrophic peat core representing the last 80 years of atmospheric deposition. The determination of these isotopes at femtogram and attogram levels was possible by using ultra-clean laboratory procedures and accelerator mass spectrometry. Since the Pu isotopic composition characteristic for global fallout, as well as anthropogenic U-236, were identified in peat samples pre-dating the period of atmospheric atom bomb testing, migration of Pu and U within the peat profile is clearly indicated. The vertical profile of the U-236/U-238 isotopic ratio represents the first observation of the U-236 bomb peak in a terrestrial environment. Comparing the abundances of the global fallout derived U-236 and Pu-239 along the peat core, the post depositional migration of plutonium exceeds that of uranium. These results highlight, for the first time, the mobility of Pu and U in a peat bog with implications for their migration in other acidic, organic rich environments.

  12. The 236U neutron capture cross-section measured at the n_TOF CERN facility

    Directory of Open Access Journals (Sweden)

    Mastromarco M.


    Full Text Available The 236U isotope plays an important role in nuclear systems, both for future and currently operating ones. The actual knowledge of the capture reaction of this isotope is satisfactory in the thermal region, but it is considered insufficient for Fast Reactor and ADS applications. For this reason the 236U(n, γ reaction cross-section has been measured for the first time in the whole energy region from thermal energy up to 1 MeV at the n_TOF facility with two different detection systems: an array of C6D6 detectors, employing the total energy deposited method, and a FX1 total absorption calorimeter (TAC, made of 40 BaF2 crystals. The two n_TOF data sets agree with each other within the statistical uncertainty in the Resolved Resonance Region up to 800 eV, while sizable differences (up to ≃ 20% are found relative to the current evaluated data libraries. Moreover two new resonances have been found in the n_TOF data. In the Unresolved Resonance Region up to 200 keV, the n_TOF results show a reasonable agreement with previous measurements and evaluated data.

  13. Towards saturation of the electron-capture delayed fission probability: The new isotopes 240Es and 236Bk

    Directory of Open Access Journals (Sweden)

    J. Konki


    Full Text Available The new neutron-deficient nuclei 240Es and 236Bk were synthesised at the gas-filled recoil separator RITU. They were identified by their radioactive decay chains starting from 240Es produced in the fusion–evaporation reaction 209Bi(34S,3n240Es. Half-lives of 6(2s and 22−6+13s were obtained for 240Es and 236Bk, respectively. Two groups of α particles with energies Eα=8.19(3MeV and 8.09(3MeV were unambiguously assigned to 240Es. Electron-capture delayed fission branches with probabilities of 0.16(6 and 0.04(2 were measured for 240Es and 236Bk, respectively. These new data show a continuation of the exponential increase of ECDF probabilities in more neutron-deficient isotopes.

  14. 236U and 239,240Pu ratios from soils around an Australian nuclear weapons test site

    International Nuclear Information System (INIS)

    Tims, S.G.; Froehlich, M.B.; Fifield, L.K.; Wallner, A.; De Cesare, M.


    The isotopes 236 U, 239 Pu and 240 Pu are present in surface soils as a result of global fallout from nuclear weapons tests carried out in the 1950's and 1960's. These isotopes potentially constitute artificial tracers of recent soil erosion and sediment movement. Only Accelerator Mass Spectrometry has the requisite sensitivity to measure all three isotopes at these environmental levels. Coupled with its relatively high throughput capabilities, this makes it feasible to conduct studies of erosion across the geographical extent of the Australian continent. In the Australian context, however, global fallout is not the only source of these isotopes. As part of its weapons development program the United Kingdom carried out a series of atmospheric and surface nuclear weapons tests at Maralinga, South Australia in 1956 and 1957. The tests have made a significant contribution to the Pu isotopic abundances present in the region around Maralinga and out to distances ∼1000 km, and impact on the assessment techniques used in the soil and sediment tracer studies. Quantification of the relative fallout contribution derived from detonations at Maralinga is complicated owing to significant contamination around the test site from numerous nuclear weapons safety trials that were also carried out around the site. We show that 236 U can provide new information on the component of the fallout that is derived from the local nuclear weapons tests, and highlight the potential of 236 U as a new fallout tracer. - Highlights: • Measured 236 U inventories around the Maralinga Test Nuclear weapons test site. • Comparison of 236 U and 239 Pu soil depth profiles at Maralinga. • Differences in 236 U and 239 Pu inventories indicate most Pu fallout is from the safety trials, rather than the weapons tests.

  15. Position paper: Live load design criteria for Project W-236A Multi-Function Waste Tank Facility

    International Nuclear Information System (INIS)

    Giller, R.A.


    The purpose of this paper is to discuss the live loads applied to the underground storage tanks of the Multi Function Waste Tank Facility, and to provide the basis for Project W-236A live load criteria. Project 236A provides encompasses building a Weather Enclosure over the two underground storage tanks at the 200-West area. According to the Material Handling Study, the Groves AT 1100 crane used within the Weather Enclosure will have a gross vehicle weight of 66.5 tons. Therefore, a 100-ton concentrated live load is being used for the planning of the construction of the Weather Enclosure

  16. Production and Evaluation of 236gNp and Reference Materials for Naturally Occurring Radioactive Materials (United States)

    Larijani, Cyrus Kouroush

    This thesis is based on the development of a radiochemical separation scheme capable of separating both 236gNp and 236Pu from a uranium target of natural isotopic composition ( 1 g uranium) and 200 MBq of fission decay products. The isobaric distribution of fission residues produced following the bombardment of a natural uranium target with a beam of 25 MeV protons has been evaluated. Decay analysis of thirteen isobarically distinct fission residues were carried out using high-resolution gamma-ray spectrometry at the UK National Physical Laboratory. Stoichiometric abundances were calculated via the determination of absolute activity concentrations associated with the longest-lived members of each isobaric chain. This technique was validated by computational modelling of likely sequential decay processes through an isobaric decay chain. The results were largely in agreement with previously published values for neutron bombardments on natural uranium at energies of 14 MeV. Higher relative yields of products with mass numbers A 110-130 were found, consistent with the increasing yield of these radionuclides as the bombarding energy is increased. Using literature values for the production cross-section for fusion of protons with uranium targets, it is estimated that an upper limit of approximately 250 Bq of activity from the 236Np ground state was produced in this experiment. Using a radiochemical separation scheme, Np and Pu fractions were separated from the produced fission decay products, with analyses of the target-based final reaction products made using Inductively Couple Plasma Mass Spectrometry (ICP-MS) and high-resolution alpha and gamma-ray spectrometry. In a separate research theme, reliable measurement of Naturally Occurring Radioactive Materials is of significance in order to comply with environmental regulations and for radiological protection purposes. The thesis describes the standardisation of three reference materials, namely Sand, Tuff and TiO2 which

  17. Design review plan for Multi-Function Waste Tank Facility (Project W-236A)

    International Nuclear Information System (INIS)

    Renfro, G.G.


    This plan describes how the Multi-Function Waste Tank Facility (MWTF) Project conducts reviews of design media; describes actions required by Project participants; and provides the methodology to ensure that the design is complete, meets the technical baseline of the Project, is operable and maintainable, and is constructable. Project W-236A is an integrated project wherein the relationship between the operating contractor and architect-engineer is somewhat different than that of a conventional project. Working together, Westinghouse Hanford Company (WHC) and ICF Karser Hanford (ICF KH) have developed a relationship whereby ICF KH performs extensive design reviews and design verification. WHC actively participates in over-the-shoulder reviews during design development, performs a final review of the completed design, and conducts a formal design review of the Safety Class I, ASME boiler and Pressure Vessel Code items in accordance with WHC-CM-6-1, Standard Engineering Practices

  18. Method for 236U Determination in Seawater Using Flow Injection Extraction Chromatography and Accelerator Mass Spectrometry

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Steier, Peter


    An automated analytical method implemented in a flow injection (FI) system was developed for rapid determination of 236U in 10 L seawater samples. 238U was used as a chemical yield tracer for the whole procedure, in which extraction chromatography (UTEVA) was exploited to purify uranium, after...... experimental parameters affecting the analytical effectiveness were investigated and optimized in order to achieve high chemical yields and simple and rapid analysis as well as low procedure background. Besides, the operational conditions for the target preparation prior to the AMS measurement were optimized......, on the basis of studying the coprecipitation behavior of uranium with iron hydroxide. The analytical results indicate that the developed method is simple and robust, providing satisfactory chemical yields (80−100%) and high analysis speed (4 h/sample), which could be an appealing alternative to conventional...

  19. Lifetime of the long-lived isomer of /sup 236/Np from. cap alpha. -,. beta. - and electron-capture decay measurements

    Energy Technology Data Exchange (ETDEWEB)

    Lindner, M.; Dupzyk, R.J.; Hoff, R.W.; Nagle, R.J. (California Univ., Livermore (USA). Lawrence Livermore National Lab.)


    The half-life of long-lived /sup 236/Np, due to ..cap alpha.., ..beta.. and electron-capture decay, was found to be 1.55 x 10/sup 5/ yr. Of all decays, 88% populate excited states in /sup 236/U and 12% populate levels in /sup 236/Pu. Lifetimes measured by growth of the ground states of /sup 236/U and /sup 236/Pu agree with values from corresponding ..gamma.. de-excitations in these daughter nuclei. Therefore, nearly all the electron-capture decays populate the 6/sup +/ level of the ground-state band in /sup 236/U. Similarly, essentially all the ..beta../sup -/ decay populates an analogous 6/sup +/ level in /sup 236/Pu, which de-excites through a previously unreported transition of 158.3 keV. If a very week ..gamma..-ray at 894 keV can be ascribed to a level in /sup 232/U populated by ..beta.. decay of /sup 232/Pa, its existence establishes a 0.2% ..cap alpha..-branching decay in /sup 236/Np.

  20. The regulatory effect of SC-236 (4-[5-(4-chlorophenyl)-3-(trifluoromethyl)-1-pyrazol-1-l] benzenesulfonamide) on stem cell factor induced migration of mast cells

    International Nuclear Information System (INIS)

    Kim, Su-Jin; Jeong, Hyun-Ja; Park, Rae-Kil; Lee, Kang-Min; Kim, Hyung-Min; Um, Jae-Young; Hong, Seung-Heon


    SC-236 (4-[5-(4-chlorophenyl)-3-(trifluoromethyl)-1-pyrazol-1-]benzenesulfonamide; C 16 H 11 ClF 3 N 3 O 2 S), is a highly selective cyclooxygenase (COX)-2 inhibitor. Recently, there have been reports that SC-236 protects against cartilage damage in addition to reducing inflammation and pain in osteoarthritis. However, the mechanism involved in the inflammatory allergic reaction has not been examined. Mast cells accumulation can be related to inflammatory conditions, including allergic rhinitis, asthma, and rheumatoid arthritis. The aim of the present study is to investigate the effects of SC-236 on stem cell factor (SCF)-induced migration, morphological alteration, and cytokine production of rat peritoneal mast cells (RPMCs). We observed that SCF significantly induced the migration and morphological alteration. The ability of SCF to enhance migration and morphological alteration was abolished by treatment with SC-236. In addition, production of tumor necrosis factor (TNF)-α, interleukin (IL)-1β, and vascular endothelial growth factor (VEGF) production induced by SCF was significantly inhibited by treatment with SC-236. Previous work has demonstrated that SCF-induced migration and cytokine production of mast cells require p38 MAPK activation. We also showed that SC-236 suppresses the SCF-induced p38 MAPK activation in RPMCs. These data suggest that SC-236 inhibits migration and cytokine production through suppression of p38 MAPK activation. These results provided new insight into the pharmacological actions of SC-236 and its potential therapeutic role in the treatment of inflammatory allergic diseases

  1. Determination of {sup 236}U in environmental samples by single extraction chromatography coupled to triple-quadrupole inductively coupled plasma-mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Guosheng [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan); Division of Nuclear Technology and Applications, Institute of High Energy Physics, Chinese Academy of Sciences (China); Beijing Engineering Research Center of Radiographic Techniques and Equipment, Beijing, 100049 (China); Tazoe, Hirofumi [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan); Yamada, Masatoshi, E-mail: [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan)


    In order to measure trace {sup 236}U and {sup 236}U/{sup 238}U in environmental samples with a high matrix effect, a novel and simple method was developed that makes the digestion and purification procedures compatible with advanced triple-quadrupole inductively coupled plasma-mass spectrometry. A total dissolution of sample with HF + HNO{sub 3} + HClO{sub 4} was followed by chromatographic separation with a single resin column containing normal type DGA resin (N,N,N′,N’-tetra-n-octyldiglycolamide) as the extractant system. The analytical accuracy and precision of {sup 236}U/{sup 238}U ratios, measured as {sup 236}U{sup 16}O{sup +}/{sup 238}U{sup 16}O{sup +}, were examined by using the reference materials IAEA-135, IAEA-385, IAEA-447, and JSAC 0471. The low method detection limit (3.50 × 10{sup −6} Bq kg{sup −1}) makes it possible to perform routine monitoring of environmental {sup 236}U due to global fallout combined with the Fukushima Daiichi Nuclear Power Plant accident fallout (>10{sup −5} Bq kg{sup −1}). Finally, the developed method was successfully applied to measure {sup 236}U/{sup 238}U ratios and {sup 236}U activities in soil samples contaminated by the accident. The low {sup 236}U/{sup 238}U atom ratios ((1.50–13.5) × 10{sup −8}) and {sup 236}U activities ((2.25–14.1) × 10{sup −2} mBq kg{sup −1}) indicate {sup 236}U contamination was mainly derived from global fallout in the examined samples. - Highlights: • A simple {sup 236}U/{sup 238}U analytical method has been developed. • The separation required just one DGA column chromatography. • {sup 236}U/{sup 238}U atom ratios in soil were measured by ICP-MS/MS. • {sup 236}U/{sup 238}U atom ratios of (1.50–13.5) × 10{sup −8} were observed in Japanese samples. • {sup 236}U activities of (2.25–14.1) × 10{sup −2} mBq kg{sup −1} were found in Japanese samples.

  2. 33 CFR 110.236 - Pacific Ocean off Barbers Point, Island of Oahu, Hawaii: Offshore pipeline terminal anchorages. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pacific Ocean off Barbers Point... Grounds § 110.236 Pacific Ocean off Barbers Point, Island of Oahu, Hawaii: Offshore pipeline terminal... regulations. (1) No vessels may anchor, moor, or navigate in anchorages A, B, C, or D except: (i) Vessels...

  3. Epidemiological and clinical features of primary liver cancer: an analysis of 236 patients

    Directory of Open Access Journals (Sweden)

    ZHAO Rongrong


    Full Text Available ObjectiveTo investigate the epidemiological and clinical features of patients with primary liver cancer (PLC. MethodsA retrospective analysis was performed for the clinical data of 236 patients with complete information who were admitted to The First Hospital of Lanzhou University and diagnosed with PLC for the first time form August 2012 to August 2014, and their epidemiological and clinical features were analyzed. The chi-square test was used for comparison of categorical data between groups. ResultsAmong the 236 PLC patients, there were 198 male patients (83.9% and 38 female patients (16.1%, and the patients aged 41-60 years has the highest incidence rate (58.5%, 138/236. Nineteen patients had a family history of liver cancer, 28 had a history of heavy drinking, 34 were complicated by type 2 diabetes, and 44 were complicated by hypertension. Among these patients, 232 (98.3% developed PLC on the basis of chronic liver disease, and 4 (1.7% had no chronic liver disease. There were 207 patients (87.7% with chronic HBV infection, and most of them had HBeAg-negative infection. Fourteen patients (5.9% had chronic HCV infection, 5 (2.1% had HBV/HCV co-infection, and 6 (2.5% had chronic alcoholic hepatitis. Among the 212 patients with HBV infection, 51(241% had HBeAg-positive chronic hepatitis B, and 95(448% had HBeAg-negative chronic hepatitis B; there was significant difference in HBV DNA level between the two groups (χ2=40687,Ρ=0001. Among all the PLC patients, 104 had an alpha-fetoprotein(AFP level of >400 IU/ml, 48 had an AFP level of 200-400 IU/ml, and 84 had an AFP level of <200 IU/ml; 154 (62.3% had a single lesion, and 72 (30.5% had multiple lesions; most (72.7% of patients with a single lesion had the single lesion in the right lobe, and the proportions of patients with multiple lesions in the right lobe and in both lobes accounted for 58.3% and 41.7%, respectively. Among the 80 PLC patients with

  4. The distribution of {sup 236}U/{sup 238}U in the North Atlantic and adjacent oceans; Die Verteilung von {sup 236}U/{sup 238}U im Nordatlantik und den angrenzenden Ozeanen

    Energy Technology Data Exchange (ETDEWEB)

    Christl, Marcus; Casacuberta, Nuria; Lachner, Johannes; Maxeiner, Sascha; Vockenhuber, Christof; Synal, Hans-Arno [Labor fuer Ionenstrahlphysik, ETH Zuerich (Switzerland); Herrmann, Juergen [Bundesamt fuer Seeschifffahrt und Hydroghraphie, Hamburg (Germany); Castrillejo, Maxi; Masque, Pere [Universitat Autonoma de Barcelona (Spain); Rutgers van der Loeff, Michiel [Alfred-Wegener-Institut, Bremerhaven (Germany)


    The technical developments of recent years, such as the introduction of helium as a stripping gas, make compact AMS systems probably among the most sensitive analyzers available for ultra-trace analyzes of actinides in the environment. Such systems are particularly suitable for the trace analysis of {sup 236}U since conventional mass spectrometry does not provide the necessary suppression of the substrate caused by molecules or neighboring masses. Over the past few years, unique data sets of {sup 236}U/{sup 238}U have been produced at the AMS System Tandy of the ETH Zurich in the Atlantic and Arctic Ocean as well as in the Mediterranean and the North Sea. This lecture will provide a brief overview of the latest technical developments in the field of heavy ion analysis at compact AMS plants at ETH Zurich. In the second part, the produced data sets are then assembled and the current understanding of this new ocean tracer discussed. [German] Die technischen Entwicklungen der letzten Jahre, wie zum Beispiel die Einfuehrung von Helium als stripper Gas, machen kompakte AMS Systeme wahrscheinlich zu den sensitivsten verfuegbaren Analysegeraeten fuer Ultra-Spurenstoffanalysen von Aktiniden in der Umwelt. Solche Systeme eignen sich im Besonderen zur Spurenanalyse von {sup 236}U, da konventionelle Massenspektrometrie hier nicht die erforderliche Unterdrueckung des durch Molekuele oder Nachbarmassen verursachten Untergrundes bietet. Am AMS System Tandy der ETH Zuerich wurden waehrend der letzten Jahre einzigartige Datensaetze von {sup 236}U/{sup 238}U im Atlantischen und Arktischen Ozean, sowie im Mittelmeer und der Nordsee produziert. In diesem Vortrag soll zunaechst ein kurzer Ueberblick ueber die neuesten technischen Entwicklungen im Bezug auf Schwerionen Analysen an kompakten AMS Anlagen der ETH Zuerich gegeben werden. Im zweiten Teil werden dann die produzierten Datensaetze zusammengefuegt und das gegenwaertige Verstaendnis dieses neuen Ozean-Tracers diskutiert.

  5. Use of 236Pu and 242Pu as a radiochemical tracer for estimation of Pu in bioassay samples by fission track analysis

    International Nuclear Information System (INIS)

    Sawant, Pramilla D.; Prabhu, Supreetha P.; Kalsi, P.C.


    236 Pu and 242 Pu are routinely used as radiochemical yield monitors in India for bioassay monitoring of occupational workers by alpha spectrometry. Fission Track Analysis (FTA) is also being standardized for trace level determination of Pu in bioassay samples. The present study, reports the utility of 236 Pu and 242 Pu as radiochemical tracers in estimation of Pu in bioassay samples by FTA technique. The advantages of using 236 Pu tracer in FTA over 242 Pu as well as the interference caused due to presence of 241 Pu in the bioassay samples of occupational workers handling power reactor grade Pu is discussed. (author)

  6. Tank 241-TX-118, core 236 analytical results for the final report

    International Nuclear Information System (INIS)

    ESCH, R.A.


    This document is the analytical laboratory report for tank 241-TX-118 push mode core segments collected between April 1, 1998 and April 13, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-TX-118 Push Mode Core sampling and Analysis Plan (TSAP) (Benar, 1997), the Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995), the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al, 1995) and the Historical Model Evaluation Data Requirements (Historical DQO) (Sipson, et al., 1995). The analytical results are included in the data summary table (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Benar, 1997). One sample exceeded the Total Alpha Activity (AT) analysis notification limit of 38.4microCi/g (based on a bulk density of 1.6), core 236 segment 1 lower half solids (S98T001524). Appropriate notifications were made. Plutonium 239/240 analysis was requested as a secondary analysis. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and are not considered in this report

  7. Effect translational invariance in low-lying electric dipole excitations in 236U and 238U

    International Nuclear Information System (INIS)

    Ertugral, F.


    In this paper the translational invariant QRPA approach suggested by Pyatov [1] for the spherical nuclei has been extended to describe the 1 - states in deformed nuclei. The role of spurious centre-of-motion state on the Pygmy dipole resonance (PDR) has been investigated in the deformed 236 U and 238 U nuclei. It has been shown that the effect of taking into account the translational invariance of the Hamiltonians in the QRPA with separation of zero energy spurious solutions are noticeable in both the low energy density of 1 - states and in the PDR. Present investigation demonstrates the advantage of the translational invariant QRPA over the non translational invariant one. Within the translational invariant model the effect of removing spurious states on the E1 strength distribution is stronger than in none invariant QRPA (∼20%) for the states up to the neutron binding energy. It is found that the spurious state is spread over many levels, the largest admixture being situated in the region of the energy spacing between nuclear shells o w h . The giant resonance states contain, as a rule, very small admixtures of the spurious state

  8. Functions and requirements for Project W-236B, Initial Pretreatment Module: Revision 1

    International Nuclear Information System (INIS)

    Swanson, L.M.


    Hanford Site tank waste supernatants will be pretreated to separate the low-level and high-level fractions. The low-level waste fraction, containing the bulk of the chemical constituents, must be processed into a vitrified waste product which will be disposed of onsite, in a safe, environmentally sound, and cost effective manner. The high-level waste fraction separated during supernatant pretreatment (primarily cesium) will be recombined with an additional high-level waste fraction generated from pretreatment of the tank waste sludges and solids. This combined high-level waste fraction will be immobilized as glass and disposed in a geological repository. The purpose of this document is to establish the functional requirements baseline for Project W-236B, Initial Pretreatment Module, by defining the level 5 and 6 functions and requirements for the project. A functional analysis approach has been used to break down the program functions and associated physical requirements that each function must meet. As the systems engineering process evolves, the design requirements document will replace this preliminary functions and requirements document. The design requirements document (DRD) will identify key decisions and associated uncertainties that impact the project. A revision of this document to a DRD is not expected to change the performance requirements or open issues. However, additional requirements and issues may be identified

  9. Feasibility studies to assess the use of 236Pu as a radiochemical yield monitor in bioassay samples

    International Nuclear Information System (INIS)

    Sawant, P.D.; Kalsi, P.C.


    Various plutonium compounds are handled in nuclear facilities of BARC. Hence, there is a possibility of occupational workers getting exposed to Pu. In vitro bioassay monitoring in which Pu is separated by chemical procedures from excreta samples and estimated by alpha-spectrometry, is the method of choice for the evaluation of internal dose to the occupational workers handling Pu. However, this method requires a suitable Pu tracer for reducing the uncertainties due to chemical yield in the separation, electro-deposition and counting efficiency. 242 Pu is commonly used as a tracer but due to its non-availability, efforts were made earlier to indigenously synthesis 236 Pu by proton irradiation of 237 Np in BARC-TIFR pelletron facility. The present study, reports the feasibility of using 236 Pu as a radiochemical yield monitor (tracer) in bioassay samples. (author)

  10. Fission Fragment Angular Distributions in the $^{234}$U(n,f) and $^{236}$U(n,f) reactions

    CERN Multimedia

    We propose to measure the fission fragment angular distribution (FFAD) of the $^{234}$U(n,f) and $^{236}$U (n,f) reactions with the PPAC detection setup used in previous n_TOF-14 experiment. This experiment would take advantage of the high resolution of the n_TOF facility to investigate the FFAD behaviour in the pronounced vibrational resonances that have been observed between 0.1 and 2 MeV for the thorium cycle isotopes. In addition, the angular distribution of these isotopes will be measured for the first time beyond 14 MeV. Furthermore, the experiment will also provide the fission cross section with reduced statistical uncertainty, extending the $^{236}$U(n,f) data up to 1 GeV

  11. (236)U and (239,)(240)Pu ratios from soils around an Australian nuclear weapons test site. (United States)

    Tims, S G; Froehlich, M B; Fifield, L K; Wallner, A; De Cesare, M


    The isotopes (236)U, (239)Pu and (240)Pu are present in surface soils as a result of global fallout from nuclear weapons tests carried out in the 1950's and 1960's. These isotopes potentially constitute artificial tracers of recent soil erosion and sediment movement. Only Accelerator Mass Spectrometry has the requisite sensitivity to measure all three isotopes at these environmental levels. Coupled with its relatively high throughput capabilities, this makes it feasible to conduct studies of erosion across the geographical extent of the Australian continent. In the Australian context, however, global fallout is not the only source of these isotopes. As part of its weapons development program the United Kingdom carried out a series of atmospheric and surface nuclear weapons tests at Maralinga, South Australia in 1956 and 1957. The tests have made a significant contribution to the Pu isotopic abundances present in the region around Maralinga and out to distances ∼1000 km, and impact on the assessment techniques used in the soil and sediment tracer studies. Quantification of the relative fallout contribution derived from detonations at Maralinga is complicated owing to significant contamination around the test site from numerous nuclear weapons safety trials that were also carried out around the site. We show that (236)U can provide new information on the component of the fallout that is derived from the local nuclear weapons tests, and highlight the potential of (236)U as a new fallout tracer. Crown Copyright © 2015. Published by Elsevier Ltd. All rights reserved.

  12. Project W-236A, work plan for preparation of a design requirements document

    International Nuclear Information System (INIS)

    Groth, B.D.


    This work plan outlines the tasks necessary, and defines the organizational responsibilities for preparing a Design Requirements Document (DRD) for project W-236A, Multi-Function Waste Tank Facility (MWTF). A DRD is a Systems Engineering document which bounds, at a high level, the requirements of a discrete system element of the Tank Waste Remediation System (TWRS) Program. This system element is usually assigned to a specific project, in this case the MWTF. The DRD is the document that connects the TWRS program requirements with the highest level projects requirements and provides the project's link to the overall TWRS mission. The MWTF DRD effort is somewhat unique in that the project is already in detailed design, whereas a DRO is normally prepared prior to preliminary design. The MWTF design effort was initiated with a Functional Design Criteria (FDC) and a Supplemental Design Requirements Document (SDRD) bounding the high level requirements. Another unique aspect of this effort is that some of the TWRS program requirements are still in development. Because of these unique aspects of the MWTF DRD development, the MWTF will be developed from existing TWRS Program requirements and project specific requirements contained in the FDC and SDRD. The following list describes the objectives of the MWTF DRD: determine the primary functions of the tanks through a functional decomposition of the TWRS Program high level functions; allocate the primary functions to a sub-system architecture for the tanks; define the fundamental design features in terms of performance requirements for the system and subsystems; identify system interfaces and design constraints; and document the results in a DRD


    International Nuclear Information System (INIS)

    Tremblay, Grant R.; O'Dea, Christopher P.; Baum, Stefi A.; Koekemoer, Anton M.; Sparks, William B.; De Bruyn, Ger; Schoenmakers, Arno P.


    We present Hubble Space Telescope Advanced Camera for Surveys and STIS FUV/NUV/optical imaging of the radio galaxy 3C 236, whose relic ∼4 Mpc radio jet lobes and inner 2 kpc compact steep spectrum (CSS) radio source are evidence of multiple epochs of active galactic nucleus (AGN) activity. Consistent with previous results, our data confirm the presence of four bright knots of FUV emission in an arc along the edge of the inner circumnuclear dust disk in the galaxy's nucleus, as well as FUV emission cospatial with the nucleus itself. We interpret these to be sites of recent or ongoing star formation. We present photometry of these knots, as well as an estimate for the internal extinction in the source using line ratios from archival ground-based spectroscopy. We estimate the ages of the knots by comparing our extinction-corrected photometry with stellar population synthesis models. We find the four knots cospatial with the dusty disk to be young, of order ∼10 7 yr old. The FUV emission in the nucleus, to which we do not expect scattered light from the AGN to contribute significantly, is likely due to an episode of star formation triggered ∼10 9 yr ago. We argue that the young ∼10 7 yr old knots stem from an episode of star formation that was roughly coeval with the event resulting in reignition of radio activity, creating the CSS source. The ∼10 9 yr old stars in the nucleus may be associated with the previous epoch of radio activity that generated the 4 Mpc relic source, before being cut off by exhaustion or interruption. The ages of the knots, considered in the context of both the disturbed morphology of the nuclear dust and the double-double morphology of the 'old' and 'young' radio sources, present evidence for an AGN/starburst connection that is possibly episodic in nature. We suggest that the AGN fuel supply was interrupted for ∼10 7 yr due to a minor merger event and has now been restored. The resultant nonsteady flow of gas in the disk is likely

  14. Determination of extremely low 236U/238U isotope ratios in environmental samples by sector-field inductively coupled plasma mass spectrometry using high-efficiency sample introduction

    International Nuclear Information System (INIS)

    Boulyga, Sergei F.; Heumann, Klaus G.


    A method by inductively coupled plasma mass spectrometry (Icp-Ms) was developed which allows the measurement of 236 U at concentration ranges down to 3 x 10 -14 g g -1 and extremely low 236 U/ 238 U isotope ratios in soil samples of 10 -7 . By using the high-efficiency solution introduction system APEX in connection with a sector-field ICP-MS a sensitivity of more than 5000 counts fg -1 uranium was achieved. The use of an aerosol desolvating unit reduced the formation rate of uranium hydride ions UH + /U + down to a level of 10 -6 . An abundance sensitivity of 3 x 10 -7 was observed for 236 U/ 238 U isotope ratio measurements at mass resolution 4000. The detection limit for 236 U and the lowest detectable 236 U/ 238 U isotope ratio were improved by more than two orders of magnitude compared with corresponding values by alpha spectrometry. Determination of uranium in soil samples collected in the vicinity of Chernobyl nuclear power plant (NPP) resulted in that the 236 U/ 238 U isotope ratio is a much more sensitive and accurate marker for environmental contamination by spent uranium in comparison to the 235 U/ 238 U isotope ratio. The ICP-MS technique allowed for the first time detection of irradiated uranium in soil samples even at distances more than 200 km to the north of Chernobyl NPP (Mogilev region). The concentration of 236 U in the upper 0-10 cm soil layers varied from 2 x 10 -9 g g -1 within radioactive spots close to the Chernobyl NPP to 3 x 10 -13 g g -1 on a sampling site located by >200 km from Chernobyl

  15. Determination of extremely low (236)U/(238)U isotope ratios in environmental samples by sector-field inductively coupled plasma mass spectrometry using high-efficiency sample introduction. (United States)

    Boulyga, Sergei F; Heumann, Klaus G


    A method by inductively coupled plasma mass spectrometry (ICP-MS) was developed which allows the measurement of (236)U at concentration ranges down to 3 x 10(-14)g g(-1) and extremely low (236)U/(238)U isotope ratios in soil samples of 10(-7). By using the high-efficiency solution introduction system APEX in connection with a sector-field ICP-MS a sensitivity of more than 5,000 counts fg(-1) uranium was achieved. The use of an aerosol desolvating unit reduced the formation rate of uranium hydride ions UH(+)/U(+) down to a level of 10(-6). An abundance sensitivity of 3 x 10(-7) was observed for (236)U/(238)U isotope ratio measurements at mass resolution 4000. The detection limit for (236)U and the lowest detectable (236)U/(238)U isotope ratio were improved by more than two orders of magnitude compared with corresponding values by alpha spectrometry. Determination of uranium in soil samples collected in the vicinity of Chernobyl nuclear power plant (NPP) resulted in that the (236)U/(238)U isotope ratio is a much more sensitive and accurate marker for environmental contamination by spent uranium in comparison to the (235)U/(238)U isotope ratio. The ICP-MS technique allowed for the first time detection of irradiated uranium in soil samples even at distances more than 200 km to the north of Chernobyl NPP (Mogilev region). The concentration of (236)U in the upper 0-10 cm soil layers varied from 2 x 10(-9)g g(-1) within radioactive spots close to the Chernobyl NPP to 3 x 10(-13)g g(-1) on a sampling site located by >200 km from Chernobyl.

  16. Sequential Injection Method for Rapid and Simultaneous Determination of 236U, 237Np, and Pu Isotopes in Seawater

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Steier, Peter


    An automated analytical method implemented in a novel dual-column tandem sequential injection (SI) system was developed for simultaneous determination of 236U, 237Np, 239Pu, and 240Pu in seawater samples. A combination of TEVA and UTEVA extraction chromatography was exploited to separate and purify...... target analytes, whereupon plutonium and neptunium were simultaneously isolated and purified on TEVA, while uranium was collected on UTEVA. The separation behavior of U, Np, and Pu on TEVA–UTEVA columns was investigated in detail in order to achieve high chemical yields and complete purification...

  17. Mass dependence of azimuthal asymmetry in the fission of {sup 232}Th and {sup 233,235,236,238}U by polarized photons

    Energy Technology Data Exchange (ETDEWEB)

    Denyak, V.V. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Pele Pequeno Principe Research Institute, Curitiba (Brazil); Khvastunov, V.M. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Paschuk, S.A. [Federal University of Technology - Parana, Curitiba (Brazil); Schelin, H.R. [Federal University of Technology - Parana, Curitiba (Brazil); Pele Pequeno Principe Research Institute, Curitiba (Brazil)


    Fission of the even-even nuclei {sup 232}Th, {sup 236,238}U and even-odd nuclei {sup 233,235}U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of {sup 236}U and {sup 238}U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of {sup 236}U. The measured cross section azimuthal asymmetry of the fission of {sup 232}Th does not show any fragment mass dependence. In the even-odd nuclei {sup 233}U and {sup 235}U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)

  18. Mass dependence of azimuthal asymmetry in the fission of 232Th and 233,235,236,238U by polarized photons

    International Nuclear Information System (INIS)

    Denyak, V.V.; Khvastunov, V.M.; Paschuk, S.A.; Schelin, H.R.


    Fission of the even-even nuclei 232 Th, 236,238 U and even-odd nuclei 233,235 U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of 236 U and 238 U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of 236 U. The measured cross section azimuthal asymmetry of the fission of 232 Th does not show any fragment mass dependence. In the even-odd nuclei 233 U and 235 U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)

  19. Angular correlation between the heavy fragments and the light charged particles in tripartition of 236U and 252Cf

    International Nuclear Information System (INIS)

    Sowinski, M.


    The energy distributions and relative intensities of protons, deuterons, tritons and alpha-particles emitted along the fission axis during thermal neutron fission of 236 U are measured simultaneously with the energies of the two fission fragments. The mass distributions of the fragments, the total kinetic energy (TKE), the dependence of the mean TKE on the fragment mass, as well as the mean kinetic energy dependence of polar particles on the fragment mass and energy are deduced from these data. Although some experimental results agree remarkably well with the hypothesis that polar particles are evaporated in-flight from fission fragments, the general conclusion is that these particles are emitted according to some other mechanism

  20. Bio-aggregates based building materials state-of-the-art report of the RILEM Technical Committee 236-BBM

    CERN Document Server

    Collet, Florence


    The work of the RILEM Technical Committee (TC -236 BBM) was dedicated to the study of construction materials made from plant particles. It considered the question whether building materials containing as main raw material recyclable and easily available plant particles are renewable. This book includes a state-of-the-art report and an appendix. The state-of-the-art report relates to the description of vegetal aggregates. Then, hygrothermal properties, fire resistance, durability and finally the impact of the variability of the method of production of bio-based concrete are assessed. The appendix is a TC report which presents the experience of a working group. The goal was to define testing methods for the measurement of water absorption, bulk density, particle size distribution, and thermal conductivity of bio aggregates. The work is based on a first round robin test of the TC-BBM where the protocols in use by the different laboratories (labs) are compared. .

  1. Determination of depth of burnup of fuel in deposition in territory Belarus, after Chernobyl accident, with the help of a tracer of U-236

    International Nuclear Information System (INIS)

    Mironov, V.P.; Matusevich, Zh.L.; Kudryashov, V.P.; Ananich, P.I.; Zhuravkov, V.V.


    Experiments and calculations for determination of depth of burnup of fuel are carried out on separate sites in Belarus. As a tracer of Chernobyl deposition the uranium-236 was used. The average depth of burnup of fuel in 30 km zone is 9,4 MW*d/kgU

  2. Applicability of the fish embryo acute toxicity (FET) test (OECD 236) in the regulatory context of Registration, Evaluation, Authorisation, and Restriction of Chemicals (REACH).

    NARCIS (Netherlands)

    Sobanska, Marta; Scholz, Stefan; Nyman, Anna-Maija; Cesnaitis, Romanas; Gutierrez Alonso, Simon; Klüver, Nils; Kühne, Ralph; Tyle, Henrik; de Knecht, Joop; Dang, Zhichao; Lundbergh, Ivar; Carlon, Claudio; De Coen, Wim

    In 2013 the Organisation for Economic Co-operation and Development (OECD) test guideline (236) for fish embryo acute toxicity (FET) was adopted. It determines the acute toxicity of chemicals to embryonic fish. Previous studies show a good correlation of FET with the standard acute fish toxicity

  3. Complete Genome Sequence of Spiroplasma floricola 23-6T (ATCC 29989), a Bacterium Isolated from a Tulip Tree (Liriodendron tulipifera L.). (United States)

    Tsai, Yi-Ming; Wu, Pei-Shan; Lo, Wen-Sui; Kuo, Chih-Horng


    Spiroplasma floricola 23-6 T (ATCC 29989) was isolated from the flower surface of a tulip tree ( Liriodendron tulipifera L.). Here, we report the complete genome sequence of this bacterium to facilitate the investigation of its biology and the comparative genomics among Spiroplasma species. Copyright © 2018 Tsai et al.

  4. Determination of irradiated reactor uranium in soil samples in Belarus using 236U as irradiated uranium tracer. (United States)

    Mironov, Vladislav P; Matusevich, Janna L; Kudrjashov, Vladimir P; Boulyga, Sergei F; Becker, J Sabine


    This work presents experimental results on the distribution of irradiated reactor uranium from fallout after the accident at Chernobyl Nuclear Power Plant (NPP) in comparison to natural uranium distribution in different soil types. Oxidation processes and vertical migration of irradiated uranium in soils typical of the 30 km relocation area around Chernobyl NPP were studied using 236U as the tracer for irradiated reactor uranium and inductively coupled plasma mass spectrometry as the analytical method for uranium isotope ratio measurements. Measurements of natural uranium yielded significant variations of its concentration in upper soil layers from 2 x 10(-7) g g(-1) to 3.4 x 10(-6) g g(-1). Concentrations of irradiated uranium in the upper 0-10 cm soil layers at the investigated sampling sites varied from 5 x 10(-12) g g(-1) to 2 x 10(-6) g g(-1) depending on the distance from Chernobyl NPP. In the majority of investigated soil profiles 78% to 97% of irradiated "Chernobyl" uranium is still contained in the upper 0-10 cm soil layers. The physical and chemical characteristics of the soil do not have any significant influence on processes of fuel particle destruction. Results obtained using carbonate leaching of 236U confirmed that more than 60% of irradiated "Chernobyl" uranium is still in a tetravalent form, ie. it is included in the fuel matrix (non-oxidized fuel UO2). The average value of the destruction rate of fuel particles determined for the Western radioactive trace (k = 0.030 +/- 0.005 yr(-1)) and for the Northern radioactive trace (k = 0.035 + 0.009 yr(-1)) coincide within experimental errors. Use of leaching of fission products in comparison to leaching of uranium for study of the destruction rate of fuel particles yielded poor coincidence due to the fact that use of fission products does not take into account differences in the chemical properties of fission products and fuel matrix (uranium).

