Molecular characterization of barley ( Hordeum vulgare L.) genome ...
African Journals Online (AJOL)
The present work aimed to select drought tolerant barley (Hordeum vulgare L.) cultivars through identification of stress genes responsible for drought tolerance. Several barley genotypes were tested for drought resistance using specific molecular markers, nine out of all the genotypes were chosen for this study; five out of ...
Lipid and sugar profiles of various barley cultivars (Hordeum vulgare
Directory of Open Access Journals (Sweden)
Pastor Kristian A.
2015-01-01
Full Text Available The lipid components and soluble sugars in flour samples of different cultivars of barley (Hordeum vulgare, involving winter malting barley, winter forage barley, spring barley, and hulless barley, were identified. Fatty acids were extracted from flour samples with n-hexane, and derivatized into volatile methyl esters, using TMSH (trimethylsulfonium hydroxide in methanol. Soluble sugars were extracted from defatted and dried samples of barley flour with 96% ethanol, and further derivatized into the corresponding trimethylsilyl (TMS oximes, using hydroxylamine hydrochloride solution and BSTFA (N,O-bis-(trimethylsilyl-trifluoroacetamide. The hexane and alcoholic extracts of barley cultivars were analyzed by GC-MS system. Lipid and sugar compositions were very similar in all barley cultivars. Therefore, multivariate analysis was applied to numerical values of automatically integrated areas of the identified fatty acid methyl esters and TMS oximes of soluble sugars. The application of hierarchical cluster analysis showed a great similarity between the investigated flour samples of barley cultivars, according to their fatty acid content (0.96. Also, significant, but somewhat less similarity was observed regarding the content of soluble sugars (0.70. These preliminary results indicate the possibility of distinguishing flour made of barley, regardless of the variety, from flours made of other cereal species, just by the analysis of the contents of fatty acids and soluble sugars.[Projekat Ministarstva nauke Republike Srbije, br. TR 31066
International Nuclear Information System (INIS)
Forster, B.P.; Pakniyat, H.; Macaulay, M.; Matheson, W.; Phillips, M.S.; Thomas, W.T.B.; Powell, W.
1994-01-01
Tests for shoot and root sodium content were carried out on various barley cultivars (Hordeum vulgare) and experimental lines including wild barley (H. spontaneum) and derivatives. Lines were grown in hydroculture with and without the addition of salt (NaCl), and sodium concentrations in shoots and roots were determined. Variation in shoot sodium content was found between the various lines; in contrast, no significant differences were found between the lines tested for root sodium content. The most significant finding was the variation in shoot sodium content between the two cultivars Golden Promise and Maythorpe. Golden Promise is a direct gamma-ray induced mutant of the cultivar Maythorpe and the reduced shoot sodium content of Golden Promise can be attributed to radiation treatment. (author)
DEFF Research Database (Denmark)
Backes, G.; Madsen, L.H.; Jaiser, H.
2003-01-01
The aims of this investigation have been to map new (quantitative) resistance genes against powdery mildew, caused by Blumeria graminis f.sp. hordei L., and leaf rust, caused by Puccinia hordei L., in a cross between the barley (Hordeum vulgare ssp. vulgare) cultivar "Vada" and the wild barley...... (Hordeum vulgare ssp. spontaneum) line "1B-87" originating from Israel. The population consisted of 121 recombinant inbred lines. Resistance against leaf rust and powdery mildew was tested on detached leaves. The leaf rust isolate "I-80" and the powdery mildew isolate "Va-4", respectively, were used...
Heterologous expression of Hordeum vulgare cysteine protease in yeast
DEFF Research Database (Denmark)
Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B
Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned with and w......Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp.
Indian Academy of Sciences (India)
Genetic diversity in barley landraces (Hordeum vulgare L. subsp. vulgare) originated from Crescent Fertile region as detected by seed storage proteins. RIM MZID FARHAT CHIBANI RAYDA BEN AYED MOHSEN HANANA JOELLE BREIDI RABIH KABALAN SAMIH EL-HAJJ HASSAN MACHLAB AHMED REBAI LAMIS ...
Haploid Barley from the Intergeneric Cross Hordeum vulgare x Psathyrostachys fragilis
DEFF Research Database (Denmark)
Bothmer, Roland; Jacobsen, Niels; Bagger Jørgensen, Rikke
1984-01-01
The intergeneric hybrid Hordeum vulgare x Psathyrostachys fragilis was fairly easily obtained. During each growing season the intermediate, perennial hybrid yielded haploid tillers of H. vulgare. Late in one season few, hybrid tillers headed. The morphology, cytology and enzymatic patterns...
Differential responses of two Egyptian barley (Hordeum vulgare L.) cultivars to salt stress.
Elsawy, Hayam I A; Mekawy, Ahmad Mohammad M; Elhity, Mahmoud A; Abdel-Dayem, Sherif M; Abdelaziz, Maha Nagy; Assaha, Dekoum V M; Ueda, Akihiro; Saneoka, Hirofumi
2018-06-01
Although barley (Hordeum vulgare L.) is considered a salt tolerant crop species, productivity of barley is affected differently by ionic, osmotic, and oxidative stresses resulting from a salty rhizosphere. The current study was conducted to elucidate the mechanism of salt tolerance in two barley cultivars, Giza128 and Giza126. The two cultivars were exposed to 200 mM NaCl hydroponically for 12 days. Although both cultivars accumulated a large amount of Na + in their leaves with similar concentrations, the growth of Giza128 was much better than that of Giza126, as measured by maintaining a higher dry weight, relative growth rate, leaf area, and plant height. To ascertain the underlying mechanisms of this differential tolerance, first, the relative expression patterns of the genes encoding Na + /H + antiporters (NHX) and the associated proton pumps (V-PPase and V-ATPase) as well as the gene encoding the plasma membrane PM H + -ATPase were analyzed in leaf tissues. Salt stress induced higher HvNHX1 expression in Giza128 (3.3-fold) than in Giza126 (1.9-fold), whereas the expression of the other two genes, HvNHX2 and HvNHX3, showed no induction in either cultivar. The expression of HvHVP1 and HvHVA was higher in Giza128 (3.8- and 2.1-fold, respectively) than in Giza126 (1.6- and 1.1-fold, respectively). The expression of the PM H + -ATPase (ha1) gene was induced more in Giza128 (8.8-fold) than in Giza126 (1.8-fold). Second, the capacity for ROS detoxification was assessed using the oxidative stress biomarkers electrolyte leakage ratio (ELR) and the concentrations of malondialdehyde (MDA) and hydrogen peroxide (H 2 O 2 ), and these parameters sharply increased in Giza126 leaves by 66.5%, 42.8% and 50.0%, respectively, compared with those in Giza128 leaves. The antioxidant enzyme (CAT, APX, sPOD, GR, and SOD) activities were significantly elevated by salt treatment in Giza128 leaves, whereas in Giza126, these activities were not significantly altered. Overall, the
Triple Hybridization with Cultivated Barley (Hordeum vulgare L.)
DEFF Research Database (Denmark)
Bothmer, R. von; Claesson, L.; Flink, J.
1989-01-01
A crossing programme for trispecific hybridization including cultivated barely (Hordeum vulgare L.) as the third parent was carried out. The primary hybrids comprised 11 interspecific combinations, each of which had either H. jabatum or H. lechleri as one of the parents. The second parent...