  5. Determination of 236U and transuranium elements in depleted uranium ammunition by α-spectrometry and ICP-MS

    International Nuclear Information System (INIS)

    Desideri, D.; Meli, M.A.; Roselli, C.; Testa, C.; Boulyga, S.F.; Becker, J.S.


    It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products ( 236 U, 239 Pu, 240 Pu, 241 Am, and 237 Np) in the ammunition. In this work the analysis of actinides by α-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. 242 Pu and 243 Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri-n-octylamine (TNOA), with a decontamination factor higher than 10 6 ; after elution plutonium was determined by ICP-MS ( 239 Pu and 240 Pu) and α-spectrometry ( 239+240 Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10 -12 g g -1 and 2 x 10 -11 g g -1 . The 240 Pu/ 239 Pu isotope ratio in one penetrator sample (0.12±0.04) was significantly lower than the 240 Pu/ 239 Pu ratios found in two soil samples from Kosovo (0.35±0.10 and 0.27±0.07). 241 Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 10 7 . The concentration of 241 Am in the penetrator samples was 2.7 x 10 -14 g g -1 and -15 g g -1 . In addition 237 Np was detected at ultratrace levels. In general, ICP-MS and α-spectrometry results were in good agreement.The presence of anthropogenic radionuclides ( 236 U, 239 Pu, 240 Pu, 241 Am, and 237 Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of radionuclides are very low, their radiotoxicological effect is negligible. (orig.)

  6. Determination of {sup 236}U and transuranium elements in depleted uranium ammunition by {alpha}-spectrometry and ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Desideri, D.; Meli, M.A.; Roselli, C.; Testa, C. [General Chemistry Institute, Urbino University, Urbino (Italy); Boulyga, S.F.; Becker, J.S. [Central Department of Analytical Chemistry, Research Centre Juelich, Juelich (Germany)


    It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products ({sup 236}U, {sup 239}Pu, {sup 240}Pu, {sup 241}Am, and {sup 237}Np) in the ammunition. In this work the analysis of actinides by {alpha}-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. {sup 242}Pu and {sup 243}Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri-n-octylamine (TNOA), with a decontamination factor higher than 10{sup 6}; after elution plutonium was determined by ICP-MS ({sup 239}Pu and {sup 240}Pu) and {alpha}-spectrometry ({sup 239+240}Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10{sup -12} g g{sup -1} and 2 x 10{sup -11} g g{sup -1}. The {sup 240}Pu/{sup 239}Pu isotope ratio in one penetrator sample (0.12{+-}0.04) was significantly lower than the {sup 240}Pu/{sup 239}Pu ratios found in two soil samples from Kosovo (0.35{+-}0.10 and 0.27{+-}0.07). {sup 241}Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 10{sup 7}. The concentration of {sup 241}Am in the penetrator samples was 2.7 x 10{sup -14} g g{sup -1} and <9.4 x 10{sup -15} g g{sup -1}. In addition {sup 237}Np was detected at ultratrace levels. In general, ICP-MS and {alpha}-spectrometry results were in good agreement.The presence of anthropogenic radionuclides ({sup 236}U, {sup 239}Pu,{sup 240}Pu, {sup 241}Am, and {sup 237}Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of

  7. Determination of (236)U and transuranium elements in depleted uranium ammunition by alpha-spectrometry and ICP-MS. (United States)

    Desideri, D; Meli, M A; Roselli, C; Testa, C; Boulyga, S F; Becker, J S


    It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products ((236)U, (239)Pu, (240)Pu, (241)Am, and (237)Np) in the ammunition. In this work the analysis of actinides by alpha-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. (242)Pu and (243)Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri- n-octylamine (TNOA), with a decontamination factor higher than 10(6); after elution plutonium was determined by ICP-MS ((239)Pu and (240)Pu) and alpha-spectrometry ((239+240)Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10(-12) g g(-1) and 2 x 10(-11) g g(-1). The (240)Pu/(239)Pu isotope ratio in one penetrator sample (0.12+/-0.04) was significantly lower than the (240)Pu/(239)Pu ratios found in two soil samples from Kosovo (0.35+/-0.10 and 0.27+/-0.07). (241)Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 10(7). The concentration of (241)Am in the penetrator samples was 2.7 x 10(-14) g g(-1) and <9.4 x 10(-15) g g(-1). In addition (237)Np was detected at ultratrace levels. In general, ICP-MS and alpha-spectrometry results were in good agreement. The presence of anthropogenic radionuclides ((236)U, (239)Pu,(240)Pu, (241)Am, and (237)Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of radionuclides are very low, their radiotoxicological effect is negligible.

  8. Numerical methods to analyze alpha spectra and application to the study of neptunium 237 and neptunium 236

    International Nuclear Information System (INIS)

    Garcia-Torano, E.


    A set of numerical methods to analize alpha spectra measured with semiconductor detectors are presented. The methods can be divided in two groups, the first being based in the X 2 minimization ands the second in the use of the Fourier Transform. The methods based in the minimization of X 2 can, in turn, be divided according to the model used to fit the spectra. Some of them use a monoenergetic line for the intercomparison with the other peaks in the same spectrum. The others take into account the analytical function developed to represent an alpha line. Both allow the determination of positions and areas of the components, as well as the uncertainties of the results. The Fast Fourier Transform is applied to the second group of methods, which include the smoothing of experimental data, and the deconvolution of spectra. Examples are given of the application of these methods to real spectra. The alpha spectra of 237 Np and 236 Np are studied by using some of the methods described in this work. (Author)

  9. Charge distribution of the 236U* fission fragments with accounting for angular momentum of the compound nuclei

    International Nuclear Information System (INIS)

    Volkov, N.G.; Emel'yanov, V.M.; Krajnov, V.P.


    In a statistical fission model calculated are charge distributions of fission fragments (CDFF) of a 236 U* nucleus and their dispersions as the functions of excitation energy and angular momentum (AM) of a compound nucleus as well as the effect of one-particle potential parameter on CDFF. The potential of two-center oscillator was choosen as the one-particle potential. The function of fissioning nucleus level density, which is necessary for calculations in the statistical approach, has been determined from one-particle spectrum. The scheme of calculations is realized with a computer. Presented are the results of calculating the dependence of a neutron gap size on nuclear temperature for various projections of total AM; CDFF for different values of E* excitation energy of AM projection and others. Calculated CDFF and experimental data were compared. Notwithstanding the availability of many parameters and a large volume of numerical calculations the model under consideration permits to describe many common regularities of heavy nucleus CDFF (experimental yields of charges, dispersion dependence on excitation energies and masses of nuclear fragments)

  10. Determination of uranium isotopic composition and 236U content of soil samples and hot particles using inductively coupled plasma mass spectrometry. (United States)

    Boulyga, S F; Becker, J S


    As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10(-4) and 10(-3) counts per atom were achieved for 238U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH+/U+ was 1.2 x 10(-4) and 1.4 x 10(-4), respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 microg L(-1) NBS U-020 standard solution was 0.11% (238U/235U) and 1.4% (236U/238U) using a MicroMist nebulizer and 0.25% (235U/238U) and 1.9% (236U/P38U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236U/238U ratio ranged from 10(-5) to 10(-3). Results obtained with ICP-MS, alpha- and gamma-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples.

  11. Determination of uranium isotopic composition and 236U content of soil samples and hot particles using inductively coupled plasma mass spectrometry

    International Nuclear Information System (INIS)

    Boulyga, S.F.; Becker, J.S.


    As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236 U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10 -4 and 10 -3 counts per atom were achieved for 238 U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH + /U + was 1.2 x 10 -4 and 1.4 x 10 -4 , respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 μg L -1 NBS U-020 standard solution was 0.11% ( 238 U/ 235 U) and 1.4% ( 236 U/ 238 U) using a MicroMist nebulizer and 0.25% ( 235 U/ 238 U) and 1.9% ( 236 U/ 238 U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236 U/ 238 U ratio ranged from 10 -5 to 10 -3 . Results obtained with ICP-MS, α- and γ-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples. (orig.)

  12. Energy dependence of average half-life of delayed neutron precursors in fast neutron induced fission of 235U and 236U

    International Nuclear Information System (INIS)

    Isaev, S.G.; Piksaikin, L.E.; Kazakov, L.E.; Tarasko, M.Z.


    The measurements of relative abundances and periods of delayed neutrons from fast neutron induced fission of 235 U and 236 U have been made at the electrostatic accelerator CG-2.5 at IPPE. The preliminary results were obtained and discussed in the frame of the systematics of the average half-life of delayed neutron precursors. It was shown that the average half-life value in both reactions depends on the energy of primary neutrons [ru

  13. Association of Haematological and Radiological Findings with Clinical Outcome in Hospitalized Children 2-36 Months Old with Severe Lower Respiratory Tract Infection

    International Nuclear Information System (INIS)

    Waris, R.; Bhatti, N.; Nisar, Y. B.


    Background: Despite reduction in ld mortality during last decade, lower respiratory tract infection (LRTI) remained number one killer of under-five. The current study aimed to assess the association of haematological and radiological findings with clinical outcome in hospitalized children 2-36 months old with severe LRTI. Methods: In the current cross sectional study, 581 children 2-36 months old with severe LRTI were enrolled and followed at the Children Hospital, Islamabad, between 2011 and 2014. At the time of enrolment, complete history of present illness, anthropometric measurements, blood sample and chest radiograph were obtained. The primary outcome was either early clinical response (within 72 hours) or delayed clinical response (>72 hours). Multivariable logistic regression was performed to examine the association between haematological and radiological findings with clinical outcome, adjusted for potential confounding factors. Results: Of 581 enrolled children, 292 (50.3 percent) children had early, and 289 (49.7 percent) had delayed clinical response. The multivariable logistic regression showed that leucocytosis (OR 1.79, 95 percent CI 1.15-2.79), neutrophilia (OR 1.91, 95 percent CI 1.29-2.84), radiological interstitial pneumonia (OR 2.49, 95 percent CI 1.70-3.64), and lobar consolidation (OR 6.00, 95 percent CI 2.41-14.96) were significantly associated with delayed clinical response, after adjusted for potential confounding factors. Conclusions: Delayed clinical response was significantly associated with abnormal haematological and radiological findings at the time of admission in children 2-36 months old with severe LRTI. Haematological and radiological findings at the time of presentation are useful for predicting delayed clinical response in children 2-36 months old with severe LRTI. (author)

  14. Time-resolved record of 236U and 239,240Pu isotopes from a coral growing during the nuclear testing program at Enewetak Atoll (Marshall Islands). (United States)

    Froehlich, M B; Chan, W Y; Tims, S G; Fallon, S J; Fifield, L K


    A comprehensive series of nuclear tests were carried out by the United States at Enewetak Atoll in the Marshall Islands, especially between 1952 and 1958. A Porites Lutea coral that was growing in the Enewetak lagoon within a few km of all of the high-yield tests contains a continuous record of isotopes, which are of interest (e.g. 14 C, 236 U, 239,240 Pu) through the testing period. Prior to the present work, 14 C measurements at ∼2-month resolution had shown pronounced peaks in the Δ 14 C data that coincided with the times at which tests were conducted. Here we report measurements of 236 U and 239,240 Pu on the same coral using accelerator mass spectrometry, and again find prominent peaks in the concentrations of these isotopes that closely follow those in 14 C. Consistent with the 14 C data, the magnitudes of these peaks do not, however, correlate well with the explosive yields of the corresponding tests, indicating that smaller tests probably contributed disproportionately to the debris that fell in the lagoon. Additional information about the different tests can also be obtained from the 236 U/ 239 Pu and 240 Pu/ 239 Pu ratios, which are found to vary dramatically over the testing period. In particular, the first thermonuclear test, Ivy-Mike, has characteristic 236 U/ 239 Pu and 240 Pu/ 239 Pu signatures which are diagnostic of the first arrival of nuclear test material in various archives. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. A 233U/236U/242Pu/244Pu spike for isotopic and isotope dilution analysis by mass spectrometry with internal calibration

    International Nuclear Information System (INIS)

    Stepanov, A.; Belyaev, B.; Buljanitsa, L.


    The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233 U, 236 U, 242 Pu and 244 Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233 U/ 236 U ratio and the 236 U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235 U/ 238 U ratio of NBS500 used as internal standard. The coefficients of variation of the 244 Pu/ 242 Pu ratio and the 242 Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240 Pu/ 239 Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs

  16. Transverse momentum and pseudorapidity distributions of charged hadrons in pp collisions at $\\sqrt{s}$ = 0.9 and 2.36 TeV

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Ero, Janos; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hoch, Michael; Hormann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schofbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; De Wolf, Eddi A.; Hashemi, Majid; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Mozer, Matthias Ulrich; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Villella, Ilaria; Chabert, Eric Christian; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Marage, Pierre Edouard; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; Cortina Gil, Eduardo; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Gregoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Militaru, Otilia; Ovyn, Severine; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Herquet, Philippe; Alves, Gilvan; Pol, Maria Elena; Henrique Gomes e Souza, Moacyr; Carvalho, Wagner; Melo Da Costa, Eliza; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Oguri, Vitor; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Dias, Marco Andre Ferreira; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Damgov, Jordan; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Stoykova, Stefka; Sultanov, Georgi; Trayanov, Rumen; Vankov, Ivan; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leandar; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Jian; Wang, Xianyou; Wang, Zheng; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Hu, Zhen; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Andres Carrillo Montoya, Camilo; Gomez Moreno, Bernardo; Andres Ocampo Rios, Alberto; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Papadakis, Antonakis; Ptochos, Fotios; Razis, Panos A.; Tsiakkouri, Demetra; Zinonos, Zinonas; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Muntel, Mait; Raidal, Martti; Rebane, Liis; Eerola, Paula; Czellar, Sandor; Harkonen, Jaakko; Heikkinen, Mika Aatos; Karimaki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampen, Tapio; Lassila-Perini, Kati; Lehti, Sami; Linden, Tomas; Luukka, Panja-Riina; Maenpaa, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Descamps, Julien; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, Francois-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, Andre; Rousseau, Delphine; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Bianchini, Lorenzo; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Elgammal, Sherif; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Mine, Philippe; Paganini, Pascal; Sirois, Yves; Thiebaux, Christophe; Zabi, Alexandre; Agram, Jean-Laurent; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Conte, Eric; Drouhin, Frederic; Ferro, Cristina; Fontaine, Jean-Charles; Gele, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Ripp-Baudot, Isabelle; Speck, Joaquim; Van Hove, Pierre; Baty, Clement; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fassi, Farida; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Pandoulas, Demetrios; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Actis, Oxana; Bender, Walter; Biallass, Philipp; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Kirsch, Matthias; Klimkovich, Tatsiana; Kreuzer, Peter; Lanske, Dankfried; Merschmeyer, Markus; Meyer, Arnd; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sowa, Michael; Steggemann, Jan; Teyssier, Daniel; Zeidler, Clemens; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flugge, Gunter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrens, Ulf; Borras, Kerstin; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Meyer, Andreas Bernhard; Mnich, Joachim; Olzem, Jan; Parenti, Andrea; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Volyanskyy, Dmytro; Wissing, Christoph; Autermann, Christian; Draeger, Jula; Eckstein, Doris; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Sander, Christian; Schleper, Peter; Schroder, Matthias; Schum, Torben; Stadie, Hartmut; Steinbruck, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Blum, Peter; Buege, Volker; Cakir, Altan; Chwalek, Thorsten; Daeuwel, Daniel; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Frey, Martin; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heinrich, Michael; Hoffmann, Karl-heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Muller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Renz, Manuel; Sabellek, Andreas; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jurgen; Stober, Fred-Markus; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Karafasoulis, Konstantinos; Kyriakis, Aristoteles; Loukas, Demitrios; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Zachariadou, Aikaterini; Agapitos, Antonis; Gouskos, Loukas; Katsas, Panagiotis; Panagiotou, Apostolos; Saganis, Konstantinos; Xaxiris, Evangelos; Evangelou, Ioannis; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Sharma, Richa; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Chauhan, Sushil; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Sandhya; Jain, Shilpi; Kumar, Ashok; Ranjan, Kirti; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Nayak, Aruna; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Fahim, Ali; Jafari, Abideh; Mohammadi Najafabadi, Mojtaba; Moshaii, Ahmad; Paktinat Mehdiabadi, Saeid; Zeinali, Maryam; Felcini, Marta; Abbrescia, Marcello; Barbone, Lucia; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pierro, Giuseppe Antonio; Polese, Giovanni; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Chiorboli, Massimiliano; Costa, Salvatore; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Broccolo, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Landi, Gregorio; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Menasce, Dario; Miccio, Vincenzo; Moroni, Luigi; Negri, Pietro; Paganoni, Marco; Pedrini, Daniele; Pullia, Antonino; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Salerno, Roberto; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Taroni, Silvia; Cimmino, Anna; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Biasotto, Massimo; Carlin, Roberto; Checchia, Paolo; De Mattia, Marco; Dorigo, Tommaso; Fanzago, Federica; Gasparini, Fabrizio; Giubilato, Piero; Gonella, Franco; Gresele, Ambra; Gulmini, Michele; Lacaprara, Stefano; Lazzizzera, Ignazio; Maron, Gaetano; Mattiazzo, Serena; Meneguzzo, Anna Teresa; Passaseo, Marina; Pegoraro, Matteo; Pozzobon, Nicola; Ronchese, Paolo; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Ventura, Sandro; Zotto, Pierluigi; Baesso, Paolo; Berzano, Umberto; Pagano, Davide; Ratti, Sergio P.; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fano, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Bocci, Andrea; Castaldi, Rino; Dell'Orso, Roberto; Dutta, Suchandra; Fiori, Francesco; Foa, Lorenzo; Gennai, Simone; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Sarkar, Subir; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Rovelli, Chiara; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Borgia, Maria Assunta; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Dellacasa, Giulio; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Penzo, Aldo; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kong, Dae Jung; Park, Hyangkyu; Son, Dong-Chul; Kim, Jaeho; Song, Sanghyeon; Jung, Seung Yong; Hong, Byung-Sik; Kim, Hyunchul; Kim, Ji Hyun; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Sim, Kwang Souk; Kim, Jangho; Choi, Minkyoo; Park, In Kyu; Choi, Suyong; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Jo, Youngkwon; Kwon, Jeongteak; Lee, Jongseok; Lee, Sungeun; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; Sanchez Hernandez, Alberto; Carrillo Moreno, Salvador; Ibarguen, Humberto Antonio Salazar; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Allfrey, Philip; Krofcheck, David; Aumeyr, Thomas; Butler, Philip H.; Signal, Tony; Williams, Jennifer C.; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Gorski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; Bargassa, Pedrame; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Musella, Pasquale; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Varela, Joao; Wohri, Hermine Katharina; Altsybeev, Igor; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger, Michael, Jr.; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Vishnevskiy, Alexander; Volodko, Anton; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Obrant, Gennady; Shcheglov, Yury; Shchetkovskiy, Alexander; Smirnov, Igor; Sulimov, Valentin; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Ilina, Natalia; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Kuleshov, Sergey; Oulianov, Alexei; Safronov, Grigory; Semenov, Sergey; Shreyber, Irina; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Vardanyan, Irina; Dremin, Igor; Kirakosyan, Martin; Konovalova, Nina; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Datsko, Kirill; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Sytine, Alexandre; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Maletic, Dimitrije; Puzovic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernandez Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Pelayo, Jesus Puerta; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; de Troconiz, Jorge F.; Cuevas, Javier; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; Iglesias, Lara Lloret; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Diaz Merino, Irma; Diez Gonzalez, Carlos; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Pardo, Patricia Lobelle; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Rodrigo, Teresa; Jimeno, Alberto Ruiz; Scodellaro, Luca; Sanudo, Mar Sobron; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Beaudette, Florian; Beccati, Barbara; Bell, Alan James; Bellan, Riccardo; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bolognesi, Sara; Bona, Marcella; Breuker, Horst; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cattai, Ariella; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Cure, Benoit; Dahms, Torsten; De Roeck, Albert; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gowdy, Stephen; Guiducci, Luigi; Gutleber, Johannes; Hartl, Christian; Harvey, John; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Huhtinen, Mika; Innocente, Vincenzo; Janot, Patrick; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Meridiani, Paolo; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mulders, Martijn; Noy, Matthew; Orimoto, Toyoko; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimia, Martti; Racz, Attila; Rolandi, Gigi; Rovere, Marco; Ryjov, Vladimir; Sakulin, Hannes; Schafer, Christoph; Schlatter, Wolf-Dieter; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stockli, Fabian; Traczyk, Piotr; Tropea, Paola; Tsirou, Andromachi; Istvan Veres, Gabor; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Konig, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Caminada, Lea; Casella, Maria Chiara; Chen, Zhiling; Cittolin, Sergio; Dambach, Sarah; Dissertori, Gunther; Dittmar, Michael; Eggel, Christina; Eugster, Jurg; Freudenreich, Klaus; Grab, Christoph; Herve, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Milenovic, Predrag; Moortgat, Filip; Nardulli, Alessandro; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann-Karin; Sawley, Marie-Christine; Schinzel, Dietrich; Sordini, Viola; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Trub, Peter; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Rikova, Mirena Ivova; Regenfus, Christian; Robmann, Peter; Rommerskirchen, Tanja; Schmidt, Alexander; Snoek, Hella; Tsirigkas, Dimitrios; Wilke, Lotte; Chang, Yuan-Hann; Chen, E.Augustine; Chen, Wan-Ting; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Wu, Jing-Han; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Lei, Yeong-Jyi; Lin, Sheng-wen; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-ming; Ueno, Koji; Wang, Chin-chi; Wang, Minzu; Adiguzel, Aytul; Ayhan, Aydin; Bakirci, Mustafa Numan; Cerci, Salim; Demir, Zahide; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gurpinar, Emine; Karaman, Turker; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sahin, Ozge; Sengul, Ozden; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gulmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Cussans, David; Frazier, Robert; Goldstein, Joel; Hansen, Maria; Heath, Greg P.; Heath, Helen F.; Hill, Christopher; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Mackay, Catherine Kirsty; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Davies, Gavin; Della Negra, Michel; Foudas, Costas; Fulcher, Jonathan; Futyan, David; Hall, Geoffrey; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; MacEvoy, Barry C.; Magnan, Anne-Marie; Marrouche, Jad; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Stoye, Markus; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Reid, Ivan; Teodorescu, Liliana; Bose, Tulika; Clough, Andrew; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sulak, Lawrence; Andrea, Jeremy; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Speer, Thomas; Tsang, Ka Vang; Breedon, Richard; Calderon de la Barca Sanchez, Manuel; Cebra, Daniel; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Erhan, Samim; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Wallny, Rainer; Babb, John; Chandra, Avdhesh; Clare, Robert; Ellison, John Anthony; Gary, J.William; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, Andre; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Norman, Matthew; Padhi, Sanjay; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Vartak, Adish; Wurthwein, Frank; Yagil, Avraham; Barge, Derek; Blume, Michael; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Garberson, Jeffrey; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lamb, James; Lowette, Steven; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Witherell, Michael; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Gataullin, Marat; Litvine, Vladimir; Ma, Yousi; Newman, Harvey B.; Rogan, Christopher; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Jang, Dong Wook; Jun, Soon Yung; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Blekman, Freya; Cassel, David; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Patterson, Juliet Ritchie; Puigh, Darren; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Vaughan, Jennifer; Weng, Yao; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Albrow, Michael; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Binkley, Morris; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gottschalk, Erik; Green, Dan; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lueking, Lee; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Smith, Richard P.; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Piero Di Giovanni, Gian; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Pakhotin, Yuriy; Piedra Gomez, Jonatan; Prescott, Craig; Rapsevicius, Valdas; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Luis Rodriguez, Jorge; Adams, Todd; Askew, Andrew; Chen, Jie; Dharmaratna, Welathantri G.D.; Diamond, Brendan; Gleyzer, Sergei V.; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Baarmand, Marc M.; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Mermerkaya, Hamit; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatian, Samvel; Mironov, Camelia; Shabalina, Elizaveta; Smoron, Agata; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Chung, Kwangzoo; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bandurin, Dmitry; Barfuss, Anne-fleur; Bolton, Tim; Chakaberia, Irakli; Kaadze, Ketino; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; D'Enterria, David; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristian Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Wyslouch, Bolek; Xie, Si; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Petyt, David; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A.; Sonnek, Peter; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Strang, Michael; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Reucroft, Steve; Swain, John; Wood, Darien; Anastassov, Anton; Kubik, Andrew; Ofierzynski, Radoslaw Adrian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Ruchti, Randy; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Killewald, Phillip; Ling, Ta-Yung; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroue, Pierre; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatzerklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, K.; Sedov, Alexey; Shipsey, Ian; Silvers, David; Yoo, Hwi Dong; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Matveev, Mikhail; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Flacher, Henning; Garcia-Bellido, Aran; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Korjenevski, Sergey; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Hatakeyama, Kenichi; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Gershtein, Yuri; Halkiadakis, Eva; Hits, Dmitry; Lath, Amitabh; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Toback, David; Weinberger, Michael; Akchurin, Nural; Jeong, Chiyoung; Lee, Sung Won; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Brownson, Eric; Engh, Daniel; Florez, Carlos; Johns, Willard; Kurt, Pelin; Sheldon, Paul; Arenton, Michael Wayne; Balazs, Michael; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Gunthoti, Kranti; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Efron, Jonathan; Flood, Kevin; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Reeder, Don; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc


    Measurements of inclusive charged-hadron transverse-momentum and pseudorapidity distributions are presented for proton-proton collisions at sqrt(s) = 0.9 and 2.36 TeV. The data were collected with the CMS detector during the LHC commissioning in December 2009. For non-single-diffractive interactions, the average charged-hadron transverse momentum is measured to be 0.46 +/- 0.01 (stat.) +/- 0.01 (syst.) GeV/c at 0.9 TeV and 0.50 +/- 0.01 (stat.) +/- 0.01 (syst.) GeV/c at 2.36 TeV, for pseudorapidities between -2.4 and +2.4. At these energies, the measured pseudorapidity densities in the central region, dN(charged)/d(eta) for |eta| < 0.5, are 3.48 +/- 0.02 (stat.) +/- 0.13 (syst.) and 4.47 +/- 0.04 (stat.) +/- 0.16 (syst.), respectively. The results at 0.9 TeV are in agreement with previous measurements and confirm the expectation of near equal hadron production in p-pbar and pp collisions. The results at 2.36 TeV represent the highest-energy measurements at a particle collider to date.

  17. Can the periodic spectral modulations observed in 236 Sloan Sky Survey stars be due to dark matter effects? (United States)

    Tamburini, Fabrizio; Licata, Ignazio


    The search for dark matter (DM) is one of the most active and challenging areas of current research. Possible DM candidates are ultralight fields such as axions and weak interacting massive particles (WIMPs). Axions piled up in the center of stars are supposed to generate matter/DM configurations with oscillating geometries at a very rapid frequency, which is a multiple of the axion mass m B (Brito et al (2015); Brito et al (2016)). Borra and Trottier (2016) recently found peculiar ultrafast periodic spectral modulations in 236 main sequence stars in the sample of 2.5 million spectra of galactic halo stars of the Sloan Digital Sky Survey (˜1% of main sequence stars in the F-K spectral range) that were interpreted as optical signals from extraterrestrial civilizations, suggesting them as possible candidates for the search for extraterrestrial intelligence (SETI) program. We argue, instead, that this could be the first indirect evidence of bosonic axion-like DM fields inside main sequence stars, with a stable radiative nucleus, where a stable DM core can be hosted. These oscillations were not observed in earlier stellar spectral classes probably because of the impossibility of starting a stable oscillatory regime due to the presence of chaotic motions in their convective nuclei. The axion mass values, (50< {m}B< 2.4× {10}3) μ {eV}, obtained from the frequency range observed by Borra and Trottier, (0.6070< f< 0.6077) THz, agree with the recent theoretical results from high-temperature lattice quantum chromodynamics (Borsanyi et al (2016); Borsanyi et al (2016b)).

  18. On the Use of 233U-236U Double-Spike for TIMS Measurements of Uranium Isotopes: A Simulation Study

    International Nuclear Information System (INIS)

    Williams, R W


    Synthetic ion beams with instantaneous and temporal characteristics appropriate to thermal ionization mass spectrometry (TIMS) were mathematically generated and analyzed to determine the effects of using a mixed 233 U- 236 U spike (double-spike) in the analysis of uranium isotopes. The instantaneous beam characteristics are the intensities (e.g., counts per second) modeled with a Poisson distribution plus a component of random noise that simulates the detection processes. Several beam intensity and mass fractionation vs. time functions were modeled to simulate a range of sample sizes and the commonly employed methods of data collection. These beam profiles were also generated with different noise levels, and signal-to-noise vs. analytical precision diagrams are presented. Modeling focused on natural uranium, where 238 U/ 235 U = 137.88, and on the ability of a given method to determine precisely and accurately small variations in this ratio. Practical limits on precision were determined to be 20-30 ppm, which is consistent with precision seen for other elements by state-of-the-art TIMS. The TIMS total evaporation method was compared directly with the double-spike method. While similar analytical precisions are obtained with either method, the double-spike method of correcting for analytical bias gives more accurate results. The results of a total evaporation analysis will deviate from true by more than the analytical precision if as little as 0.05% of the signal is not integrated, whereas the accuracy and precision of the double-spiked analyses are always linked

  19. Actinide production from xenon bombardments of curium-248

    International Nuclear Information System (INIS)

    Welch, R.B.


    Production cross sections for many actinide nuclides formed in the reaction of 129 Xe and 132 Xe with 248 Cm at bombarding energies slightly above the coulomb barrier were determined using radiochemical techniques to isolate these products. These results are compared with cross sections from a 136 Xe + 248 Cm reaction at a similar energy. When compared to the reaction with 136 Xe, the maxima in the production cross section distributions from the more neutron deficient projectiles are shifted to smaller mass numbers, and the total cross section increases for the production of elements with atomic numbers greater than that of the target, and decreases for lighter elements. These results can be explained by use of a potential energy surface (PES) which illustrates the effect of the available energy on the transfer of nucleons and describes the evolution of the di-nuclear complex, an essential feature of deep-inelastic reactions (DIR), during the interaction. The other principal reaction mechanism is the quasi-elastic transfer (QE). Analysis of data from a similar set of reactions, 129 Xe, 132 Xe, and 136 Xe with 197 Au, aids in explaining the features of the Xe + Cm product distributions, which are additionally affected by the depletion of actinide product yields due to deexcitation by fission. The PES is shown to be a useful tool to predict the general features of product distributions from heavy ion reactions


    Higgins, G.H.; Crane, W.W.T.


    A large-scale process for production and purification of Cm/sup 242/ is described. Aluminum slugs containing Am are irradiated and declad in a NaOH-- NaHO/sub 3/ solution at 85 to 100 deg C. The resulting slurry filtered and washed with NaOH, NH/sub 4/OH, and H/sub 2/O. Recovery of Cm from filtrate and washings is effected by an Fe(OH)/sub 3/ precipitation. The precipitates are then combined and dissolved ln HCl and refractory oxides centrifuged out. These oxides are then fused with Na/sub 2/CO/sub 3/ and dissolved in HCl. The solution is evaporated and LiCl solution added. The Cm, rare earths, and anionic impurities are adsorbed on a strong-base anfon exchange resin. Impurities are eluted with LiCl--HCl solution, rare earths and Cm are eluted by HCl. Other ion exchange steps further purify the Cm. The Cm is then precipitated as fluoride and used in this form or further purified and processed. (T.R.H.)

  1. Gastrointestinal absorption of neptunium and curium in humans

    International Nuclear Information System (INIS)

    Popplewell, D.S.; Harrison, J.D.; Ham, G.J.


    The gastrointestinal absorption of Np and Cm has been determined in five male adult volunteers. The Np and Cm, which were in citrate solution, were taken with food. An initial experiment with each individual determined the fraction of each element excreted in the urine following intravenous administration. Subsequently, the results for urinary excretion for the two routes of administration were used to calculate the fractional absorption (f1) of ingested Np and Cm. The mean f1 values were: Np (2.0 +/- 0.2) X 10 - 4 , range (1.2-2.9) X 10 - 4 , and Cm (1.7 +/- 0.3) X 10 - 4 , range (0.95-3.0) X 10 - 4 , the quoted uncertainties being the standard error of the means. Currently, the International Commission on Radiological Protection recommends a value of 10 - 3 for both elements. Cumulative urinary excretion over 1 wk after intravenous injection accounted for about 20%-40% of administered Np and 7%-10% of Cm. At the conclusion of the experiment, the total committed effective dose equivalent for each volunteer was calculated to be in the range 130-250 microSv, based on the individual f1 values, and, in some cases, a knowledge of the rate of clearance of 239 Np through the gut as measured by whole-body counting

  2. Interaction of europium and curium with alpha-amylase

    Energy Technology Data Exchange (ETDEWEB)

    Barkleit, Astrid [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Div. Chemistry of the F-Elements; Heller, Anne [Technische Univ. Dresden (Germany). Inst. for Zoology, Molecular Cell Physiology and Endocrinology; Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Div. Biogeochemistry


    Time-resolved laser-induced fluorescence spectroscopy (TRLFS) revealed that Eu(III) and Cm(III) form two dominant species with the protein α-amylase (Amy): one with the coordination of a single carboxylate group of the protein and the other with three coordinating carboxylate groups.

  3. Removal of americium and curium from high-level wastes

    International Nuclear Information System (INIS)

    Bond, W.D.; Leuze, R.E.


    The DHDECMP process was demonstrated to give a 99.5% removal of actinides from actual HLLW in small-scale, batch extraction tests. Results from cold tests indicate that it may be possible to carry out the oxalate precipitation step of the OPIX process continuously. About 90% recovery of the trivalent actinides and lanthanides can be achieved in the continuous precipitation. the presence of zirconium impurity in feed solutions to Talspeak process at concentrations of 10 -4 M (0.5% of the Zr in the original waste) affected phase separations but equipment could be operated satisfactory in cold tests. Zirconium concentrations of 10 -3 M seriously affected phase separations and substantial quantities of interfacial cruds were formed. Modest concentrations (0.006 M or less) of H 2 MEHP, a suspected degradation product of HDEHP, did not effect separation factors. The presence of impurities derived from the thermal degradation of DHDECMP did not inhibit the loading of the trivalent actinide and lanthanide elements in the cation exchange chromatographic process for their separation. It appears that the biodentate (DHDECMP) solvent extraction process and the OPIX process are the leading candidate process for the co-removal of trivalent actinide and lanthanide elements from HLLW. The cation exchange chromatography and the Talspeak processes, are the leading candidate processes for the subsequent separation of actinides and lanthanides. The bidentate and cation exchange processes are further along in their development than the other processes and are currently considered the reference processes for the partitioning of Am-Cm from HLLW. 4 figures, 4 tables

  4. A bioassay method for americium and curium in feces

    International Nuclear Information System (INIS)

    Alexandre Gagne; Dominic Lariviere; Joel Surette; Sheila Kramer-Tremblay; Xiongxin Dai; Candice Didychuk


    Fecal radiobioassay is an essential and sensitive tool to estimate the internal intake of actinides after a radiological incident. A new fecal analysis method, based on lithium metaborate fusion of fecal ash for complete sample dissolution followed by sequential column chromatography separation of actinides, has been developed for the determination of low-level Am and Cm in a large size sample. Spiked synthetic fecal samples were analyzed to evaluate method performance against the acceptance criteria for radiobioassay as defined by ANSI N13.30; both satisfactory accuracy and repeatability were achieved. This method is a promising candidate for reliable dose assessment of low level actinide exposure to meet the regulatory requirements of routine radiobioassay for nuclear workers and the public. (author)

  5. Determination of extremely low {sup 236}U/{sup 238}U isotope ratios in environmental samples by sector-field inductively coupled plasma mass spectrometry using high-efficiency sample introduction

    Energy Technology Data Exchange (ETDEWEB)

    Boulyga, Sergei F. [Institute of Inorganic Chemistry and Analytical Chemistry, Johannes Gutenberg-University Mainz, Duesbergweg 10-14, 55099 Mainz (Germany)]. E-mail:; Heumann, Klaus G. [Institute of Inorganic Chemistry and Analytical Chemistry, Johannes Gutenberg-University Mainz, Duesbergweg 10-14, 55099 Mainz (Germany)


    A method by inductively coupled plasma mass spectrometry (Icp-Ms) was developed which allows the measurement of {sup 236}U at concentration ranges down to 3 x 10{sup -14} g g{sup -1} and extremely low {sup 236}U/{sup 238}U isotope ratios in soil samples of 10{sup -7}. By using the high-efficiency solution introduction system APEX in connection with a sector-field ICP-MS a sensitivity of more than 5000 counts fg{sup -1} uranium was achieved. The use of an aerosol desolvating unit reduced the formation rate of uranium hydride ions UH{sup +}/U{sup +} down to a level of 10{sup -6}. An abundance sensitivity of 3 x 10{sup -7} was observed for {sup 236}U/{sup 238}U isotope ratio measurements at mass resolution 4000. The detection limit for {sup 236}U and the lowest detectable {sup 236}U/{sup 238}U isotope ratio were improved by more than two orders of magnitude compared with corresponding values by alpha spectrometry. Determination of uranium in soil samples collected in the vicinity of Chernobyl nuclear power plant (NPP) resulted in that the {sup 236}U/{sup 238}U isotope ratio is a much more sensitive and accurate marker for environmental contamination by spent uranium in comparison to the {sup 235}U/{sup 238}U isotope ratio. The ICP-MS technique allowed for the first time detection of irradiated uranium in soil samples even at distances more than 200 km to the north of Chernobyl NPP (Mogilev region). The concentration of {sup 236}U in the upper 0-10 cm soil layers varied from 2 x 10{sup -9} g g{sup -1} within radioactive spots close to the Chernobyl NPP to 3 x 10{sup -13} g g{sup -1} on a sampling site located by >200 km from Chernobyl.

  6. Global emissions of the hydrofluorocarbons (HFCs) HFC-365mfc, HFC-245fa, HFC-227ea, and HFC-236fa based on atmospheric observations (United States)

    Vollmer, M. K.; Miller, B. R.; Rigby, M. L.; Reimann, S.; Muhle, J.; Agage, Soge, Snu Members, Kopri Members


    We report on the atmospheric measurements and global emissions of the hydrofluorocarbons (HFCs) HFC-365mfc (CH3CH2CF2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). These measurements are from in-situ observations at stations of AGAGE (Advanced Global Atmospheric Gases Experiment) and SOGE (System for Observations of Halogenated Greenhouse Gases in Europe), and from the Korean station Gosan. We also report on flask sample measurements from the Antarctic stations King Sejong and Troll, and extend our records back to the 1970s using archived air samples of both hemispheres. All data are used in a global 12-box 2-dimensional atmospheric transport model to derive global abundances and emission estimates. All four HFCs have strongly increased in the atmosphere in recent years with growth rates at nearly 10 %, resulting in dry air mole fractions at the end of 2009 of 0.49 ppt for HFC-365mfc, 1.00 ppt for HFC-245fa, and 0.51 ppt for HFC-227ea. HFC-236fa, for which we report the first atmospheric measurements, is less abundant and has grown to 0.069 ppt at the end of 2009. Our model results show rapidly growing emissions of HFC-365mfc and HFC-245fa after 2002 but surprisingly these have now started to decline to globally 2.7 kt/yr (HFC-365mfc) and 6.1 kt/yr (HFC-245fa). On the other hand HFC-227ea and HFC-236fa show uninterrupted growth in their emissions of 2.5 kt/yr and 0.2 kt/yr at the end of 2009.