International Nuclear Information System (INIS)
Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.
2015-01-01
The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)
Directory of Open Access Journals (Sweden)
Lucie Maršálová
2016-08-01
Full Text Available Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley Hordeum marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defence-related proteins from late-embryogenesis abundant (LEA family, several chaperones from heat shock protein (HSP family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper (bZIP and nascent polypeptide-associated complex (NAC families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H
DEFF Research Database (Denmark)
Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.
1986-01-01
Callus was induced from hybrids between cultivated barley (Hordeum vulgare L. ssp. vulgare) and ten species of wild barley (Hordeum L.) as well as from one backcross line ((H. lechleri .times. H. vulgare) .times. H. vulgare). Successful callus induction and regeneration of plants were achieved from...... explants of young spikes on the barley medium J 25-8. The capacity for plant regeneration was dependent on the wild parental species. In particular, combinations with four related wild species, viz. H. jubatum, H. roshevitzii, H. lechleri, and H. procerum, regenerated high numbers of plants from calli....
Hordeum vulgare cysteine protease heterologous expressed in yeast
DEFF Research Database (Denmark)
Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach
, (Hordeum vulgare) endoprotease B2 (HvEPB2) was cloned with and without the 5 amino acid C-terminal sequence into the Pichia pastoris expression vector pPICZ Aα and electrotransformed into Pichia pastoris strain SDM1163. Heterologous protein production was induced with 2% MeOH and the protein expression...
Cytogenetisch en embryologisch onderzoek aan kruisingen tussen Hordeum vulgare en H. bulbosum
Lange, W.
1969-01-01
Crosses between barley (Hordeum vulgare) and bulbous barleygrass ( H.bulbosum) could be valuable for the transfer of such properties as resistance to cold or diseases from H. bulbosum to H. vulgare. From the literature it was known that difficulties arose in the cross: seed abortion necessitating
Evaluation of genetic diversity in barley (Hordeum vulgare L.) from ...
African Journals Online (AJOL)
User
2015-06-03
Jun 3, 2015 ... were kernel weight per spike and thousand seed weight. ...... Ser. Biol. 17:65-70. CSA (2010) Area and production of crops (private peasant holdings, ... (Hordeum vulgare L.) landraces in variable production system,. Ethiopia.
International Nuclear Information System (INIS)
Mahmood, K.
2011-01-01
Although barley (Hordeum vulgare L.) is regarded as salt tolerant among crop plants, its growth and plant development is severely affected by ionic and osmotic stresses in salt-affected soils. To elucidate the tolerance mechanism, growth and ion uptake of three barley cultivars, differing in salt tolerance, were examined under different levels of NaCl, K/sup +/ Na/sup +/ and NaHCO/sub 3/ in the root medium. The cultivars differed greatly in their responses to varying root medium conditions. Plant growth was more adversely affected by NaHCO/sub 3/ than NaCl. In general, biomass yields were comparable under control and 100 mM NaCl. However, growth of all three cultivars was significantly inhibited by NaHCO/sub 3/ even at low concentration (10 mM). Improved K/sup +/ supply in saline medium increased K/sup +/ uptake and growth of less tolerant cultivars. K/sup +/ uptake was more adversely affected by NaHCO/sub 3/ than NaCl salinity. Selective K/sup +/ uptake and lower Cl/sup -/ in shoots seemed to be associated with the growth responses. K application would help better growth of these cultivars on K-deficient saline-sodic soils and under irrigation with poor quality water having high Residual Sodium Carbonate (RSC) and/or Sodium Adsorption Ratio (SAR). (author)
Evaluation of genetic diversity in barley ( Hordeum vulgare L.) from ...
African Journals Online (AJOL)
This study aimed to determine the genetic diversity and relationships among barley varieties (Hordeum vulgare L.) growing at Wollo Highland areas by using hordein and agro-morphological traits. Twenty (20) varieties were laid down in randomized complete block design (RCBD) design with three replications; they were ...
Zhou, Hong; Liu, Shihang; Liu, Yujiao; Liu, Yaxi; You, Jing; Deng, Mei; Ma, Jian; Chen, Guangdeng; Wei, Yuming; Liu, Chunji; Zheng, Youliang
2016-09-13
Kernel length is an important target trait in barley (Hordeum vulgare L.) breeding programs. However, the number of known quantitative trait loci (QTLs) controlling kernel length is limited. In the present study, we aimed to identify major QTLs for kernel length, as well as putative candidate genes that might influence kernel length in wild barley. A recombinant inbred line (RIL) population derived from the barley cultivar Baudin (H. vulgare ssp. vulgare) and the long-kernel wild barley genotype Awcs276 (H.vulgare ssp. spontaneum) was evaluated at one location over three years. A high-density genetic linkage map was constructed using 1,832 genome-wide diversity array technology (DArT) markers, spanning a total of 927.07 cM with an average interval of approximately 0.49 cM. Two major QTLs for kernel length, LEN-3H and LEN-4H, were detected across environments and further validated in a second RIL population derived from Fleet (H. vulgare ssp. vulgare) and Awcs276. In addition, a systematic search of public databases identified four candidate genes and four categories of proteins related to LEN-3H and LEN-4H. This study establishes a fundamental research platform for genomic studies and marker-assisted selection, since LEN-3H and LEN-4H could be used for accelerating progress in barley breeding programs that aim to improve kernel length.
DEFF Research Database (Denmark)
Jensen, J.; Linde-Laursen, Ib
1984-01-01
In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...
Development and Meiosis of Three Interspecific Hybrids with Cultivated Barley (Hordeum vulgare L.)
DEFF Research Database (Denmark)
Von Bothmer, R.; Flink, J.; Linde-Laursen, Ib
1986-01-01
The development and meiosis of three interspecific hybrids between cultivated barley (Hordeum vulgare L.) and H. secalinum Schreb., H. tetraploidum Covas, and H. parodii Covas, respectively, were studied. All three hybrid combinations developed very slowly vegetatively. Meiosis of the hybrids...
Characterization of senscence-associated NAC transcription factors in Barley (Hordeum Vulgare L.)
DEFF Research Database (Denmark)
Podzimska, Dagmara Agata
, such as yield, biomass production and nutrient quality, and NAC (NAM, ATAF1/2 and CUC2) transcription factors are promising targets for the breeding. The aim of this thesis was thus to assess the role of NAC transcription factors in regulation of senescence in barley (Hordeum vulgare L.) and to contribute...
DEFF Research Database (Denmark)
Bothmer, R. von; Bengtsson, M.; Flink, J.
1988-01-01
Several complex hybrids were produced from the combination [(Hordeum lechleri, 6 .times. .times. H. procerum, 6 .times.) .times. H. vulgare, 2 .times.]. Crosses with six diploid barley lines resulted in triple hybrids, most of which had a full complement of barley chromosomes (no. 1-7), but were...
NAC Transcription Factors of Barley (Hordeum vulgare L.) and their Involvement in Leaf Senescence
DEFF Research Database (Denmark)
Wagner, Michael
parts of the senescence process. The specific aims of this study were therefore (1) to establish and characterise the NAC transcription factors of the model cereal crop barley (Hordeum vulgare L.) (2) to identify and study putative barley NAC transcription factors involved in the regulation of leaf...
Resistance genes in barley (Hordeum vulgare L.) and their identification with molecular markers.
Chełkowski, Jerzy; Tyrka, Mirosław; Sobkiewicz, Andrzej
2003-01-01
Current information on barley resistance genes available from scientific papers and on-line databases is summarised. The recent literature contains information on 107 major resistance genes (R genes) against fungal pathogens (excluding powdery mildew), pathogenic viruses and aphids identified in Hordeum vulgare accessions. The highest number of resistance genes was identified against Puccinia hordei, Rhynchosporium secalis, and the viruses BaYMV and BaMMV, with 17, 14 and 13 genes respectively. There is still a lot of confusion regarding symbols for R genes against powdery mildew. Among the 23 loci described to date, two regions Mla and Mlo comprise approximately 31 and 25 alleles. Over 50 R genes have already been localised and over 30 mapped on 7 barley chromosomes. Four barley R genes have been cloned recently: Mlo, Rpg1, Mla1 and Mla6, and their structures (sequences) are available. The paper presents a catalogue of barley resistance gene symbols, their chromosomalocation and the list of available DNA markers useful in characterising cultivars and breeding accessions.
Informed collecting, conservation, monitoring and utilization of genetic diversity require knowledge of the distribution and structure of genetic variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic...
Bengtsson, Therése; Åhman, Inger; Manninen, Outi; Reitan, Lars; Christerson, Therese; Due Jensen, Jens; Krusell, Lene; Jahoor, Ahmed; Orabi, Jihad
2017-01-01
The powdery mildew fungus, Blumeria graminis f. sp. hordei is a worldwide threat to barley ( Hordeum vulgare L. ssp. vulgare ) production. One way to control the disease is by the development and deployment of resistant cultivars. A genome-wide association study was performed in a Nordic spring barley panel consisting of 169 genotypes, to identify marker-trait associations significant for powdery mildew. Powdery mildew was scored during three years (2012-2014) in four different locations within the Nordic region. There were strong correlations between data from all locations and years. In total four QTLs were identified, one located on chromosome 4H in the same region as the previously identified mlo locus and three on chromosome 6H. Out of these three QTLs identified on chromosome 6H, two are in the same region as previously reported QTLs for powdery mildew resistance, whereas one QTL appears to be novel. The top NCBI BLASTn hit of the SNP markers within the novel QTL predicted the responsible gene to be the 26S proteasome regulatory subunit, RPN1, which is required for innate immunity and powdery mildew-induced cell death in Arabidopsis . The results from this study have revealed SNP marker candidates that can be exploited for use in marker-assisted selection and stacking of genes for powdery mildew resistance in barley.
DEFF Research Database (Denmark)
Kirkensgaard, Kristine Groth; Hägglund, Per; Finnie, Christine
2009-01-01
to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 A resolution and refined to an R (cryst) of 19.0% and an R (free) of 23.8%. The dimeric protein...
DEFF Research Database (Denmark)
Knoch, Eva; Motawie, Mohammed Saddik; Olsen, Carl Erik
2016-01-01
Barley (Hordeum vulgare L.) produces five leucine-derived hydroxynitrile glucosides (HNGs), of which only epiheterodendrin is a cyanogenic glucoside. The four non-cyanogenic HNGs are the β-HNG epidermin and the γ-HNGs osmaronin, dihydroosmaronin and sutherlandin. By analyzing 247 spring barley...
Ceretta, S.S.E.; Eeuwijk, van F.A.
2008-01-01
The efficiency of cultivar trial networks is an important subject in official cultivar testing. We investigated this efficiency for malting barley (Hordeum vulgare L.) in Uruguay, using data on 213 cultivars tested across an eight-year period at six locations. The variance-components approach was
DEFF Research Database (Denmark)
Pedersen, L.H.; Jacobsen, S.; Hejgaard, J.
1993-01-01
The plasma membrane bound beta-1,3-D-glucan (callose) synthase. assumed to be involved in the resistance to the powdery mildew fungus (Erysiphe graminis f.sp. hordei), was partially purified from a microsomal fraction of green barley leaves (Hordeum vulgare L.). Plasma membranes were enriched...
cultivars and identification of genotype-specific fingerprints using ...
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 89; Online resources. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers. S. K. Jaiswal Shree P. Pandey S. Sharma R. Prasad L. C. Prasad R. P. S. Verma Arun K. Joshi. Volume 89 Online ...
Evaluation of barley (hordeum vulgare l.) germplasm for high forage production under salt stress
International Nuclear Information System (INIS)
Saleem, A.; Qurainy, F.A.; Akram, N.A.
2014-01-01
To explore high biomass producing salt tolerant cultivars of a potential forage crop barley (Hordeum vulgare L.), 30-day old plants of 105 different accessions from different origin were subjected to saline and non-saline (control) conditions for 45 days. Salinity stress (150 mM NaCl) markedly suppressed plant growth (shoot and/or root fresh and dry weights), chlorophyll pigments (a and b), internal CO/sub 2/ concentration, stomatal conductance, rate of transpiration and photosynthesis, while a considerable salt-induced increase was observed in all fluorescence related attributes including efficiency of photosystem-II (Fv/Fm), co-efficient of non-photochemical quenching (QN), photochemical quenching (QP), and non-photochemical quenching (NPQ) in all 105 accessions of barley. The response of all 105 barley accessions to salt stress varied significantly for all the morpho-physiological attributes determined in the present study. Overall, on the basis of shoot and root dry weights, accessions, 4050, 4053, 4056, 4163, 4228, 4229, 4244, 4245, 4290, 4414, 4415, 4427, 4452, Mahali, Jesto, 4165, 4229, 4249, 4405, 4409, 4426, 4456, and Giza 123 were found superior while accessions, 4245, 4158, 4166, 4246, 4406, 4423, 4441, 4442 4447, 4453 and 4458 inferior under saline conditions. (author)
Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu
2009-01-01
Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593
Diversity in Indian barley (Hordeum vulgare) cultivars and ...
Indian Academy of Sciences (India)
tinguish varieties of crop plants and establish their purity as a prerequisite for any ... of genetic material in germplasm collection and as a general guide for the choice ... Sixty-nine barley cultivars were grown under field condi- tions in three ...
Geography of Genetic Structure in Barley Wild Relative Hordeum vulgare subsp. spontaneum in Jordan.
Thormann, Imke; Reeves, Patrick; Reilley, Ann; Engels, Johannes M M; Lohwasser, Ulrike; Börner, Andreas; Pillen, Klaus; Richards, Christopher M
2016-01-01
Informed collecting, conservation, monitoring and utilization of genetic diversity requires knowledge of the distribution and structure of the variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic diversity for barley improvement and co-occurs with the domesticate within the center of origin. We studied the current distribution of genetic diversity and population structure in H. vulgare subsp. spontaneum in Jordan and investigated whether it is correlated with either spatial or climatic variation inferred from publically available climate layers commonly used in conservation and ecogeographical studies. The genetic structure of 32 populations collected in 2012 was analyzed with 37 SSRs. Three distinct genetic clusters were identified. Populations were characterized by admixture and high allelic richness, and genetic diversity was concentrated in the northern part of the study area. Genetic structure, spatial location and climate were not correlated. This may point out a limitation in using large scale climatic data layers to predict genetic diversity, especially as it is applied to regional genetic resources collections in H. vulgare subsp. spontaneum.