  7. Determination of uranium isotopic composition and {sup 236}U content of soil samples and hot particles using inductively coupled plasma mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Boulyga, S.F. [Radiation Physics and Chemistry Problems Inst., Minsk (Belarus); Becker, J.S. [Central Department for Analytical Chemistry, Research Centre Juelich (Germany)


    As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The {sup 236}U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10{sup -4} and 10{sup -3} counts per atom were achieved for {sup 238}U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH{sup +}/U{sup +} was 1.2 x 10{sup -4} and 1.4 x 10{sup -4}, respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 {mu}g L{sup -1} NBS U-020 standard solution was 0.11% ({sup 238}U/{sup 235}U) and 1.4% ({sup 236}U/{sup 238}U) using a MicroMist nebulizer and 0.25% ({sup 235}U/{sup 238}U) and 1.9% ({sup 236}U/{sup 238}U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the {sup 236}U/{sup 238}U ratio ranged from 10{sup -5} to 10{sup -3}. Results obtained with ICP-MS, {alpha}- and {gamma}-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples. (orig.)

  8. Data Evaluation of Actinide Cross Sections: 238Pu, 237Pu, and 236Pu

    Energy Technology Data Exchange (ETDEWEB)

    Guaglioni, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jurgenson, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Descalle, M. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ormand, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Younes, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mattoon, C. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beck, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bailey, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)


    This report documents the recent evaluation of the 236Pu, 237Pu, and 238Pu cross section sets. Nuclear data evaluation is the fundamental interface that takes measured nuclear cross section data and turns them into a continuous curve that 1) is consistent with other measurements and nuclear reaction theory/models, and 2) is required by down-stream users. All experiments that generate nuclear data need to include an evaluation step for their data to be broadly useful to the end users.

  9. A-type central stars of planetary nebulae. 2. The central stars of NGC 2346, He 2-36 and NGC 3132

    Energy Technology Data Exchange (ETDEWEB)

    Mendez, R H [Instituto de Astronomia y Fisica del Espacio, Buenos Aires (Argentina)


    Spectrograms, scanner, uvby and ANS ultraviolet measurements of the central stars of NGC 2346, He 2-36 and NGC 3132 are analysed. The observations suggest that the first one is a foreground horizontal-branch star, and the second is above the horizontal branch, presumably in a rapid evolutionary phase. Both objects are probably variable. The central star of NGC 3132 is a slightly evolved main-sequence star with a hot visual companion. The evolutionary status of this system is briefly discussed.

  10. Charged-particle multiplicity measurement in proton-proton collisions at $\\sqrt{s}$ = 0.9 and 2.36 TeV with ALICE at LHC

    CERN Document Server

    Aamodt, K.; Abeysekara, U.; Abrahantes Quintana, A.; Abramyan, A.; Adamova, D.; Aggarwal, M.M.; Aglieri Rinella, G.; Agocs, A.G.; Aguilar Salazar, S.; Ahammed, Z.; Ahmad, A.; Ahmad, N.; Ahn, S.U.; Akimoto, R.; Akindinov, A.; Aleksandrov, D.; Alessandro, B.; Alfaro Molina, R.; Alici, A.; Avina, E.Almaraz; Alme, J.; Alt, T.; Altini, V.; Altinpinar, S.; Andrei, C.; Andronic, A.; Anelli, G.; Angelov, V.; Anson, C.; Anticic, T.; Antinori, F.; Antinori, S.; Antipin, K.; Antonczyk, D.; Antonioli, P.; Anzo, A.; Aphecetche, L.; Appelshauser, H.; Arcelli, S.; Arceo, R.; Arend, A.; Armesto, N.; Arnaldi, R.; Aronsson, T.; Arsene, I.C.; Asryan, A.; Augustinus, A.; Averbeck, R.; Awes, T.C.; Aysto, J.; Azmi, M.D.; Bablok, S.; Bach, M.; Badala, A.; Baek, Y.W.; Bagnasco, S.; Bailhache, R.; Bala, R.; Baldisseri, A.; Baldit, A.; Ban, J.; Barbera, R.; Barnafoldi, G.G.; Barnby, L.; Barret, V.; Bartke, J.; Barile, F.; Basile, M.; Basmanov, V.; Bastid, N.; Bathen, B.; Batigne, G.; Batyunya, B.; Baumann, C.; Bearden, I.G.; Becker, B.; Belikov, I.; Bellwied, R.; Belmont-Moreno, E.; Belogianni, A.; Benhabib, L.; Beole, S.; Berceanu, I.; Bercuci, A.; Berdermann, E.; Berdnikov, Y.; Betev, L.; Bhasin, A.; Bhati, A.K.; Bianchi, L.; Bianchi, N.; Bianchin, C.; Bielcik, J.; Bielcikova, J.; Bilandzic, A.; Bimbot, L.; Biolcati, E.; Blanc, A.; Blanco, F.; Blanco, F.; Blau, D.; Blume, C.; Boccioli, M.; Bock, N.; Bogdanov, A.; Boggild, H.; Bogolyubsky, M.; Bohm, J.; Boldizsar, L.; Bombara, M.; Bombonati, C.; Bondila, M.; Borel, H.; Borshchov, V.; Borisov, A.; Bortolin, C.; Bose, S.; Bosisio, L.; Bossu, F.; Botje, M.; Bottger, S.; Bourdaud, G.; Boyer, B.; Braun, M.; Braun-Munzinger, P.; Bravina, L.; Bregant, M.; Breitner, T.; Bruckner, G.; Brun, R.; Bruna, E.; Bruno, G.E.; Budnikov, D.; Buesching, H.; Buncic, P.; Busch, O.; Buthelezi, Z.; Caffarri, D.; Cai, X.; Caines, H.; Camacho, E.; Camerini, P.; Campbell, M.; Canoa Roman, V.; Capitani, G.P.; Cara Romeo, G.; Carena, F.; Carena, W.; Carminati, F.; Casanova Diaz, A.; Caselle, M.; Castellanos, J.Castillo; Castillo Hernandez, J.F.; Catanescu, V.; Cattaruzza, E.; Cavicchioli, C.; Cerello, P.; Chambert, V.; Chang, B.; Chapeland, S.; Charpy, A.; Charvet, J.L.; Chattopadhyay, S.; Chattopadhyay, S.; Cherney, M.; Cheshkov, C.; Cheynis, B.; Chiavassa, E.; Chibante Barroso, V.; Chinellato, D.D.; Chochula, P.; Choi, K.; Chojnacki, M.; Christakoglou, P.; Christensen, C.H.; Christiansen, P.; Chujo, T.; Chuman, F.; Cicalo, C.; Cifarelli, L.; Cindolo, F.; Cleymans, J.; Cobanoglu, O.; Coffin, J.P.; Coli, S.; Colla, A.; Conesa Balbastre, G.; Conesa del Valle, Z.; Conner, E.S.; Constantin, P.; Contin, G.; Contreras, J.G.; Corrales Morales, Y.; Cormier, T.M.; Cortese, P.; Cortes Maldonado, I.; Cosentino, M.R.; Costa, F.; Cotallo, M.E.; Crescio, E.; Crochet, P.; Cuautle, E.; Cunqueiro, L.; Cussonneau, J.; Dainese, A.; Dalsgaard, H.H.; Danu, A.; Das, I.; Das, S.; Dash, A.; Dash, S.; de Barros, G.O.V.; De Caro, A.; de Cataldo, G.; de Cuveland, J.; De Falco, A.; De Gaspari, M.; de Groot, J.; De Gruttola, D.; de Haas, A.P.; De Marco, N.; De Pasquale, S.; De Remigis, R.; de Rooij, R.; de Vaux, G.; Delagrange, H.; Dellacasa, G.; Deloff, A.; Demanov, V.; Denes, E.; Deppman, A.; D'Erasmo, G.; Derkach, D.; Devaux, A.; Di Bari, D.; Di Giglio, C.; Di Liberto, S.; Di Mauro, A.; Di Nezza, P.; Dialinas, M.; Diaz, L.; Diaz, R.; Dietel, T.; Divia, R.; Djuvsland, O.; Dobretsov, V.; Dobrin, A.; Dobrowolski, T.; Donigus, B.; Dominguez, I.; Dordic, O.; Dubey, A.K.; Dubuisson, J.; Ducroux, L.; Dupieux, P.; Dutta Majumdar, A.K.; Dutta Majumdar, M.R.; Elia, D.; Emschermann, D.; Enokizono, A.; Espagnon, B.; Estienne, M.; Esumi, S.; Evans, D.; Evrard, S.; Eyyubova, G.; Fabjan, C.W.; Fabris, D.; Faivre, J.; Falchieri, D.; Fantoni, A.; Fasel, M.; Fateev, O.; Fearick, R.; Fedunov, A.; Fehlker, D.; Fekete, V.; Felea, D.; Fenton-Olsen, B.; Feofilov, G.; Fernandez Tellez, A.; Ferreiro, E.G.; Ferretti, A.; Ferretti, R.; Figueredo, M.A.S.; Filchagin, S.; Fini, R.; Fionda, F.M.; Fiore, E.M.; Floris, M.; Fodor, Z.; Foertsch, S.; Foka, P.; Fokin, S.; Formenti, F.; Fragiacomo, E.; Fragkiadakis, M.; Frankenfeld, U.; Frolov, A.; Fuchs, U.; Furano, F.; Furget, C.; Fusco Girard, M.; Gaardhoje, J.J.; Gadrat, S.; Gagliardi, M.; Gago, A.; Gallio, M.; Ganoti, P.; Ganti, M.S.; Garabatos, C.; Garcia Trapaga, C.; Gebelein, J.; Gemme, R.; Germain, M.; Gheata, A.; Gheata, M.; Ghidini, B.; Ghosh, P.; Giraudo, G.; Giubellino, P.; Gladysz-Dziadus, E.; Glasow, R.; Glassel, P.; Glenn, A.; Gomez Jimenez, R.; Gonzalez Santos, H.; Gonzalez-Trueba, L.H.; Gonzalez-Zamora, P.; Gorbunov, S.; Gorbunov, Y.; Gotovac, S.; Gottschlag, H.; Grabski, V.; Grajcarek, R.; Grelli, A.; Grigoras, A.; Grigoras, C.; Grigoriev, V.; Grigoryan, A.; Grigoryan, S.; Grinyov, B.; Grion, N.; Gros, P.; Grosse-Oetringhaus, J.F.; Grossiord, J.Y.; Grosso, R.; Guber, F.; Guernane, R.; Guerzoni, B.; Gulbrandsen, K.; Gulkanyan, H.; Gunji, T.; Gupta, A.; Gupta, R.; Gustafsson, H.A.; Gutbrod, H.; Haaland, O.; Hadjidakis, C.; Haiduc, M.; Hamagaki, H.; Hamar, G.; Hamblen, J.; Han, B.H.; Harris, J.W.; Hartig, M.; Harutyunyan, A.; Hasch, D.; Hasegan, D.; Hatzifotiadou, D.; Hayrapetyan, A.; Heide, M.; Heinz, M.; Helstrup, H.; Herghelegiu, A.; Hernandez, C.; Herrera Corral, G.; Herrmann, N.; Hetland, K.F.; Hicks, B.; Hiei, A.; Hille, P.T.; Hippolyte, B.; Horaguchi, T.; Hori, Y.; Hristov, P.; Hrivnacova, I.; Hu, S.; Huang, M.; Huber, S.; Humanic, T.J.; Hutter, D.; Hwang, D.S.; Ichou, R.; Ilkaev, R.; Ilkiv, I.; Inaba, M.; Innocenti, P.G.; Ippolitov, M.; Irfan, M.; Ivan, C.; Ivanov, A.; Ivanov, M.; Ivanov, V.; Iwasaki, T.; Jacholkowski, A.; Jacobs, P.; Jancurova, L.; Jangal, S.; Janik, R.; Jena, C.; Jena, S.; Jirden, L.; Jones, G.T.; Jones, P.G.; Jovanovic, P.; Jung, H.; Jung, W.; Jusko, A.; Kaidalov, A.B.; Kalcher, S.; Kalinak, P.; Kalisky, M.; Kalliokoski, T.; Kalweit, A.; Kamal, A.; Kamermans, R.; Kanaki, K.; Kang, E.; Kang, J.H.; Kapitan, J.; Kaplin, V.; Kapusta, S.; Karavichev, O.; Karavicheva, T.; Karpechev, E.; Kazantsev, A.; Kebschull, U.; Keidel, R.; Khan, M.M.; Khan, S.A.; Khanzadeev, A.; Kharlov, Y.; Kikola, D.; Kileng, B.; Kim, D.J.; Kim, D.S.; Kim, D.W.; Kim, H.N.; Kim, J.; Kim, J.H.; Kim, J.S.; Kim, M.; Kim, M.; Kim, S.H.; Kim, S.; Kim, Y.; Kirsch, S.; Kisel, I.; Kiselev, S.; Kisiel, A.; Klay, J.L.; Klein, J.; Klein-Bosing, C.; Kliemant, M.; Klovning, A.; Kluge, A.; Kniege, S.; Koch, K.; Kolevatov, R.; Kolojvari, A.; Kondratiev, V.; Kondratyeva, N.; Konevskih, A.; Kornas, E.; Kour, R.; Kowalski, M.; Kox, S.; Kozlov, K.; Kral, J.; Kralik, I.; Kramer, F.; Kraus, I.; Kravcakova, A.; Krawutschke, T.; Krivda, M.; Krumbhorn, D.; Krus, M.; Kryshen, E.; Krzewicki, M.; Kucheriaev, Y.; Kuhn, C.; Kuijer, P.G.; Kumar, L.; Kumar, N.; Kupczak, R.; Kurashvili, P.; Kurepin, A.; Kurepin, A.N.; Kuryakin, A.; Kushpil, S.; Kushpil, V.; Kutouski, M.; Kvaerno, H.; Kweon, M.J.; Kwon, Y.; La Rocca, P.; Lackner, F.; Ladron de Guevara, P.; Lafage, V.; Lal, C.; Lara, C.; Larsen, D.T.; Laurenti, G.; Lazzeroni, C.; Le Bornec, Y.; Le Bris, N.; Lee, H.; Lee, K.S.; Lee, S.C.; Lefevre, F.; Lenhardt, M.; Leistam, L.; Lehnert, J.; Lenti, V.; Leon, H.; Leon Monzon, I.; Leon Vargas, H.; Levai, P.; Li, X.; Li, Y.; Lietava, R.; Lindal, S.; Lindenstruth, V.; Lippmann, C.; Lisa, M.A.; Listratenko, O.; Liu, L.; Loginov, V.; Lohn, S.; Lopez, X.; Lopez Noriega, M.; Lopez-Ramirez, R.; Lopez Torres, E.; Lovhoiden, G.; Lozea Feijo Soares, A.; Lu, S.; Lunardon, M.; Luparello, G.; Luquin, L.; Lutz, J.R.; Ma, K.; Ma, R.; Madagodahettige-Don, D.M.; Maevskaya, A.; Mager, M.; Mahapatra, D.P.; Maire, A.; Makhlyueva, I.; Mal'Kevich, D.; Malaev, M.; Malagalage, K.J.; Maldonado Cervantes, I.; Malek, M.; Malkiewicz, T.; Malzacher, P.; Mamonov, A.; Manceau, L.; Mangotra, L.; Manko, V.; Manso, F.; Manzari, V.; Mao, Y.; Mares, J.; Margagliotti, G.V.; Margotti, A.; Marin, A.; Martashvili, I.; Martinengo, P.; Martinez Hernandez, M.I.; Martinez Davalos, A.; Martinez Garcia, G.; Maruyama, Y.; Marzari Chiesa, A.; Masciocchi, S.; Masera, M.; Masetti, M.; Masoni, A.; Massacrier, L.; Mastromarco, M.; Mastroserio, A.; Matthews, Z.L.; Matyja, A.; Mayani, D.; Mazza, G.; Mazzoni, M.A.; Meddi, F.; Menchaca-Rocha, A.; Mendez Lorenzo, P.; Meoni, M.; Mercado Perez, J.; Mereu, P.; Miake, Y.; Michalon, A.; Miftakhov, N.; Milosevic, J.; Minafra, F.; Mischke, A.; Miskowiec, D.; Mitu, C.; Mizoguchi, K.; Mlynarz, J.; Mohanty, B.; Molnar, L.; Mondal, M.M.; Montano Zetina, L.; Monteno, M.; Montes, E.; Morando, M.; Moretto, S.; Morsch, A.; Moukhanova, T.; Muccifora, V.; Mudnic, E.; Muhuri, S.; Muller, H.; Munhoz, M.G.; Munoz, J.; Musa, L.; Musso, A.; Nandi, B.K.; Nania, R.; Nappi, E.; Navach, F.; Navin, S.; Nayak, T.K.; Nazarenko, S.; Nazarov, G.; Nedosekin, A.; Nendaz, F.; Newby, J.; Nianine, A.; Nicassio, M.; Nielsen, B.S.; Nikolaev, S.; Nikolic, V.; Nikulin, S.; Nikulin, V.; Nilsen, B.S.; Nilsson, M.S.; Noferini, F.; Nomokonov, P.; Nooren, G.; Novitzky, N.; Nyatha, A.; Nygaard, C.; Nyiri, A.; Nystrand, J.; Ochirov, A.; Odyniec, G.; Oeschler, H.; Oinonen, M.; Okada, K.; Okada, Y.; Oldenburg, M.; Oleniacz, J.; Oppedisano, C.; Orsini, F.; Ortiz Velasquez, A.; Ortona, G.; Oskamp, C.J.; Oskarsson, A.; Osmic, F.; Osterman, L.; Ostrowski, P.; Otterlund, I.; Otwinowski, J.; Ovrebekk, G.; Oyama, K.; Ozawa, K.; Pachmayer, Y.; Pachr, M.; Padilla, F.; Pagano, P.; Paic, G.; Painke, F.; Pajares, C.; Pal, S.; Pal, S.K.; Palaha, A.; Palmeri, A.; Panse, R.; Papikyan, V.; Pappalardo, G.S.; Park, W.J.; Pastircak, B.; Pastore, C.; Paticchio, V.; Pavlinov, A.; Pawlak, T.; Peitzmann, T.; Pepato, A.; Pereira, H.; Peressounko, D.; Perez, C.; Perini, D.; Perrino, D.; Peryt, W.; Peschek, J.; Pesci, A.; Peskov, V.; Pestov, Y.; Peters, A.J.; Petracek, V.; Petridis, A.; Petris, M.; Petrov, P.; Petrovici, M.; Petta, C.; Peyre, J.; Piano, S.; Piccotti, A.; Pikna, M.; Pillot, P.; Pinazza, O.; Pinsky, L.; Pitz, N.; Piuz, F.; Platt, R.; Ploskon, M.; Pluta, J.; Pocheptsov, T.; Pochybova, S.; Podesta Lerma, P.L.M.; Poggio, F.; Poghosyan, M.G.; Polak, K.; Polichtchouk, B.; Polozov, P.; Polyakov, V.; Pommeresch, B.; Pop, A.; Posa, F.; Pospisil, V.; Potukuchi, B.; Pouthas, J.; Prasad, S.K.; Preghenella, R.; Prino, F.; Pruneau, C.A.; Pshenichnov, I.; Puddu, G.; Pujahari, P.; Pulvirenti, A.; Punin, A.; Punin, V.; Putis, M.; Putschke, J.; Quercigh, E.; Rachevski, A.; Rademakers, A.; Radomski, S.; Raiha, T.S.; Rak, J.; Rakotozafindrabe, A.; Ramello, L.; Ramirez Reyes, A.; Rammler, M.; Raniwala, R.; Raniwala, S.; Rasanen, S.S.; Rashevskaya, I.; Rath, S.; Read, K.F.; Real, J.S.; Redlich, K.; Renfordt, R.; Reolon, A.R.; Reshetin, A.; Rettig, F.; Revol, J.P.; Reygers, K.; Ricaud, H.; Riccati, L.; Ricci, R.A.; Richter, M.; Riedler, P.; Riegler, W.; Riggi, F.; Rivetti, A.; Rodriguez Cahuantzi, M.; Roed, K.; Rohrich, D.; Roman Lopez, S.; Romita, R.; Ronchetti, F.; Rosinsky, P.; Rosnet, P.; Rossegger, S.; Rossi, A.; Roukoutakis, F.; Rousseau, S.; Roy, C.; Roy, P.; Rubio-Montero, A.J.; Rui, R.; Rusanov, I.; Russo, G.; Ryabinkin, E.; Rybicki, A.; Sadovsky, S.; Safarik, K.; Sahoo, R.; Saini, J.; Saiz, P.; Sakata, D.; Salgado, C.A.; Salgueiro Domingues da Silva, R.; Salur, S.; Samanta, T.; Sambyal, S.; Samsonov, V.; Sandor, L.; Sandoval, A.; Sano, M.; Sano, S.; Santo, R.; Santoro, R.; Sarkamo, J.; Saturnini, P.; Scapparone, E.; Scarlassara, F.; Scharenberg, R.P.; Schiaua, C.; Schicker, R.; Schindler, H.; Schmidt, C.; Schmidt, H.R.; Schossmaier, K.; Schreiner, S.; Schuchmann, S.; Schukraft, J.; Schutz, Y.; Schwarz, K.; Schweda, K.; Scioli, G.; Scomparin, E.; Segato, G.; Semenov, D.; Senyukov, S.; Seo, J.; Serci, S.; Serkin, L.; Serradilla, E.; Sevcenco, A.; Sgura, I.; Shabratova, G.; Shahoyan, R.; Sharkov, G.; Sharma, N.; Sharma, S.; Shigaki, K.; Shimomura, M.; Shtejer, K.; Sibiriak, Y.; Siciliano, M.; Sicking, E.; Siddi, E.; Siemiarczuk, T.; Silenzi, A.; Silvermyr, D.; Simili, E.; Simonetti, G.; Singaraju, R.; Singh, R.; Singhal, V.; Sinha, B.C.; Sinha, T.; Sitar, B.; Sitta, M.; Skaali, T.B.; Skjerdal, K.; Smakal, R.; Smirnov, N.; Snellings, R.; Snow, H.; Sogaard, C.; Soloviev, A.; Soltveit, H.K.; Soltz, R.; Sommer, W.; Son, C.W.; Son, H.; Song, M.; Soos, C.; Soramel, F.; Soyk, D.; Spyropoulou-Stassinaki, M.; Srivastava, B.K.; Stachel, J.; Staley, F.; Stan, E.; Stefanek, G.; Stefanini, G.; Steinbeck, T.; Stenlund, E.; Steyn, G.; Stocco, D.; Stock, R.; Stolpovsky, P.; Strmen, P.; Suaide, A.A.P.; Subieta Vasquez, M.A.; Sugitate, T.; Suire, C.; Sumbera, M.; Susa, T.; Swoboda, D.; Symons, J.; Szanto de Toledo, A.; Szarka, I.; Szostak, A.; Szuba, M.; Tadel, M.; Tagridis, C.; Takahara, A.; Takahashi, J.; Tanabe, R.; Takaki, D.J.Tapia; Taureg, H.; Tauro, A.; Tavlet, M.; Tejeda Munoz, G.; Telesca, A.; Terrevoli, C.; Thader, J.; Tieulent, R.; Tlusty, D.; Toia, A.; Tolyhy, T.; Torcato de Matos, C.; Torii, H.; Torralba, G.; Toscano, L.; Tosello, F.; Tournaire, A.; Traczyk, T.; Tribedy, P.; Troger, G.; Truesdale, D.; Trzaska, W.H.; Tsiledakis, G.; Tsilis, E.; Tsuji, T.; Tumkin, A.; Turrisi, R.; Turvey, A.; Tveter, T.S.; Tydesjo, H.; Tywoniuk, K.; Ulery, J.; Ullaland, K.; Uras, A.; Urban, J.; Urciuoli, G.M.; Usai, G.L.; Vacchi, A.; Vala, M.; Valencia Palomo, L.; Vallero, S.; van den Brink, A.; van der Kolk, N.; Vyvre, P.Vande; van Leeuwen, M.; Vannucci, L.; Vargas, A.; Varma, R.; Vasiliev, A.; Vassiliev, I.; Vasileiou, M.; Vechernin, V.; Venaruzzo, M.; Vercellin, E.; Vergara, S.; Vernet, R.; Verweij, M.; Vetlitskiy, I.; Vickovic, L.; Viesti, G.; Vikhlyantsev, O.; Vilakazi, Z.; Villalobos Baillie, O.; Vinogradov, A.; Vinogradov, L.; Vinogradov, Y.; Virgili, T.; Viyogi, Y.P.; Vodopianov, A.; Voloshin, K.; Voloshin, S.; Volpe, G.; von Haller, B.; Vranic, D.; Vrlakova, J.; Vulpescu, B.; Wagner, B.; Wagner, V.; Wallet, L.; Wan, R.; Wang, D.; Wang, Y.; Watanabe, K.; Wen, Q.; Wessels, J.; Westerhoff, U.; Wiechula, J.; Wikne, J.; Wilk, A.; Wilk, G.; Williams, M.C.S.; Willis, N.; Windelband, B.; Xu, C.; Yang, C.; Yang, H.; Yasnopolskiy, S.; Yermia, F.; Yi, J.; Yin, Z.; Yokoyama, H.; Yoo, I-K.; Yuan, X.; Yurevich, V.; Yushmanov, I.; Zabrodin, E.; Zagreev, B.; Zalite, A.; Zampolli, C.; Zanevsky, Yu.; Zaporozhets, S.; Zarochentsev, A.; Zavada, P.; Zbroszczyk, H.; Zelnicek, P.; Zenin, A.; Zepeda, A.; Zgura, I.; Zhalov, M.; Zhang, X.; Zhou, D.; Zhou, S.; Zhu, J.; Zichichi, A.; Zinchenko, A.; Zinovjev, G.; Zoccarato, Y.; Zychacek, V.; Zynovyev, M.


    Charged-particle production was studied in proton-proton collisions collected at the LHC with the ALICE detector at centre-of-mass energies 0.9 TeV and 2.36 TeV in the pseudorapidity range |eta| < 1.4. In the central region (|eta| < 0.5), at 0.9 TeV, we measure charged-particle pseudorapidity density dNch/deta = 3.02 +- 0.01 (stat.) +0.08 -0.05 (syst.) for inelastic interactions, and dNch/deta = 3.58 +- 0.01 (stat.) +0.12 -0.12 (syst.) for non-single-diffractive interactions. At 2.36 TeV, we find dNch/deta = 3.77 +- 0.01 (stat.) +0.25 -0.12 (syst.) for inelastic, and dNch/deta = 4.43 +- 0.01 (stat.) +0.17 -0.12 (syst.) for non-single-diffractive collisions. The relative increase in charged-particle multiplicity from the lower to higher energy is 24.7% +- 0.5% (stat.) +5.7% -2.8% (syst.) for inelastic and 23.7% +- 0.5% (stat.) +4.6% -1.1% (syst.) for non-single-diffractive interactions. This increase is consistent with that reported by the CMS collaboration for non-single-diffractive events and larger th...

  11. H-alpha observations of Sh2-190, Sh2-222, Sh2-229, Sh2-236 HII regions (United States)

    Sahan, Muhittin


    Hα spectral line (6563Å) profiles of four northern HII regions in the our galaxy (Sh2-190, Sh2-222, Sh2-229, Sh2-236) have been obtained using DEFPOS spectrometer, located at coude focus of 150 cm RTT150 telescope at TUBITAK National Observatory (TUG, Antalya, Turkey). Observations were carried out at nights of 2015 December 24-27 with long exposure times ranging from 900s to 3600s. The LSR velocities and the linewidths (Full Width Half Maximum: FWHM) of the Hα emission lines were found to be in the range of -45.46 kms-1 to +3.57 kms-1 and 38.50 kms-1 to 44.10 kms-1, respectively. The Sh2-229 HII region is the faintest one (211.16 R), while the Sh2-236 HII region (IC410) is brightest source (535.75 R). The LSR velocity and the line width (FWHM) results of the DEFPOS/RTT150 system were compared with the data by several authors given in literature and results of DEFPOS data were found to be in good agreement with data given in literature.

  12. Thermodynamic performance of an auto-cascade ejector refrigeration cycle with mixed refrigerant R32 + R236fa

    International Nuclear Information System (INIS)

    Tan, Yingying; Wang, Lin; Liang, Kunfeng


    In this paper, an auto-cascade ejector refrigeration cycle (ACERC) is proposed to obtain lower refrigeration temperature based on conventional ejector refrigeration and auto-cascade refrigeration principle. The thermodynamic performance of ACERC is investigated theoretically. The zeotropic refrigerant mixture R32 + R236fa is used as its working fluid. A parametric analysis is conducted to evaluate the effects of some thermodynamic parameters on the cycle performance. The study shows that refrigerant mixture composition, condenser outlet temperature and evaporation pressure have effects on performance of ACERC. The theoretical results also indicate that the ACERC can achieve the lowest refrigeration temperature at the temperature level of −30 °C. The application of zeotropic refrigerant mixture auto-cascade refrigeration in the ejector refrigeration cycle can provide a new way to obtain lower refrigeration temperature utilizing low-grade thermal energy. - Highlights: • An auto-cascade ejector refrigerator with R32 + R236fa mixed refrigerant is proposed. • The cycle can obtain a refrigeration temperature at −30 °C temperature range. • The effects of some thermodynamic parameters on the cycle performance are evaluated

  13. Analysis of {sup 236}U and plutonium isotopes, {sup 239,240}Pu, on the 1 MV AMS system at the Centro Nacional de Aceleradores, as a potential tool in oceanography

    Energy Technology Data Exchange (ETDEWEB)

    Chamizo, Elena; López-Lora, Mercedes [Centro Nacional de Aceleradores (Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía), Thomas Alva Edison 7, 41092 Seville (Spain); Villa, María [Departamento de Física Aplicada II, Universidad de Sevilla, Av. Reina Mercedes 4A, 41012 Seville (Spain); Servicio de Radioisótopos, Centro de Investigación, Tecnología e Innovación, Universidad de Sevilla, Av. Reina Mercedes 4B, 41012 Seville (Spain); Casacuberta, Núria [Laboratory of Ion Beam Physics, ETH Zürich, Otto-Stern-Weg 5, CH-8093 Zürich (Switzerland); López-Gutiérrez, José María [Centro Nacional de Aceleradores (Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía), Thomas Alva Edison 7, 41092 Seville (Spain); Departamento de Física Aplicada I, Escuela Universitaria Politécnica, Universidad de Sevilla, Virgen de África 7, 41011 Seville (Spain); Pham, Mai Khanh [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco)


    The performance of the 1 MV AMS system at the CNA (Centro Nacional de Aceleradores, Seville, Spain) for {sup 236}U and {sup 239,240}Pu measurements has been extensively investigated. A very promising {sup 236}U/{sup 238}U abundance sensitivity of about 3 × 10{sup −11} has been recently achieved, and background figures for {sup 239}Pu of about 10{sup 6} atoms were reported in the past. These promising results lead to the use of conventional low energy AMS systems for the analysis of {sup 236}U and {sup 239}Pu and its further application in environmental studies. First {sup 236}U results obtained on our AMS system for marine samples (sediments and water) are presented here. Results of two new IAEA reference materials (IAEA-410 and IAEA-412, marine sediments from Pacific Ocean) are reported. The obtained {sup 236}U/{sup 239}Pu atom ratios, of 0.12 and 0.022, respectively, show a dependency with the contamination source (i.e. local fallout from the US tests performed at the Bikini Atoll and general fallout). The results obtained for a third IAEA reference material (IAEA-381, seawater from the Irish Sea), are also presented. In the following, the uranium and plutonium isotopic compositions obtained on a set of 5 intercomparison seawater samples from the Arctic Ocean provided by the ETH Zürich are discussed. By comparing them with the obtained results on the 600 kV AMS facility Tandy at the ETH Zürich, we demonstrate the solidity of the CNA technique for {sup 236}U/{sup 238}U determinations at, at least, 7 × 10{sup −10} level. Finally, these results are discussed in their environmental context.

  14. Atmospheric histories and global emissions of the anthropogenic hydrofluorocarbons HFC-365mfc, HFC-245fa, HFC-227ea, and HFC-236fa (United States)

    Vollmer, Martin K.; Miller, Benjamin R.; Rigby, Matthew; Reimann, Stefan; Mühle, Jens; Krummel, Paul B.; O'Doherty, Simon; Kim, Jooil; Rhee, Tae Siek; Weiss, Ray F.; Fraser, Paul J.; Simmonds, Peter G.; Salameh, Peter K.; Harth, Christina M.; Wang, Ray H. J.; Steele, L. Paul; Young, Dickon; Lunder, Chris R.; Hermansen, Ove; Ivy, Diane; Arnold, Tim; Schmidbauer, Norbert; Kim, Kyung-Ryul; Greally, Brian R.; Hill, Matthias; Leist, Michael; Wenger, Angelina; Prinn, Ronald G.


    We report on ground-based atmospheric measurements and emission estimates of the four anthropogenic hydrofluorocarbons (HFCs) HFC-365mfc (CH3CF2CH2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). In situ measurements are from the global monitoring sites of the Advanced Global Atmospheric Gases Experiment (AGAGE), the System for Observations of Halogenated Greenhouse Gases in Europe (SOGE), and Gosan (South Korea). We include the first halocarbon flask sample measurements from the Antarctic research stations King Sejong and Troll. We also present measurements of archived air samples from both hemispheres back to the 1970s. We use a two-dimensional atmospheric transport model to simulate global atmospheric abundances and to estimate global emissions. HFC-365mfc and HFC-245fa first appeared in the atmosphere only ˜1 decade ago; they have grown rapidly to globally averaged dry air mole fractions of 0.53 ppt (in parts per trillion, 10-12) and 1.1 ppt, respectively, by the end of 2010. In contrast, HFC-227ea first appeared in the global atmosphere in the 1980s and has since grown to ˜0.58 ppt. We report the first measurements of HFC-236fa in the atmosphere. This long-lived compound was present in the atmosphere at only 0.074 ppt in 2010. All four substances exhibit yearly growth rates of >8% yr-1 at the end of 2010. We find rapidly increasing emissions for the foam-blowing compounds HFC-365mfc and HFC-245fa starting in ˜2002. After peaking in 2006 (HFC-365mfc: 3.2 kt yr-1, HFC-245fa: 6.5 kt yr-1), emissions began to decline. Our results for these two compounds suggest that recent estimates from long-term projections (to the late 21st century) have strongly overestimated emissions for the early years of the projections (˜2005-2010). Global HFC-227ea and HFC-236fa emissions have grown to average values of 2.4 kt yr-1

  15. Charged particle multiplicities in pp interactions at sqrt(s) = 0.9, 2.36, and 7 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Khachatryan, V. [Yerevan Physics Institute (Aremenia); et al.,


    Measurements of primary charged hadron multiplicity distributions are presented for non-single-diffractive events in proton-proton collisions at centre-of-mass energies of sqrt(s) = 0.9, 2.36, and 7 TeV, in five pseudorapidity ranges from |eta|<0.5 to |eta|<2.4. The data were collected with the minimum-bias trigger of the CMS experiment during the LHC commissioning runs in 2009 and the 7 TeV run in 2010. The multiplicity distribution at sqrt(s) = 0.9 TeV is in agreement with previous measurements. At higher energies the increase of the mean multiplicity with sqrt(s) is underestimated by most event generators. The average transverse momentum as a function of the multiplicity is also presented. The measurement of higher-order moments of the multiplicity distribution confirms the violation of Koba-Nielsen-Olesen scaling that has been observed at lower energies.

  16. Charged particle multiplicities in pp interactions at \\sqrt{s} = 2.36$ TeV measured with the ATLAS detector at the LHC

    CERN Document Server

    The ATLAS collaboration


    In December 2009 data at the centre-of-mass energy of sqrt(s) = 2.36 TeV were recorded with the ATLAS detector. This was the first time the LHC had been operated at this beam energy and stable beam conditions were not declared. Therefore, to ensure detector safety, the silicon strip detector was in standby mode with reduced sensor bias voltage, which makes track reconstruction more difficult. Two complementary methods were developed to measure the charged particle multiplicity distributions and, in particular, estimate the track reconstruction efficiency under these challenging conditions. The first uses the full Inner Detector information and corrects the efficiency from the simulation using a data-driven technique. The second uses tracks reconstructed from pixel detector information only. The charged particle multiplicity and its dependence on transverse momentum and pseudorapidity are measured for events with at least one charged particle in the kinematic range |eta| 500 MeV. The average charged particle m...

  17. Fission cross section ratios for sup 233,234,236 U relative to sup 235 U from 0. 5 to 400 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J. (Los Alamos National Lab., NM (USA)); Carlson, A.D.; Wasson, O.A. (National Inst. of Standards and Technology, Gaithersburg, MD (USA)); Hill, N.W. (Oak Ridge National Lab., TN (USA))


    Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of {sup 233, 234, 236}U relative to {sup 235}U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for {sup 235}U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for {sup 235}U(n,f). 6 refs., 1 fig.

  18. Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.


    Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233, 234, 236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for 235 U(n,f). 6 refs., 1 fig

  19. Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.


    Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233,234,236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most of the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n, f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n, f) at 14.1 MeV which will allow us to obtain cross section values from the ratio data and our values for 235 U(n, f). (orig.)