Directory of Open Access Journals (Sweden)
Šurlan-Momirović Gordana
2013-01-01
Full Text Available Molecular diversity of 145 barley (Hordeum vulgare subsp. vulgare L. accessions from the Serbian GenBank was assessed by single sequence repeats (SSR markers. A set of 15 SSRs, covering all chromosomes of the diploid barley genome with 2-3 SSR markers per chromosome, with a range of 4-18 alleles per locus were used. In total, 15 loci and 119 alleles were detected, with an average of 7.93 alleles per locus. The Polymorphic information content value ranged from 0.220 to 0.782 with a mean value of 0.534. Regarding the growth habit and row type groups, gene diversity was comparatively higher for the spring (0.616 and six-rowed accessions (0.616 than for the winter and two- rowed accessions (0.322 and 0.478, respectively. Analysis of molecular variance showed that all sources of variation were significant (P < 0.01, but the between-group component was predominant (76.85% for growth habit and 89.45% for row type. Unweighted Pair Group Method with Arithmetic Mean (UPGMA cluster analysis based on the shared allele distance (DSA matrix estimated on the SSR data assigned the genotypes into two clusters - the first smaller consisting of the six 6-rowed spring cultivars and the second comprising six subclusters. Genotype MBR1012 was separated from all other genotypes that constitute UPGMA tree. The associations of genotypes belonging to different growth habit and row type groups were assessed using Principal Coordinate Analysis revealing separation of winter growth habit group from facultative one. The use of the STRUCTURE clustering algorithm allowed the identification of 2 subpopulations of genotypes. [Projekat Ministarstva nauke Republike Srbije, br. TR31092
International Nuclear Information System (INIS)
Bornman, J.F.; Bjoern, L.O.; Bornman, C.H.
1982-01-01
Estimates of viability as measured by vital straining with fluorescein diacetate were carried out on freshly isolated and partially aged (16-hour-old) Beta vulgaris and Hordeum vulgare mesophyll protoplasts following irradiation with UV-B. Damage to the photosynthetic system by UV-B was determined by delayed light emission (DLE). In the case of freshly isolated Protoplasts Beta was approximately 30% more susceptible than Hordeum following 3h irradiation, with viability decreasing from 90% to 40%. After storage of protoplasts on ice for 16 h UV-B radiation markedly depressed viability in both species, but in the case of Hordeum there was a substantial initial loss of nearly 70% in viability over the first hour of irradiation. The first 10 min of UV-B radiation decreased the intensity of DLE by 40% without appreciably affecting the decay rate. Longer treatment times did not give a proportional effect so that even after 60 min of UV-B the inhibition did not exceed 60%. This suggested that although the enzyme system responsible for FDA hydrolysis may be partially inactivated (viability was 75-80% as compared with 90% in the control), the UV-B did not penetrate the innermost parts of the chloroplasts, but left some thylakoids undamaged. (orig.)
International Nuclear Information System (INIS)
Cowan, A.K.; Railton, I.D.
1987-01-01
Excised light-grown leaves and etiolated leaves of Hordeum vulgare L. cv Dyan catabolized applied (+/-)-[2- 14 C]abscisic acid ([+/-]-[2- 14 C]ABA) to phaseic acid (PA), dihydrophaseic acid (DPA), and 2'-hydroxymethyl ABA (2'-HMABA). Identification of these catabolites was made by microchemical methods and by combined capillary gas chromatography-mass spectrometry (GC-MS) following high dose feeds of nonlabeled substrate to leaves. Circular dichroism analysis revealed that 2'-HMABA was derived from the (-) enantiomer of ABA. Refeeding studies were used to confirm the catabolic route. The methyl ester of (+/-)-[2 14 C]-ABA was hydrolyzed efficiently by light-grown leaves of H. vulgare. Leaf age played a significant role in (+/-)-ABA catabolism, with younger leaves being less able than their older counterparts to catabolize this compound. The catabolism of (+/-)-ABA was inhibited markedly in water-stressed Hordeum leaves which was characterized by a decreased incorporation of label into 2'-HMABA, DPA, and conjugates. The specific, mixed function oxidase inhibitor, ancymidol, did not inhibit, dramatically (+/-)-ABA catabolism in light-grown leaves of Hordeum whereas the 80s ribosome, translational inhibitor, cycloheximide, inhibited this process markedly. The 70s ribosome translational inhibitors, lincomycin and chloramphenicol, were less effective than cycloheximide in inhibiting (+/-)-ABA catabolism, implying that cytoplasmic protein synthesis is necessary for the catabolism of (+/-)-ABA in Hordeum leaves whereas chloroplast protein synthesis plays only a minor role. This further suggests that the enzymes involved in (+/-)-ABA catabolism in this plant are cytoplasmically synthesized and are turned-over rapidly, although the enzyme responsible for glycosylating (+/-)-ABA itself appeared to be stable
Rankl, Simone
2017-01-01
N-Acyl-D/L-homoserine lactones (AHLs) are produced as microbial signaling compounds during bacterial intra- and inter-specific communication in the rhizosphere. Thus, plants are naturally exposed to these compounds and respond with tissue-specific reactions. In the present study the impact of AHLs on the monocot barley (Hordeum vulgare L.) was investigated. The treatment with C8- and C12- homoserine lactones (HSL) resulted in root and shoot biomass gain as well as in the formation of lat...
Directory of Open Access Journals (Sweden)
Pavlova Violetta Aleksandrovna
2014-04-01
Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.
Ramakrishna, Ramnarain; Sarkar, Dipayan; Manduri, Avani; Iyer, Shreyas Ganesan; Shetty, Kalidas
2017-10-01
Sprouts of cereal grains, such as barley ( Hordeum vulgare L.), are a good source of beneficial phenolic bioactives. Such health relevant phenolic bioactives of cereal sprouts can be targeted to manage chronic hyperglycemia and oxidative stress commonly associated with type 2 diabetes (T2D). Therefore improving phenolic bioactives by stimulating plant endogenous defense responses such as protective pentose phosphate pathway (PPP) during sprouting has significant merit. Based on this metabolic rationale, this study aimed to enhance phenolic bioactives and associated antioxidant and anti-hyperglycemic functions in dark germinated barley sprouts using exogenous elicitor treatments. Dark-germinated sprouts of two malting barley cultivars (Pinnacle and Celebration), treated with chitosan oligosaccharide (COS) and marine protein hydrolysate (GP), were evaluated. Total soluble phenolic content (TSP), phenolic acid profiles, total antioxidant activity (TA) and in vitro inhibitory activities of hyperglycemia relevant α-amylase and α-glucosidase enzymes of the dark germinated barley sprouts were evaluated at day 2, 4, and 6 post elicitor treatments. Overall, TSP content, TA, and α-amylase inhibitory activity of dark germinated barley sprouts decreased, while α-glucosidase inhibitory activity and gallic acid content increased from day 2 to day 6. Among barley cultivars, high phenolic antioxidant-linked anti-hyperglycemic bioactives were observed in Celebration. Furthermore, GP and COS seed elicitor treatments in selective doses improved T2D relevant phenolic-linked anti-hyperglycemic bioactives of barley spouts at day 6. Therefore, such seed elicitation approach can be strategically used to develop bioactive enriched functional food ingredients from cereal sprouts targeting chronic hyperglycemia and oxidative stress linked to T2D.