  20. Charged particle multiplicities in pp interactions at $\\sqrt{s}$ = 0.9, 2.36, and 7 TeV

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hartl, Christian; Hoch, Michael; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Kiesenhofer, Wolfgang; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; Ceard, Ludivine; Cerny, Karel; De Wolf, Eddi A.; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Maes, Michael; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Hreus, Tomas; Marage, Pierre Edouard; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Costantini, Silvia; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Grégoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Ovyn, Severine; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Alves, Gilvan; De Jesus Damiao, Dilson; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Carvalho, Wagner; Da Costa, Eliza Melo; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Nogima, Helio; Oguri, Vitor; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Ferreira Dias, Marco Andre; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Trayanov, Rumen; Vankov, Ivan; Dyulendarova, Milena; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Marinova, Evelina; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Wang, Jian; Wang, Jian; Wang, Xianyou; Wang, Zheng; Yang, Min; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Li, Wenbo; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Cabrera, Andrés; Gomez Moreno, Bernardo; Ocampo Rios, Alberto Andres; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A.; Rykaczewski, Hans; Assran, Yasser; Mahmoud, Mohammed; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Müntel, Mait; Raidal, Martti; Rebane, Liis; Azzolini, Virginia; Eerola, Paula; Czellar, Sandor; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, François-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, André; Shreyber, Irina; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Beaudette, Florian; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Ochando, Christophe; Paganini, Pascal; Porteboeuf, Sarah; Sabes, David; Salerno, Roberto; Sirois, Yves; Thiebaux, Christophe; Wyslouch, Bolek; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Karim, Mehdi; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Baty, Clement; Beaupere, Nicolas; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Falkiewicz, Anna; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Ata, Metin; Bender, Walter; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Klimkovich, Tatsiana; Klingebiel, Dennis; Kreuzer, Peter; Lanske, Dankfried; Magass, Carsten; Masetti, Gianni; Merschmeyer, Markus; Meyer, Arnd; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flügge, Günter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Rennefeld, Jörg; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Borras, Kerstin; Cakir, Altan; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Eckstein, Doris; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Olzem, Jan; Parenti, Andrea; Raspereza, Alexei; Raval, Amita; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Tomaszewska, Justyna; Volyanskyy, Dmytro; Walsh, Roberval; Wissing, Christoph; Autermann, Christian; Bobrovskyi, Sergei; Draeger, Jula; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Pietsch, Niklas; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schröder, Matthias; Schum, Torben; Schwandt, Joern; Srivastava, Ajay Kumar; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Buege, Volker; Chwalek, Thorsten; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heindl, Stefan Michael; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Renz, Manuel; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Gouskos, Loukas; Mertzimekis, Theodoros; Panagiotou, Apostolos; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Sandhya; Jain, Shilpi; Kumar, Ashok; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Hashemi, Majid; Jafari, Abideh; Khakzad, Mohsen; Mohammadi, Abdollah; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pierro, Giuseppe Antonio; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Trentadue, Raffaello; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Di Matteo, Leonardo; Ghezzi, Alessio; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Buontempo, Salvatore; Carrillo Montoya, Camilo Andres; Cimmino, Anna; De Cosa, Annapaola; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Merola, Mario; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Biasotto, Massimo; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Conti, Enrico; De Mattia, Marco; Dorigo, Tommaso; Fanzago, Federica; Gasparini, Fabrizio; Giubilato, Piero; Gresele, Ambra; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Meneguzzo, Anna Teresa; Nespolo, Massimo; Perrozzi, Luca; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Ventura, Sandro; Zotto, Pierluigi; Zumerle, Gianni; Baesso, Paolo; Berzano, Umberto; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Taroni, Silvia; Valdata, Marisa; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Sarkar, Subir; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Montanino, Damiana; Penzo, Aldo; Heo, Seong Gu; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kim, Ji Eun; Kong, Dae Jung; Park, Hyangkyu; Son, Dohhee; Son, Dong-Chul; Kim, Jaeho; Kim, Jae Yool; Song, Sanghyeon; Choi, Suyong; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Ji Hyun; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Seo, Eunsung; Shin, Seungsu; Sim, Kwang Souk; Choi, Minkyoo; Kang, Seokon; Kim, Hyunyong; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Bilinskas, Mykolas Jurgis; Grigelionis, Ignas; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; De La Cruz Burelo, Eduard; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A.; Allfrey, Philip; Krofcheck, David; Tam, Jason; Butler, Philip H.; Doesburg, Robert; Silverwood, Hamish; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Sá Martins, Pedro; Musella, Pasquale; Nayak, Aruna; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Varela, Joao; Wöhri, Hermine Katharina; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger Jr., Michael; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Bondar, Nikolai; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Lychkovskaya, Natalia; Safronov, Grigory; Semenov, Sergey; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Korablev, Andrey; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; Codispoti, Giuseppe; de Trocóniz, Jorge F; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Vizan Garcia, Jesus Manuel; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chamizo Llatas, Maria; Chuang, Shan-Huei; Duarte Campderros, Jordi; Felcini, Marta; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Lobelle Pardo, Patricia; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz Jimeno, Alberto; Scodellaro, Luca; Sobron Sanudo, Mar; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Baillon, Paul; Ball, Austin; Barney, David; Bell, Alan James; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bocci, Andrea; Bolognesi, Sara; Breuker, Horst; Brona, Grzegorz; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Curé, Benoît; D'Enterria, David; Dahms, Torsten; De Roeck, Albert; Duarte Ramos, Fernando; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gennai, Simone; Georgiou, Georgios; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gomez-Reino Garrido, Robert; Gouzevitch, Maxime; Govoni, Pietro; Gowdy, Stephen; Guiducci, Luigi; Hansen, Magnus; Harvey, John; Hegeman, Jeroen; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Innocente, Vincenzo; Janot, Patrick; Karavakis, Edward; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Nesvold, Erik; Nguyen, Matthew; Orimoto, Toyoko; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Polese, Giovanni; Racz, Attila; Rolandi, Gigi; Rommerskirchen, Tanja; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stöckli, Fabian; Stoye, Markus; Tropea, Paola; Tsirou, Andromachi; Tsyganov, Andrey; Veres, Gabor Istvan; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Bortignon, Pierluigi; Caminada, Lea; Chen, Zhiling; Cittolin, Sergio; Dissertori, Günther; Dittmar, Michael; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hervé, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Martinez Ruiz del Arbol, Pablo; Meridiani, Paolo; Milenovic, Predrag; Moortgat, Filip; Nef, Pascal; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann - Karin; Sawley, Marie-Christine; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Aguiló, Ernest; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Favaro, Carlotta; Ivova Rikova, Mirena; Millan Mejias, Barbara; Regenfus, Christian; Robmann, Peter; Schmidt, Alexander; Snoek, Hella; Wilke, Lotte; Chang, Yuan-Hann; Chen, Kuan-Hsin; Chen, Wan-Ting; Dutta, Suchandra; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Liu, Zong-kai; Lu, Yun-Ju; Wu, Jing-Han; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wang, Minzu; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gökbulut, Gül; Güler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Kayis Topaksu, Aysel; Nart, Alisah; Önengüt, Gülsen; Ozdemir, Kadri; Ozturk, Sertac; Polatöz, Ayse; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yildirim, Eda; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gülmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Özbek, Melih; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Clement, Emyr; Cussans, David; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Hansen, Maria; Hartley, Dominic; Heath, Greg P.; Heath, Helen F.; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Poll, Anthony; Senkin, Sergey; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Belyaev, Alexander; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Davies, Gavin; Della Negra, Michel; Fulcher, Jonathan; Futyan, David; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Martin, William; Reid, Ivan; Teodorescu, Liliana; Hatakeyama, Kenichi; Bose, Tulika; Carrera Jarrin, Edgar; Clough, Andrew; Fantasia, Cory; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; Sulak, Lawrence; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Ferapontov, Alexey; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Segala, Michael; Speer, Thomas; Tsang, Ka Vang; Borgia, Maria Assunta; Breedon, Richard; Calderon De La Barca Sanchez, Manuel; Cebra, Daniel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Schwarz, Thomas; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Deisher, Amanda; Duris, Joseph; Erhan, Samim; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Babb, John; Clare, Robert; Ellison, John Anthony; Gary, J William; Giordano, Ferdinando; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Pasztor, Gabriella; Satpathy, Asish; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tu, Yanjun; Vartak, Adish; Würthwein, Frank; Yagil, Avraham; Barge, Derek; Bellan, Riccardo; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Geffert, Paul; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lowette, Steven; Mccoll, Nickolas; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Gataullin, Marat; Kcira, Dorian; Litvine, Vladimir; Ma, Yousi; Mott, Alexander; Newman, Harvey B.; Rogan, Christopher; Timciuc, Vladlen; Traczyk, Piotr; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Jun, Soon Yung; Liu, Yueh-Feng; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Edelmaier, Christopher; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Fields, Laura Johanna; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Kuznetsov, Valentin; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Puigh, Darren; Riley, Daniel; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Vaughan, Jennifer; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Green, Dan; Gunthoti, Kranti; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; Hirschauer, James; Hooberman, Benjamin; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Khatiwada, Rakshya; Kilminster, Benjamin; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Pordes, Ruth; Prokofyev, Oleg; Saoulidou, Niki; Sexton-Kennedy, Elizabeth; Sharma, Seema; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Goldberg, Sean; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Muniz, Lana; Pakhotin, Yuriy; Prescott, Craig; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Sellers, Paul; Skhirtladze, Nikoloz; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bandurin, Dmitry; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Veeraraghavan, Venkatesh; Baarmand, Marc M.; Dorney, Brian; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bai, Yuting; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Lacroix, Florent; O'Brien, Christine; Silvestre, Catherine; Smoron, Agata; Strom, Derek; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Noonan, Daniel; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Makouski, Mikhail; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Lu, Ying; Mignerey, Alice; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; Dutta, Valentina; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Xie, Si; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Godshalk, Andrew; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Chasco, Matthew; Kaadze, Ketino; Reucroft, Steve; Swain, John; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Odell, Nathaniel; Ofierzynski, Radoslaw Adrian; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Hill, Christopher; Killewald, Phillip; Kotov, Khristian; Ling, Ta-Yung; Rodenburg, Marissa; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hebda, Philip; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatserklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, Karolos; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Boulahouache, Chaouki; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Flacher, Henning; Garcia-Bellido, Aran; Goldenzweig, Pablo; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Barker, Anthony; Duggan, Daniel; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hits, Dmitry; Lath, Amitabh; Panwalkar, Shruti; Patel, Rishi; Richards, Alan; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Tatarinov, Aysen; Toback, David; Weinberger, Michael; Akchurin, Nural; Bardak, Cemile; Damgov, Jordan; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Mane, Poonam; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Appelt, Eric; Brownson, Eric; Engh, Daniel; Florez, Carlos; Gabella, William; Johns, Willard; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sheldon, Paul; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Boutle, Sarah; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Francis, Brian; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Milstène, Caroline; Sakharov, Alexandre; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Efron, Jonathan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Parker, William; Reeder, Don; Ross, Ian; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc


    Measurements of primary charged hadron multiplicity distributions are presented for non-single-diffractive events in proton-proton collisions at centre-of-mass energies of sqrt(s) = 0.9, 2.36, and 7 TeV, in five pseudorapidity ranges from |eta|<0.5 to |eta|<2.4. The data were collected with the minimum-bias trigger of the CMS experiment during the LHC commissioning runs in 2009 and the 7 TeV run in 2010. The multiplicity distribution at sqrt(s) = 0.9 TeV is in agreement with previous measurements. At higher energies the increase of the mean multiplicity with sqrt(s) is underestimated by most event generators. The average transverse momentum as a function of the multiplicity is also presented. The measurement of higher-order moments of the multiplicity distribution confirms the violation of Koba-Nielsen-Olesen scaling that has been observed at lower energies.

  1. The use of 59Ni, 99Tc, and 236U to monitor the release of radionuclides from objects containing spent nuclear fuel dumped in the Kara Sea

    International Nuclear Information System (INIS)

    Mount, M.E.; Layton, D.W.; Hamilton, T.F.; Lynn, M.


    Between 1965 and 1981, five objects and six naval reactor pressure vessels (RPVs) from four former Soviet Union submarines and a special container from the icebreaker Lenin, all containing damaged spent nuclear fuel (SNF) were dumped in a variety of containments, at four sites in the Kara Sea. The International Atomic Energy Agency initiated the International Arctic Seas Assessment Project (IASAP) to study the possible health and environmental effects from disposal of these objects. One outcome of the IASAP was an estimation of the radionuclide inventory and their release rates from these objects. A follow-on concern is the ability to detect the radionuclides released into the water column. The work reported here is the feasibility of using the long-lived radionuclides 59 Ni, 99 Tc, and 236 U encased within these objects, to monitor the breakdown of the containments due to corrosion

  2. Position paper, need for additional waste storage capacity and recommended path forward for project W-236a, Multi-function Waste Tank Facility

    International Nuclear Information System (INIS)

    Awadalla, N.G.


    Project W-236a, Multi-function waste Tank Facility (MWTF), was initiated to increase the safe waste storage capacity for the Tank Waste Remediation System (TWRS) by building two new one million gallon underground storage tanks in the 200 West Area and four tanks in the 200 East Area. Construction of the tanks was scheduled to begin in September 1994 with operations beginning in calendar year (CY) 1998. However, recent reviews have raised several issues regarding the mission, scope, and schedule of the MWTF. The decision to build new tanks must consider several elements, such as: Operational risk and needs -- Operational risk and flexibility must be managed such that any identified risk is reduced as soon as practicable; The amount of waste that will be generated in the future -- Additional needed tank capacity must be made available to support operations and maintain currently planned safety improvement activities; Safety issues -- The retrieval of waste from single-shell tanks (SSTs) and watch list tanks will add to the total amount of waste that must be stored in a double-shell tank (DST); Availability of existing DSTs -- The integrity of the 28 existing DSTs must be continuously managed; and Affect on other projects and programs -- Because MWTF systems have been integrated with other projects, a decision on one project will affect another. In addition the W-236a schedule is logically tied to support retrieval and safety program plans. Based on the above, two new tanks are needed for safe waste storage in the 200 West Area, and they need to be built as soon as practicable. Design should continue for the tanks in the 200 East Area with a decision made by September, on whether to construct them. Construction of the cross-site transfer line should proceed as scheduled. To implement this recommendation several actions need to be implemented

  3. Fission coincident neutrons from the reactions p + sup(235,236,238)U with protons between 12,7 and 25.5 MeV

    International Nuclear Information System (INIS)

    Plischke, P.


    With the proton beam of the Hamburg isochronous cyclotron (HAIZY) thin uranium targets with the mass numbers 235, 236, and 238 were bombarded. Both fragments from the fission of the Np reaction systems and the neutrons coincident with the fragments were detected in the plane perpendicular to the beam direction. Measured and stored event by event were for all particles the times of flight. The detection of the neutron succeeded in conventional time-of-flight technique with NE213 liquid scintillators. A fission detector system with plastic scintillator foils was developed. It permits high event rates over long measuring times and allows the choice of so long neutron flight paths that a neutron energy resolution between 2% and 4% could be reached. The determination of the fragment masses is in spite of the short flight paths of 15 respectively 21 cm possible to +-2 amu. The isotropic component das discussed under the assumption that it is composed of prefission and scission neutrons which were emitted befor fission respectively during the fragmentation. From the post fission results the distribution of the excitation energy to both fragments was determined in dependence of Esup(*) and the fragment mass. (orig./HSI) [de

  4. Charged particle multiplicities at {radical}(s)=0.9, 2.36 and 7.0 TeV with the CMS detector at LHC

    Energy Technology Data Exchange (ETDEWEB)

    Rougny, Romain [Universiteit Antwerpen, Gratiekapelstraat 10, BE-2000 Antwerpen (Belgium); De Wolf, E.A.; Janssen, X.; Mucibello, L.; Van Remortel, N.; Lee, Y.J.; Busza, Wit


    The charged particle multiplicity, n, is an essential observable in hadron collisions. It is the result of the counting of all charged particles produced by the primary proton-proton interaction. In particular, the events collected by minimum bias triggers contain soft interactions and produce mostly particles with low transverse momenta. The shape of the charged particle multiplicity spectrum is sensitive to the particle production mechanism of these soft interactions which are described by non-perturbative models, inspired by QCD. The correlations between produced hadrons are reflected in the shape of the multiplicity spectrum, while the mean multiplicity increases with the center of mass energy of the collision. We present the measurement of the charged particle multiplicity distributions, 1/s d{sigma}/dn, in increasing sub-domains of pseudorapidity and transverse momentum acceptance, for non single diffractive interactions. The data are further corrected for the trigger and event selection efficiency and the effects of tracking inefficiency and secondary tracks originating from the decay of long lived particles and products of interaction with the beam pipe and the detector material. This measurement is based on minimum bias data collected by the CMS detector at {radical}(s) = 0.9, 2.36 and 7 TeV. The data were collected during the LHC commissioning run in 2009 and at the beginning of 2010. (authors)

  5. Clinico-pathological correlation of digital rectal examination findings amongst Nigerian men with prostatic diseases: A prospective study of 236 cases

    Directory of Open Access Journals (Sweden)

    Rufus W Ojewola


    Full Text Available Aims and Objective: This study aims at correlating different digital rectal examination (DRE abnormalities with histopathological results in patients with prostatic diseases. Materials and Methods: A prospective study of 236 patients who underwent prostate needle biopsy (PNB. Inclusion criteria were presence of abnormal DRE findings or elevated prostate specific antigen above 4 ng/ml or both. They all had 10-core extended transrectal biopsy and specimens were sent for histopathological examination. Correlations were made between DRE findings and histopathology results. Two separate multivariate logistic regression models were created; the first evaluated the relationship of predictors (DRE findings to the likelihood of detecting cancer and the second explored predictors of high-grade cancer on PNB. Results: Two hundred and thirty-six patients were enrolled with a mean age of 66.9 years and range of 43-90 years. Histopathology results were malignant in 102 (43.2% and benign in 134 (56.8%. Ninety-one (38.6% and 145 (61.4% had normal DRE and abnormal DRE findings with cancer detection rates of 23.1% and 55.8% respectively. Nodular prostate is the most common abnormality in 63.4% patients with abnormal DRE. Each sign of DRE had different predictive value with enhanced positive predictive value when combinations of abnormalities are present. Abnormal DRE is an independent predictor of high-grade tumor. Mean Gleason scores were 4.7 and 7.1 in patients with normal and abnormal DRE respectively. Conclusion: DRE is a useful and important tool in assessing patients with suspected prostate diseases who need prostate biopsy. An abnormal DRE correlated well with prostate cancer and independently predicted high-grade disease in these men.

  6. Peptide profiling of bovine kefir reveals 236 unique peptides released from caseins during its production by starter culture or kefir grains. (United States)

    Ebner, Jennifer; Aşçı Arslan, Ayşe; Fedorova, Maria; Hoffmann, Ralf; Küçükçetin, Ahmet; Pischetsrieder, Monika


    Kefir has a long tradition in human nutrition due to its presupposed health promoting effects. To investigate the potential contribution of bioactive peptides to the physiological effects of kefir, comprehensive analysis of the peptide profile was performed by nano-ESI-LTQ-Orbitrap MS coupled to nano-ultrahigh-performance liquid chromatography. Thus, 257 peptides were identified, mainly released from β-casein, followed by αS1-, κ-, and αS2-casein. Most (236) peptides were uniquely detected in kefir, but not in raw milk indicating that the fermentation step does not only increase the proteolytic activity 1.7- to 2.4-fold compared to unfermented milk, but also alters the composition of the peptide fraction. The influence of the microflora was determined by analyzing kefir produced from traditional kefir grains or commercial starter culture. Kefir from starter culture featured 230 peptide sequences and showed a significantly, 1.4-fold higher proteolytic activity than kefir from kefir grains with 127 peptides. A match of 97 peptides in both varieties indicates the presence of a typical kefir peptide profile that is not influenced by the individual composition of the microflora. Sixteen of the newly identified peptides were previously described as bioactive, including angiotensin-converting enzyme (ACE)-inhibitory, antimicrobial, immunomodulating, opioid, mineral binding, antioxidant, and antithrombotic effects. The present study describes a comprehensive peptide profile of kefir comprising 257 sequences. The peptide list was used to identify 16 bioactive peptides with ACE-inhibitory, antioxidant, antithrombotic, mineral binding, antimicrobial, immunomodulating and opioid activity in kefir. Furthermore, it was shown that a majority of the kefir peptides were not endogenously present in the raw material milk, but were released from milk caseins by proteases of the microbiota and are therefore specific for the product. Consequently, the proteolytic activity and the

  7. First measurement of Bose-Einstein correlations in proton-proton collisions at √s=0.9 and 2.36 TeV at the LHC. (United States)

    Khachatryan, V; Sirunyan, A M; Tumasyan, A; Adam, W; Bergauer, T; Dragicevic, M; Erö, J; Fabjan, C; Friedl, M; Frühwirth, R; Ghete, V M; Hammer, J; Hänsel, S; Hoch, M; Hörmann, N; Hrubec, J; Jeitler, M; Kasieczka, G; Kiesenhofer, W; Krammer, M; Liko, D; Mikulec, I; Pernicka, M; Rohringer, H; Schöfbeck, R; Strauss, J; Taurok, A; Teischinger, F; Waltenberger, W; Walzel, G; Widl, E; Wulz, C-E; Mossolov, V; Shumeiko, N; Suarez Gonzalez, J; Benucci, L; Ceard, L; De Wolf, E A; Hashemi, M; Janssen, X; Maes, T; Mucibello, L; Ochesanu, S; Roland, B; Rougny, R; Selvaggi, M; Van Haevermaet, H; Van Mechelen, P; Van Remortel, N; Adler, V; Beauceron, S; Blyweert, S; D'Hondt, J; Devroede, O; Kalogeropoulos, A; Maes, J; Maes, M; Tavernier, S; Van Doninck, W; Van Mulders, P; Villella, I; Chabert, E C; Charaf, O; Clerbaux, B; De Lentdecker, G; Dero, V; Gay, A P R; Hammad, G H; Marage, P E; Vander Velde, C; Vanlaer, P; Wickens, J; Costantini, S; Grunewald, M; Klein, B; Marinov, A; Ryckbosch, D; Thyssen, F; Tytgat, M; Vanelderen, L; Verwilligen, P; Walsh, S; Zaganidis, N; Basegmez, S; Bruno, G; Caudron, J; De Favereau De Jeneret, J; Delaere, C; Demin, P; Favart, D; Giammanco, A; Grégoire, G; Hollar, J; Lemaitre, V; Militaru, O; Ovyn, S; Pagano, D; Pin, A; Piotrzkowski, K; Quertenmont, L; Schul, N; Beliy, N; Caebergs, T; Daubie, E; Alves, G A; Pol, M E; Souza, M H G; Carvalho, W; Da Costa, E M; De Jesus Damiao, D; De Oliveira Martins, C; Fonseca De Souza, S; Mundim, L; Oguri, V; Santoro, A; Silva Do Amaral, S M; Sznajder, A; Torres Da Silva De Araujo, F; Dias, F A; Dias, M A F; Fernandez Perez Tomei, T R; Gregores, E M; Marinho, F; Novaes, S F; Padula, Sandra S; Darmenov, N; Dimitrov, L; Genchev, V; Iaydjiev, P; Piperov, S; Stoykova, S; Sultanov, G; Trayanov, R; Vankov, I; Dyulendarova, M; Hadjiiska, R; Kozhuharov, V; Litov, L; Marinova, E; Mateev, M; Pavlov, B; Petkov, P; Bian, J G; Chen, G M; Chen, H S; Jiang, C H; Liang, D; Liang, S; Wang, J; Wang, J; Wang, X; Wang, Z; Yang, M; Zang, J; Zhang, Z; Ban, Y; Guo, S; Hu, Z; Mao, Y; Qian, S J; Teng, H; Zhu, B; Cabrera, A; Carrillo Montoya, C A; Gomez Moreno, B; Ocampo Rios, A A; Osorio Oliveros, A F; Sanabria, J C; Godinovic, N; Lelas, D; Lelas, K; Plestina, R; Polic, D; Puljak, I; Antunovic, Z; Dzelalija, M; Brigljevic, V; Duric, S; Kadija, K; Morovic, S; Attikis, A; Fereos, R; Galanti, M; Mousa, J; Nicolaou, C; Papadakis, A; Ptochos, F; Razis, P A; Rykaczewski, H; Tsiakkouri, D; Zinonos, Z; Mahmoud, M; Hektor, A; Kadastik, M; Kannike, K; Müntel, M; Raidal, M; Rebane, L; Azzolini, V; Eerola, P; Czellar, S; Härkönen, J; Heikkinen, A; Karimäki, V; Kinnunen, R; Klem, J; Kortelainen, M J; Lampén, T; Lassila-Perini, K; Lehti, S; Lindén, T; Luukka, P; Mäenpää, T; Tuominen, E; Tuominiemi, J; Tuovinen, E; Ungaro, D; Wendland, L; Banzuzi, K; Korpela, A; Tuuva, T; Sillou, D; Besancon, M; Dejardin, M; Denegri, D; Descamps, J; Fabbro, B; Faure, J L; Ferri, F; Ganjour, S; Gentit, F X; Givernaud, A; Gras, P; Hamel de Monchenault, G; Jarry, P; Locci, E; Malcles, J; Marionneau, M; Millischer, L; Rander, J; Rosowsky, A; Rousseau, D; Titov, M; Verrecchia, P; Baffioni, S; Bianchini, L; Bluj, M; Broutin, C; Busson, P; Charlot, C; Dobrzynski, L; Elgammal, S; Granier de Cassagnac, R; Haguenauer, M; Kalinowski, A; Miné, P; Paganini, P; Sabes, D; Sirois, Y; Thiebaux, C; Zabi, A; Agram, J-L; Besson, A; Bloch, D; Bodin, D; Brom, J-M; Cardaci, M; Conte, E; Drouhin, F; Ferro, C; Fontaine, J-C; Gelé, D; Goerlach, U; Greder, S; Juillot, P; Karim, M; Le Bihan, A-C; Mikami, Y; Speck, J; Van Hove, P; Fassi, F; Mercier, D; Baty, C; Beaupere, N; Bedjidian, M; Bondu, O; Boudoul, G; Boumediene, D; Brun, H; Chanon, N; Chierici, R; Contardo, D; Depasse, P; El Mamouni, H; Fay, J; Gascon, S; Ille, B; Kurca, T; Le Grand, T; Lethuillier, M; Mirabito, L; Perries, S; Sordini, V; Tosi, S; Tschudi, Y; Verdier, P; Xiao, H; Roinishvili, V; Anagnostou, G; Edelhoff, M; Feld, L; Heracleous, N; Hindrichs, O; Jussen, R; Klein, K; Merz, J; Mohr, N; Ostapchuk, A; Perieanu, A; Raupach, F; Sammet, J; Schael, S; Sprenger, D; Weber, H; Weber, M; Wittmer, B; Actis, O; Ata, M; Bender, W; Biallass, P; Erdmann, M; Frangenheim, J; Hebbeker, T; Hinzmann, A; Hoepfner, K; Hof, C; Kirsch, M; Klimkovich, T; Kreuzer, P; Lanske, D; Magass, C; Merschmeyer, M; Meyer, A; Papacz, P; Pieta, H; Reithler, H; Schmitz, S A; Sonnenschein, L; Sowa, M; Steggemann, J; Teyssier, D; Zeidler, C; Bontenackels, M; Davids, M; Duda, M; Flügge, G; Geenen, H; Giffels, M; Haj Ahmad, W; Heydhausen, D; Kress, T; Kuessel, Y; Linn, A; Nowack, A; Perchalla, L; Pooth, O; Sauerland, P; Stahl, A; Thomas, M; Tornier, D; Zoeller, M H; Aldaya Martin, M; Behrenhoff, W; Behrens, U; Bergholz, M; Borras, K; Campbell, A; Castro, E; Dammann, D; Eckerlin, G; Flossdorf, A; Flucke, G; Geiser, A; Hauk, J; Jung, H; Kasemann, M; Katkov, I; Kleinwort, C; Kluge, H; Knutsson, A; Kuznetsova, E; Lange, W; Lohmann, W; Mankel, R; Marienfeld, M; Melzer-Pellmann, I-A; Meyer, A B; Mnich, J; Mussgiller, A; Olzem, J; Parenti, A; Raspereza, A; Schmidt, R; Schoerner-Sadenius, T; Sen, N; Stein, M; Tomaszewska, J; Volyanskyy, D; Wissing, C; Autermann, C; Draeger, J; Eckstein, D; Enderle, H; Gebbert, U; Kaschube, K; Kaussen, G; Klanner, R; Mura, B; Naumann-Emme, S; Nowak, F; Sander, C; Schettler, H; Schleper, P; Schröder, M; Schum, T; Schwandt, J; Stadie, H; Steinbrück, G; Thomsen, J; Wolf, R; Bauer, J; Buege, V; Cakir, A; Chwalek, T; Daeuwel, D; De Boer, W; Dierlamm, A; Dirkes, G; Feindt, M; Gruschke, J; Hackstein, C; Hartmann, F; Heinrich, M; Held, H; Hoffmann, K H; Honc, S; Kuhr, T; Martschei, D; Mueller, S; Müller, Th; Niegel, M; Oberst, O; Oehler, A; Ott, J; Peiffer, T; Piparo, D; Quast, G; Rabbertz, K; Ratnikov, F; Renz, M; Sabellek, A; Saout, C; Scheurer, A; Schieferdecker, P; Schilling, F-P; Schott, G; Simonis, H J; Stober, F M; Troendle, D; Wagner-Kuhr, J; Zeise, M; Zhukov, V; Ziebarth, E B; Daskalakis, G; Geralis, T; Kyriakis, A; Loukas, D; Manolakos, I; Markou, A; Markou, C; Mavrommatis, C; Petrakou, E; Gouskos, L; Katsas, P; Panagiotou, A; Evangelou, I; Kokkas, P; Manthos, N; Papadopoulos, I; Patras, V; Triantis, F A; Aranyi, A; Bencze, G; Boldizsar, L; Debreczeni, G; Hajdu, C; Horvath, D; Kapusi, A; Krajczar, K; Laszlo, A; Sikler, F; Vesztergombi, G; Beni, N; Molnar, J; Palinkas, J; Szillasi, Z; Veszpremi, V; Raics, P; Trocsanyi, Z L; Ujvari, B; Bansal, S; Beri, S B; Bhatnagar, V; Jindal, M; Kaur, M; Kohli, J M; Mehta, M Z; Nishu, N; Saini, L K; Sharma, A; Sharma, R; Singh, A P; Singh, J B; Singh, S P; Ahuja, S; Bhattacharya, S; Chauhan, S; Choudhary, B C; Gupta, P; Jain, S; Jain, S; Kumar, A; Ranjan, K; Shivpuri, R K; Choudhury, R K; Dutta, D; Kailas, S; Kataria, S K; Mohanty, A K; Pant, L M; Shukla, P; Suggisetti, P; Aziz, T; Guchait, M; Gurtu, A; Maity, M; Majumder, D; Majumder, G; Mazumdar, K; Mohanty, G B; Saha, A; Sudhakar, K; Wickramage, N; Banerjee, S; Dugad, S; Mondal, N K; Arfaei, H; Bakhshiansohi, H; Fahim, A; Jafari, A; Mohammadi Najafabadi, M; Paktinat Mehdiabadi, S; Safarzadeh, B; Zeinali, M; Abbrescia, M; Barbone, L; Colaleo, A; Creanza, D; De Filippis, N; De Palma, M; Dimitrov, A; Fedele, F; Fiore, L; Iaselli, G; Lusito, L; Maggi, G; Maggi, M; Manna, N; Marangelli, B; My, S; Nuzzo, S; Pierro, G A; Pompili, A; Pugliese, G; Romano, F; Roselli, G; Selvaggi, G; Silvestris, L; Trentadue, R; Tupputi, S; Zito, G; Abbiendi, G; Benvenuti, A C; Bonacorsi, D; Braibant-Giacomelli, S; Capiluppi, P; Castro, A; Cavallo, F R; Codispoti, G; Cuffiani, M; Fanfani, A; Fasanella, D; Giacomelli, P; Giunta, M; Grandi, C; Marcellini, S; Masetti, G; Montanari, A; Navarria, F L; Odorici, F; Perrotta, A; Rossi, A M; Rovelli, T; Siroli, G; Travaglini, R; Albergo, S; Cappello, G; Chiorboli, M; Costa, S; Tricomi, A; Tuve, C; Barbagli, G; Broccolo, G; Ciulli, V; Civinini, C; D'Alessandro, R; Focardi, E; Frosali, S; Gallo, E; Genta, C; Lenzi, P; Meschini, M; Paoletti, S; Sguazzoni, G; Tropiano, A; Benussi, L; Bianco, S; Colafranceschi, S; Fabbri, F; Piccolo, D; Fabbricatore, P; Musenich, R; Benaglia, A; Cerati, G B; De Guio, F; Di Matteo, L; Ghezzi, A; Govoni, P; Malberti, M; Malvezzi, S; Martelli, A; Massironi, A; Menasce, D; Miccio, V; Moroni, L; Negri, P; Paganoni, M; Pedrini, D; Ragazzi, S; Redaelli, N; Sala, S; Salerno, R; Tabarelli de Fatis, T; Tancini, V; Taroni, S; Buontempo, S; Cimmino, A; De Cosa, A; De Gruttola, M; Fabozzi, F; Iorio, A O M; Lista, L; Noli, P; Paolucci, P; Azzi, P; Bacchetta, N; Bellan, P; Bisello, D; Carlin, R; Checchia, P; Conti, E; De Mattia, M; Dorigo, T; Dosselli, U; Gasparini, F; Gasparini, U; Giubilato, P; Gresele, A; Lacaprara, S; Lazzizzera, I; Margoni, M; Mazzucato, M; Meneguzzo, A T; Nespolo, M; Perrozzi, L; Pozzobon, N; Ronchese, P; Simonetto, F; Torassa, E; Tosi, M; Vanini, S; Zotto, P; Zumerle, G; Baesso, P; Berzano, U; Riccardi, C; Torre, P; Vitulo, P; Viviani, C; Biasini, M; Bilei, G M; Caponeri, B; Fanò, L; Lariccia, P; Lucaroni, A; Mantovani, G; Menichelli, M; Nappi, A; Santocchia, A; Servoli, L; Valdata, M; Volpe, R; Azzurri, P; Bagliesi, G; Bernardini, J; Boccali, T; Castaldi, R; Dagnolo, R T; Dell'orso, R; Fiori, F; Foà, L; Giassi, A; Kraan, A; Ligabue, F; Lomtadze, T; Martini, L; Messineo, A; Palla, F; Palmonari, F; Segneri, G; Serban, A T; Spagnolo, P; Tenchini, R; Tonelli, G; Venturi, A; Verdini, P G; Barone, L; Cavallari, F; Del Re, D; Di Marco, E; Diemoz, M; Franci, D; Grassi, M; Longo, E; Organtini, G; Palma, A; Pandolfi, F; Paramatti, R; Rahatlou, S; Amapane, N; Arcidiacono, R; Argiro, S; Arneodo, M; Biino, C; Botta, C; Cartiglia, N; Castello, R; Costa, M; Demaria, N; Graziano, A; Mariotti, C; Marone, M; Maselli, S; Migliore, E; Mila, G; Monaco, V; Musich, M; Obertino, M M; Pastrone, N; Pelliccioni, M; Romero, A; Ruspa, M; Sacchi, R; Solano, A; Staiano, A; Trocino, D; Vilela Pereira, A; Ambroglini, F; Belforte, S; Cossutti, F; Della Ricca, G; Gobbo, B; Montanino, D; Penzo, A; Chang, S; Chung, J; Kim, D H; Kim, G N; Kim, J E; Kong, D J; Park, H; Son, D C; Kim, Zero; Kim, J Y; Song, S; Hong, B; Kim, H; Kim, J H; Kim, T J; Lee, K S; Moon, D H; Park, S K; Rhee, H B; Sim, K S; Choi, M; Kang, S; Kim, H; Park, C; Park, I C; Park, S; Choi, S; Choi, Y; Choi, Y K; Goh, J; Lee, J; Lee, S; Seo, H; Yu, I; Janulis, M; Martisiute, D; Petrov, P; Sabonis, T; Castilla Valdez, H; De La Cruz Burelo, E; Lopez-Fernandez, R; Sánchez Hernández, A; Villaseñor-Cendejas, L M; Carrillo Moreno, S; Salazar Ibarguen, H A; Casimiro Linares, E; Morelos Pineda, A; Reyes-Santos, M A; Allfrey, P; Krofcheck, D; Tam, J; Butler, P H; Signal, T; Williams, J C; Ahmad, M; Ahmed, I; Asghar, M I; Hoorani, H R; Khan, W A; Khurshid, T; Qazi, S; Cwiok, M; Dominik, W; Doroba, K; Konecki, M; Krolikowski, J; Frueboes, T; Gokieli, R; Górski, M; Kazana, M; Nawrocki, K; Szleper, M; Wrochna, G; Zalewski, P; Almeida, N; David, A; Faccioli, P; Ferreira Parracho, P G; Gallinaro, M; Mini, G; Musella, P; Nayak, A; Raposo, L; Ribeiro, P Q; Seixas, J; Silva, P; Soares, D; Varela, J; Wöhri, H K; Altsybeev, I; Belotelov, I; Bunin, P; Finger, M; Finger, M; Golutvin, I; Kamenev, A; Karjavin, V; Kozlov, G; Lanev, A; Moisenz, P; Palichik, V; Perelygin, V; Shmatov, S; Smirnov, V; Volodko, A; Zarubin, A; Bondar, N; Golovtsov, V; Ivanov, Y; Kim, V; Levchenko, P; Smirnov, I; Sulimov, V; Uvarov, L; Vavilov, S; Vorobyev, A; Andreev, Yu; Gninenko, S; Golubev, N; Kirsanov, M; Krasnikov, N; Matveev, V; Pashenkov, A; Toropin, A; Troitsky, S; Epshteyn, V; Gavrilov, V; Ilina, N; Kaftanov, V; Kossov, M; Krokhotin, A; Kuleshov, S; Oulianov, A; Safronov, G; Semenov, S; Shreyber, I; Stolin, V; Vlasov, E; Zhokin, A; Boos, E; Dubinin, M; Dudko, L; Ershov, A; Gribushin, A; Kodolova, O; Lokhtin, I; Obraztsov, S; Petrushanko, S; Sarycheva, L; Savrin, V; Snigirev, A; Andreev, V; Dremin, I; Kirakosyan, M; Rusakov, S V; Vinogradov, A; Azhgirey, I; Bitioukov, S; Datsko, K; Grishin, V; Kachanov, V; Konstantinov, D; Krychkine, V; Petrov, V; Ryutin, R; Slabospitsky, S; Sobol, A; Sytine, A; Tourtchanovitch, L; Troshin, S; Tyurin, N; Uzunian, A; Volkov, A; Adzic, P; Djordjevic, M; Krpic, D; Maletic, D; Milosevic, J; Puzovic, J; Aguilar-Benitez, M; Alcaraz Maestre, J; Arce, P; Battilana, C; Calvo, E; Cepeda, M; Cerrada, M; Chamizo Llatas, M; Colino, N; De La Cruz, B; Diez Pardos, C; Fernandez Bedoya, C; Fernández Ramos, J P; Ferrando, A; Flix, J; Fouz, M C; Garcia-Abia, P; Gonzalez Lopez, O; Goy Lopez, S; Hernandez, J M; Josa, M I; Merino, G; Puerta Pelayo, J; Redondo, I; Romero, L; Santaolalla, J; Willmott, C; Albajar, C; de Trocóniz, J F; Cuevas, J; Fernandez Menendez, J; Gonzalez Caballero, I; Lloret Iglesias, L; Vizan Garcia, J M; Cabrillo, I J; Calderon, A; Chuang, S H; Diaz Merino, I; Diez Gonzalez, C; Duarte Campderros, J; Fernandez, M; Gomez, G; Gonzalez Sanchez, J; Gonzalez Suarez, R; Jorda, C; Lobelle Pardo, P; Lopez Virto, A; Marco, J; Marco, R; Martinez Rivero, C; Martinez Ruiz Del Arbol, P; Matorras, F; Rodrigo, T; Ruiz Jimeno, A; Scodellaro, L; Sobron Sanudo, M; Vila, I; Vilar Cortabitarte, R; Abbaneo, D; Auffray, E; Baillon, P; Ball, A H; Barney, D; Beaudette, F; Bellan, R; Benedetti, D; Bernet, C; Bialas, W; Bloch, P; Bocci, A; Bolognesi, S; Breuker, H; Brona, G; Bunkowski, K; Camporesi, T; Cano, E; Cattai, A; Cerminara, G; Christiansen, T; Coarasa Perez, J A; Covarelli, R; Curé, B; Dahms, T; De Roeck, A; Elliott-Peisert, A; Funk, W; Gaddi, A; Gennai, S; Gerwig, H; Gigi, D; Gill, K; Giordano, D; Glege, F; Gomez-Reino Garrido, R; Gowdy, S; Guiducci, L; Hansen, M; Hartl, C; Harvey, J; Hegner, B; Henderson, C; Hoffmann, H F; Honma, A; Innocente, V; Janot, P; Lecoq, P; Leonidopoulos, C; Lourenço, C; Macpherson, A; Mäki, T; Malgeri, L; Mannelli, M; Masetti, L; Mavromanolakis, G; Meijers, F; Mersi, S; Meschi, E; Moser, R; Mozer, M U; Mulders, M; Nesvold, E; Orsini, L; Perez, E; Petrilli, A; Pfeiffer, A; Pierini, M; Pimiä, M; Racz, A; Rolandi, G; Rovelli, C; Rovere, M; Sakulin, H; Schäfer, C; Schwick, C; Segoni, I; Sharma, A; Siegrist, P; Simon, M; Sphicas, P; Spiga, D; Spiropulu, M; Stöckli, F; Traczyk, P; Tropea, P; Tsirou, A; Veres, G I; Vichoudis, P; Voutilainen, M; Zeuner, W D; Bertl, W; Deiters, K; Erdmann, W; Gabathuler, K; Horisberger, R; Ingram, Q; Kaestli, H C; König, S; Kotlinski, D; Langenegger, U; Meier, F; Renker, D; Rohe, T; Sibille, J; Starodumov, A; Caminada, L; Chen, Z; Cittolin, S; Dissertori, G; Dittmar, M; Eugster, J; Freudenreich, K; Grab, C; Hervé, A; Hintz, W; Lecomte, P; Lustermann, W; Marchica, C; Meridiani, P; Milenovic, P; Moortgat, F; Nardulli, A; Nef, P; Nessi-Tedaldi, F; Pape, L; Pauss, F; Punz, T; Rizzi, A; Ronga, F J; Sala, L; Sanchez, A K; Sawley, M-C; Schinzel, D; Stieger, B; Tauscher, L; Thea, A; Theofilatos, K; Treille, D; Weber, M; Wehrli, L; Weng, J; Amsler, C; Chiochia, V; De Visscher, S; Ivova Rikova, M; Millan Mejias, B; Regenfus, C; Robmann, P; Rommerskirchen, T; Schmidt, A; Tsirigkas, D; Wilke, L; Chang, Y H; Chen, K H; Chen, W T; Go, A; Kuo, C M; Li, S W; Lin, W; Liu, M H; Lu, Y J; Wu, J H; Yu, S S; Bartalini, P; Chang, P; Chang, Y H; Chang, Y W; Chao, Y; Chen, K F; Hou, W-S; Hsiung, Y; Kao, K Y; Lei, Y J; Lin, S W; Lu, R-S; Shiu, J G; Tzeng, Y M; Ueno, K; Wang, C C; Wang, M; Wei, J T; Adiguzel, A; Ayhan, A; Bakirci, M N; Cerci, S; Demir, Z; Dozen, C; Dumanoglu, I; Eskut, E; Girgis, S; Gökbulut, G; Güler, Y; Gurpinar, E; Hos, I; Kangal, E E; Karaman, T; Kayis Topaksu, A; Nart, A; Onengüt, G; Ozdemir, K; Ozturk, S; Polatöz, A; Sahin, O; Sengul, O; Sogut, K; Tali, B; Topakli, H; Uzun, D; Vergili, L N; Vergili, M; Zorbilmez, C; Akin, I V; Aliev, T; Bilmis, S; Deniz, M; Gamsizkan, H; Guler, A M; Ocalan, K; Ozpineci, A; Serin, M; Sever, R; Surat, U E; Yildirim, E; Zeyrek, M; Deliomeroglu, M; Demir, D; Gülmez, E; Halu, A; Isildak, B; Kaya, M; Kaya, O; Ozbek, M; Ozkorucuklu, S; Sonmez, N; Levchuk, L; Bell, P; Bostock, F; Brooke, J J; Cheng, T L; Cussans, D; Frazier, R; Goldstein, J; Hansen, M; Heath, G P; Heath, H F; Hill, C; Huckvale, B; Jackson, J; Kreczko, L; Mackay, C K; Metson, S; Newbold, D M; Nirunpong, K; Smith, V J; Ward, S; Basso, L; Bell, K W; Belyaev, A; Brew, C; Brown, R M; Camanzi, B; Cockerill, D J A; Coughlan, J A; Harder, K; Harper, S; Kennedy, B W; Olaiya, E; Petyt, D; Radburn-Smith, B C; Shepherd-Themistocleous, C H; Tomalin, I R; Womersley, W J; Worm, S D; Bainbridge, R; Ball, G; Ballin, J; Beuselinck, R; Buchmuller, O; Colling, D; Cripps, N; Cutajar, M; Davies, G; Della Negra, M; Foudas, C; Fulcher, J; Futyan, D; Guneratne Bryer, A; Hall, G; Hatherell, Z; Hays, J; Iles, G; Karapostoli, G; Lyons, L; Magnan, A-M; Marrouche, J; Nandi, R; Nash, J; Nikitenko, A; Papageorgiou, A; Pesaresi, M; Petridis, K; Pioppi, M; Raymond, D M; Rompotis, N; Rose, A; Ryan, M J; Seez, C; Sharp, P; Sparrow, A; Stoye, M; Tapper, A; Tourneur, S; Vazquez Acosta, M; Virdee, T; Wakefield, S; Wardrope, D; Whyntie, T; Barrett, M; Chadwick, M; Cole, J E; Hobson, P R; Khan, A; Kyberd, P; Leslie, D; Reid, I D; Teodorescu, L; Bose, T; Clough, A; Heister, A; St John, J; Lawson, P; Lazic, D; Rohlf, J; Sulak, L; Andrea, J; Avetisyan, A; Bhattacharya, S; Chou, J P; Cutts, D; Esen, S; Heintz, U; Jabeen, S; Kukartsev, G; Landsberg, G; Narain, M; Nguyen, D; Speer, T; Tsang, K V; Borgia, M A; Breedon, R; Calderon De La Barca Sanchez, M; Cebra, D; Chertok, M; Conway, J; Cox, P T; Dolen, J; Erbacher, R; Friis, E; Ko, W; Kopecky, A; Lander, R; Liu, H; Maruyama, S; Miceli, T; Nikolic, M; Pellett, D; Robles, J; Schwarz, T; Searle, M; Smith, J; Squires, M; Tripathi, M; Vasquez Sierra, R; Veelken, C; Andreev, V; Arisaka, K; Cline, D; Cousins, R; Deisher, A; Erhan, S; Farrell, C; Felcini, M; Hauser, J; Ignatenko, M; Jarvis, C; Plager, C; Rakness, G; Schlein, P; Tucker, J; Valuev, V; Wallny, R; Babb, J; Clare, R; Ellison, J; Gary, J W; Hanson, G; Jeng, G Y; Kao, S C; Liu, F; Liu, H; Luthra, A; Nguyen, H; Pasztor, G; Satpathy, A; Shen, B C; Stringer, R; Sturdy, J; Sumowidagdo, S; Wilken, R; Wimpenny, S; Andrews, W; Branson, J G; Dusinberre, E; Evans, D; Golf, F; Holzner, A; Kelley, R; Lebourgeois, M; Letts, J; Mangano, B; Muelmenstaedt, J; Padhi, S; Palmer, C; Petrucciani, G; Pi, H; Pieri, M; Ranieri, R; Sani, M; Sharma, V; Simon, S; Tu, Y; Vartak, A; Würthwein, F; Yagil, A; Barge, D; Blume, M; Campagnari, C; D'Alfonso, M; Danielson, T; Garberson, J; Incandela, J; Justus, C; Kalavase, P; Koay, S A; Kovalskyi, D; Krutelyov, V; Lamb, J; Lowette, S; Pavlunin, V; Rebassoo, F; Ribnik, J; Richman, J; Rossin, R; Stuart, D; To, W; Vlimant, J R; Witherell, M; Bornheim, A; Bunn, J; Gataullin, M; Kcira, D; Litvine, V; Ma, Y; Newman, H B; Rogan, C; Shin, K; Timciuc, V; Veverka, J; Wilkinson, R; Yang, Y; Zhu, R Y; Akgun, B; Carroll, R; Ferguson, T; Jang, D W; Jun, S Y; Paulini, M; Russ, J; Terentyev, N; Vogel, H; Vorobiev, I; Cumalat, J P; Dinardo, M E; Drell, B R; Ford, W T; Heyburn, B; Luiggi Lopez, E; Nauenberg, U; Smith, J G; Stenson, K; Ulmer, K A; Wagner, S R; Zang, S L; Agostino, L; Alexander, J; Blekman, F; Chatterjee, A; Das, S; Eggert, N; Fields, L J; Gibbons, L K; Heltsley, B; Hopkins, W; Khukhunaishvili, A; Kreis, B; Kuznetsov, V; Nicolas Kaufman, G; Patterson, J R; Puigh, D; Riley, D; Ryd, A; Shi, X; Sun, W; Teo, W D; Thom, J; Thompson, J; Vaughan, J; Weng, Y; Wittich, P; Biselli, A; Cirino, G; Winn, D; Abdullin, S; Albrow, M; Anderson, J; Apollinari, G; Atac, M; Bakken, J A; Banerjee, S; Bauerdick, L A T; Beretvas, A; Berryhill, J; Bhat, P C; Bloch, I; Borcherding, F; Burkett, K; Butler, J N; Chetluru, V; Cheung, H W K; Chlebana, F; Cihangir, S; Demarteau, M; Eartly, D P; Elvira, V D; Fisk, I; Freeman, J; Gao, Y; Gottschalk, E; Green, D; Gutsche, O; Hahn, A; Hanlon, J; Harris, R M; James, E; Jensen, H; Johnson, M; Joshi, U; Khatiwada, R; Kilminster, B; Klima, B; Kousouris, K; Kunori, S; Kwan, S; Limon, P; Lipton, R; Lykken, J; Maeshima, K; Marraffino, J M; Mason, D; McBride, P; McCauley, T; Miao, T; Mishra, K; Mrenna, S; Musienko, Y; Newman-Holmes, C; O'Dell, V; Popescu, S; Pordes, R; Prokofyev, O; Saoulidou, N; Sexton-Kennedy, E; Sharma, S; Smith, R P; Soha, A; Spalding, W J; Spiegel, L; Tan, P; Taylor, L; Tkaczyk, S; Uplegger, L; Vaandering, E W; Vidal, R; Whitmore, J; Wu, W; Yumiceva, F; Yun, J C; Acosta, D; Avery, P; Bourilkov, D; Chen, M; Di Giovanni, G P; Dobur, D; Drozdetskiy, A; Field, R D; Fu, Y; Furic, I K; Gartner, J; Kim, B; Klimenko, S; Konigsberg, J; Korytov, A; Kotov, K; Kropivnitskaya, A; Kypreos, T; Matchev, K; Mitselmakher, G; Pakhotin, Y; Piedra Gomez, J; Prescott, C; Remington, R; Schmitt, M; Scurlock, B; Sellers, P; Wang, D; Yelton, J; Zakaria, M; Ceron, C; Gaultney, V; Kramer, L; Lebolo, L M; Linn, S; Markowitz, P; Martinez, G; Mesa, D; Rodriguez, J L; Adams, T; Askew, A; Chen, J; Diamond, B; Gleyzer, S V; Haas, J; Hagopian, S; Hagopian, V; Jenkins, M; Johnson, K F; Prosper, H; Sekmen, S; Veeraraghavan, V; Baarmand, M M; Guragain, S; Hohlmann, M; Kalakhety, H; Mermerkaya, H; Ralich, R; Vodopiyanov, I; Adams, M R; Anghel, I M; Apanasevich, L; Bazterra, V E; Betts, R R; Callner, J; Cavanaugh, R; Dragoiu, C; Garcia-Solis, E J; Gerber, C E; Hofman, D J; Khalatian, S; Lacroix, F; Shabalina, E; Smoron, A; Strom, D; Varelas, N; Akgun, U; Albayrak, E A; Bilki, B; Cankocak, K; Clarida, W; Duru, F; Lae, C K; McCliment, E; Merlo, J-P; Mestvirishvili, A; Moeller, A; Nachtman, J; Newsom, C R; Norbeck, E; Olson, J; Onel, Y; Ozok, F; Sen, S; Wetzel, J; Yetkin, T; Yi, K; Barnett, B A; Blumenfeld, B; Bonato, A; Eskew, C; Fehling, D; Giurgiu, G; Gritsan, A V; Guo, Z J; Hu, G; Maksimovic, P; Rappoccio, S; Swartz, M; Tran, N V; Whitbeck, A; Baringer, P; Bean, A; Benelli, G; Grachov, O; Murray, M; Radicci, V; Sanders, S; Wood, J S; Zhukova, V; Bandurin, D; Bolton, T; Chakaberia, I; Ivanov, A; Kaadze, K; Maravin, Y; Shrestha, S; Svintradze, I; Wan, Z; Gronberg, J; Lange, D; Wright, D; Baden, D; Boutemeur, M; Eno, S C; Ferencek, D; Hadley, N J; Kellogg, R G; Kirn, M; Mignerey, A; Rossato, K; Rumerio, P; Santanastasio, F; Skuja, A; Temple, J; Tonjes, M B; Tonwar, S C; Twedt, E; Alver, B; Bauer, G; Bendavid, J; Busza, W; Butz, E; Cali, I A; Chan, M; D'Enterria, D; Everaerts, P; Gomez Ceballos, G; Goncharov, M; Hahn, K A; Harris, P; Kim, Y; Klute, M; Lee, Y-J; Li, W; Loizides, C; Luckey, P D; Ma, T; Nahn, S; Paus, C; Roland, C; Roland, G; Rudolph, M; Stephans, G S F; Sumorok, K; Sung, K; Wenger, E A; Wyslouch, B; Xie, S; Yilmaz, Y; Yoon, A S; Zanetti, M; Cole, P; Cooper, S I; Cushman, P; Dahmes, B; De Benedetti, A; Dudero, P R; Franzoni, G; Haupt, J; Klapoetke, K; Kubota, Y; Mans, J; Rekovic, V; Rusack, R; Sasseville, M; Singovsky, A; Cremaldi, L M; Godang, R; Kroeger, R; Perera, L; Rahmat, R; Sanders, D A; Sonnek, P; Summers, D; Bloom, K; Bose, S; Butt, J; Claes, D R; Dominguez, A; Eads, M; Keller, J; Kelly, T; Kravchenko, I; Lazo-Flores, J; Lundstedt, C; Malbouisson, H; Malik, S; Snow, G R; Baur, U; Iashvili, I; Kharchilava, A; Kumar, A; Smith, K; Strang, M; Zennamo, J; Alverson, G; Barberis, E; Baumgartel, D; Boeriu, O; Reucroft, S; Swain, J; Wood, D; Zhang, J; Anastassov, A; Kubik, A; Ofierzynski, R A; Pozdnyakov, A; Schmitt, M; Stoynev, S; Velasco, M; Won, S; Antonelli, L; Berry, D; Hildreth, M; Jessop, C; Karmgard, D J; Kolb, J; Kolberg, T; Lannon, K; Lynch, S; Marinelli, N; Morse, D M; Ruchti, R; Slaunwhite, J; Valls, N; Warchol, J; Wayne, M; Ziegler, J; Bylsma, B; Durkin, L S; Gu, J; Killewald, P; Ling, T Y; Williams, G; Adam, N; Berry, E; Elmer, P; Gerbaudo, D; Halyo, V; Hunt, A; Jones, J; Laird, E; Lopes Pegna, D; Marlow, D; Medvedeva, T; Mooney, M; Olsen, J; Piroué, P; Stickland, D; Tully, C; Werner, J S; Zuranski, A; Acosta, J G; Huang, X T; Lopez, A; Mendez, H; Oliveros, S; Ramirez Vargas, J E; Zatzerklyaniy, A; Alagoz, E; Barnes, V E; Bolla, G; Borrello, L; Bortoletto, D; Everett, A; Garfinkel, A F; Gecse, Z; Gutay, L; Jones, M; Koybasi, O; Laasanen, A T; Leonardo, N; Liu, C; Maroussov, V; Merkel, P; Miller, D H; Neumeister, N; Potamianos, K; Shipsey, I; Silvers, D; Yoo, H D; Zablocki, J; Zheng, Y; Jindal, P; Parashar, N; Cuplov, V; Ecklund, K M; Geurts, F J M; Liu, J H; Morales, J; Padley, B P; Redjimi, R; Roberts, J; Betchart, B; Bodek, A; Chung, Y S; de Barbaro, P; Demina, R; Flacher, H; Garcia-Bellido, A; Gotra, Y; Han, J; Harel, A; Miner, D C; Orbaker, D; Petrillo, G; Vishnevskiy, D; Zielinski, M; Bhatti, A; Demortier, L; Goulianos, K; Hatakeyama, K; Lungu, G; Mesropian, C; Yan, M; Atramentov, O; Gershtein, Y; Gray, R; Halkiadakis, E; Hidas, D; Hits, D; Lath, A; Rose, K; Schnetzer, S; Somalwar, S; Stone, R; Thomas, S; Cerizza, G; Hollingsworth, M; Spanier, S; Yang, Z C; York, A; Asaadi, J; Eusebi, R; Gilmore, J; Gurrola, A; Kamon, T; Khotilovich, V; Montalvo, R; Nguyen, C N; Pivarski, J; Safonov, A; Sengupta, S; Toback, D; Weinberger, M; Akchurin, N; Bardak, C; Damgov, J; Jeong, C; Kovitanggoon, K; Lee, S W; Mane, P; Roh, Y; Sill, A; Volobouev, I; Wigmans, R; Yazgan, E; Appelt, E; Brownson, E; Engh, D; Florez, C; Gabella, W; Johns, W; Kurt, P; Maguire, C; Melo, A; Sheldon, P; Velkovska, J; Arenton, M W; Balazs, M; Buehler, M; Conetti, S; Cox, B; Hirosky, R; Ledovskoy, A; Neu, C; Yohay, R; Gollapinni, S; Gunthoti, K; Harr, R; Karchin, P E; Mattson, M; Milstène, C; Sakharov, A; Anderson, M; Bachtis, M; Bellinger, J N; Carlsmith, D; Dasu, S; Dutta, S; Efron, J; Gray, L; Grogg, K S; Grothe, M; Herndon, M; Klabbers, P; Klukas, J; Lanaro, A; Lazaridis, C; Leonard, J; Lomidze, D; Loveless, R; Mohapatra, A; Polese, G; Reeder, D; Savin, A; Smith, W H; Swanson, J; Weinberg, M