Matthies, I.E.; Hintum, van T.J.L.; Weise, S.; Röder, M.S.
2012-01-01
Diversity arrays technology (DArT) and simple sequence repeat (SSR) markers were applied to investigate population structure, extent of linkage disequilibrium and genetic diversity (kinship) on a genome-wide level in European barley (Hordeum vulgare L.) cultivars. A set of 183 varieties could be
Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences
DEFF Research Database (Denmark)
Svitashev, S.; Bryngelsson, T.; Vershinin, A.
1994-01-01
A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...
Genome-Wide Association Mapping of Stem Rust Resistance in Hordeum vulgare subsp. spontaneum.
Sallam, Ahmad H; Tyagi, Priyanka; Brown-Guedira, Gina; Muehlbauer, Gary J; Hulse, Alex; Steffenson, Brian J
2017-10-05
Stem rust was one of the most devastating diseases of barley in North America. Through the deployment of cultivars with the resistance gene Rpg1 , losses to stem rust have been minimal over the past 70 yr. However, there exist both domestic (QCCJB) and foreign (TTKSK aka isolate Ug99) pathotypes with virulence for this important gene. To identify new sources of stem rust resistance for barley, we evaluated the Wild Barley Diversity Collection (WBDC) (314 ecogeographically diverse accessions of Hordeum vulgare subsp. spontaneum ) for seedling resistance to four pathotypes (TTKSK, QCCJB, MCCFC, and HKHJC) of the wheat stem rust pathogen ( Puccinia graminis f. sp. tritici , Pgt ) and one isolate (92-MN-90) of the rye stem rust pathogen ( P. graminis f. sp. secalis , Pgs ). Based on a coefficient of infection, the frequency of resistance in the WBDC was low ranging from 0.6% with HKHJC to 19.4% with 92-MN-90. None of the accessions was resistant to all five cultures of P. graminis A genome-wide association study (GWAS) was conducted to map stem rust resistance loci using 50,842 single-nucleotide polymorphic markers generated by genotype-by-sequencing and ordered using the new barley reference genome assembly. After proper accounting for genetic relatedness and structure among accessions, 45 quantitative trait loci were identified for resistance to P. graminis across all seven barley chromosomes. Three novel loci associated with resistance to TTKSK, QCCJB, MCCFC, and 92-MN-90 were identified on chromosomes 5H and 7H, and two novel loci associated with resistance to HKHJC were identified on chromosomes 1H and 3H. These novel alleles will enhance the diversity of resistance available for cultivated barley. Copyright © 2017 Sallam et al.
Zinc blotting assay for detection of zinc binding prolamin in barley (Hordeum vulgare) grain
DEFF Research Database (Denmark)
Uddin, Mohammad Nasir; Nielsen, Ane Langkilde-Lauesen; Vincze, Eva
2014-01-01
In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc......-binding protein. However, to our knowledge so far this zinc blotting assay has never been applied to detect a prolamin fraction in barley grains. A radioactive zinc (65ZnCl2) blotting technique was optimized to detect zinc-binding prolamins, followed by development of an easy-to-follow nonradioactive colorimetric...... zinc blotting method with a zinc-sensing dye, dithizone. Hordeins were extracted from mature barley grain, separated by SDS-PAGE, blotted on a membrane, renatured, overlaid, and probed with zinc; subsequently, zinc-binding specificity of certain proteins was detected either by autoradiography or color...
Directory of Open Access Journals (Sweden)
Z Amini
2013-08-01
Full Text Available Future climate changes are expected to increase risks of drought, which already represent the most common stress factor for stable barley (Hordeum vulgare L. production in Iran. Up to now, extensive research projects have been done to study effects of drought stress on the antioxidant enzyme activity. While there is a few works of such studies on the field condition. In order to study of water deficit effects on the antioxidant enzymes activities as a secondary stress, we evaluate the effects of mild and severe drought stress on activities of antioxidative enzymes including superoxide dismutases, ascorbate peroxidase, catalase and peroxidase, among four barley genotypes, differing in the capacity to maintain the grain yield under drought condition during beginning on anthesis, kernel watery ripe and late milk stages under field condition. Results showed that drought increased the activity of antioxidant enzymes in all genotypes. At beginning of anthesis, POX activity of Q22 was higher than it in other genotypes ( P
Powdery Mildew Resistance in 268 Entries of Hordeum vulgare
DEFF Research Database (Denmark)
Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J
1984-01-01
A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most...
Piacentini, Karim Cristina
2015-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias, Programa de Pós-Graduação em Ciência dos Alimentos, Florianópolis, 2015. A cevada (Hordeum vulgare L sp. vulgare) é considerada um dos cereais mais importantes no contexto mundial. Atualmente, uma preocupação latente da indústria cervejeira é o crescimento de fungos filamentosos nos grãos, que acorre devido ao manejo inadequado da matéria prima durante o armazenamento (excesso de umidade), a conde...
Geras'kin, Stanislav A; Oudalova, Alla A; Kim, Jin Kyu; Dikarev, Vladimir G; Dikareva, Nina S
2007-03-01
The induction of chromosome aberrations in Hordeum vulgare germinated seeds was studied after ionizing irradiation with doses in the range of 10-1,000 mGy. The relationship between the frequency of aberrant cells and the absorbed dose was found to be nonlinear. A dose-independent plateau in the dose range from about 50 to 500 mGy was observed, where the level of cytogenetic damage was significantly different from the spontaneous level. The comparison of the goodness of the experimental data fitting with mathematical models of different complexity, using the most common quantitative criteria, demonstrated the advantage of a piecewise linear model over linear and polynomial models in approximating the frequency of cytogenetical disturbances. The results of the study support the hypothesis of indirect mechanisms of mutagenesis induced by low doses. Fundamental and applied implications of these findings are discussed.
Cardinal, Marie-Josée; Kaur, Rajvinder; Singh, Jaswinder
2016-10-01
Domestication and intensive selective breeding of plants has triggered erosion of genetic diversity of important stress-related alleles. Researchers highlight the potential of using wild accessions as a gene source for improvement of cereals such as barley, which has major economic and social importance worldwide. Previously, we have successfully introduced the maize Ac/Ds transposon system for gene identification in cultivated barley. The objective of current research was to investigate the response of Hordeum vulgare ssp. spontaneum wild barley accessions in tissue culture to standardize parameters for introduction of Ac/Ds transposons through genetic transformation. We investigated the response of ten wild barley genotypes for callus induction, regenerative green callus induction and regeneration of fertile plants. The activity of exogenous Ac/Ds elements was observed through a transient assay on immature wild barley embryos/callus whereby transformed embryos/calli were identified by the expression of GUS. Transient Ds expression bombardment experiments were performed on 352 pieces of callus (3-5 mm each) or immature embryos in 4 genotypes of wild barley. The transformation frequency of putative transgenic callus lines based on transient GUS expression ranged between 72 and100 % in wild barley genotypes. This is the first report of a transformation system in H. vulgare ssp. spontaneum.
Farmers without borders-genetic structuring in century old barley (Hordeum vulgare).
Forsberg, N E G; Russell, J; Macaulay, M; Leino, M W; Hagenblad, J
2015-02-01
The geographic distribution of genetic diversity can reveal the evolutionary history of a species. For crop plants, phylogeographic patterns also indicate how seed has been exchanged and spread in agrarian communities. Such patterns are, however, easily blurred by the intense seed trade, plant improvement and even genebank conservation during the twentieth century, and discerning fine-scale phylogeographic patterns is thus particularly challenging. Using historical crop specimens, these problems are circumvented and we show here how high-throughput genotyping of historical nineteenth century crop specimens can reveal detailed geographic population structure. Thirty-one historical and nine extant accessions of North European landrace barley (Hordeum vulgare L.), in total 231 individuals, were genotyped on a 384 single nucleotide polymorphism assay. The historical material shows constant high levels of within-accession diversity, whereas the extant accessions show more varying levels of diversity and a higher degree of total genotype sharing. Structure, discriminant analysis of principal components and principal component analysis cluster the accessions in latitudinal groups across country borders in Finland, Norway and Sweden. FST statistics indicate strong differentiation between accessions from southern Fennoscandia and accessions from central or northern Fennoscandia, and less differentiation between central and northern accessions. These findings are discussed in the context of contrasting historical records on intense within-country south to north seed movement. Our results suggest that although seeds were traded long distances, long-term cultivation has instead been of locally available, possibly better adapted, genotypes.
International Nuclear Information System (INIS)
Negi, Mahima; Tilak, K.V.B.R.; Sachdev, M.S.
1991-01-01
Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N 0 P 1 (0 kg N and 30 kg P 2 O 5 ha -1 ) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15 N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs
Genetic analysis on the competitive ability of barley ( Hordeum ...
African Journals Online (AJOL)
Genetic analysis on the competitive ability of barley ( Hordeum vulgare L.) recombinant inbred lines intercropped with oat ( Avena sativa L.) weeds. ... Furthermore, the commonly used herbicide price is soaring from time to time and out of the reach of the poor farmers in the developing countries. Therefore, this method is an ...
Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María
2015-01-01
The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants.
DEFF Research Database (Denmark)
Holme, Inger Bæksted; Brinch-Pedersen, Henrik; Lange, Mette
2008-01-01
, and compared that to the data for the model cultivar, Golden Promise. Subsequently, we analyzed the transformation efficiencies of the four cultivars using the protocol for Agrobacterium infection of ovules, previously developed for Golden Promise. Agrobacterium tumefaciens strain AGL0, carrying the binary...
Directory of Open Access Journals (Sweden)
Miriama Kopernická
2016-01-01
Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was
Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare
Scheu, Arne Hagen August
2017-05-01
Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.
Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A. M.; Voesenek, Laurentius A. C. J.; Pierik, Ronald
2015-01-01
Background and Aims Volatile organic compounds (VOCs) play various roles in plant–plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar ‘Alva’ cause changes in biomass allocation in plants of the cultivar ‘Kara’. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant–plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant–plant signalling between ‘Alva’ and ‘Kara’. Methods The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by ‘Alva’ under control and far-red light-enriched conditions were analysed using gas chromatography–mass spectrometry (GC-MS). ‘Kara’ plants were exposed to the VOC blend emitted by the ‘Alva’ plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for ‘Kara’ plants exposed to ‘Alva’ VOCs, and also for ‘Alva’ plants exposed to either control or far-red-enriched light treatments. Key Results Total VOC emissions by ‘Alva’ were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by ‘Alva’ plants exposed to low R:FR was found to affect carbon allocation in receiver plants of ‘Kara’. Conclusions The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions
Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A M; Voesenek, Laurentius A C J; Pierik, Ronald
2015-05-01
Volatile organic compounds (VOCs) play various roles in plant-plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar 'Alva' cause changes in biomass allocation in plants of the cultivar 'Kara'. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant-plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant-plant signalling between 'Alva' and 'Kara'. The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by 'Alva' under control and far-red light-enriched conditions were analysed using gas chromatography-mass spectrometry (GC-MS). 'Kara' plants were exposed to the VOC blend emitted by the 'Alva' plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for 'Kara' plants exposed to 'Alva' VOCs, and also for 'Alva' plants exposed to either control or far-red-enriched light treatments. Total VOC emissions by 'Alva' were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by 'Alva' plants exposed to low R:FR was found to affect carbon allocation in receiver plants of 'Kara'. The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions affect VOC-mediated plant-plant interactions. © The Author 2015. Published by Oxford University Press on
The Study of Phenological and Morphophysiological Traits of New and Old Barely Shoot Cultivars
Directory of Open Access Journals (Sweden)
N Moshfeghi
2015-07-01
Full Text Available In order to compare morphophysiological traits between new and old cultivars of barley (Hordeum vulgare L. a greenhouse experiment was conducted in greenhouse condition in Faculty of Agriculture, Ferdowsi University of Mashhad in spring and summer 2011.The type of experiment was a completely randomized design with eight treatments (Nosrat , Youssof , Fagr30 , Nick and four old cultivars include (Reihan, Kavir, Zarjo , Valfajr and three replications. All seeds were grown in PVC tubes contained washed sands and disruptive sampling was occurred with destroying plastic bags in the end of the four stages uncluding 6th leaf stage, jointing, heading and ripening. Results indicated that new cultivars showed better performances in all shoot growth parameters than the old cultivars. Modern cultivars for most traits, particularly traits that were positively correlated with yield and its components proved more successful than the old cultivars. They had longer reproductive periods and grain filling duration but their vegetative period were shorter than old cultivars. Among shoots characteristics, new cultivars had higher leaf area, stem dry weight and stem length than old cultivars. Result of this study showed that, among all the characteristics of grain yield and yield components, such as grain weight ,spike length, spike per plant, grain per spike and number tiller , new figures were better than old figures. In general, new cultivar Nick was introduced as the best cultivar and Zarjo was introduced as the weakest cultivar.
High-throughput transcriptome analysis of barley (Hordeum vulgare) exposed to excessive boron.