    Bose-Einstein correlations have been measured using samples of proton-proton collisions at 0.9 and 2.36 TeV center-of-mass energies, recorded by the CMS experiment at the CERN Large Hadron Collider. The signal is observed in the form of an enhancement of pairs of same-sign charged particles with small relative four-momentum. The size of the correlated particle emission region is seen to increase significantly with the particle multiplicity of the event.

  8. First Measurement of Bose-Einstein Correlations in proton-proton Collisions at $\\sqrt{s}$ =0.9 and 2.36 TeV at the LHC

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hoch, Michael; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Kiesenhofer, Wolfgang; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; Ceard, Ludivine; De Wolf, Eddi A.; Hashemi, Majid; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; Blyweert, Stijn; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Maes, Michael; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Villella, Ilaria; Chabert, Eric Christian; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Marage, Pierre Edouard; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Costantini, Silvia; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Grégoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Militaru, Otilia; Ovyn, Severine; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Alves, Gilvan; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Carvalho, Wagner; Melo Da Costa, Eliza; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Oguri, Vitor; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Ferreira Dias, Marco Andre; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Stoykova, Stefka; Sultanov, Georgi; Trayanov, Rumen; Vankov, Ivan; Dyulendarova, Milena; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Marinova, Evelina; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Wang, Jian; Wang, Xianyou; Wang, Zheng; Yang, Min; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Hu, Zhen; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Gomez Moreno, Bernardo; Ocampo Rios, Alberto Andres; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Nicolaou, Charalambos; Papadakis, Antonakis; Ptochos, Fotios; Razis, Panos A.; Rykaczewski, Hans; Tsiakkouri, Demetra; Zinonos, Zinonas; Mahmoud, Mohammed; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Müntel, Mait; Raidal, Martti; Rebane, Liis; Azzolini, Virginia; Eerola, Paula; Czellar, Sandor; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Descamps, Julien; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, François-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, André; Rousseau, Delphine; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Elgammal, Sherif; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Kalinowski, Artur; Miné, Philippe; Paganini, Pascal; Sabes, David; Sirois, Yves; Thiebaux, Christophe; Zabi, Alexandre; Agram, Jean-Laurent; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Karim, Mehdi; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Speck, Joaquim; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Baty, Clement; Beaupere, Nicolas; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Actis, Oxana; Ata, Metin; Bender, Walter; Biallass, Philipp; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Kirsch, Matthias; Klimkovich, Tatsiana; Kreuzer, Peter; Lanske, Dankfried; Magass, Carsten; Merschmeyer, Markus; Meyer, Arnd; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Sowa, Michael; Steggemann, Jan; Teyssier, Daniel; Zeidler, Clemens; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flügge, Günter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Borras, Kerstin; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Olzem, Jan; Parenti, Andrea; Raspereza, Alexei; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Tomaszewska, Justyna; Volyanskyy, Dmytro; Wissing, Christoph; Autermann, Christian; Draeger, Jula; Eckstein, Doris; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schröder, Matthias; Schum, Torben; Schwandt, Joern; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Buege, Volker; Cakir, Altan; Chwalek, Thorsten; Daeuwel, Daniel; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Renz, Manuel; Sabellek, Andreas; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Gouskos, Loukas; Katsas, Panagiotis; Panagiotou, Apostolos; Evangelou, Ioannis; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Sharma, Richa; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Chauhan, Sushil; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Shilpi; Jain, Sandhya; Kumar, Ashok; Ranjan, Kirti; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Fahim, Ali; Jafari, Abideh; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pierro, Giuseppe Antonio; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Trentadue, Raffaello; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Broccolo, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Di Matteo, Leonardo; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Miccio, Vincenzo; Moroni, Luigi; Negri, Pietro; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Salerno, Roberto; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Taroni, Silvia; Buontempo, Salvatore; Cimmino, Anna; De Cosa, Annapaola; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Bisello, Dario; Carlin, Roberto; Checchia, Paolo; Conti, Enrico; De Mattia, Marco; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Giubilato, Piero; Gresele, Ambra; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Mazzucato, Mirco; Meneguzzo, Anna Teresa; Nespolo, Massimo; Perrozzi, Luca; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zumerle, Gianni; Baesso, Paolo; Berzano, Umberto; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Valdata, Marisa; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Castaldi, Rino; Tito DAgnolo, Raffaele; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Montanino, Damiana; Penzo, Aldo; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kim, Ji Eun; Kong, Dae Jung; Park, Hyangkyu; Son, Dong-Chul; Kim, Jaeho; Kim, Jae Yool; Song, Sanghyeon; Hong, Byung-Sik; Kim, Hyunchul; Kim, Ji Hyun; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Sim, Kwang Souk; Choi, Minkyoo; Kang, Seokon; Kim, Hyunyong; Park, Chawon; Park, Inkyu; Park, Sangnam; Choi, Suyong; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; De La Cruz Burelo, Eduard; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Villaseñor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A.; Allfrey, Philip; Krofcheck, David; Tam, Jason; Butler, Philip H.; Signal, Tony; Williams, Jennifer C.; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Mini, Giuliano; Musella, Pasquale; Nayak, Aruna; Raposo, Luis; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Soares, David; Varela, Joao; Wöhri, Hermine Katharina; Altsybeev, Igor; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger Jr., Michael; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Bondar, Nikolai; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Ilina, Natalia; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Kuleshov, Sergey; Oulianov, Alexei; Safronov, Grigory; Semenov, Sergey; Shreyber, Irina; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Datsko, Kirill; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Sytine, Alexandre; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Krpic, Dragomir; Maletic, Dimitrije; Milosevic, Jovan; Puzovic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Diaz Merino, Irma; Diez Gonzalez, Carlos; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Lobelle Pardo, Patricia; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Rodrigo, Teresa; Ruiz Jimeno, Alberto; Scodellaro, Luca; Sobron Sanudo, Mar; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Beaudette, Florian; Bellan, Riccardo; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bocci, Andrea; Bolognesi, Sara; Breuker, Horst; Brona, Grzegorz; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cattai, Ariella; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Curé, Benoît; Dahms, Torsten; De Roeck, Albert; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gennai, Simone; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gomez-Reino Garrido, Robert; Gowdy, Stephen; Guiducci, Luigi; Hansen, Magnus; Hartl, Christian; Harvey, John; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Innocente, Vincenzo; Janot, Patrick; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Mavromanolakis, Georgios; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Nesvold, Erik; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Racz, Attila; Rolandi, Gigi; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stöckli, Fabian; Traczyk, Piotr; Tropea, Paola; Tsirou, Andromachi; Veres, Gabor Istvan; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Caminada, Lea; Chen, Zhiling; Cittolin, Sergio; Dissertori, Günther; Dittmar, Michael; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hervé, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Meridiani, Paolo; Milenovic, Predrag; Moortgat, Filip; Nardulli, Alessandro; Nef, Pascal; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann - Karin; Sawley, Marie-Christine; Schinzel, Dietrich; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Ivova Rikova, Mirena; Millan Mejias, Barbara; Regenfus, Christian; Robmann, Peter; Rommerskirchen, Tanja; Schmidt, Alexander; Tsirigkas, Dimitrios; Wilke, Lotte; Chang, Yuan-Hann; Chen, Kuan-Hsin; Chen, Wan-Ting; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Lu, Yun-Ju; Wu, Jing-Han; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lin, Sheng-Wen; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Ueno, Koji; Wang, Chin-chi; Wang, Minzu; Wei, Jui-Te; Adiguzel, Aytul; Ayhan, Aydin; Bakirci, Mustafa Numan; Cerci, Salim; Demir, Zahide; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gökbulut, Gül; Güler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Kayis Topaksu, Aysel; Nart, Alisah; Önengüt, Gülsen; Ozdemir, Kadri; Ozturk, Sertac; Polatöz, Ayse; Sahin, Ozge; Sengul, Ozden; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yildirim, Eda; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gülmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Özbek, Melih; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Cussans, David; Frazier, Robert; Goldstein, Joel; Hansen, Maria; Heath, Greg P.; Heath, Helen F.; Hill, Christopher; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Mackay, Catherine Kirsty; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Belyaev, Alexander; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Davies, Gavin; Della Negra, Michel; Foudas, Costas; Fulcher, Jonathan; Futyan, David; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Stoye, Markus; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Reid, Ivan; Teodorescu, Liliana; Bose, Tulika; Clough, Andrew; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sulak, Lawrence; Andrea, Jeremy; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Speer, Thomas; Tsang, Ka Vang; Borgia, Maria Assunta; Breedon, Richard; Calderon De La Barca Sanchez, Manuel; Cebra, Daniel; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Schwarz, Thomas; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Deisher, Amanda; Erhan, Samim; Farrell, Chris; Felcini, Marta; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Wallny, Rainer; Babb, John; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Pasztor, Gabriella; Satpathy, Asish; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tu, Yanjun; Vartak, Adish; Würthwein, Frank; Yagil, Avraham; Barge, Derek; Blume, Michael; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Garberson, Jeffrey; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lamb, James; Lowette, Steven; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Witherell, Michael; Bornheim, Adolf; Bunn, Julian; Gataullin, Marat; Kcira, Dorian; Litvine, Vladimir; Ma, Yousi; Newman, Harvey B.; Rogan, Christopher; Shin, Kyoungha; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Jang, Dong Wook; Jun, Soon Yung; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Blekman, Freya; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Fields, Laura Johanna; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Kuznetsov, Valentin; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Puigh, Darren; Riley, Daniel; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Vaughan, Jennifer; Weng, Yao; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Green, Dan; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Khatiwada, Rakshya; Kilminster, Benjamin; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Pordes, Ruth; Prokofyev, Oleg; Saoulidou, Niki; Sexton-Kennedy, Elizabeth; Sharma, Seema; Smith, Richard P.; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Pakhotin, Yuriy; Piedra Gomez, Jonatan; Prescott, Craig; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Sellers, Paul; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Mesa, Dalgis; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Veeraraghavan, Venkatesh; Baarmand, Marc M.; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Mermerkaya, Hamit; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatian, Samvel; Lacroix, Florent; Shabalina, Elizaveta; Smoron, Agata; Strom, Derek; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bandurin, Dmitry; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Mignerey, Alice; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; D'Enterria, David; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Wyslouch, Bolek; Xie, Si; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Sonnek, Peter; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Strang, Michael; Zennamo, Joseph; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Reucroft, Steve; Swain, John; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Ofierzynski, Radoslaw Adrian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Killewald, Phillip; Ling, Ta-Yung; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatzerklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, Karolos; Shipsey, Ian; Silvers, David; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Flacher, Henning; Garcia-Bellido, Aran; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Hatakeyama, Kenichi; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hits, Dmitry; Lath, Amitabh; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Toback, David; Weinberger, Michael; Akchurin, Nural; Bardak, Cemile; Damgov, Jordan; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Mane, Poonam; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Appelt, Eric; Brownson, Eric; Engh, Daniel; Florez, Carlos; Gabella, William; Johns, Willard; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sheldon, Paul; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Gunthoti, Kranti; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Milstène, Caroline; Sakharov, Alexandre; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Dutta, Suchandra; Efron, Jonathan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Herndon, Matthew; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Polese, Giovanni; Reeder, Don; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc


    Bose-Einstein correlations have been measured using samples of proton-proton collisions at 0.9 and 2.36 TeV center-of-mass energies, recorded by the CMS experiment at the CERN Large Hadron Collider. The signal is observed in the form of an enhancement of pairs of same-sign charged particles with small relative four-momentum. The size of the correlated particle emission region is seen to increase significantly with the particle multiplicity of the event.

  9. Study of paramagnetic defect centers in as-grown and annealed TiO2 anatase and rutile nanoparticles by a variable-temperature X-band and high-frequency (236 GHz) EPR. (United States)

    Misra, S K; Andronenko, S I; Tipikin, D; Freed, J H; Somani, V; Prakash, Om


    Detailed EPR investigations on as-grown and annealed TiO 2 nanoparticles in the anatase and rutile phases were carried out at X-band (9.6 GHz) at 77, 120-300 K and at 236 GHz at 292 K. The analysis of EPR data for as-grown and annealed anatase and rutile samples revealed the presence of several paramagnetic centers: Ti 3+ , O - , adsorbed oxygen (O 2 - ) and oxygen vacancies. On the other hand, in as-grown rutile samples, there were observed EPR lines due to adsorbed oxygen (O 2 - ) and the Fe 3+ ions in both Ti 4+ substitutional positions, with and without coupling to an oxygen vacancy in the near neighborhood. Anatase nanoparticles were completely converted to rutile phase when annealed at 1000° C, exhibiting EPR spectra similar to those exhibited by the as-grown rutile nanoparticles. The high-frequency (236 GHz) EPR data on anatase and rutile samples, recorded in the region about g = 2.0 exhibit resolved EPR lines, due to O - and O 2 - ions enabling determination of their g-values with higher precision, as well as observation of hyperfine sextets due to Mn 2+ and Mn 4+ ions in anatase.

  10. Numerical investigations of the fuel cycle for a 10 GW(TH)-OTTO-pebble-bed reactor with regard to high conversion ratio under special consideration of U-236 disconnexion through isotope-separation

    International Nuclear Information System (INIS)

    Werner, H.


    A conversion ratio of near 1.0 can be achieved in a pebble-bed reactor using the OTTO (once through then out) loading scheme, having an economic burn-up of the fuel, an economic power density and a moderation ratio, which is considered realistically for the future. The flexibility of the reactor concept and of the fuel element design allows to recycle the fuel during full-power operation. In the present report first the criteria are shown, which are necessary to reach a high conversion ratio. Further it is presented that the conversion ratio increases considerably by closing the fuel cycle in consequence of the building-up of U-233. In this way the fuel inventory and the fuel consumption can considerably be diminished. It is demonstrated that the building-up and the accumulation of U-236 effects an important deterioration of the neutron economy. By taking the reprocessed uranium through an isotope separation (for example: ultra-gas-centrifugation) and by separation of U-236 from the other uranium isotopes it is possible to reduce the fuel consumption considerably. The expenditure and the cost which are necessary for the isotope separation are presented. (orig.) [de

  11. The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    Meadows, J.W.


    The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

  12. Calorimetric low-temperature detectors for low-energy (E≤1 MeV/amu) heavy ions and their first application in the accelerator mass spectroscopy for trace analysis of 236U

    International Nuclear Information System (INIS)

    Kraft-Bermuth, S.


    In the thesis presented here, calorimetric low temperature detectors were for the first time applied in accelerator mass spectrometry (AMS) to determine the isotope ratio of 236 U to 238 U in several samples of natural uranium. The detectors consist of a superconducting aluminium film deposited onto a sapphire absorber which is used as thermistor. An energetic heavy ion deposits its kinetic energy as heat in the absorber. The temperature rise is detected by the resistance change of the superconductor. The AMS experiments were performed at the tandem accelerator VERA of the ''Institut fuer Isotopenforschung und Kernphysik'' of the University of Vienna. In an energy range of 10-60 MeV, a relative energy resolution of ΔE/E=7.10 -3 could be achieved, one order of magnitude better than with conventional ionization detectors. Improving thermal and electronic noise yielded in a second experiment for uranium ions with E=17 MeV a relative energy resolution of ΔE/E=4.6.10 -3 . The energy response of the detectors was linear over the whole energy range and independent of the ion mass. Down to a level of 0.1%, no pulse height defect was observed. With the energy resolution obtained it is possible to determine the isotope ratio of 236 U/ 238 U for several samples of natural uranium. With the resolution achieved it is possible furthermore to apply the detectors in several test experiments for direct mass identification of heavy ions using a combined energy/time of flight measurement. In these first tests, a mass resolution of ΔM/M=(8.5-11.0).10 -3 was achieved. In a first test to apply the detectors for detection of so called ''super heavy elements (Z>=112)'', the large dynamic range allowed to identify the reaction products and their alpha decays simultaneously and time dependent. (orig.)

  13. SNS vil høre om det supplerende materiale giver anledning til ændringer i de tidligere fremsendte risikovurderinger. Gossypium hirsutum (281-24-236/3006-210-23). Supplerende materiale til sagen (Four questions: Molecular characterisation / Food-feed assessment). Modtaget 12-12-2005, deadline 16

    DEFF Research Database (Denmark)

    Kjellsson, Gøsta; Damgaard, Christian; Strandberg, Morten Tune


    "DMU finder at det nye materiale om den molekulære karakterisering af 281-24-236x3006-210-23 bomulden, ikke giver anledning til at ændre den tidligere riskovurdering. Vedr. spørgsmål 1 er det i svaret fra anmelderen blevet tilfredsstillende redegjort for hvilket materiale der blev anvendt. Vedr s...

  14. Rapid selective separation of americium/curium from simulated nuclear forensic matrices using triazine ligands

    Energy Technology Data Exchange (ETDEWEB)

    Higginson, Matthew A.; Livens, Francis R.; Heath, Sarah L. [Manchester Univ. (United Kingdom). Centre for Radiochemistry Research; Thompson, Paul; Marsden, Olivia J. [AWE, Aldermaston, Reading (United Kingdom); Harwood, Laurence M.; Hudson, Michael J. [Reading Univ. (United Kingdom). Dept. of Chemistry; Lewis, Frank W. [Reading Univ. (United Kingdom). Dept. of Chemistry; Northumbria Univ., Newcastle upon Tyne (United Kingdom). Dept. of Chemical and Forensic Sciences


    In analysis of complex nuclear forensic samples containing lanthanides, actinides and matrix elements, rapid selective extraction of Am/Cm for quantification is challenging, in particular due the difficult separation of Am/Cm from lanthanides. Here we present a separation process for Am/Cm(III) which is achieved using a combination of AG1-X8 chromatography followed by Am/Cm extraction with a triazine ligand. The ligands tested in our process were CyMe{sub 4}-BTPhen, CyMe{sub 4}-BTBP, CA-BTP and CA-BTPhen. Our process allows for purification and quantification of Am and Cm (recoveries 80% - 100%) and other major actinides in < 2 d without the use of multiple columns or thiocyanate. The process is unaffected by high level Ca(II)/Fe(III)/Al(III) (10 mg mL{sup -1}) and thus requires little pre-treatment of samples.

  15. Uptake of plutonium, americium, curium, and neptunium in plants cultivated under greenhouse conditions

    International Nuclear Information System (INIS)

    Pimpl, M.; Schmidt, W.


    The root-uptake of Np, Pu, Am, and Cm from three different artificially contaminated soils in grass, maize, spring wheat, and potatoes was investigated under greenhouse conditions in pots filled with 9 kg contaminated soil and in lysimeters with a surface area of 0,5 m 2 containing the soils in undisturbed profils up to a depth of 80 cm. Only the plough layer of 30 cm was contaminated with Np, Pu, Am, and Cm. Crop cultivation was done corresponding to usual practice in agriculture. Results of the 1st vegetation period are represented. Transfer factors obtained deviate considerably from those which are recommended for the estimation of long-term exposure of man in the Federal Republic of Germany. (orig.)

  16. Fission-product yields for thermal-neutron fission of curium-243

    International Nuclear Information System (INIS)

    Breederland, D.G.


    Cumulative fission yields for 25 gamma rays emitted during the decay of 23 fission products produced by thermal-neutron fission of 243 Cm have been determined. Using Ge(Li) spectroscopy, 33 successive pulse-height spectra of gamma rays emitted from a 77-ng sample of 243 Cm over a period of approximately two and one-half months were analyzed. Reduction of these spectra resulted in the identification and matching of gamma-ray energies and half-lives to specific radionuclides. Using these results, 23 cumulative fission-product yields were calculated. Only those radionuclides having half-lives between 6 hours and 65 days were observed. Prior to this experiment, no fission-product yields had been recorded for 243 Cm

  17. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.


    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  18. Characteristics of plutonium, curium and uranium in hulls of FUGEN MOX spent fuel by destructive analysis

    International Nuclear Information System (INIS)

    Iijima, Shizuka; Goto, Yuichi; Samoto, Hirotaka; Shichi, Ryo; Shimizu, Takenori


    We have been developing a non-destructive assay system called hulls monitor for nuclear fuel materials retained in hulls at the Tokai Reprocessing Plant (TRP). The hulls monitor is based on a passive neutron measurement method, so its applicability should be evaluated by a destructive analysis of hulls that are recovered from the reprocessing process. In this study, hulls came from the Advanced Thermal Reactor (ATR) FUGEN were taken from the dissolution process of TRP and destructively analyzed. Two kinds of hulls from ATR-MOX spent fuel assemblies and from ATR-UO 2 spent fuel assemblies were taken and soaked with nitric acid then fused with ammonium hydrogen sulfate, followed by Pu, 244 Cm, U mass determination by alpha spectrometry and ICP-AES. The characteristics of hulls came from MOX spent fuel assemblies were revealed by comparison of ATR-MOX spent fuel with ATR-UO 2 spent fuel. (author)

  19. Americium-Curium Stabilization - 5'' Cylindrical Induction Melter System Design Basis

    International Nuclear Information System (INIS)

    Witt, D.C.


    Approximately 11,000 liters (3,600) gallons of solution containing isotopes of Am and Cm are currently stored in F-Canyon Tank 17.1. These isotopes were recovered during plutonium-242 production campaigns in the mid- and late-1970s. Experimental work for the project began in 1995 by the Savannah River Technology Center (SRTC). Details of the process are given in the various sections of this document

  20. Optimization conditions for the separation of rare earth elements, americium, curium and cesium with HPLC technique

    International Nuclear Information System (INIS)

    Goutelard, F.; Caussignac, C.; Brennetot, R.; Stadelmann, G.; Gautier, C.


    In order to validate the neutronic code calculations used in the nuclear field, it is necessary to quantify the isotopic composition of the nuclear irradiated fuels with high precision and accuracy. A separation step whose objective is to isolate the elements of interest in a fraction as pure as possible, is performed before mass spectrometry detection (MC-ICP-MS, TIMS), in order to eliminate isobaric interferences. In a first step, uranium and plutonium are separated from the fission products by ion exchange chromatography. Then, fission products are separated by high performance liquid chromatography (HPLC). A gradient separation with a silica sulphonated support as stationary phase and hydroxy-methyl butyric acid (HMB) as eluent solution provides a good degree of separation of the rare earth elements, Am, Cm and Cs. But, for a same manufacturer, the rate of sulphonated groups is variable from one column to another for a given production batch. For every replacement of column, it is necessary to adjust the separation conditions. Furthermore, the high radioactivity of the samples injected damages the stationary phase, dragging a regular renewal of the columns. The goal of this study is to determine the optimal separation conditions with a minimum of tests in order to limit the time assigned to this operation. A first Doehlert experimental design with pH and HMB concentration as variables has been implemented to optimize Gd, Eu separation, in isocratic initial conditions. A second one has been tested in order to separate the higher lanthanides and to fix the final conditions of the gradient separation. A last set of tests has been performed to characterize the cesium behaviour. Finally, the gradient conditions have been adjusted in order to perform the full separation of lanthanides, Cs, Am and Cm with nuclear facilities. (author)

  1. Temperature thresholds for surface blistering of platinum and stainless steel exposed to curium-242 alpha radiations

    International Nuclear Information System (INIS)

    McDonell, W.R.; Dillich, S.


    Implantation of helium in materials exposed to alpha-emitting radionuclides such as 242 Cm causes surface blistering at elevated temperatures. The temperature thresholds for such blistering are of practical importance to the selection of suitable container materials for radionuclides, and are of fundamental interest with regard to the mechanisms of helium blistering of materials in radiation environments. The purpose of this investigation was to establish temperature thresholds for surface blistering of platinum and stainless-steel container materials by post-irradiation heating of specimens exposed at room temperature to alpha particles from an external 242 Cm source. These thresholds were compared with (1) the analogous temperature thresholds for surface blistering of materials exposed to external beams of accelerator helium ions, and (2) thresholds for swelling and grain-boundary cracking of materials in which helium is generated internally by (n,α) reactions during reactor exposures

  2. Multi-recycling of plutonium and incineration of americium, curium, and technetium in PWRs

    International Nuclear Information System (INIS)

    Golfier, H.; Bergeron, J.; Puill, A.; Rohart, M.


    The future of nuclear power requires a clear strategy for radwaste and Plutonium management. Pressurized water reactors (PWR) and the associated fuel cycle installations represent the largest part of the French power plants (and are partly paid off). The reactors in service produce an annual 10 tons of Pu, 1.4 tons of minor actinides (MA), and 3.8 tons of long-lived fission products (LLFP). The spent fuel is reprocessed in La Hague plant to recover the energetic elements U and Pu. The latter was initially dedicated to power Fast Breeder Reactors that converted the depleted and reprocessed, thus ensuring a significant part of the French national energy resources. The shut-down of Super-Phenix, the postponement of building of Fast Breeder Reactors (FBR) and the relaxed need for stretching natural U resources raise the issue of Pu management. In fact, the Pu mono-recycling practiced in France since 1987 (St Laurent B1) only slows down the Pu accumulation in spent nuclear fuel, yet it is unable to stabilize the Pu inventory. Beyond the cooperation with its industrial partners, CEA investigates solutions for short and medium term Pu management thus contributing to research required for keeping nuclear power as an energy option. The range of these investigations shall cover both adaptations for light water reactors to facilitate Pu recycling and more innovative solutions concerning reactors, fuel and fuel cycle. The aim of using Pu more efficiently in PWR has led, not only for economic and non-proliferation reasons, but also for considerations related to the optimization of Pu and MA management. The mastery of Pu inventory is a requirement for all long-lived radwaste management methods. In this context, the potential of innovative PWRs has been investigated to control the Pu fluxes and to make them a milestone on the way to clean nuclear power. This paper presents the most recent results related to Pu utilization and MA and LLFP incineration like (Am+Cm) and Tc. To determine the influence of the Pu fluxes, a 1450 MWe PWR with one standard and one innovative concept (code named APA for Advanced Plutonium fuel Assembly) have been performed. A multi-recycling scenario is simulated with a 400 TWhe power plant park. (authors)

  3. Sorption of plutonium and curium on ion exchange resins in mixed aqueous organic solutions

    International Nuclear Information System (INIS)

    Haidvogel, N.; Reitsamer, G.; Grass, F.


    The sorption of the sulfate and nitrate-complexes of the actinides Pu(III), Pu(IV), Pu(VI), Am(III) and Om(III) on the ion-exchange-resins Dowex 1X8 and Dowex 50 WX8 is investigated. The strong sorbability of these actinide ions in solvents with high content of alcohol is explained by the existence of anionic complexes like Pu(III) (SO 4 ) 2 - , Pu(IV) (SO 4 ) 3 2 - , Pu(VI)O 2 (SO 4 ) 2 2 - , Am(SO 4 ) 2 - respectively Am(NO 3 ) 4 - and Om(NO 3 ) 4 - . The taking of autoradiographs from the thin-layer chromatograms by the aid of a special device and the evaluation of the autoradiographs by a particular photodensitometer are described. The measurement of the radioactivity of the α-emitting nuclides Pu 239, Am 241 and Om 242 are done by liquid-scintillation spectrometry. (author)

  4. Total and spontaneous fission half-lives of the americium and curium nuclides

    International Nuclear Information System (INIS)

    Holden, N.E.


    The total half-life and the half-life for spontaneous fission are evaluated for the various long-lived nuclides of interest. Recommended values are presented for 241 Am, /sup 242m/Am, 243 Am, 242 Cm, 243 Cm, 244 Cm, 245 Cm, 246 Cm, 247 Cm, 248 Cm, and 250 Cm. The uncertainties are provided at the 95% confidence limit for each of the recommended values

  5. Incorporation of plutonium, americium and curium into the Irish Sea seabed by biological activity

    Energy Technology Data Exchange (ETDEWEB)

    Kershaw, P J; Swift, D J; Pentreath, R J; Lovett, M B


    Bioturbation was considered as a potentially significant mechanism for the incorporation of long-lived radionuclides into the seabed and in particular the activities of a large echiuran Maximulleria lankesteri. Radionuclides of the transuranium elements plutonium, americium and cirium are discharged into the Irish Sea under authorization as part of the low-level liquid effluent from the British Nuclear Fuels plc reprocessing plant at Sellafield, Cumbria, England. The distribution of Pu-239, 240, Pu-238, Am-241, Cm-244 and Cm-242 concentrations and the Pu-239, 240/Pu-238 quotient in samples taken in April and May 1983 from the sediment surface, burrow linings, sediments adjacent to burrows, and the gut contents and body of a large M. lankesteri clearly indicate that bioturbation is responsible, at least in part, for the incorporation of these radionuclides to depths of up to 140 cm. This area of sediments represents a significant present-day sink, but the permanence of this sink and the likelihood that radioactivity will be remobilized and be returned to man, depends on a large number of factors. 15 references, 18 figures.

  6. Structural, electronic, and thermodynamic properties of curium dioxide: Density functional theory calculations (United States)

    Hou, Ling; Li, Wei-Dong; Wang, Fangwei; Eriksson, Olle; Wang, Bao-Tian


    We present a systematic investigation of the structural, magnetic, electronic, mechanical, and thermodynamic properties of CmO2 with the local density approximation (LDA)+U and the generalized gradient approximation (GGA)+U approaches. The strong Coulomb repulsion and the spin-orbit coupling (SOC) effects on the lattice structures, electronic density of states, and band gaps are carefully studied, and compared with other A O2 (A =U , Np, Pu, and Am). The ferromagnetic configuration with half-metallic character is predicted to be energetically stable while a charge-transfer semiconductor is predicted for the antiferromagnetic configuration. The elastic constants and phonon spectra show that the fluorite structure is mechanically and dynamically stable. Based on the first-principles phonon density of states, the lattice vibrational energy is calculated using the quasiharmonic approximation. Then, the Gibbs free energy, thermal expansion coefficient, specific heat, and entropy are obtained and compared with experimental data. The mode Grüneisen parameters are presented to analyze the anharmonic properties. The Slack relation is applied to obtain the lattice thermal conductivity in temperature range of 300-1600 K. The phonon group velocities are also calculated to investigate the heat transfer. For all these properties, if available, we compare the results of CmO2 with other A O2 .

  7. Comparative uptake and distribution of plutonium, americium, curium and neptunium in four plant species

    Energy Technology Data Exchange (ETDEWEB)

    Schreckhise, R E; Cline, J F [Battelle Pacific Northwest Labs., Richland, WA (USA)


    Uptake of the nitrate forms of /sup 238/Pu, /sup 239/Pu, /sup 241/Am, /sup 244/Cm and /sup 237/Np from soil into selected parts of four different plant species grown under field conditions was compared Alfalfa, barley, peas and cheatgrass were grown outdoors in small weighing lysimeters filled with soil containing these radionuclides. The plants were harvested at maturity, divided into selected components and radiochemically analyzed by alpha-energy analysis. Soil concentration did not appear to affect the plant uptake of /sup 238/Pu, /sup 239/Pu, /sup 241/Am or /sup 244/Cm for the two levels utilized. The relative plant uptake of the five different transuranics was /sup 237/Np>/sup 244/Cm approximately equal /sup 241/Am>/sup 239/Pu approximately equal/sup 238/Pu. Relative uptake values of Np for various plant parts ranged from 2200 to 45,000 times as great as for Pu, while Am and Cm values were 10-20 times as great. The values for seeds were significantly lower than those for the other aboveground plant parts for all four transuranic elements. The legumes accumulated approx. 10 times more than the grasses. A comparison of the postulated radionuclide content of plants grown in soil contaminated with material from spent liquid metal fast breeder reactor fuels indicated that concentrations of isotopes of Am, Cm and Np would exceed /sup 239/Pu values.

  8. Assessment of Neptunium, Americium, and Curium in the Savannah River Site Environment

    International Nuclear Information System (INIS)

    Carlton, W.H.


    A series of documents has been published in which the impact of various radionuclides released to the environment by Savannah River Site (SRS) operations has been assessed. The quantity released, the disposition of the radionuclides in the environment, and the dose to offsite individuals has been presented for activation products, carbon cesium, iodine, plutonium, selected fission products, strontium, technetium, tritium, uranium, and the noble gases. An assessment of the impact of nonradioactive mercury also has been published.This document assesses the impact of radioactive transuranics released from SRS facilities since the first reactor became operational late in 1953. The isotopes reported here are 239Np, 241Am, and 244Cm

  9. Americium-curium separation by means of selective extraction of hexavalent americium using a centrifugal contactor

    International Nuclear Information System (INIS)

    Musikas, C.; Germain, M.; Bathellier, A.


    This paper deals with Am (VI) - Cm (III) separation in nitrate media. The kinetics of oxidation of Am (III) by sodium persulfate in the presence of Ag + ions were reinvestigated by studying the effect of additions of small amounts of reagents which do not drastically change the distribution coefficients of Am (VI) or Cm (III) ions. Organo phosphorus solvents were selected because they are radiation resistant, possess weak reductant properties and that their affinity for hexavalent ion is high. The operating procedure was selected by consideration of the results of the two previous investigations. This can be done by using a centrifugal contactor enabling in to set organic-aqueous phase contact time in accordance with the kinetics of extraction of Am (VI), oxidation of Am (III) in aqueous phase, and reduction of Am (VI) in organic phase

  10. Order parameters and magnetocrystalline anisotropy of off-stoichiometric D0{sub 22} Mn{sub 2.36}Ga epitaxial films grown on MgO (001) and SrTiO{sub 3} (001)

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hwachol; Sukegawa, Hiroaki, E-mail:; Mitani, Seiji; Hono, Kazuhiro [National Institute for Materials Science (NIMS), Sengen 1-2-1, Tsukuba, Ibaraki 305-0047 (Japan)


    We study the relationship between long range order parameters and the magnetocrystalline anisotropy of off-stoichiometric D0{sub 22} Mn{sub 2.36}Ga (MnGa) epitaxial films grown on MgO (001) and SrTiO{sub 3} (STO) (001) single crystalline substrates. MnGa films deposited on MgO (001) show rather large irregular variation in magnetization with increasing substrate temperature in spite of the improved long range order of total atomic sites. The specific site long range order of Mn-I site characterized in the [101] orientation revealed the fluctuation of the occupation fraction of two Mn atomic sites with elevated substrate temperature, which appears more relevant to the observed magnetization change than the long range order of the total atomic sites. In case of MnGa films grown on the lattice-matched STO (001), high long range order of the total atomic sites in spite of the existence of secondary phase represents that the lattice mismatch plays a crucial role in determining the atomic arrangement of Mn and Ga atoms in the off-stoichiometric compositional case of MnGa.

  11. Synthesis of 14C-labelled polychlorobiphenyls derived from the labelled 4-chloro-, 2,5-dichloro-, 3,4-dichloro-, 2,3-dichloro-2,4,5-trichloro- and 2,3,6-trichloroanilines

    International Nuclear Information System (INIS)

    Bergman, A.; Bamford, I.; Wachtmeister, C.A.


    [ 14 C]Aniline hydrogen sulphate was acetylated, and the acetanilide obtained was chlorinated with N-chlorosuccinimide to 2-chloro, 4-chloro- and 2,4-dichloroacet[ 14 C]anilide. The labelled 2- and 4-chloroacet[ 14 C]anilides were hydrolyzed and treated with aluminium chloride, hydrogen chloride and chlorine in dry dichloromethane to give the major products 2,5-dichloro-and 3,4-dichloro[ 14 C]aniline. The labelled 2,3-dichloro- and 2,3,6-trichloroanilines were obtained as minor products from the chlorination of 2-chloro[ 14 C]aniline, likewise 2,4,5-trichloroaniline was obtained from 4-chloro[ 14 C]aniline. The [ 14 C]anilines prepared were coupled with benzene, 1,4-dichloro-, 1,2-dichloro- or 1,3-dichlorobenzene to give 4-chloro-, 2,3',4',5-tetrachloro-, 2,3,3',4'-tetrachloro-, 3,3',4,4'-tetrachloro-, 2,2',5,5'-tetrachloro-, 2,2',3,3'-tetrachloro-, 2,2',3,5',6-pentachloro-, 2,2',4,4',5-pentachloro- and 2,3',4,5,5'-pentachloro[ 14 C]biphenyl. 3,4-Dichloro[ 14 C]aniline and biphenyls prepared from this aniline were found to be contaminated by bromoanalogues. The origin of these have been studied. (author)

  12. 49 CFR 236.741 - Distance, stopping. (United States)


    ... portion of railroad at its maximum authorized speed, will travel during a full service application of the brakes, between the point where such application is initiated and the point where the train comes to a...

  13. 17 CFR 256.236 - Taxes accrued. (United States)


    ... credited with the amount of taxes accrued during the accounting period, corresponding debits being made to... be kept so as to show for each class of taxes the amount accrued, the basis for the accrual, the...

  14. 10 CFR 600.236 - Procurement. (United States)


    ... analysis to determine the most economical approach. (5) To foster greater economy and efficiency, grantees... characteristics and standards to which it must conform if it is to satisfy its intended use. Detailed product... grantee or subgrantee desires to have the review accomplished after a solicitation has been developed, the...

  15. Publications | Page 236 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... of Nicaragua) (restricted access). Over the last two decades indigenous peoples in the Latin American region have been struggling for state recognition of cultural difference and for the granting of collective rights. This dissertation explores the activism of indigenous women and their participation within indigenous socio-.

  16. 24 CFR 236.710 - Qualified tenant. (United States)


    ..., the income of the individual or family must be determined to be too low to permit the individual or... consent forms for the obtaining of wage and claim information from State Wage Information Collection...

  17. BDML Metadata: 236 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available BY-NC-SA 0.150 0ec11f69-8817-4c7f-94cf-8973a5da1081 0.105 x 0.105 x 0.5 (micrometer), 40 (second) ...

  18. 49 CFR 236.2 - Grounds. (United States)


    ... circuit, except circuits which include any track rail and except the common return wires of single-wire, single-break, signal control circuits using a grounded common, and alternating current power distribution...

  19. Gender | Page 236 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    “And I thought: I'm really not making the world a better place,” she says. ... and their full potential as citizens and equal partners in decision-making and development. ... Equity issues are again attracting attention from academics and policy ...

  20. 49 CFR 236.792 - Reservoir, equalizing. (United States)


    ... Reservoir, equalizing. An air reservoir connected with and adding volume to the top portion of the equalizing piston chamber of the automatic brake valve, to provide uniform service reductions in brake pipe...

  1. 49 CFR 236.903 - Definitions. (United States)


    ... the site-specific application programs, run timers, read inputs, drive outputs, perform self... validation process is to determine “whether the correct product was built.” Verification means the process of... established at the start of that phase. The goal of the verification process is to determine “whether the...

  2. 49 CFR 236.1003 - Definitions. (United States)


    ... auxiliary or industry tracks, a segment or route of railroad tracks: (1) Of a Class I railroad, as.... Tourist, scenic, historic, or excursion operations as defined in part 238 of this chapter are not...

  3. 49 CFR 236.329 - Bolt lock. (United States)


    ... TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING THE INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Interlocking Rules and Instructions... derail and displaying an aspect indicating stop cannot be operated to display a less restrictive aspect...

  4. 9 CFR 2.36 - Annual report. (United States)


    ..., that uses or intends to use live animals in research, tests, experiments, or for teaching. Each... names and the numbers of animals upon which teaching, research, experiments, or tests were conducted... animals upon which experiments, teaching, research, surgery, or tests were conducted involving...

  5. Analysis of cascade impactor and EPA method 29 data from the americium/curium pilot melter system

    International Nuclear Information System (INIS)

    Zamecnik, J.R.


    The offgas system of the Am/Cm pilot melter at TNX was characterized by measuring the particulate evolution using a cascade impactor and EPA Method 29. This sampling work was performed by John Harden of the Clemson Environmental Technologies Laboratory, under SCUREF Task SC0056. Elemental analyses were performed by the SRTC Mobile Laboratory.Operation of the Am/Cm melter with B2000 frit has resulted in deposition of PbO and boron compounds in the offgas system that has contributed to pluggage of the High Efficiency Mist Eliminator (HEME). Sampling of the offgas system was performed to quantify the amount of particulate in the offgas system under several sets of conditions. Particulate concentration and particle size distribution were measured just downstream of the melter pressure control air addition port and at the HEME inlet. At both locations, the particulate was measured with and without steam to the film cooler while the melter was idled at about 1450 degrees Celsius. Additional determinations were made at the melter location during feeding and during idling at 1150 degrees Celsius rather than 1450 degrees Celsius (both with no steam to the film cooler). Deposition of particulates upstream of the melter sample point may have, and most likely did occur in each run, so the particulate concentrations measured do no necessarily reflect the total particulate emission at the melt surface. However, the data may be used in a relative sense to judge the system performance

  6. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.


    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  7. Chromatographic studies of the lanthanide element separation for the americium/curium large scale separation using ion exchange resins

    International Nuclear Information System (INIS)

    Ginisty, Claude.


    The Am/Cm large scale separations, operated by chromatography with the use of ion exchange resins, are described by numerous publications. The bibliographic studies allow to retain the followed points: use of sulfonate cationic resins, development by elution with the α-hydroxyisobutyric acid, column loadings between 1 and 30% of the capacity, possibility to use no radioactive lanthanides prior to actinides for trial purposes. The optimisation of such a process is the major part of this thesis. This point is realised by introducing a new definition for the resolution, for non symmetrical elution peaks, and a measure of this dissymmetry by introducing a shape factor F. For the separation itself and for the pressure drop in the column, the influence of the following parameters are studied: composition of the elution solution (concentration and pH), column temperature (20 to 90 0 C), resin size (9 to 27 μm), rate flow of mobile phase (70 -2 .mn -1 ), column length and diameter. Symmetrical elution peaks may be obtained, even with a 27% loading. Elution conditions may be modified during the separation process in order to have the best recovery for the two components (1,3 [fr

  8. Use of curium neutron flux from head-end pyroprocessing subsystems for the High Reliability Safeguards methodology

    Energy Technology Data Exchange (ETDEWEB)

    Borrelli, R.A., E-mail:


    The deployment of nuclear energy systems (NESs) is expanding around the world. Nations are investing in NESs as a means to establish energy independence, grow national economies, and address climate change. Transitioning to the advanced nuclear fuel cycle can meet growing energy demands and ensure resource sustainability. However, nuclear facilities in all phases of the advanced fuel cycle must be ‘safeguardable,’ where safety, safeguards, and security are integrated into a practical design strategy. To this end, the High Reliability Safeguards (HRS) approach is a continually developing safeguardability methodology that applies intrinsic design features and employs a risk-informed approach for systems assessment that is safeguards-motivated. Currently, a commercial pyroprocessing facility is used as the example system. This paper presents a modeling study that investigates the neutron flux associated with processed materials. The intent of these studies is to determine if the neutron flux will affect facility design, and subsequently, safeguardability. The results presented in this paper are for the head-end subsystems in a pyroprocessing facility. The collective results from these studies will then be used to further develop the HRS methodology.

  9. Spectroscopic studies on the interaction of europium(III) and curium(III) with components of the human mucosa

    Energy Technology Data Exchange (ETDEWEB)

    Wilke, Claudia; Barkleit, Astrid [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Div. Chemistry of the F-Elements


    To evaluate the health risks of lanthanides (Ln) and radiotoxic actinides (An) in case of ingestion accidents etc., investigations into the chemical reactions of these metals in the human gastrointestinal tract are necessary. Our previous study revealed that mucin, an important part of the protective mucosa layer in the digestive system, shows a strong interaction with Eu(III). Based on these results, the present study focuses on the components of this glycoprotein and identified N-acetylneuraminic acid (NANA) as the dominant binding carbohydrate of mucin. TRLFS measurements suggest the formation of a 1: 1 complex with log β of 3.2 ± 0.1 for Eu(III) and 3.3 ± 0.1 for Cm(III), respectively.

  10. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.


    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  11. The fission cross sections of /sup 230/Th, /sup 232/Th, /sup 233/U, /sup 234/U, /sup 236/U, /sup 238/U, /sup 237/Np, /sup 239/Pu and /sup 242/Pu relative /sup 235/U at 14. 74 MeV neutron energy

    Energy Technology Data Exchange (ETDEWEB)

    Meadows, J.W.


    The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.

  12. 8 CFR 236.1 - Apprehension, custody, and detention. (United States)


    ... safety of other persons or of property. If an alien meets this burden, the alien must further demonstrate... Kiribati Kuwait Kyrgyzstan Malaysia Malta Mauritius Moldova Mongolia Nigeria Philippines Poland 4 4...

  13. 49 CFR Appendix B to Part 236 - Risk Assessment Criteria (United States)


    ... designated life-cycle of the product. Each risk metric for the proposed product must be expressed with an... as applicable; (2) Train movement density for freight, work, and passenger trains where applicable..., transient, and intermittent faults accounting for the fault coverage of the integrated hardware/software...

  14. 48 CFR 852.236-80 - Subcontracts and work coordination. (United States)


    ... conflict in location or elevation of any of the utilities with themselves, with structural items or with other construction items, he/she shall bring this conflict to the attention of the contracting officer immediately. In doing so, the contractor shall explain the proposed method of solving the problem or shall...

  15. All projects related to | Page 236 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Revenue and Health Impacts of Restructuring Tobacco Excise Tax in the Philippines ... have implications for tobacco control and consumption, and public health, ... Region: North and Central America, South America, Argentina, Bolivia, Brazil ...

  16. 18 CFR 367.2360 - Account 236, Taxes accrued. (United States)


    ..., the basis for the accrual, the accounts to which charged, and the amount of tax paid. ... accrued. (a) This account must be credited with the amount of taxes accrued during the accounting period... date of the balance sheet, must be shown under account 165, Prepayments (§ 367.1650). (b) If accruals...

  17. 49 CFR 236.913 - Filing and approval of PSPs. (United States)


    ... Administrator for Safety considers the following applicable factors when evaluating the risk assessment: (i) The... product; (vi) The extent to which identified faults are effectively addressed; (vii) Whether the risk... concludes it is necessary based upon consideration of the following factors: (i) Those factors listed in...

  18. 49 CFR 236.929 - Training specific to roadway workers. (United States)


    ... themselves or roadway work groups. (b) What subject areas must roadway worker training include? (1... control equipment in establishing protection for roadway workers and their equipment. (2) Instruction for roadway workers must ensure recognition of processor-based signal and train control equipment on the...

  19. 49 CFR 236.1049 - Training specific to roadway workers. (United States)


    ... who provide protection for themselves or roadway work groups. (b) Training subject areas. (1... control equipment in establishing protection for roadway workers and their equipment. (2) Instruction for... recognition of processor-based signal and train control equipment on the wayside and an understanding of how...

  20. 49 CFR 236.907 - Product Safety Plan (PSP). (United States)


    ... addressed during the life cycle of the product, including maximum threshold limits for each hazard (for... accordance with other criteria if demonstrated to the satisfaction of the Associate Administrator for Safety... contractor employees and supervisors necessary to ensure the safe and proper installation, implementation...

  1. Permitting plan for project W-236B, initial pretreatment module

    International Nuclear Information System (INIS)

    Tollefson, K.S.


    The Tank Waste Remediation System pretreatment process mission is to separate high-level and low-level waste fractions. A comprehensive review of environmental regulations has indicated that several environmental reviews, permits, and approvals are required before construction and operation of the facility. This revised document provides a summary of permit application data requirements, alternative strategies for permit completion and approval, as well as the probability of success for each alternative for the Initial Pretreatment Module resulting from recent revisions to the Tri-Party Agreement

  2. 49 CFR 236.552 - Insulation resistance; requirement. (United States)


    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING THE INSTALLATION... resistance between wiring and ground of continuous inductive automatic cab signal system, automatic train...

  3. Crossflow Filtration: EM-31, WP-2.3.6

    International Nuclear Information System (INIS)

    Duignan, M.; Nash, C.; Poirier, M.


    In the interest of accelerating waste treatment processing, the DOE has funded studies to better understand filtration with the goal of improving filter fluxes in existing crossflow equipment. The Savannah River National Laboratory (SRNL) performed some of those studies, with a focus on start-up techniques, filter cake development, the application of filter aids (cake forming solid precoats), and body feeds (flux enhancing polymers). This paper discusses the progress of those filter studies. Crossflow filtration is a key process step in many operating and planned waste treatment facilities to separate undissolved solids from supernate solutions. This separation technology generally has the advantage of self-cleaning through the action of wall shear stress created by the flow of waste slurry through the filter tubes. However, the ability of filter wall self-cleaning depends on the slurry being filtered. Many of the alkaline radioactive wastes are extremely challenging to filtration, e.g., those containing compounds of aluminum and iron, which have particles whose size and morphology reduce permeability. Unfortunately, low filter flux can be a bottleneck in waste processing facilities such as the Savannah River Integrated Salt Disposition Process and the Hanford Waste Treatment Plant. Any improvement to the filtration rate would lead directly to increased throughput of the entire process. To date increased rates are generally realized by either increasing the crossflow filter feed flow rate, limited by pump capacity, or by increasing filter surface area, limited by space and increasing the required pump load. SRNL set up both dead-end and crossflow filter tests to better understand filter performance based on filter media structure, flow conditions, filter cleaning, and several different types of filter aids and body feeds. Using non-radioactive simulated wastes, both chemically and physically similar to the actual radioactive wastes, the authors performed several tests to evaluate methods to improve filter performance. With the proper use of filter flow conditions and filter enhancers, filter flow rates can be increased over rates currently realized today. Experiments that use non-radioactive simulants for actual waste always carry the inherent risk of not eliciting prototypic results; however, they will assist in focusing the scope needed to minimize radioactive testing and thus maximize safety. To that end this investigation has determined: (1) Waste simulant SB6 was found to be more challenging to filtration than a SRS Tank 8F simulant; (2) Higher solids concentration presents a greater challenge to filtration; (3) Filter cake is something that should be properly developed in initial filter operation; (4) Backpulsing is not necessary to maintain a good filter flux with salt wastes; (5) Scouring a filter without cleaning will lead to improved filter performance; (6) The presence of a filter cake can improve the solids separation by an order of magnitude as determined by turbidity; (7) A well developed cake with periodic scouring may allow a good filter flux to be maintained for long periods of time; and (8) Filtrate flux decline is reversible when the concentration of the filtering slurry drops and the filter is scoured.

  4. 49 CFR 236.909 - Minimum performance standard. (United States)


    ...://; (ii) The product is... exposure must be expressed as total train miles traveled per year over the relevant railroad infrastructure...

  5. 48 CFR 852.236-88 - Contract changes-supplement. (United States)


    ... small tools, incidental job burdens, and general home office expenses and no separate allowance will be... contractor shall submit proposals for changes in work to the resident engineer. Proposals, to be submitted as..., labor costs (separated into trades), construction equipment, etc. (Labor costs are to be identified with...

  6. 48 CFR 52.236-7 - Permits and Responsibilities. (United States)


    ... obtaining any necessary licenses and permits, and for complying with any Federal, State, and municipal laws... negligence. The Contractor shall also be responsible for all materials delivered and work performed until...

  7. Plutonium reclamation facility (PRF, building 236-Z) layup plan

    International Nuclear Information System (INIS)



    This document reviews each system inside PRF to determine the operation and maintenance requirements necessary to maintain safe and predictable system performance for facility systems needed to remain operational while minimizing the maintenance and surveillance being performed. Also covered are the actions required to place PRF in a safe layup configuration while minimizing hazards and taking into account the need for reactivation of certain equipment when cleanup work commences in the future

  8. 42 CFR 456.236 - Continued stay review process. (United States)


    ... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals Ur Plan... each continued stay of a recipient in the mental hospital, the committee, subgroup or designee reviews... committee, subgroup or designee finds that a recipient's continued stay in the mental hospital is needed...

  9. 49 CFR 236.23 - Aspects and indications. (United States)


    ... shown by the position of semaphore blades, color of lights, position of lights, flashing of lights, or... light, shape and color of semaphore blades or any combination thereof, subject to the following...; day aspects by lights or semaphore arms. A single white light shall not be used. (2) Reflector lenses...

  10. 40 CFR 180.236 - Triphenyltin hydroxide; tolerances for residues. (United States)


    ....0 Cattle, fat 0.2 Cattle, kidney 2.0 Cattle, liver 4.0 Cattle, meat 0.5 Goat, fat 0.2 Goat, kidney 2.0 Goat, liver 4.0 Goat, meat 0.5 Hog, fat 0.3 Hog, meat 0.06 Hog, meat byproducts 0.3 Horse, fat 0.2 Horse, kidney 2.0 Horse, liver 4.0 Horse, meat 0.5 Milk 0.06 Pecan 0.05 Potato 0.05 Sheep, fat 0.2 Sheep...

  11. 48 CFR 852.236-87 - Accident prevention. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Accident prevention. 852... Accident prevention. As prescribed in 836.513, insert the following clause: Accident Prevention (SEP 1993) The Resident Engineer on all assigned construction projects, or other Department of Veterans Affairs...

  12. Dicty_cDB: VHH236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *vikqrlpri tlinyqlyhlisqiqhpihqw*islinsfksilivilkrlpvfwlqrn*eqskkptikal krvknyqnffnln*YLSSRPIDTWRLMSVHYQNYQH...kqywqvqmkrmhgkefwrdqrlqihiifpdyi*wmnimi*vikqrlpri tlinyqlyhlisqiqhpihqw*islinsfksilivilkrlpvfwlqrn*eqskkptikal

  13. Worldwide Report, Telecommunications Policy, Research and Development, No. 236

    National Research Council Canada - National Science Library


    This report contains information concerning the telecommunications policy, research and development of the following countries: (1) Australia, (2) Argentina, (3) Madagascar, (4) South Africa, (5) Zaire, (6...

  14. 236 Effective Social Work Practice in Lagos: An Emerging

    African Journals Online (AJOL)



    Oct 17, 2010 ... social work profession; institutional perspective is the modern approach that is currently put in place, that ... Lagos had for long been in the fore-front of the development of social work in Nigeria .... organization has crises within or without or both; ... newly learnt ways of solving problems, so, learning effective.

  15. 49 CFR 236.0 - Applicability, minimum requirements, and penalties. (United States)


    ... persons, or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed... state law seeking damages for personal injury, death, or property damage alleging that a party has... 49 Transportation 4 2010-10-01 2010-10-01 false Applicability, minimum requirements, and penalties...

  16. Kinetic-energy distribution for symmetric fission of 236U

    International Nuclear Information System (INIS)

    Brissot, R.; Bocquet, J.P.; Ristori, C.; Crancon, J.; Guet, C.R.; Nifenecker, H.A.; Montoya, M.


    Fission fragment kinetic-energy distributions have been measured at the Grenoble high-flux reactor with the Lohengrin facility. Spurious events were eliminated in the symmetric region by a coherence test based on a time-of-flight measurement of fragment velocities. A Monte-Carlo calculation is then performed to correct the experimental data for neutron evaporation. The difference between the most probable kinetic energy in symmetric fission and the fission in which the heavy fragment is 'magic' (Zsub(H)=50) is found to be approximately =30 MeV. The results suggest that for the symmetric case the total excitation energy available at scission is shared equally among the fragments. (author)

  17. 48 CFR 52.236-4 - Physical Data. (United States)


    ..., such as surveys, auger borings, core borings, test pits, probings, test tunnels]. (b) Weather... fixed-price construction contract is contemplated and physical data (e.g., test borings, hydrographic...

  18. 33 CFR 236.5 - Policy and procedure. (United States)


    ... manage when directly integrated with the implementation or management of the water resource development... created by a water resource development to be recommended for implementation by the Corps of Engineers. (3... DEFENSE WATER RESOURCE POLICIES AND AUTHORITIES: CORPS OF ENGINEERS PARTICIPATION IN IMPROVEMENTS FOR...

  19. 49 CFR 236.701 - Application, brake; full service. (United States)


    ... a split reduction in brake pipe pressure at a service rate until maximum brake cylinder pressure is developed. As applied to an automatic or electro-pneumatic brake with speed governor control, an application other than emergency which develops the maximum brake cylinder pressure, as determined by the design of...

  20. 236 basis of osteological characters. Tandy & Keith (1972) place this ...

    African Journals Online (AJOL)

    pocket of warm water, but is nevertheless within the range of the living species in the Mediter- ranean and West Africa (KcnsIey 1974: 211). D. Cram (in litt.) suggests that larvae overdue for metamorphosis might have found a warm-water patch, settled, but might be unable to reproduce due to the generally low temperatures.

  1. 49 CFR 236.205 - Signal control circuits; requirements. (United States)


    ..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Automatic... car, (b) When points of a switch are not closed in proper position, (c) When an independently operated...

  2. 48 CFR 852.236-91 - Special notes. (United States)


    ... buildings, structures, and communications facilities, or other engineering projects, including furnishing... contracts), organization (including company officers), technical qualifications, financial resources and... system component having functional or physical characteristics different from those indicated or...

  3. 8 CFR 236.3 - Detention and release of juveniles. (United States)


    ... parent, close relative, a friend, or to an organization found on the free legal services list. A juvenile... must in fact communicate either with a parent, adult relative, friend, or with an organization found on... parent; (ii) Legal guardian; or (iii) An adult relative (brother, sister, aunt, uncle, grandparent) who...

  4. 48 CFR 452.236-77 - Emergency Response. (United States)


    ... contracts: Emergency Response (NOV 1996) (a) Contractor's Responsibility for Fire Fighting. (1) The... emergency work (anticipated to be restricted to fire fighting). An equitable adjustment for the temporary... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Emergency Response. 452...

  5. 48 CFR 652.236-70 - Accident Prevention. (United States)


    ..., toxic, reactive or unstable, or any operations which creates any kind of contamination inside an... be responsible for its subcontractors' compliance with this clause. (d) Written program. Before... develop a mutual understanding relative to administration of the overall safety program. (e) Notification...


    Energy Technology Data Exchange (ETDEWEB)

    Duignan, M.; Nash, C.; Poirier, M.


    In the interest of accelerating waste treatment processing, the DOE has funded studies to better understand filtration with the goal of improving filter fluxes in existing crossflow equipment. The Savannah River National Laboratory (SRNL) performed some of those studies, with a focus on start-up techniques, filter cake development, the application of filter aids (cake forming solid precoats), and body feeds (flux enhancing polymers). This paper discusses the progress of those filter studies. Crossflow filtration is a key process step in many operating and planned waste treatment facilities to separate undissolved solids from supernate solutions. This separation technology generally has the advantage of self-cleaning through the action of wall shear stress created by the flow of waste slurry through the filter tubes. However, the ability of filter wall self-cleaning depends on the slurry being filtered. Many of the alkaline radioactive wastes are extremely challenging to filtration, e.g., those containing compounds of aluminum and iron, which have particles whose size and morphology reduce permeability. Unfortunately, low filter flux can be a bottleneck in waste processing facilities such as the Savannah River Integrated Salt Disposition Process and the Hanford Waste Treatment Plant. Any improvement to the filtration rate would lead directly to increased throughput of the entire process. To date increased rates are generally realized by either increasing the crossflow filter feed flow rate, limited by pump capacity, or by increasing filter surface area, limited by space and increasing the required pump load. SRNL set up both dead-end and crossflow filter tests to better understand filter performance based on filter media structure, flow conditions, filter cleaning, and several different types of filter aids and body feeds. Using non-radioactive simulated wastes, both chemically and physically similar to the actual radioactive wastes, the authors performed several tests to evaluate methods to improve filter performance. With the proper use of filter flow conditions and filter enhancers, filter flow rates can be increased over rates currently realized today. Experiments that use non-radioactive simulants for actual waste always carry the inherent risk of not eliciting prototypic results; however, they will assist in focusing the scope needed to minimize radioactive testing and thus maximize safety. To that end this investigation has determined: (1) Waste simulant SB6 was found to be more challenging to filtration than a SRS Tank 8F simulant; (2) Higher solids concentration presents a greater challenge to filtration; (3) Filter cake is something that should be properly developed in initial filter operation; (4) Backpulsing is not necessary to maintain a good filter flux with salt wastes; (5) Scouring a filter without cleaning will lead to improved filter performance; (6) The presence of a filter cake can improve the solids separation by an order of magnitude as determined by turbidity; (7) A well developed cake with periodic scouring may allow a good filter flux to be maintained for long periods of time; and (8) Filtrate flux decline is reversible when the concentration of the filtering slurry drops and the filter is scoured.

  7. 48 CFR 52.236-5 - Material and Workmanship. (United States)


    ... specifically provided in this contract. References in the specifications to equipment, material, articles, or... equipment, material, article, or process that, in the judgment of the Contracting Officer, is equal to that... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Material and Workmanship...

  8. 7 CFR 23.6 - Plan of Work. (United States)


    ... relationship of this program to ongoing planning and development efforts. (3) The organizational structure for... research program techniques, and organizational structure for planning and conducting each program... separate concise statement describing specific extension projects to be funded under each program. The...

  9. Dicty_cDB: SSD236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EVHVMGRIKKRPESYNPKFSFILDPD TITFFAMAIEVCDASTIYVEDHLDEACGAFLPGCFWCPWSSKLTREIKV*tirvklnss* lnliklnt*ifnnkvy*tkvfikk Frame B: ---pmvtimil...fsn*qipkkfkwpeifclerkamkfm*wvelkrdlkaiiqsfplfltqi qshflp

  10. Prompt neutrons from {sup 236}U fission fragments

    Energy Technology Data Exchange (ETDEWEB)

    Boldeman, J W; Musgrove, A.R. de L.; Walsch, R L


    Measurements were made of prompt neutron emission in the thermal neutron fission of {sup 235}U. The mean neutron emission per fragment was obtained for particular values of the fragment mass and total kinetic energy. A direct neutron counting method was employed and a comparison made with data from previous experiments of this type. (author)

  11. Transuranium analysis methodologies for biological and environmental samples

    International Nuclear Information System (INIS)

    Wessman, R.A.; Lee, K.D.; Curry, B.; Leventhal, L.