Tombuloglu, Guzin; Tombuloglu, Huseyin; Sakcali, M Serdal; Unver, Turgay
2015-02-15
Boron (B) is an essential micronutrient for optimum plant growth. However, above certain threshold B is toxic and causes yield loss in agricultural lands. While a number of studies were conducted to understand B tolerance mechanism, a transcriptome-wide approach for B tolerant barley is performed here for the first time. A high-throughput RNA-Seq (cDNA) sequencing technology (Illumina) was used with barley (Hordeum vulgare), yielding 208 million clean reads. In total, 256,874 unigenes were generated and assigned to known peptide databases: Gene Ontology (GO) (99,043), Swiss-Prot (38,266), Clusters of Orthologous Groups (COG) (26,250), and the Kyoto Encyclopedia of Genes and Genomes (KEGG) (36,860), as determined by BLASTx search. According to the digital gene expression (DGE) analyses, 16% and 17% of the transcripts were found to be differentially regulated in root and leaf tissues, respectively. Most of them were involved in cell wall, stress response, membrane, protein kinase and transporter mechanisms. Some of the genes detected as highly expressed in root tissue are phospholipases, predicted divalent heavy-metal cation transporters, formin-like proteins and calmodulin/Ca(2+)-binding proteins. In addition, chitin-binding lectin precursor, ubiquitin carboxyl-terminal hydrolase, and serine/threonine-protein kinase AFC2 genes were indicated to be highly regulated in leaf tissue upon excess B treatment. Some pathways, such as the Ca(2+)-calmodulin system, are activated in response to B toxicity. The differential regulation of 10 transcripts was confirmed by qRT-PCR, revealing the tissue-specific responses against B toxicity and their putative function in B-tolerance mechanisms. Copyright © 2014. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Victor Raboy
2015-04-01
Full Text Available The potential benefits of the low phytic acid (lpa seed trait for human and animal nutrition, and for phosphorus management in non-ruminant animal production, are well documented. However, in many cases the lpa trait is associated with impaired seed or plant performance, resulting in reduced yield. This has given rise to the perception that the lpa trait is tightly correlated with reduced yield in diverse crop species. Here we report a powerful test of this correlation. We measured grain yield in lines homozygous for each of six barley (Hordeum vulgare L. lpa mutations that greatly differ in their seed phytic acid levels. Performance comparisons were between sibling wild-type and mutant lines obtained following backcrossing, and across two years in five Idaho (USA locations that greatly differ in crop yield potential. We found that one lpa mutation (Hvlpa1-1 had no detectable effect on yield and a second (Hvlpa4-1 resulted in yield losses of only 3.5%, across all locations. When comparing yields in three relatively non-stressful production environments, at least three lpa mutations (Hvlpa1-1, Hvlpa3-1, and Hvlpa4-1 typically had yields similar to or within 5% of the wild-type sibling isoline. Therefore in the case of barley, lpa mutations can be readily identified that when simply incorporated into a cultivar result in adequately performing lines, even with no additional breeding for performance within the lpa line. In conclusion, while some barley lpa mutations do impact field performance, a substantial fraction appears to have little or no effect on yield.
Directory of Open Access Journals (Sweden)
Bouhaouel, I.
2016-01-01
Full Text Available Description of the subject. The present study focuses on the description of the allelopathic interactions between wild and crop species that may occur in a given ecosystem. Objectives. The objective is the evaluation of the allo- and autoinhibition activity of root exudates of barley (Hordeum vulgare L. subsp. vulgare and great brome (Bromus diandrus Roth. seedlings by water-soluble allelochemicals. Method. The allelopathic activities of five Tunisian barley genotypes (modern varieties and landraces, one Saudi Arabian barley landrace and great brome were assessed using a modified laboratory bioassay named "seedling-after-seedling agar method". Results. The barley or the great brome reduced, to a greater extent, the root growth compared to the shoot growth of receiver species. The response of the root system architecture of the great brome towards barley root exudates was studied in detail. All the measured root traits were highly sensitive to the presence of barley. In our conditions, the allelopathic activity of barley root exudates had no apparent relationship with the size of the root and a prominent action of genetic determinants in the allelopathic potential between genotypes is proposed. The alloinhibitory activity of barley or great brome root exudates deferred between the receiver species but was always higher than the autoinhibition potential. The autoinhibition in barley proved to depend on whether the genotypes used as donor and receiver are identical or different, suggesting a specific interaction of allelochemicals with the receiver plant. These molecules seem to be the main actors in the allelopathic barley potential as external factors such variations of pH have no evident relevance in the inhibition process. Conclusions. Barley and great brome exude molecules in their surroundings. This affects the growth of the receiver plants, suggesting that these compounds might contribute to the plant community dynamics.
Alikhani, Mehdi; Khatabi, Behnam; Sepehri, Mozhgan; Nekouei, Mojtaba Khayam; Mardi, Mohsen; Salekdeh, Ghasem Hosseini
2013-06-01
Piriformospora indica is a root-interacting mutualistic fungus capable of enhancing plant growth, increasing plant resistance to a wide variety of pathogens, and improving plant stress tolerance under extreme environmental conditions. Understanding the molecular mechanisms by which P. indica can improve plant tolerance to stresses will pave the way to identifying the major mechanisms underlying plant adaptability to environmental stresses. We conducted greenhouse experiments at three different salt levels (0, 100 and 300 mM NaCl) on barley (Hordeum vulgare L.) cultivar "Pallas" inoculated with P. indica. Based on the analysis of variance, P. indica had a significant impact on the barley growth and shoot biomass under normal and salt stress conditions. P. indica modulated ion accumulation in colonized plants by increasing the foliar potassium (K(+))/sodium (Na(+)) ratio, as it is considered a reliable indicator of salt stress tolerance. P. indica induced calcium (Ca(2+)) accumulation and likely influenced the stress signal transduction. Subsequently, proteomic analysis of the barley leaf sheath using two-dimensional electrophoresis resulted in detection of 968 protein spots. Of these detected spots, the abundance of 72 protein spots changed significantly in response to salt treatment and P. indica-root colonization. Mass spectrometry analysis of responsive proteins led to the identification of 51 proteins. These proteins belonged to different functional categories including photosynthesis, cell antioxidant defense, protein translation and degradation, energy production, signal transduction and cell wall arrangement. Our results showed that P. indica induced a systemic response to salt stress by altering the physiological and proteome responses of the plant host.
Directory of Open Access Journals (Sweden)
M.A. Urchei
1994-12-01
Full Text Available Objetivando avaliar os efeitos de défices hídricos, em três estádios fonológicos da cultura da cevada (Hordeum vulgare L., foi conduzido experimento em vasos, com delineamento em blocos ao acaso. Foram utilizados nove tratamentos decorrentes da combinação dos potenciais mínimos de água no solo de -0,05, -0,20 e -1,50 MPa, com os estádios fenológicos de máximo perfilhamento, florescimento e grão leitoso, permanecendo uniformizados durante o restante do ciclo, entre os potenciais de -0,01 a -0,05 MPa. Os resultados de produção, peso e teor de proteína dos grãos, tamanho de espigas, número total e número de espigas chochas, mostraram que os efeitos de défices hídricos variaram com a intensidade, duração e estádio fenológico da cultura, onde o estádio de florescimento mostrou-se mais sensível ao défice de água. A ocorrência de défice hídrico intenso, em cada um dos estádios, bem como ciclos repetidos de défices moderados ou intensos, levaram à diminuições significativas na produção de grãos, além de ocorrer tendência ao aumento do teor de protema dos grãos. O manejo da irrigação na cultura da cevada, quando se busca a máxima eficiência no uso da água, deve levar em conta os diferentes estádios fenológicos.The experiment was carried out under greenhouse conditions, with the objective of evaluating the effects of water deficits in three phenological phases of barley crop (Hordeum vulgare L.. Pots were arranged in a randomized block design with nine treatments. They originated from the combination of minimum soil water potentials of -0,05, -0,20 and -1,50 MPa, with the phenological phases of maximum tillering, flowering and milky grain, having been hold uniformly along the rest of the cycle, between -0,01 and -0,05 MPa potentials. Weight of grain, protein content, spike sizes, spike total number and number of hollow spikes, showed that water deficit effects varied with the intensity, duration and
International Nuclear Information System (INIS)
Kirkensgaard, Kristine G.; Hägglund, Per; Finnie, Christine; Svensson, Birte; Henriksen, Anette
2009-01-01
The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R cryst of 19.0% and an R free of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation
Energy Technology Data Exchange (ETDEWEB)
Kirkensgaard, Kristine G. [Carlsberg Laboratory (Denmark); Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Hägglund, Per; Finnie, Christine; Svensson, Birte [Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Henriksen, Anette, E-mail: anette@crc.dk [Carlsberg Laboratory (Denmark)
2009-09-01
The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R{sub cryst} of 19.0% and an R{sub free} of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation.