    Analytical procedures for the most abundant transuranium nuclides in the environment (i.e., plutonium and, to a lesser extent, americium) are available. There is a lack of procedures for doing sequential analysis for Np, Pu, Am, and Cm in environmental samples, primarily because of current emphasis on Pu and Am. Reprocessing requirements and waste disposal connected with the fuel cycle indicate that neptunium and curium must be considered in environmental radioactive assessments. Therefore it was necessary to develop procedures that determine all four of these radionuclides in the environment. The state of the art of transuranium analysis methodology as applied to environmental samples is discussed relative to different sample sources, such as soil, vegetation, air, water, and animals. Isotope-dilution analysis with 243 Am ( 239 Np) and 236 Pu or 242 Pu radionuclide tracers is used. Americium and curium are analyzed as a group, with 243 Am as the tracer. Sequential extraction procedures employing bis(2-ethyl-hexyl)orthophosphoric acid (HDEHP) were found to result in lower yields and higher Am--Cm fractionation than ion-exchange methods

  12. Chemical speciation of strontium, americium, and curium in high level waste: Predictive modeling of phase partitioning during tank processing. Annual progress report, October 1996--September 1997

    International Nuclear Information System (INIS)

    Choppin, G.; Felmy, A.R.


    'The program at Florida State University was funded to collaborate with Dr. A. Felmy (PNNL) on speciation in high level wastes and with Dr. D. Rai (PNNL) on redox of Pu under high level waste conditions. The funding provided support for 3 research associates (postdoctoral researchers) under Professor G. R. Choppin as P.I. Dr. Kath Morris from U. Manchester (Great Britain), Dr. Dean Peterman and Dr. Amy Irwin (both from U. Cincinnati) joined the laboratory in the latter part of 1996. After an initial training period to become familiar with basic actinide chemistry and radiochemical techniques, they began their research. Dr. Peterman was assigned the task of measuring Th-EDTA complexation prior to measuring Pu(IV)-EDTA complexation. These studies are associated with the speciation program with Dr. Felmy. Drs. Morris and Irwin initiated research on redox of plutonium with agents present in the Hanford Tanks as a result of radiolysis or from use in separations. The preliminary results obtained thus far are described in this report. It is expected that the rate of progress will continue to increase significantly as the researchers gain more experience with plutonium chemistry.'

  13. The distribution of plutonium, americium and curium isotopes in pond and stream sediments of the Savannah River Plant, South Carolina, USA

    International Nuclear Information System (INIS)

    Alberts, J.J.; Halverson, J.E.; Orlandini, K.A.


    The concentrations of 238 Pu, 239 , 240 Pu, 241 Am and 244 Cm were determined in sediment samples from five streams and two ponds on the Savannah River Plant (SRP) and in four sediment samples from the Savannah River above and below the plant site. The following concentration ranges were determined: 238 Pu, 0.07-386 fCi g -1 ; 239 , 240 Pu, 0.37-1410 fCi g -1 ; 241 Am, 0.1-4360 fCi g -1 ; 244 Cm, -1 . Comparisons of the elemental and isotopic ratios of the sediments show that the majority of the sediments studied have been impacted upon by plant operations and that sediments outside the plant boundary in the Savannah River have only been influenced by aerial releases. Atom ratios of 240 Pu/ 239 Pu indicate that up to 86% of the Pu in these sediments is derived from plant operations. However, comparisons of the concentration data with values for other impacted sediments near nuclear facilities indicate that the levels are relatively small. Finally, <13% of the Pu, Am or Cm in pond sediments is associated with humic or fulvic acids, indicating that little of the material should be remobilized in oxic environments through organic complexation. (author)

  14. Structural characterisations and mechanistic investigations of the selective dissolution of americium by the ferricyanide ions in alkaline media. Application for the partitioning americium curium

    International Nuclear Information System (INIS)

    Fouchard, Sebastien


    Americium exhibits a high solubility form in basic media under oxidant conditions, unlike the other Transplutonium elements (TPE). This property can be used in the frame of High Level Liquid Waste (HLLW) treatment in order to extract preferentially the americium element, the main responsible of the long term radiotoxicity of the nuclear waste. This soluble compound can be obtained by addition of a concentrated basic solution of Fe(CN) 6 3- ions on Am(OH) 3 precipitates. This technique enables a rapid extraction of Am by the synthesis of this soluble form in alkaline solutions. Under these conditions, the other TPE remain in the solid state as trivalent hydroxide solids, strongly insoluble. In the case of dissolutions involving large amounts of Am(OH) 3 , the formation of the soluble complex is concomitant with the appearance of a reddish precipitate in the basic solution. Dissolution experiments which were carried out on this solid in NaOH/Fe(CN) 6 3- have demonstrated the dependency of the solubility equilibria with the media. Spectroscopic studies (UV Visible, XAS) on the precipitate have enabled the determination of the chemical structure and the oxidation state of the americium in the solid: Na 2 Am(V)O 2 (OH) 3 ,nH 2 O. Electrochemical studies on the americium solution have confirmed that the oxidation of Am(OH) 3 by the Fe(CN) 6 3- ions in basic media could only lead to the pentavalent form. A stoichiometric study carries out between a AmO 2 + ion and one Fe(CN) 6 3- ion and the spectroscopic characterisation of this reaction have demonstrated that the Fe(CN) 6 3- ion didn't remain as an un-complexed form in solution after the alkaline mixing. These results tend to prove that this dissolution of Am(OH) 3 is much more complex than a simple oxidation by the Fe(CN) 6 3- ions. The existence of molecular interactions between AmO 2 + and Fe(CN) 6 3- has been postulated and a mechanistic scheme has been proposed in order to explain the appearance of the soluble form of Am in basic ferricyanide media. (author) [fr

  15. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.


    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  16. Luminescence study on solvation of americium(III), curium(III) and several lanthanide(III) ions in nonaqueous and binary mixed solvents

    International Nuclear Information System (INIS)

    Kimura, T.; Nagaishi, R.; Kato, Y.; Yoshida, Z.


    The luminescence lifetimes of An(III) and Ln(III) ions [An=Am and Cm; Ln=Nd, Sm, Eu, Tb and Dy] were measured in dimethyl sulfoxide(DMSO), N,N-dimethylformamide(DMF), methanol(MeOH), water and their perdeuterated solvents. Nonradiative decay rates of the ions were in the order of H 2 O > MeOH > DMF > DMSO, indicating that O-H vibration is more effective quencher than C-H, C=O, and S=O vibrations in the solvent molecules. Maximal lifetime ratios τ D /τ H were observed for Eu(III) in H 2 O, for Sm(III) in MeOH and DMF, and for Sm(III) and Dy(III) in DMSO. The solvent composition in the first coordination sphere of Cm(III) and Ln(III) in binary mixed solvents was also studied by measuring the luminescence lifetime. Cm(III) and Ln(III) were preferentially solvated by DMSO in DMSO-H 2 O, by DMF in DMF-H 2 O, and by H 2 O in MeOH-H 2 O over the whole range of the solvent composition. The order of the preferential solvation, i.e., DMSO > DMF > H 2 O > MeOH, correlates with the relative basicity of these solvents. The Gibbs free energy of transfer of ions from water to nonaqueous solvents was further estimated from the degree of the preferential solvation. (orig.)

  17. Experimental model of ultrasound thermotherapy in rats inoculated with Walker-236 tumor Modelo experimental de termoterapia ultrassônica em ratos inoculados com tumor de Walker-236

    Directory of Open Access Journals (Sweden)

    José Antonio Carlos Otaviano David Morano


    Full Text Available PURPOSE: To develop a model to evaluate the effects of focal pulsed ultrasound (US waves as a source of heat for treatment of murine subcutaneous implanted Walker tumor. METHODS: An experimental, controlled, comparative study was conducted. Twenty male Wistar rats (160-300 g randomized in 2 equal groups (G-1: Control and G-2: Hyperthermia were inoculated with Walker-256 carcinosarcoma tumor. After 5 days G-2 rats were submitted to 45ºC hyperthermia. Heat was delivered directly to the tumor by an ultrasound (US equipment (3 MHz frequency, 1,5W/cm³. Tumor temperature reached 45º C in 3 minutes and was maintained at this level for 5 minutes. Tumor volume was measured on days 5, 8, 11, 14 e 17 post inoculation in both groups. Unpaired t-test was used for comparison. POBJETIVO: Desenvolver um modelo para avaliar os efeitos do ultra-som focal pulsado como fonte de calor para o tratamento de tumores de Walker subcutâneos implantados em ratos. MÉTODOS: Um estudo experimental, controlado, comparativo foi realizado. Vinte ratos Wistar machos (160-300 g divididos em dois grupos (G-1: Controle e G-2: hipertermia foram inoculados com tumor de Walker carcinossarcoma-256. Após cinco dias os ratos do grupo G-2 ratos foram submetidos a hipertermia (45ºC. O calor foi aplicado diretamente no tumor por um equipamento de ultrassonografia (3 MHz, 1,5 W/cm³. A temperatura no tumor atingiu 45ºC em 3 minutos e foi mantida nesse nível por 5 minutos. O volume do tumor foi medido nos dias 5, 8, 11, 14 e 17 após a inoculação, em ambos os grupos. Teste t não pareado foi utilizado para comparação. P <0,05 foi considerado significante. RESULTADOS: O volume do tumor foi significativamente maior no 5º dia e diminuiu nos dias 11, 14 e 17 nos ratos tratados. Animais submetidos à hipertermia sobreviveram mais tempo que os animais do grupo controle. No 29º dia após a inoculação do tumor, 40% dos ratos do grupo controle e 77,78% dos ratos tratados com hipertermia permaneceram vivos. CONCLUSÃO: Os resultados obtidos mostram que o modelo proposto é bastante simples e pode ser utilizado em laboratórios menos sofisticados para estudar os efeitos da hipertermia focal no tratamento dos tumores malignos implantados ou em estudos de sobrevida.

  18. Järve Keskus : Tallinn, Pärnu mnt. 236 = Järve Centre : 236 Pärnu Rd., Tallinn / Jaak Huimerind

    Index Scriptorium Estoniae

    Huimerind, Jaak, 1957-


    Projekteerija: Arhitektuuribüroo Studio Paralleel. Arhitektid Jaak Huimerind, Indrek Saarepera. Kaastöötajad Kristi Põldme, Indrek Laos, Reet Viigipuu. Avalike ruumide sisekujundus: Mari Kurismaa. Konstruktiivne osa: E-Inseneribüroo. Projekt 2000-2002, valmis 2002. Asendi-, I ja II korruse plaan, 6 vaadet

  19. Extractability of plutonium-238 and curium-242 from a contaminated soil as a function of pH and certain soil components. CH3COOH-NH4OH system

    International Nuclear Information System (INIS)

    Nishita, H.


    Extractability of 238 Pu and 242 Cm from an artificially contaminated soil as a function of pH and certain soil components was examined with an equilibrium batch technique by the use of a CH 3 COOH--NH 4 OH extracting system. The influence of various soil components on 238 Pu and 242 Cm extractability was determined indirectly by selective removal of the components from the soil. The soil organic matter appeared to have a major influence on the extractability of these radionuclides. Though to a lesser extent, free iron oxides exerted an influence also. Before removal of soil organic matter, the extractability curves for these radionuclides were qualitatively similar in general form. The nature of this form is discussed. Within the contaminated, untreated soil, the 238 Pu and 242 Cm extractability ranged from 0.60 to 30.8% and 0.11 to 14.83% of dose, respectively, depending on the pH of the extracting solution. The liquid-to soild-phase ratio (K'/sub d/) values ranged from 3.5 x 10 -4 to 2.7 x 10 -2 for 238 Pu and 0.9 x 10 -4 to 1.4 x 10 -2 for 242 Cm. Very low extractability occurred in the pH range from approx. 8.6 to approx. 9.7 for 238 Pu and from 7.6 to approx. 9.7 for 242 Cm

  20. Neutron-induced Fission Cross Sections of Am and Cm isotopes (Final Report of Research Contract 14485). Resonance and Fast Neutron Induced Fission Cross Sections of Americium and Curium Nuclides (Third-year Progress Report of Research Contract 14485)

    International Nuclear Information System (INIS)

    Alekseev, A.A.; Bergman, A.A.; Berlev, A.I.; Koptelov, E.A.; Egorov, A.S.; Samylin, B.F.; Trufanov, A.M.; Fursov, B.I.; Shorin, V.S.


    The neutron induced fission cross sections of Am and Cm isotopes were measured relative to 239 Pu in the neutron energy range from 1 eV to 20 keV at the INR RAS lead slowing down spectrometer LSDS-100. The fission resonance integrals were also estimated using the measured cross section data. The results have been compared with the available experimental and evaluated data. This analysis has shown the present status of the measured fission cross sections and the necessity to revise the evaluated cross sections libraries for the minor actinides. (author)

  1. 49 CFR Appendix D to Part 236 - Independent Review of Verification and Validation (United States)


    ... standards. (f) The reviewer shall analyze all Fault Tree Analyses (FTA), Failure Mode and Effects... for each product vulnerability cited by the reviewer; (4) Identification of any documentation or... not properly followed; (6) Identification of the software verification and validation procedures, as...

  2. 50 CFR 23.6 - What are the roles of the Management and Scientific Authorities? (United States)


    ... and Scientific Authorities? Under Article IX of the Treaty, each Party must designate a Management and... designated the Scientific Authority and Management Authority, which for purposes of this section includes FWS... primarily with management and regulatory issues and the Scientific Authority is responsible for dealing...

  3. 49 CFR 236.528 - Restrictive condition resulting from open hand-operated switch; requirement. (United States)


    ... SYSTEMS, DEVICES, AND APPLIANCES Automatic Train Stop, Train Control and Cab Signal Systems Rules and...-operated switch three-eighths inch or more, or hand-operated switch is not locked where facing point lock with circuit controller is used, the resultant restrictive condition of an automatic train stop or...

  4. 48 CFR 3052.236-70 - Special precautions for work at operating airports. (United States)


    ... within the existing aprons shall be the electric type of not less than 100 watts intensity placed and... electric or battery type lights. These lights and flags shall be placed so as to outline the construction...) Trucks and other motorized equipment entering the airport or construction area shall do so only over...

  5. : tous les projets | Page 236 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    inclusion sociale dans les économies émergentes (les pays BRICS) et ailleurs. Projet. Comment la science, la technologie et l'innovation peuvent-elles contribuer à la réduction de la pauvreté et au développement inclusif, en particulier au Brésil, ...

  6. 49 CFR 236.1015 - PTC Safety Plan content requirements and PTC System Certification. (United States)


    ... vendor or supplier to be addressed during the life-cycle of the PTC system, including maximum threshold... employees and supervisors necessary to ensure safe and proper installation, implementation, operation... Appendix C of this part must, to the satisfaction of the Associate Administrator, be shown to: (i) Reliably...

  7. Preliminary design requirements document (DRD) for Project W-236B, ''Initial Pretreatment Module''

    International Nuclear Information System (INIS)

    Swanson, L.M.


    The scope of this Design Requirements Document (DRD) is to identify and define the functions, with associated requirements, which must be performed to separate Hanford Site tank waste supernatants into low-level and high-level fractions. This documents sets forth function requirements, performance requirements, and design constraints necessary to begin conceptual design for the Initial Pretreatment Module (IPM). System and physical interfaces between the IPM project and the Tank Waste Remediation System (TWRS) are identified. The constraints, performance requirements, and transfer of information and data across a technical interface will be documented in an Interface Control Document. Supplemental DRDs will be prepared to provide more detailed requirements specific to systems described in the DRD

  8. Multi-Function Waste Tank Facility Quality Assurance Program Plan, Project W-236A. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Hall, L.R.


    This document describes the Quality Assurance (QA) program for the Multi-Function Waste Tank Facility (MWTF) Project. The purpose of this QA program is to control project activities in such a manner as to achieve the mission of the MWTF Project in a safe and reliable manner. The QA program for the MWTF Project is founded on DOE Order 5700.6C, Quality Assurance, and implemented through the use of ASME NQA-1, Quality Assurance Program Requirements for Nuclear Facilities (ASME 1989 with addenda la-1989, lb-1991 and lc-1992). This document describes the program and planned actions which the Westinghouse Hanford Company (WHC) will implement to demonstrate and ensure that the project meets the requirements of DOE Order 5700.6C through the interpretive guidance of ASME NQA-1.

  9. 48 CFR 252.236-7012 - Military construction on Kwajalein Atoll-evaluation preference. (United States)


    ... the laws of the Marshall Islands, that— (i) Is more than 50 percent owned by citizens of the Marshall Islands; or (ii) Complies with the following: (A) The firm has done business in the Marshall Islands on a... that complies with the following: (i) The corporate headquarters are in the United States; (ii) The...

  10. SCI 236 AGARDograph. Part Two; National Aeronautics and Space Administration Armstrong Flight Research Center Annex (United States)

    Neal, Bradford A.; Stoliker, Patrick C.


    NASA AFRC is a United States government entity that conducts the integration and operation of new and unproven technologies into proven flight vehicles as well as the flight test of one-of-a-kind experimental aircraft. AFRC also maintains and operates several platform aircraft that allow the integration of a wide range of sensors to conduct airborne remote sensing, science observations and airborne infrared astronomy. To support these types of operations AFRC has the organization, facilities and tools to support the experimental flight test of unique vehicles and conduct airborne sensing/observing.

  11. Lv et al., Afr J Tradit Complement Altern Med. (2016) 13(2):229-236 ...

    African Journals Online (AJOL)


    substantial protection against HIE, however, 40 mg of MF exhibit superior neuroprotection in equivalence with 20 mg of MF. Conclusion: The results of the present study distinctly proving the beneficial effect of MF against HIE by concomitantly improving neuronal count and antioxidant status. Hence, we recommend MF ...

  12. 78 FR 19192 - Foreign-Trade Zone 236-Palm Springs, California; Application for Reorganization and Expansion... (United States)


    ... area'' in the context of the Board's standard 2,000-acre activation limit for a zone. The application... includes the following sites: Site 1 (902 acres)--Palm Springs International Airport, 3400 E. Tahquitz Canyon Way, 410 N. Farrell Drive, 820 Research Drive and adjacent Gene Autry Business Park, Palm Springs...

  13. Dynamic Studies of Struve Double Stars: STF4 and STF 236AB Appear Gravitationally Bound (United States)

    Wiley, E. O.; Rica, F. M.


    Dynamics of two Struve double stars, WDS 00099+0827 (STF 4) and WDS 02556+2652 (STF 326 AB) are analyzed using astrometric criteria to determine their natures as gravitationally bound or unbound systems. If gravitationally bound, then observed relative velocity will be within limits according to the orbital energy conservation equation. Full implementation of this criterion was possible because the relative radial velocities as well as proper motions have been estimated. Other physical parameters were taken from literature or estimated using published protocols. Monte Carlo analysis indicates that both pairs have a high probability of being gravitationally bound and thus are long-period binaries.

  14. 48 CFR 52.236-11 - Use and Possession Prior to Completion. (United States)


    ... possession or use shall not be deemed an acceptance of any work under the contract. (b) While the Government... adjustment shall be made in the contract price or the time of completion, and the contract shall be modified...

  15. Source identification of Pu and 236U deposited on Norwegian territories


    Wendel, Cato Christian


    Plutonium (Pu) is a predominately anthropogenic element produced during neutron irradiation of U in reactors and nuclear weapon detonations. Pu has been released to the environment during nuclear weapon detonations, nuclear reactor accidents, and in association with reprocessing of spent nuclear fuel. The most important source of Pu in the environment were the 543 atmospheric nuclear detonations conducted worldwide in the period 1945 – 1980 by the former Soviet Union (FSU), USA, United Kingdo...

  16. 49 CFR 236.203 - Hand operated crossover between main tracks; protection. (United States)


    ...) Electric locking of the switches of the crossover. Signals governing movements over either switch shall... crossover is occupied by a train, locomotive or car in such a manner as to foul the main track. It shall not... electric locking releases. ...

  17. 49 CFR 236.1005 - Requirements for Positive Train Control systems. (United States)


    .... (4) The control circuit or electronic equivalent for all movement authorities over any switches... device operated directly by the switch points, derail, or by switch locking mechanism, or through relay or electronic device controlled by such circuit controller or functionally equivalent device, for...

  18. 49 CFR Appendix C to Part 236 - Safety Assurance Criteria and Processes (United States)


    ...-safe design concept. Intrinsically fail-safe hardware circuits or systems are those that employ... system (all its elements including hardware and software) must be designed to assure safe operation with...; human errors that could impact hardware design; unsafe conditions that could occur because of an...

  19. 48 CFR 52.236-21 - Specifications and Drawings for Construction. (United States)


    ... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of... shown on the drawings and not mentioned in the specifications, shall be of like effect as if shown or..., diagrams, layouts, schematics, descriptive literature, illustrations, schedules, performance and test data...

  20. Supplemental design requirements document, Multifunction Waste Tank Facility, Project W-236A. Revision 1

    International Nuclear Information System (INIS)

    Groth, B.D.


    The Multi-Function Waste Tank Facility (MWTF) consists of four, nominal 1 million gallon, underground double-shell tanks, located in the 200-East area, and two tanks of the same capacity in the 200-West area. MWTF will provide environmentally safe storage capacity for wastes generated during remediation/retrieval activities of existing waste storage tanks. This document delineates in detail the information to be used for effective implementation of the Functional Design Criteria requirements

  1. Ajeigbe et al., Afr J Tradit Complement Altern Med. (2013) 10(5):236 ...

    African Journals Online (AJOL)


    major source of drug development in the pharmaceutical industry (Burton et al., 1983). Several plants are ... Okoli et al., 2007). In South-eastern Nigeria, leaves of this plant is claimed to be ..... Table 4.1: Haematological Profile of Rats Administered with Different Concentrations of Aqueous Extract of Aspilia africana. GROUP.

  2. Sexospécificités | Page 236 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    A website is helping Southeast Asian women earn an income and balance their work and home lives. Called eHomemakers, it is Southeast ... Researchers supported by IDRC guided the first families into this new venture when the construction of a hydro dam flooded the area in 1982. Read more about Fish cage culture ...

  3. 48 CFR 1252.236-70 - Special precautions for work at operating airports. (United States)


    ... working condition at all times other than daylight hours. The hour of beginning and the hour of ending of... shall be marked by yellow flags during daylight hours and by red lights at other times. The red lights... less than 100 watts intensity placed and supported as required. All other construction markings on...

  4. Book Symposium: Duncan Pritchard, Epistemic Angst (Princeton University Press, 2015, xiii + 236 pages

    Directory of Open Access Journals (Sweden)

    Duncan Pritchard

    Full Text Available ABSTRACT This book symposium features three critical pieces dealing with Duncan Pritchard's book, 'Epistemic Angst'; the symposium also contains Pritchard's replies to his critics.

  5. 49 CFR 236.340 - Electromechanical interlocking machine; locking between electrical and mechanical levers. (United States)


    ... Electromechanical interlocking machine; locking between electrical and mechanical levers. In electro-mechanical interlocking machine, locking between electric and mechanical levers shall be maintained so that mechanical... 49 Transportation 4 2010-10-01 2010-10-01 false Electromechanical interlocking machine; locking...

  6. 49 CFR 236.1006 - Equipping locomotives operating in PTC territory. (United States)


    ... 31, 2015, a train controlled by a locomotive with an onboard PTC apparatus that has failed en route... III railroad, including a tourist or excursion railroad, and controlled by a locomotive not equipped...

  7. Multi-Function Waste Tank Facility Quality Assurance Program Plan, Project W-236A. Revision 2

    International Nuclear Information System (INIS)

    Hall, L.R.


    This document describes the Quality Assurance (QA) program for the Multi-Function Waste Tank Facility (MWTF) Project. The purpose of this QA program is to control project activities in such a manner as to achieve the mission of the MWTF Project in a safe and reliable manner. The QA program for the MWTF Project is founded on DOE Order 5700.6C, Quality Assurance, and implemented through the use of ASME NQA-1, Quality Assurance Program Requirements for Nuclear Facilities (ASME 1989 with addenda la-1989, lb-1991 and lc-1992). This document describes the program and planned actions which the Westinghouse Hanford Company (WHC) will implement to demonstrate and ensure that the project meets the requirements of DOE Order 5700.6C through the interpretive guidance of ASME NQA-1

  8. 49 CFR Appendix E to Part 236 - Human-Machine Interface (HMI) Design (United States)


    ... center of the operator's field of view by placing items that need to be found quickly in the upper left hand corner and items which are not time-critical in the lower right hand corner of the field of view... scheduling; and (3) HMI design must support contingency planning. (h) Ensure that electronics equipment radio...

  9. Non-conservation of parity in fission of 234U, 236U and 240Pu nuclei

    International Nuclear Information System (INIS)

    Danilyan, G.V.; Vodennikov, B.D.; Dronyaev, V.P.; Novitskij, V.V.; Pavlov, V.S.; Borovlev, S.P.


    Targets, which contained approximately 100 μ -2 fissionable material placed on both sides of an aluminium backing and were 0.1-0.15 mm wide, were arranged in a vacuum chamber along the axis of the neutron beam. Silicon surface-barrier detectors were arranged on each side of the target to detect fission fragments emitted by the target either in the direction of neutron polarization or away from it, depending on the direction of neutron-beam polarization at the moment of fragment detection. The direction of polarization could be reversed once per second; however, it was reversed not regularly but stochastically. An electronic circuit separated out pulses from light and heavy fragments and channelled them into scaling circuits corresponding to the two opposing directions of polarization. After each measurement cycle a computer connected on line with the experiment calculated the asymmetry in the number of light and heavy fragments counted by a given detector when the direction of neutron beam polarization was reversed. The measurement cycle lasted approximately 17 min, during which time the direction of polarization was reversed on average approximately 600 times. Measurements on a polarized beam alternated with measurements on a depolarized beam. Control measurements excluded the possibility of instruments affecting the results

  10. 48 CFR 852.236-83 - Payments under fixed-price construction contracts (including NAS). (United States)


    ... (CPM) network. (4) The CPM network shall include a separate cost loaded activity for adjusting and... shall show on the critical path method (CPM) network the total cost of the guarantee period services in... contracting officer. The activity on the CPM shall have money only and not activity time. (ii) The contractor...

  11. Uranium-236 as an indicator of fuel-cycle uranium in ground water

    International Nuclear Information System (INIS)

    Jaquish, R.E.


    Environmental monitoring on and around the Hanford Site includes regular sampling of onsite monitoring wells and offsite farm wells. Uranium has been identified in the ground water onsite and also in water from farm wells located on the east side of the Columbia River, across from the Hanford Site. Information on the hydrology of the area indicates that the source of the offsite uranium is not the Hanford Site. This study evaluated the isotopic composition of the uranium in water from the various wells to differentiate the onsite uranium contamination from natural uranium offsite. 5 refs., 2 figs., 2 tabs

  12. Uranium and transuranium analysis

    International Nuclear Information System (INIS)

    Regnaud, F.


    Analytical chemistry of uranium, neptunium, plutonium, americium and curium is reviewed. Uranium and neptunium are mainly treated and curium is only briefly evoked. Analysis methods include coulometry, titration, mass spectrometry, absorption spectrometry, spectrofluorometry, X-ray spectrometry, nuclear methods and radiation spectrometry [fr

  13. ASSIS, Machado de. Casa Velha / The Old House. Trad. de Mark Carlyon. Rio de Janeiro: Cidade Viva, 2010. 236 p.

    Directory of Open Access Journals (Sweden)

    Cynthia Beatrice Costa


    Full Text Available Por meio do exame desta edição bilíngue da novela machadiana, pretende-se analisar como o ato tradutório e as informações extratextuais foram valorizados pelos editores, ensaístas e pelo próprio tradutor.

  14. ASSIS, Machado de. Casa Velha / The Old House. Trad. de Mark Carlyon. Rio de Janeiro: Cidade Viva, 2010. 236 p.

    Directory of Open Access Journals (Sweden)

    Cynthia Beatrice Costa


    Full Text Available Por meio do exame desta edição bilíngue da novela machadiana, pretende-se analisar como o ato tradutório e as informações extratextuais foram valorizados pelos editores, ensaístas e pelo próprio tradutor.

  15. 48 CFR 652.236-72 - Statement of Qualifications for the Omnibus Diplomatic Security and Antiterrorism Act. (United States)


    ..., state, city) (ii) Type of return (e.g., income tax, franchise tax, etc.). Include all that apply: 3... completed must be reported. Transactions that call for continued or future performance shall be...

  16. Governing Civil Service Pay in China, by Alfred M. Wu. Copenhagen: NIAS Press, 2014. xvi+236 pp

    DEFF Research Database (Denmark)

    Brødsgaard, Kjeld Erik


    Book review of: Governing Civil Service Pay in China by Alfred M. Wu. Copenhagen: NIAS Press, 2014.......Book review of: Governing Civil Service Pay in China by Alfred M. Wu. Copenhagen: NIAS Press, 2014....

  17. Montecarlo calculation of the isomeric cross sections ratio for the reaction 237Np(n,2n)236Np

    International Nuclear Information System (INIS)

    Cleri, F.


    A Montecarlo calculation of the isomeric cross section ratio for the (n,2n) reaction on 237 Np has been carried out based on the Hauser-Feshbach formulation. A standard energy-dependent optical model potential was used, with zero deformation parameters and no spin-orbit coupling. Investigation was made about the role of the energy cut-off value, of the higher multipole (E2) transition, of the gamma-ray versus second neutron emission, of the value of the spin cutt-off parameter. The results give the correct qualitative energy dependence of the branching ratio, with the assumption that the 1 - level is the ground state. The spin cut-off value obtained indicates a less pronounced deviation of the nuclear moment of inertia from the rigid-body value, with respect to older evaluations for high-mass nuclei. (author)

  18. Economic and Performance Analysis of Gear Box Failures. Cooperative Research and Development Final Report, CRADA Number CRD-07-236

    Energy Technology Data Exchange (ETDEWEB)

    Keller, Jonathan [National Renewable Energy Lab. (NREL), Golden, CO (United States)


    The National Renewable Energy Laboratory (NREL) in Golden, CO, USA is forming a collaborative within the wind energy industry to address reliability issues on wind turbines. The National Wind Technology Center (NWTC), leading the collaborative effort, will allow gearbox manufacturers, bearing manufacturers, wind turbine owner/operators, and wind turbine manufacturers to team up for joint projects that address specific issues regarding design and reliability of wind turbine gearboxes. The primary means of investigation will be through full scale testing and analysis of actual gearboxes, both in the field and in the NREL 2.5 MW dynamometer test facility. These teams would contribute resources into a campaign that is intended to serve the mutual interests of a majority of the wind and gearbox industry stakeholders in addition to the specific project team objectives. that address specific issues regarding design and reliability of wind turbine gearboxes. The primary means of investigation will be through full scale testing and analysis of actual gearboxes, both in the field and in the NREL 2.5 MW dynamometer test facility. These teams would contribute resources into a campaign that is intended to serve the mutual interests of a majority of the wind and gearbox industry stakeholders in addition to the specific project team objectives.

  19. Deaf English--An Investigation of the Written English Competence of Deaf Adolescents. Technical Report No. 236. (United States)

    Charrow, Veda R.

    Presented is support for the existence of "Deaf English," a non-standard dialect common to the prelingually deaf; and reported is an investigation of the written English competence of deaf adolescents. In the first half of the document the author discusses the historical background of deaf education and the linguistic and cognitive abilities of…

  20. SU-F-T-236: Comparison of Two IMRT/VMAT QA Systems Using Gamma Index Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Dogan, N [University of Miami, Miami, FL (United States); Denissova, S [Sylvester Comprehensive Cancer Center Deerfield, Weston, FL (United States)


    Purpose: The goal of this study is to assess differences in the Gamma index pass rates when using two commercial QA systems and provide optimum Gamma index parameters for pre-treatment patient specific QA. Methods: Twenty-two VMAT cases that consisted of prostate, lung, head and neck, spine, brain and pancreas, were included in this study. The verification plans have been calculated using AcurosXB(V11) algorithm for different dose grids (1.5mm, 2.5mm, 3mm). The measurements were performed on TrueBeam(Varian) accelerator using both EPID(S1000) portal imager and ArcCheck(SunNuclearCorp) devices. Gamma index criteria variation of 3%/3mm, 2%/3mm, 2%/2mm and threshold (TH) doses of 5% to 50% were used in analysis. Results: The differences in Gamma pass rates between two devices are not statistically significant for 3%/3mm, yielding pass rate higher than 95%. Increase of lower dose TH showed reduced pass rates for both devices. ArcCheck’s more pronounced effect can be attributed to higher contribution of lower dose region spread. As expected, tightening criteria to 2%/2mm (TH: 10%) decreased Gamma pass rates below 95%. Higher EPID (92%) pass rates compared to ArcCheck (86%) probably due to better spatial resolution. Portal Dosimetry results showed lower Gamma pass rates for composite plans compared to individual field pass rates. This may be due to the expansion in the analyzed region which includes pixels not included in the separate field analysis. Decreasing dose grid size from 2.5mm to 1.5mm did not show statistically significant (p<0.05) differences in Gamma pass rates for both QA devices. Conclusion: Overall, both system measurements agree well with calculated dose when using gamma index criteria of 3%/3mm for a variety of VMAT cases. Variability between two systems increases using different dose GRID, TH and tighter gamma criteria and must be carefully assessed prior to clinical use.

  1. Historia magistra vitae (Cic. De or. 2.36). The Prime Objective of Radiosurgery in Acoustic Neurinomas. (United States)

    Valentino, V; Benassi, M; Strigari, L


    The central question of stereotaxic radiosurgery in acoustic neurinomas is how to pinpoint its main objective: is it a better alternative to neurosurgery or an option when surgery is unfeasible? This study is a continuation of the article published in 1995 in Acta Neurochirurgica, but benefits from greater experience, more complete analysis and longer supervision of results. The conclusions that can be drawn to date from our own findings and from others in the literature are the following: radiosurgery can be used not only to prevent neurinoma growth and at the same time to preserve the patient's neurological conditions without the risk of complications, but it can also be counted on to provide a cure. However, radiosurgery as an excising device is more insidious than the microsurgical scalpel, since the narrow beam of radiation, directed to a limited target without opening the skull, is invisible. The expression coined by Lars Leksell regarded precisely the innovation he himself conceived in the 'closed skull operation', with reference to its use in cases of acoustic neurinoma as an alternative to traditional surgery. Hence, whatever technique or instruments are involved, it is always a question of interventional neuroradiology or minimally invasive neurosurgery.

  2. 24 CFR 5.236 - Procedures for termination, denial, suspension, or reduction of assistance based on information... (United States)


    ... or participant based on income information obtained from a SWICA or a Federal agency. Procedures... information reveals an employer or other income source that was not disclosed by the assistance applicant or..., the PHA shall request the undisclosed employer or other income source to furnish any information...

  3. SU-E-J-236: Audiovisual Biofeedback Improves Breath-Hold Lung Tumor Position Reproducibility Measured with 4D MRI

    International Nuclear Information System (INIS)

    Lee, D; Pollock, S; Keall, P; Greer, P; Lapuz, C; Ludbrook, J; Kim, T


    Purpose: Audiovisual biofeedback breath-hold (AVBH) was employed to reproduce tumor position on inhale and exhale breath-holds for 4D tumor information. We hypothesize that lung tumor position will be more consistent using AVBH compared with conventional breath-hold (CBH). Methods: Lung tumor positions were determined for seven lung cancer patients (age: 25 – 74) during to two separate 3T MRI sessions. A breathhold training session was performed prior to the MRI sessions to allow patients to become comfortable with AVBH and their exhale and inhale target positions. CBH and AVBH 4D image datasets were obtained in the first MRI session (pre-treatment) and the second MRI session (midtreatment) within six weeks of the first session. Audio-instruction (MRI: Siemens Skyra) in CBH and verbal-instruction (radiographer) in AVBH were used. A radiation oncologist contoured the lung tumor using Eclipse (Varian Medical Systems); tumor position was quantified as the centroid of the contoured tumor after rigid registration based on vertebral anatomy across two MRI sessions. CBH and AVBH were compared in terms of the reproducibility assessed via (1) the difference between the two exhale positions for the two sessions and the two inhale positions for the sessions. (2) The difference in amplitude (exhale to inhale) between the two sessions. Results: Compared to CBH, AVBH improved the reproducibility of two exhale (or inhale) lung tumor positions relative to each other by 33%, from 6.4±5.3 mm to 4.3±3.0 mm (p=0.005). Compared to CBH, AVBH improved the reproducibility of exhale and inhale amplitude by 66%, from 5.6±5.9 mm to 1.9±1.4 mm (p=0.005). Conclusions: This study demonstrated that audiovisual biofeedback can be utilized for improving the reproducibility of breath-hold lung tumor position. These results are advantageous towards achieving more accurate emerging radiation treatment planning methods, in addition to imaging and treatment modalities utilizing breath-hold procedures

  4. SU-E-J-236: Audiovisual Biofeedback Improves Breath-Hold Lung Tumor Position Reproducibility Measured with 4D MRI

    Energy Technology Data Exchange (ETDEWEB)

    Lee, D; Pollock, S; Keall, P [Radiation Physics Laboratory, Sydney Medical School, The University of Sydney, NSW (Australia); Greer, P [School of Mathematical and Physical Sciences, The University of Newcastle, Newcastle, NSW (Australia); Department of Radiation Oncology, Calvary Mater Newcastle, Newcastle, NSW (Australia); Lapuz, C; Ludbrook, J [Department of Radiation Oncology, Calvary Mater Newcastle, Newcastle, NSW (Australia); Kim, T [Radiation Physics Laboratory, Sydney Medical School, The University of Sydney, NSW (Australia); Department of Radiation Oncology, University of Virginia Health System, Charlottesville, VA (United States)


    Purpose: Audiovisual biofeedback breath-hold (AVBH) was employed to reproduce tumor position on inhale and exhale breath-holds for 4D tumor information. We hypothesize that lung tumor position will be more consistent using AVBH compared with conventional breath-hold (CBH). Methods: Lung tumor positions were determined for seven lung cancer patients (age: 25 – 74) during to two separate 3T MRI sessions. A breathhold training session was performed prior to the MRI sessions to allow patients to become comfortable with AVBH and their exhale and inhale target positions. CBH and AVBH 4D image datasets were obtained in the first MRI session (pre-treatment) and the second MRI session (midtreatment) within six weeks of the first session. Audio-instruction (MRI: Siemens Skyra) in CBH and verbal-instruction (radiographer) in AVBH were used. A radiation oncologist contoured the lung tumor using Eclipse (Varian Medical Systems); tumor position was quantified as the centroid of the contoured tumor after rigid registration based on vertebral anatomy across two MRI sessions. CBH and AVBH were compared in terms of the reproducibility assessed via (1) the difference between the two exhale positions for the two sessions and the two inhale positions for the sessions. (2) The difference in amplitude (exhale to inhale) between the two sessions. Results: Compared to CBH, AVBH improved the reproducibility of two exhale (or inhale) lung tumor positions relative to each other by 33%, from 6.4±5.3 mm to 4.3±3.0 mm (p=0.005). Compared to CBH, AVBH improved the reproducibility of exhale and inhale amplitude by 66%, from 5.6±5.9 mm to 1.9±1.4 mm (p=0.005). Conclusions: This study demonstrated that audiovisual biofeedback can be utilized for improving the reproducibility of breath-hold lung tumor position. These results are advantageous towards achieving more accurate emerging radiation treatment planning methods, in addition to imaging and treatment modalities utilizing breath-hold procedures.

  5. Investigation of prompt gamma-ray yields as a function of mass and charge of 236U fission fragments

    International Nuclear Information System (INIS)

    Bogdzel', A.A.; Gundorin, N.A.; Duka-Zojomi, A.; Kliman, Ya.; Krishtiak, J.