Hordein Variation in Wild (Hordeum Spontaneum) and Cultivated (H. Vulgare) Barley
DEFF Research Database (Denmark)
Doll, Hans; Brown, A. H. D.
1979-01-01
The storage protein hordein contains two major groups of polypeptides which are highly polymorphic in barley, and in its evolutionary progenitor Hordeum spontaneum Koch. Crosses between the two species showed that the complex electrophoretic phenotypes within the two groups of polypeptides are go...
Journal of Genetics Online Resources
Indian Academy of Sciences (India)
pdf. Jaiswal S. K., Pandey S. P., Sharma S., Prasad R., Prasad L. C., Verma R. P. S. and Joshi A. K. 2010 Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.
Directory of Open Access Journals (Sweden)
F. Taghavi Ghasemkheyli
2015-01-01
Full Text Available To investigate the effect of Trichoderma harzianum, as a bioabsorbant to ameliorate the harmful effects of cadmium (Cd on growth and yield of barley (Hordeum vulgare L. variety ‘Sahra’, a factorial pot experiment based on completely randomized design with three replicates was conducted. Trichoderma harzianum withtwo levels (with and without inoculation and cadmium nitrate with four levels (0, 50, 100 and 150 mg.L-1 were the treatments. Results of ANOVA revealed that there was a significant interaction between Trichoderma and cadmium nitrate in terms of biological yield, straw yield, harvest index, spike number per plant and seed number per spike. Mean comparisons showed that Trichoderma inoculation at all Cd levels significantly improved both biological and straw yields. Trichoderma at 50 and 100 mg.L-1 of Cd also increased the spike number per plant (up to 120 and 66%, respectively significantly. Increasing Cd levels decreased seed yield (19%, 1000 seed weight (18%, partitioning coefficient (57% and tolerance index (23% significantly. Inoculation of Trichoderma into growth medium had a significant effect on seed yield and tolerance index (up to 17 and 22%, respectively. In conclusion, Trichoderma harzianum inoculation at lower concentrations of Cd (50 and 100 mg.L-1 could be effective to improve growth parameters of barley plant.
Regrowth in Barley (Hordeum vulgare L.) and Rye (Secale cereale L.)
DEFF Research Database (Denmark)
Christiansen, J L; Jørgensen, Johannes Ravn; Jørnsgård, B
1998-01-01
Regrowth after cutting at four development stages, from heading to grain maturity, was investigated in a pot experiment containing three rye and four barley varieties (including 2 Hordeum spontaneum lines). Regrowth in the barley varieties decreased strongly from heading to grain maturity. Rye ge...
Directory of Open Access Journals (Sweden)
Mahmoud A. Saleh
2011-02-01
Full Text Available Essential oils of the fruits of three organically grown cultivars of Egyptian fennel (Foeniculum vulgare var. azoricum, Foeniculum vulgare var. dulce and Foeniculum vulgare var. vulgare were examined for their chemical constituents, antimicrobial and antioxidant activities. Gas chromatography/mass spectrometry analysis of the essential oils revealed the presence of 18 major monoterpenoids in all three cultivars but their percentage in each oil were greatly different. trans-Anethole, estragole, fenchone and limonene were highly abundant in all of the examined oils. Antioxidant activities of the essential oils were evaluated using the DPPH radical scavenging, lipid peroxidation and metal chelating assays. Essential oils from the azoricum and dulce cultivars were more effective antioxidants than that from the vulgare cultivar. Antimicrobial activities of each oil were measured against two species of fungi, two species of Gram negative and two species of Gram positive bacteria. All three cultivars showed similar antimicrobial activity.
Shahat, Abdelaaty A; Ibrahim, Abeer Y; Hendawy, Saber F; Omer, Elsayed A; Hammouda, Faiza M; Abdel-Rahman, Fawzia H; Saleh, Mahmoud A
2011-02-01
Essential oils of the fruits of three organically grown cultivars of Egyptian fennel (Foeniculum vulgare var. azoricum, Foeniculum vulgare var. dulce and Foeniculum vulgare var. vulgare) were examined for their chemical constituents, antimicrobial and antioxidant activities. Gas chromatography/mass spectrometry analysis of the essential oils revealed the presence of 18 major monoterpenoids in all three cultivars but their percentage in each oil were greatly different. trans-Anethole, estragole, fenchone and limonene were highly abundant in all of the examined oils. Antioxidant activities of the essential oils were evaluated using the DPPH radical scavenging, lipid peroxidation and metal chelating assays. Essential oils from the azoricum and dulce cultivars were more effective antioxidants than that from the vulgare cultivar. Antimicrobial activities of each oil were measured against two species of fungi, two species of Gram negative and two species of Gram positive bacteria. All three cultivars showed similar antimicrobial activity.
Ford, Brett; Deng, Weiwei; Clausen, Jenni; Oliver, Sandra; Boden, Scott; Hemming, Megan; Trevaskis, Ben
2016-01-01
An increase in global temperatures will impact future crop yields. In the cereal crops wheat and barley, high temperatures accelerate reproductive development, reducing the number of grains per plant and final grain yield. Despite this relationship between temperature and cereal yield, it is not clear what genes and molecular pathways mediate the developmental response to increased temperatures. The plant circadian clock can respond to changes in temperature and is important for photoperiod-dependent flowering, and so is a potential mechanism controlling temperature responses in cereal crops. This study examines the relationship between temperature, the circadian clock, and the expression of flowering-time genes in barley (Hordeum vulgare), a crop model for temperate cereals. Transcript levels of barley core circadian clock genes were assayed over a range of temperatures. Transcript levels of core clock genes CCA1, GI, PRR59, PRR73, PRR95, and LUX are increased at higher temperatures. CCA1 and PRR73 respond rapidly to a decrease in temperature whereas GI and PRR59 respond rapidly to an increase in temperature. The response of GI and the PRR genes to changes in temperature is lost in the elf3 mutant indicating that their response to temperature may be dependent on a functional ELF3 gene. PMID:27580625
International Nuclear Information System (INIS)
Lock, K.; De Schamphelaere, K.A.C.; Becaus, S.; Criel, P.; Van Eeckhout, H.; Janssen, C.R.
2007-01-01
A Biotic Ligand Model was developed predicting the effect of cobalt on root growth of barley (Hordeum vulgare) in nutrient solutions. The extent to which Ca 2+ , Mg 2+ , Na + , K + ions and pH independently affect cobalt toxicity to barley was studied. With increasing activities of Mg 2+ , and to a lesser extent also K + , the 4-d EC50 Co2+ increased linearly, while Ca 2+ , Na + and H + activities did not affect Co 2+ toxicity. Stability constants for the binding of Co 2+ , Mg 2+ and K + to the biotic ligand were obtained: log K CoBL = 5.14, log K MgBL = 3.86 and log K KBL = 2.50. Limited validation of the model with one standard artificial soil