    New experimental results determining yields of the prompt gamma-rays from the excited states decay of fission fragments are presented. 80 gamma-transitions were observed in 51 fission fragments. The measurements were performed by Ge(Li)-spectrometry in coincidence with fast ionization chamber (10g 235 U). The beam of the resonance neutrons with energy range from 0.7 to 36 eV was used

  6. Cryogenic gamma detectors enable direct detection of 236U and minor actinides for non-destructive assay

    International Nuclear Information System (INIS)

    Miguel Velazquez; Jonathan Dreyer; Drury, O.B.; Friedrich, Stephan; Saleem Salaymeh


    We demonstrate the utility of a superconducting transition edge sensor (TES) γ-ray detector with high energy resolution and low Compton background for nondestructive assay (NDA) of a uranium sample from reprocessed nuclear fuel. We show that TES γ-detectors can separate low-energy actinide γ-emissions from the background and nearby lines, even from minor isotopes whose signals are often obscured in NDA with conventional Ge detectors. Superconducting γ-detectors may therefore bridge the gap between high-accuracy destructive assay (DA) and easier-to-use NDA. (author)

  7. Estimation of 244Cm intake by bioassay measurements following a contamination incident

    International Nuclear Information System (INIS)

    Thein, M.; Bogard, J.S.; Eckerman, K.F.


    An employee was contaminated with radioactive material consisting primarily of 244 Cm and 246 Cm as a consequence of handling a curium nitrate solution at a reprocessing facility. In vivo gamma analysis and in vitro (urine and fecal) bioassay measurements were performed. A sample of the curium solution from the workplace was obtained to confirm that the nitrate was the chemical form and to identify the isotopes of curium present. The mass ratio of 244 Cm/ 246 Cm was determined to be 91 to 7. Observed excretion rates were consistent with available information on curium. The results of the in vivo and in vitro measurements are presented and intake estimates for the incident are developed. (author) 11 refs.; 3 figs.; 2 tabs

  8. Chemistry of pyroprocessing for nuclear waste transmutation

    Energy Technology Data Exchange (ETDEWEB)

    Ackerman, J.P. [Argonne National Laboratory, IL (United States)


    Pyrochemical treatment of spent nuclear fuel is an attractive approach for separating the transuranium (TRU) elements neptunium, plutonium, americium, and curium because of its simplicity, diversion resistance, and potentially low cost.

  9. Consistent evaluation of neutron cross sections for the 242-244Cm isotopes

    International Nuclear Information System (INIS)

    Ignatyuk, A.V.; Maslov, V.M.


    The knowledge of neutron cross-sections for Curium isotopes is necessary for solving the problems of the external fuel cycle. Experimental information on the cross-sections is very meager and does not satisfy requirements and existing evaluations in different libraries differ substantially for fission and (n,2n) reaction cross-sections. This situation requires a critical review of the entire set of evaluations of the neutron cross-sections for Curium. 17 refs, 3 figs

  10. Some basic advantages of accelerator-driven transmutation of minor actinides and iodine-129

    Energy Technology Data Exchange (ETDEWEB)

    Shmelev, A.N.; Apse, V.A.; Kulikov, G.G. [Moscow Engineering Physics Institute (Russian Federation)


    The blanket of accelerator-driven facility designed for I-129 transmutation doesn`t contain fissile and fertile materials. So the overheating of iodine compounds transmuted is practically excluded. The efficacy of I-129 transmutation is estimated. Curium being accumulated in nuclear reactors can be incinerated in blanket of accelerator-driven facility. The deep depletion of curium diluted with inert material can be achieved.

  11. Separation and recovery of Cm from Cm-Pu mixed oxide samples containing Am impurity

    International Nuclear Information System (INIS)

    Hirokazu Hayashi; Hiromichi Hagiya; Mitsuo Akabori; Yasuji Morita; Kazuo Minato


    Curium was separated and recovered as an oxalate from a Cm-Pu mixed oxide which had been a 244 Cm oxide sample prepared more than 40 years ago and the ratio of 244 Cm to 240 Pu was estimated to 0.2:0.8. Radiochemical analyses of the solution prepared by dissolving the Cm-Pu mixed oxide in nitric acid revealed that the oxide contained about 1 at% of 243 Am impurity. To obtain high purity curium solution, plutonium and americium were removed from the solution by an anion exchange method and by chromatographic separation using tertiary pyridine resin embedded in silica beads with nitric acid/methanol mixed solution, respectively. Curium oxalate, a precursor compound of curium oxide, was prepared from the purified curium solution. 11.9 mg of Cm oxalate having some amounts of impurities, which are 243 Am (5.4 at%) and 240 Pu (0.3 at%) was obtained without Am removal procedure. Meanwhile, 12.0 mg of Cm oxalate (99.8 at% over actinides) was obtained with the procedure including Am removals. Both of the obtained Cm oxalate sample were supplied for the syntheses and measurements of the thermochemical properties of curium compounds. (author)

  12. 236. Introducción de un programa con cirugía mitral videoasistida: los diez principios de la curva de aprendizaje

    Directory of Open Access Journals (Sweden)

    R. Boix


    Conclusiones: Esta técnica es muy demandante y requiere de una larga curva de aprendizaje, pero un programa establecido de forma segura puede llevarse a cabo. ¡Los cardiólogos y los pacientes prefieren esta técnica!

  13. A 10-MWe solar-thermal central-receiver pilot plant: Solar facilities design integration. Plant operating/training manual (RADL-Item 2-36) (United States)


    Plant and system level operating instructions are provided for the Barstow Solar Pilot Plant. Individual status instructions are given that identify plant conditions, process controller responsibilities, process conditions and control accuracies, operating envelopes, and operator cautions appropriate to the operating condition. Transition operating instructions identify the sequence of activities to be carried out to accomplish the indicated transition. Most transitions involve the startup or shutdown of an individual flowpath. Background information is provided on collector field operations, and the heliostat groupings and specific commands used in support receiver startup are defined.

  14. 49 CFR Appendix F to Part 236 - Minimum Requirements of FRA Directed Independent Third-Party Assessment of PTC System Safety... (United States)


    ..., national, or international standards. (f) The reviewer shall analyze all Fault Tree Analyses (FTA), Failure... cited by the reviewer; (4) Identification of any documentation or information sought by the reviewer...) Identification of the hardware and software verification and validation procedures for the PTC system's safety...

  15. Retraction notice to: Artificial intelligence in pharmaceutical product formulation: Neural computing [Chem. Ind. Chem. Eng. Q. 15(4) (2009) 227-236


    Ibrić Svetlana; Đurić Zorica; Parojčić Jelena; Petrović Jelena


    This article has been retracted at the request of the authors. The retraction has been made because the authors admitted that they took the text and rawings from the review article written by R. Rowe and E. Colbourn, Future Medicinal Chemistry 1(4) (2009) 713-726, without their permission and even did not include this article in the list of references. One of the conditions of submission of a paper for publication are that authors confirm that their work is entirely originally written, someon...

  16. Urinary incontinence 4 and 12 years after first delivery: Risk factors associated with prevalence, incidence, remission, and persistence in a cohort of 236 women


    Pizzoferrato, Anne-Cécile; Fauconnier, Arnaud; Quiboeuf, Emeline; Morel, Karine; Schaal, Jean-Patrick; Fritel, Xavier


    International audience; AIMS: Our aim was to study risk factors associated with prevalence, incidence, and remission of UI 4 and 12 years after first delivery. METHODS: Seven hundred seventy-four nulliparous women who gave birth in 1996 in two French maternity units at term received a questionnaire about their urinary symptoms in 2000 and again in 2008. Two hundred thirty-six women returned a questionnaire about UI 4 and 12 years after first delivery. Four groups of women were built: (A) wome...

  17. Urinary incontinence 4 and 12 years after first delivery: risk factors associated with prevalence, incidence, remission, and persistence in a cohort of 236 women. (United States)

    Pizzoferrato, Anne-Cécile; Fauconnier, Arnaud; Quiboeuf, Emeline; Morel, Karine; Schaal, Jean-Patrick; Fritel, Xavier


    Our aim was to study risk factors associated with prevalence, incidence, and remission of UI 4 and 12 years after first delivery. Seven hundred seventy-four nulliparous women who gave birth in 1996 in two French maternity units at term received a questionnaire about their urinary symptoms in 2000 and again in 2008. Two hundred thirty-six women returned a questionnaire about UI 4 and 12 years after first delivery. Four groups of women were built: (A) women continent 4 and 12 years after first delivery; (B) women continent at 4 and incontinent at 12 years; (C) women incontinent at 4 and continent at 12 years; and (D) women incontinent at 4 and 12 years. Multivariate logistic regressions were used to determine risk factors of UI prevalence (groups B + D vs. A + C), incidence (B vs. A), remission (C vs. D), and onset of UI (D vs. Factors associated with UI 12 years after first pregnancy were: BMI (OR = 1.17 [95%CI: 1.04-1.32], by 1 kg/m(2) ) and increasing BMI (1.43 [1.19-1.73]), first child's weight (1.08 [1.001-1.16], by 100 g) and UI during first pregnancy (3.77 [1.83-7.76]). Factors associated with UI incidence were age at first delivery (0.86 [0.75-0.98]) and high BMI (1.24 [1.05-1.45]). Increasing BMI, UI during first pregnancy, and heavy first child reduce the likelihood of UI remission (0.37 [0.20-0.68], 0.11 [0.02-0.63], and 0.73[0.59-0.91], respectively). UI during first pregnancy could be indicative of individual susceptibility to UI. Obesity appears to be a modifiable factor for remission of UI in women. © 2013 Wiley Periodicals, Inc.

  18. Kaiser Engineers Hanford internal position paper -- Project W-236A, Multi-function Waste Tank Facility -- Peer reviews of selected activities

    International Nuclear Information System (INIS)

    Stine, M.D.


    The purpose of this paper is to develop and document a proposed position on the performance of independent peer reviews on selected design and analysis components of the Title 1 [Preliminary] and Title 2 [Final] design phases of the Multi-Function Waste Tank Facility [MWTF] project. An independent, third-party peer review is defined as a documented critical review of documents, data, designs, design inputs, tests, calculations, or related materials. The peer review should be conducted by persons independent of those who performed the work, but who are technically qualified to perform the original work. The peer review is used to assess the validity of assumptions and functional requirements, to assess the appropriateness and logic of selected methodologies and design inputs, and to verify calculations, analyses and computer software. The peer review can be conducted at the end of the design activity, at specific stages of the design process, or continuously and concurrently with the design activity. This latter method is often referred to as ''Continuous Peer Review.''

  19. Web technologies in a collaborative platform for clinical trials - DOI: 10.3395/reciis.v3i4.236en

    Directory of Open Access Journals (Sweden)

    Miriam Akemi Manabe Capretz


    Full Text Available Web technologies have changed software development. The changes affect a full range of applications as well as the way users interact with computers. In the health domain, clinical research demands a lot of investment, effort and information in order to safely commercialize a new drug. The WebInVivo project aims at providing automated support for clinical research based on Web technologies. It includes mechanisms for sharing and reusing clinical trial information, such as protocols, protocol data, workflows and workflow metadata and for controlling the protocol life cycle, from modeling to execution. In this project, knowledge from the biomedical area permeates three segments of Brazilian society: (a research and development, (b health agents, and (c the population. This knowledge will be made available through social networks for these segments of Brazilian society.

  20. Temperature-compensated Love wave based gas sensor on waveguide structure of SiO2/36° YX LiTaO3

    International Nuclear Information System (INIS)

    Wang, Wen; Xie, Xiao; Chen, Gui; Liu, Jiuling; He, Shitang


    A temperature-compensated Love wave device was proposed for gas sensing utilizing a waveguide structure of SiO 2 /36° YX LiTaO 3 . Significant improvement in the temperature stability of the hybrid Love wave device was implemented by varying the guiding layer thickness. The optimal values yielding low cross-sensitivity to temperature and high mass sensitivity in gas sorption were determined theoretically by solving the coupled electromechanical field equation in layered media. The theoretical analysis was confirmed experimentally in dimethylmethylphosphonate (DMMP) detection by using a fluoroalcoholpolysiloxane (SXFA) coated Love wave sensor. The experimental results indicate that better sensitivity and excellent temperature stability were obtained from the developed Love wave gas sensor over the Rayleigh surface acoustic wave (R-SAW) sensors. (paper)

  1. Gamma-Ray Emission Spectra as a Constraint on Calculations of 234,236,238U Neutron-Capture Cross Sections

    Energy Technology Data Exchange (ETDEWEB)

    Ullmann, John Leonard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kawano, Toshihiko [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Bredeweg, Todd Allen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Baramsai, Bayarbadrakh [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Couture, Aaron Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Haight, Robert Cameron [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jandel, Marian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mosby, Shea Morgan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); O' Donnell, John M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rundberg, Robert S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Vieira, David J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Wilhelmy, Jerry B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Becker, John A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wu, Ching-Yen [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Krticka, Milan [Charles Univ., Prague (Czech Republic)


    Neutron capture cross sections in the “continuum” region (>≈1 keV) and gamma-emission spectra are of importance to basic science and many applied fields. Careful measurements have been made on most common stable nuclides, but physicists must rely on calculations (or “surrogate” reactions) for rare or unstable nuclides. Calculations must be benchmarked against measurements (cross sections, gamma-ray spectra, and <Γγ>). Gamma-ray spectrum measurements from resolved resonances were made with 1 - 2 mg/cm2 thick targets; cross sections at >1 keV were measured using thicker targets. The results show that the shape of capture cross section vs neutron energy is not sensitive to the form of the strength function (although the magnitude is); the generalized Lorentzian E1 strength function is not sufficient to describe the shape of observed gamma-ray spectra; MGLO + “Oslo M1” parameters produces quantitative agreement with the measured 238U(n,γ) cross section; additional strength at low energies (~ 3 MeV) -- likely M1-- is required; and careful study of complementary results on low-lying giant resonance strength is needed to consistently describe observations.

  2. Fetal cell detection in maternal blood : A study in 236 samples using erythroblast morphology, DAB and HbF staining, and FISH analysis

    NARCIS (Netherlands)

    Oosterwijk, JC; Mesker, WE; Ouwerkerk-van Velzen, MCM; Knepfle, CFHM; Wiesmeijer, KC; Beverstock, GC; van Ommen, GJB; Kanhai, HHH; Tanke, HJ


    A protocol to detect fetal nucleated red blood cells (NRBCs) was tested in 217 pregnant women and in 19 nonpregnant controls. All the pregnant women were sampled after chorionic villus sampling (CVS); 20 were also sampled pre-CVS. NRBC recognition was based upon morphology by using staining of

  3. Costing of severe pneumonia in hospitalized infants and children aged 2-36 months, at a secondary and tertiary level hospital of a not-for-profit organization

    DEFF Research Database (Denmark)

    Madsen, Helle Ostergaard; Hanehøj, Malin; Das, Ashima Rani


    OBJECTIVES: To determine health care provider cost and household cost of the treatment of severe pneumonia in infants and young children admitted to secondary and tertiary level health care facilities. METHODS: The study was done in a private, not-for-profit medical college hospital, in Vellore...... comprised travel, accommodation and special food during the period of illness, and indirect costs of productivity loss for family members. Patient specific resource consumption and related charges were recorded from charts, nursing records, pharmacy lists and hospital bills, and the providers view point...

  4. Critical Masses for Unreflected Metal Spheres

    International Nuclear Information System (INIS)

    Westfall, Robert Michael; Wright, Richard Q.


    Calculated critical masses of bare metal spheres for 28 actinide isotopes, using the SCALE/XSDRNPM one-dimensional, discrete-ordinates system, are presented. ENDF/B-VI, ENDF/B-VII, and JENDL-3.3 cross sections were used in the calculations. Results are given for isotopes of uranium, neptunium, plutonium, americium, curium, californium, and for one isotope of einsteinium. Calculated k values for these same nuclides are also given. We show that, for non-threshold or low-threshold fission nuclides, a good approximation for the nuclide k is the value of nubar at 1 MeV. A plot of the critical mass versus k values is given for 19 nuclides with A-numbers between 232 and 250. The peaks in the critical mass curve (for seven nuclides) correspond to dips in the k curve. For the seven cases with the largest critical mass, six are even-even nuclides. Neptunium-237, with a critical mass of about 62.7 kg (ENDF/B-VI calculation), has an odd number of protons and an even number of neutrons. However, two cases with quite small critical masses, 232U and 236Pu, are also even-even. These two nuclides do not exhibit threshold fission behavior like most other even-even nuclides. The largest critical mass is 208.8 kg for 243Am and the smallest is 2.44 kg for 251Cf. The calculated k values vary from 1.5022 for 234U to 4.4767 for 251Cf. A correlation between the calculated critical mass (kg) and the fission spectrum averaged value of is given for the elements U, Np, Pu, Am, Cm, and Cf. For each of the five elements, a fit to the data for that element is provided. In each case the fit employs a negative exponential of the form mass = exp(A + B ∼ ln). The values of A and B are element dependent and vary slightly for each of the five elements. The method described here is mainly applicable for non-threshold fission nuclides (15 of the 28 nuclides considered in this paper). There are three exceptions, 238Pu, 244Cm, and 250Cf, which all exhibit threshold fission behavior.

  5. Recovery of trans-plutonium elements; Recuperation des elements transplutoniens

    Energy Technology Data Exchange (ETDEWEB)

    Espie, J Y; Poncet, B; Simon, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires


    The object of this work is to study the recovery of americium and curium from the fission-product solution obtained from the processing of irradiated fuel elements made of natural metallic uranium alloyed with aluminium, iron and silicon; these elements have been subjected to an average irradiation of 4000 MW days/ton in a gas-graphite type reactor having a thermal power of 3.7 MW/ton of uranium. The process used consists of 3 extraction cycles and one americium-curium separation: - 1) extraction cycle in 40 per cent TBP: extraction of actinides and lanthanides; elimination of fission products; - 2) extraction cycle in 8 per cent D2EHPA: decontamination from the fission products, decontamination of actinides from lanthanides; - 3) extraction cycle in 40 per cent TBP: separation of the complexing agent and concentration of the actinides; - 4) americium-curium separation by precipitation. (authors) [French] Cette etude a pour objet, la recuperation de l'americium et du curium de la solution de produits de fission provenant du traitement de combustibles irradies a base d'uranium naturel metallique allie a l'aluminium, le fer, et le silicium, et ayant subi une irradiation moyenne de 4000 MWj/t dans une pile du type graphite-gaz, dont la puissance thermique est de 3.7 MW/t d'uranium. Le procede utilise comprend 3 cycles d'extraction et une separation americium-curium: - 1. cycle d'extraction dans le TBP a 40 pour cent: extraction des actinides et des lanthanides, elimination des produits de fission; - 2. cycle d'extraction dans le D2EHPA a 8 pour cent: decontamination en produits de fission, decontamination des actinides en lanthanides; - 3. cycle d'extraction dans le TBP a 40 pour cent: separation du complexant et concentration des actinides; - 4. separation americium-curium par precipitation. (auteurs)

  6. Identification of colloids in nuclear waste glass reactions

    International Nuclear Information System (INIS)

    Cunnane, J.C.; Bates, J.K.


    Characterization data for particulates formed under a variety of laboratory leaching conditions that simulate glass reaction in a repository environment are presented. Data on the particle size distributions and filterable fractions for neptunium, plutonium, americium, and curium were obtained by filtrations through a series of filters with pore sizes ranging from 1 μm to 3.8 nm. The neptunium was found to be largely nonfilterable. Americium and plutonium were associated with filterable particles. The particles with which the americium, plutonium, and curium were associated were characterized using transmission electron microscopy (TEM) examination techniques. 8 refs., 1 fig., 2 tabs

  7. JPRS Report, Science & Technology, USSR: Space. (United States)


    Half-life, years Specific Heat Release W/hr Plutonium-238 87.5 0.46 Curium-244 18.4 2.8 Curium-242 0.45 120 Polonium - 210 0.38 144 Polonium - 210 ...begun train- ing a year before the flight. The prospective space travelers had to be trained to stay in a special capsule and to use nozzles for food ...conditions of extended weight- lessness. On command, the animals are given food and water, waste is removed, and day/night conditions are regulated

  8. Low-level determination of transuranic elements in marine environment samples

    International Nuclear Information System (INIS)

    Ballestra, S.; Holm, E.; Fukai, R.


    The procedures developed and currently employed in the Monaco Laboratory for determining transuranic elements in seawater, marine sediments and organisms are described and discussed. While the standard anion-exchange procedure from the hydrochloric acid medium is used for the separation of plutonium isotopes from americium, purification of americium and curium is achieved by an ion-exchange sorption from the methanol-nitric acid medium, followed by an elution with the methanol-hydrochloric acid mixture. Satisfactory clean-up of plutonium as well as americium and curium can be achieved by applying the described procedures. (author)

  9. Actinides compounds for the transmutation: scientific contributions of american and japanese collaborations; Composes d'actinides pour la transmutation: apports scientifiques de collaborations americaines et japonaises

    Energy Technology Data Exchange (ETDEWEB)

    Raison, Ph.; Albiot, T


    This paper deals with the minor actinides transmutation and the scientific contribution of the ORNL and the JAERI. It presents researches on the Am-Zr-Y-O system in the framework of the heterogeneous reprocessing, the curium and pyrochlore structures, with the ORNL contribution and phase diagrams, data of Thermodynamics, actinides nitrides, with the JAERI. (A.L.B.)


    International Nuclear Information System (INIS)



    Co-60 was produced in the Savannah River Site (SRS) reactors in the 1970s, and the irradiated cobalt reactor slugs were stored in a reactor basin at SRS. Since the activity rates of these slugs were not accurately known, assaying was required. A sodium iodide gamma detector was placed above a specially designed air collimator assembly, so that the slug was eight to nine feet from the detector and was shielded by the basin water. Also, 18 curium sampler slugs, used to produce Cm-244 from Pu-239, were to be disposed of with the cobalt slugs. The curium slugs were also analyzed with a High Purity Germanium (HPGE) detector in an attempt to identify any additional radionuclides produced from the irradiation. Co-60 concentrations were determined for reactor disassembly basin cobalt slugs and the 18 curium sampler slugs. The total Co-60 activity of all of the assayed slugs in this work summed to 31,783 curies on 9/15/03. From the Co-60 concentrations of the curium sampler slugs, the irradiation flux was determined for the known irradiation time. The amounts of Pu-238,-239,-240,-241,-242; Am-241,-243; and Cm-242,-244 produced were then obtained based on the original amount of Pu-239 irradiated

  11. Fuel selection for radioisotope thermoelectric generators

    International Nuclear Information System (INIS)

    Menezes, A.


    The availability of Radioisotope Thermoeletric Generator fuels is evaluated based on the amount of fuel discharged from selected power reactors. In general, the best alternatives are either to use Plutonium-238 produced by irradiation of Neptunium-237 generated in typical thermal reactors or to use Curium-244 directly separated from the discharged fuels of fast or thermal reactors. (author) [pt

  12. Analysis of large soil samples for actinides (United States)

    Maxwell, III; Sherrod, L [Aiken, SC


    A method of analyzing relatively large soil samples for actinides by employing a separation process that includes cerium fluoride precipitation for removing the soil matrix and precipitates plutonium, americium, and curium with cerium and hydrofluoric acid followed by separating these actinides using chromatography cartridges.

  13. Transmutation Scenarios Impacts on Advanced Nuclear Cycles. Fabrication, Reprocessing and Transportation

    International Nuclear Information System (INIS)

    Saturnin, A.; Sarrat, P.; Hancok, H.; Milot, J.-F.; Duret, B.; Jasserand, F.; Fillastre, E.; Giffard, F.-X.; Chabert, C.; Van Den Durpel, L.; Caron-Charles, M.; Lefevre, J.C.; Carlier, B.; Arslan, M.; Favet, D.; Garzenne, C.; Barbrault, P.


    Conclusions: First detailed assessment of plants and transportation in various transmutation scenarios. In case of curium transmutation: large difficulties and uncertainties requiring whole new technology development (more pronounced for ADS option). For Am transmutation: more feasible, still to be demonstrated on specific points for industrial extrapolation

  14. Cylindrical Induction Melter Modicon Control System

    International Nuclear Information System (INIS)

    Weeks, G.E.


    In the last several years an extensive R ampersand D program has been underway to develop a vitrification system to stabilize Americium (Am) and Curium (Cm) inventories at SRS. This report documents the Modicon control system designed for the 3 inch Cylindrical Induction Melter (CIM)

  15. Determination of 241Am and 244Cm in environmental samples

    International Nuclear Information System (INIS)

    Bonino, N.O.; Grinman, A.D.R.; Serdeiro, N.H.


    The present technique describes a method to separate, purify and measure low levels of americium and curium in different environmental samples such as sediments, soils, water, vegetables, and air filters. The determination of radionuclides in theses environmental matrices have analytical problems, since a simple method doesn't exist for the purification, which is indispensable for its later measuring alpha spectrometry. The developed technique consist on taking an aliquot of the sample to analyze, to add tracer as americium 243 and curium 242, and to dissolve the matrix in a such way to have a clear solution. For the isolation of the americium and curium of the other actinides ar used as separation techniques: precipitation with Fe 3+ , anionic and cationic exchange, and extraction with a appropriate organic solvent. The purification of the americium and curium is followed by the electrodeposition habitually used. The measurement is carried out by alpha spectrometry with a detector of implanted ion. The detection limit for this techniques is of 0,002 Bq/l or 0,2 mBq in the case of filters. (author)

  16. Actinides compounds for the transmutation: scientific contributions of american and japanese collaborations

    International Nuclear Information System (INIS)

    Raison, Ph.; Albiot, T.


    This paper deals with the minor actinides transmutation and the scientific contribution of the ORNL and the JAERI. It presents researches on the Am-Zr-Y-O system in the framework of the heterogeneous reprocessing, the curium and pyrochlore structures, with the ORNL contribution and phase diagrams, data of Thermodynamics, actinides nitrides, with the JAERI. (A.L.B.)

  17. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    Stoddard, D.H.


    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  18. Neutron resonance parameters of CM isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.; Kolesov, A.G.; Poruchikov, V.A.


    The total neutron cross sections of isotopes 244, 245, 246, 248 Curium have been measured on reactor CM-2 using the time-of-flight method. Single-level Breit-Wigner resonance parameters: energy E 0 , neutron width 2g GITAn, total width GITA, total neutron cross section in resonance sigma 0 have been obtained by the shape and area methods

  19. ORF Alignment: NC_002620 [GENIUS II[Archive

    Lifescience Database Archive (English)


  20. Studies on black stain root disease in ponderosa pine. pp. 236-240. M. Garbelotto & P. Gonthier (Editors). Proceedings 12th International Conference on Root and Butt Rots of Forest Trees. (United States)

    W. J. Otrosina; J. T. Kliejunas; S. S. Sung; S. Smith; D. R. Cluck


    Black stain root disease of ponderosa pine, caused by Lepfographium wageneri var. ponderosum (Harrington & Cobb) Harrington & Cobb, is increasing on many eastside pine stands in northeastern California. The disease is spread from tree to tree via root contacts and grafts but new infections are likely vectored by root...

  1. Postoperative consumption of opioid analgesics following correction of pectus excavatum is influenced by pectus severity: a single-centre study of 236 patients undergoing minimally invasive correction of pectus excavatum

    DEFF Research Database (Denmark)

    Grosen, Kasper; Pfeiffer-Jensen, Mogens; Pilegaard, Hans


    Objective: Surgical correction of pectus excavatum (PE) is primarily performed to achieve cosmetic and psychological benefits for the patient. Minimally invasive repair of PE is often associated with severe postoperative pain. This study estimates the effect of the severity of PE...... regression analysis was performed to estimate the effect of the severity of PE on the postoperative consumption of opioid analgesics and to adjust for potential confounding. Results: The total morphine consumption following minimally invasive repair of PE ranged between 20 and 370mgday(-1). Multiple linear...... demographics, peri- and postoperative information, including data on pain management. The consumption of opioid analgesics was registered after discontinuation of epidural analgesia and other types of opioid analgesics used during the study period were converted to morphine equivalents. Multiple linear...

  2. Nursing Research Using Historical Methods: Qualitative Designs and Methods in Nursing Mary de Chesnay Nursing Research Using Historical Methods: Qualitative Designs and Methods in Nursing 236pp £65.95 Springer 9780826126177 0826126170 [Formula: see text]. (United States)


    Just as the present can be understood by examining the past, the use of historical research methods can help nurses to understand the present to influence the future. This text emphasises how this approach to nursing research can provide a contextual framework from which nurses can consider their own practice.

  3. Corrigendum to "Multiple-quantum spin counting in magic-angle-spinning NMR via low-power symmetry-based dipolar recoupling" [J. Magn. Reson. 236 (2013) 31-40 (United States)

    Teymoori, Gholamhasan; Pahari, Bholanath; Viswanathan, Elumalai; Edén, Mattias


    The authors regret that an inappropriate NMR data processing, not known to all authors at the time of publication, was used to produce the multiple-quantum coherence (MQC) spin counting data presented in our article: this lead to artificially enhanced results, particularly concerning those obtained at long MQC excitation intervals (τexc). Here we reproduce Figs. 4-7 with correctly processed data.

  4. Information, communication and control systems for vehicle, road and traffic management. Contribution OECD Seminar on Micro-electronics for Road and Traffic Management. Tokyo, October 29 - November 2, 1984, Session V, p. 236-241.

    NARCIS (Netherlands)

    Oei, H.-l.


    The application of micro-electronics for vehicle, road and traffic management has increased rapidly in the past 10 to 15 years. The approach, however, is very often rather isolated, resulting in problems regarding consistency, continuity, uniformity and compatibility. The whole field of possible

  5. Independent verification survey report for exposure units Z2-24, Z2-31, Z2-32, AND Z2-36 in zone 2 of the East Tennessee technology park Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    King, David A. [Oak Ridge Inst. for Science and Education (ORISE), Oak Ridge, TN (United States)


    The U.S. Department of Energy (DOE) Oak Ridge Office of Environmental Management selected Oak Ridge Associated Universities (ORAU), through the Oak Ridge Institute for Science and Education (ORISE) contract, to perform independent verification (IV) at Zone 2 of the East Tennessee Technology Park (ETTP) in Oak Ridge, Tennessee. ORAU has concluded IV surveys, per the project-specific plan (PSP) (ORAU 2013a) covering exposure units (EUs) Z2-24, -31, -32, and -36. The objective of this effort was to verify the target EUs comply with requirements in the Zone 2 Record of Decision (ROD) (DOE 2005), as implemented by using the dynamic verification strategy presented in the dynamic work plan (DWP) (BJC 2007); and confirm commitments in the DWP were adequately implemented, as verified via IV surveys and soil sampling.

  6. Bile acids and lipids in isolated rat hepatocytes. II. Source of cholesterol used for bile acid formation, estimated by incorporation of tritium from tritiated water, and by the effect of ML-236B

    NARCIS (Netherlands)

    Kempen, H.J.; Vos Van Holstein, M.; Lange,


    Chemicals/CAS: cholesterol, 57-88-5; cholic acid, 32500-01-9, 361-09-1, 81-25-4; colestyramine, 11041-12-6, 58391-37-0; compactin, 73573-88-3; lipid, 66455-18-3; tritium oxide, 14940-65-9; Bile Acids and Salts; Cholesterol, 57-88-5; Cholestyramine, 11041-12-6; compactin, 73573-88-3; Lipids;

  7. Quantum-chemical consideration of extermal valent forms of actinides

    International Nuclear Information System (INIS)

    Ionova, G.V.; Pershina, V.G.; Spitsyn, V.I.


    Stability of valent forms of actinides that has not yet studied experimentally, is considered within the framework of quantum-chemical considerations. Oxidizing potentials E 0 for actinide elements are determined theoretically. A dependence of the definite valent state stability on relativistic effect is shown. A conclusion is made that oxidizing potential E 0 (4-5) for americium should be higher than E 0 (4-5) for plutonium. A relatively small oxidizing potential E 0 (4-5) for curium speaks about principle possibility of production of five-valent curium in solution, though it is less stable than the six-valent one. Oxidizing potential corresponding to transition of three-valent californium into the four-valent state should be less than the value adopted in literature. A relatively small oxidizing potential of californium E 0 (4-5) speaks about possible existence of five-valent californium in solution

  8. Fabrication and Pre-irradiation Characterization of a Minor Actinide and Rare Earth Containing Fast Reactor Fuel Experiment for Irradiation in the Advanced Test Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Timothy A. Hyde


    The United States Department of Energy, seeks to develop and demonstrate the technologies needed to transmute the long-lived transuranic actinide isotopes contained in spent nuclear fuel into shorter lived fission products, thereby decreasing the volume of material requiring disposal and reducing the long-term radiotoxicity and heat load of high-level waste sent to a geologic repository. This transmutation of the long lived actinides plutonium, neptunium, americium and curium can be accomplished by first separating them from spent Light Water Reactor fuel using a pyro-metalurgical process, then reprocessing them into new fuel with fresh uranium additions, and then transmuted to short lived nuclides in a liquid metal cooled fast reactor. An important component of the technology is developing actinide-bearing fuel forms containing plutonium, neptunium, americium and curium isotopes that meet the stringent requirements of reactor fuels and materials.

  9. Managing radioactive wastes of nuclear power plants in operation and site decommissioning phases

    International Nuclear Information System (INIS)

    Ardalani, E.; Khadivi, S.


    A large nuclear reactor annually produces about 25-50 tons consumed Uranium. These consumed materials consist of Uranium and also Plutonium and Curium. In total, about three percent of these materials are remained from fission. Existing actinides (Uranium, Plutonium, and Curium) cause long-term and short-term radiation that could have harmful effects on the environment. In order to reduce the diverse effects of radioactive wastes in Nuclear Power Plants, different procedures are employed such as compaction, chemical treatment, vitrification, canning and sealing with concrete and safe storage. In this paper, the harmful effects of nuclear wastes on the environment are introduced and a management procedure is presented to minimize its diverse effects

  10. Removal of actinides from high-level wastes generated in the reprocessing of commercial fuels

    International Nuclear Information System (INIS)

    Bond, W.D.; Leuze, R.E.


    Progress is reported on a technical feasibility study of removing the very long-lived actinides (uranium, neptunium, plutonium, americium, and curium) from high-level wastes generated in the commercial reprocessing of spent nuclear fuels. The study was directed primarily at wastes from the reprocessing of light water reactor (LWR) fuels and specifically to developing satisfactory methods for reducing the actinide content of these wastes to values that would make 1000-year-decayed waste comparable in radiological toxicity to natural uranium ore deposits. Although studies are not complete, results thus far indicate the most promising concept for actinide removal includes both improved recovery of actinides in conventional fuel reprocessing and secondary processing of the high-level wastes. Secondary processing will be necessary for the removal of americium and curium and perhaps some residual plutonium. Laboratory-scale studies of separations methods that appear most promising are reported and conceptual flowsheets are discussed. (U.S.)

  11. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Berry, John A.; Yui, Mikazu; Kitamura, Akira


    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  12. On possibility of transuranium element by the method of transport reactions

    International Nuclear Information System (INIS)

    Sinitsyna, G.S.; Krashenitsyn, G.N.; Shestakov, B.I.


    A possibility to use chemical transport reaction for separation of uranium, plutonium and some transplutonium elements is shown. The method is based on the use of the known plutonium property to form tetrachloride existing only in the gaseous phase in chlorine atmosphere, which is transported ever the temperature gradiept. Two ways of transport reaction realization - the method of flow and the method of diffusion in closed volume are tested. The experiments are made using specially synthesized plutonium dioxide, containing uranium, americium, curium, lanthanum, terbium, barium. Chlorination is realized by the mixture of chlorine and carbon tetrachloride at temperatures 723-953 K. Plutonium trichloride is deposited in the range 613-653 K, uranium - in the range 473-523 K, curium, americium, lanthanum, terbium, barium remain in the start zone if its temperature does not exceed 873 K

  13. A warning on fission resonance intergrals: Caveat utor

    International Nuclear Information System (INIS)

    Holden, N.E.


    A common error is made in defining the resonance integral in most tabulations and handbooks. Although it has a minor effect on the capture resonance integral and on the fission resonance integral for the fissile nuclides, it leads to gross errors in the fission resonance integral for the fertile nuclides. The errors in the fission resonance integral for fertile nuclides of the elements from thorium through curium in the ENDF/B-V library will be presented. Let the user beware

  14. Nuclear data needs for subcritical reactors with heavy-metal coolant

    International Nuclear Information System (INIS)

    Ignatyuk, A.V.


    Requests on improvement of evaluated data files for minor actinides (MA) are briefly reviewed. New evaluations of neutron cross sections for Np-237, Am-241 and Am-243 after the corresponding tests and verifications should satisfy the required accuracies of data for developing MA-burners. More difficult problems arise for curium isotopes, evaluated data of which are strongly divergent. International expertise of available evaluations could be very desirable. Needs in data improvements for perspective heavy-metal liquid coolants are outlined. (author)

  15. Recent solvent extraction experience at Savannah River

    International Nuclear Information System (INIS)

    Gray, L.W.; Burney, G.A.; Gray, J.H.; Hodges, M.E.; Holt, D.L.; Macafee, I.M.; Reif, D.J.; Shook, H.E.


    Tributyl phosphate-based solvent extraction processes have been used at Savannah River for more than 30 years to separate and purify thorium, uranium, neptunium, plutonium, americium, and curium isotopes. This report summarizes the advancement of solvent extraction technology at Savannah River during the 1980's. Topics that are discussed include equipment improvements, solvent treatment, waste reduction, and an improved understanding of the various chemistries in the process streams entering, within, and leaving the solvent extraction processes

  16. Analog elements for transuranic chemistries

    International Nuclear Information System (INIS)

    Weimer, W.C.


    The analytical technique for measuring trace concentrations of the analog rare earth elements has been refined for optimal detection. The technique has been used to determine the rare earth concentrations in a series of geological and biological materials, including samples harvested from controlled lysimeter investigations. These studies have demonstrated that any of the trivalent rare earth elements may be used as analog elements for the trivalent transuranics, americium and curium

  17. Computation of actinide pourbaix diagrams at 298 K and 550 K (U,Np,Pu,Am,Cm - H{sub 2}O)

    Energy Technology Data Exchange (ETDEWEB)

    Piro, M.H.; Bruni, G.M.F.; Lewis, B.J.; Thompson, W.T., E-mail: [Royal Military College of Canada, Dept. of Chemistry and Chemical Engineering, Kingston, Ontario (Canada); Iglesias, F.C. [Candesco Corp., Toronto, Ontario (Canada); Guoping, M.A.; Nashiem, R. [Bruce Power Limited., Tiverton, Ontario (Canada); Roberts, J.G. [Cantech Associates Limited, Burlington, Ontario (Canada)


    Pourbaix diagrams for the actinides ranging from uranium to curium have been developed from the enthalpy of formation, entropy and heat capacity (or estimates thereof) for the phases and aqueous species. Emphasis has been given to the region between hydrogen and oxygen gas saturation.Additional thermodynamic computations illustrate how the data may be employed in better understanding the chemical behaviour of fuel debris circulating in CANDU reactor coolant. (author)

  18. Analysis of Americium in Transplutonium Process Solutions

    International Nuclear Information System (INIS)

    Ferguson, R.B.


    One of the more difficult analyses in the transplutonium field is the determination of americium at trace levels in a complex matrix such as a process dissolver solution. Because of these conditions a highly selective separation must precede the measurement of americium. The separation technique should be mechanically simple to permit remote operation with master-slave manipulators. For subsequent americium measurement by the mass spectroscopic isotopic-dilution technique, plutonium and curium interferences must also have been removed

  19. Device for the determination of concentrations of fissile and/or fertile materials by means of x-ray fluorescence spectrometry

    International Nuclear Information System (INIS)

    Von Baeckmann, A.; Neuber, J.


    In analyzing fissile and/or fertile materials in the thorium, uranium, neptunium, plutonium, americium and curium group, time and accuracy are significant factors. An automated system for rapidly analyzing these materials includes: sample preparation device in which aliquots of sample are weighed and mixed with known amounts of solution; x-ray fluorescence spectrometer; and, a central control system for controlling the operation and analyzing the data. (auth)

  20. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.


    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual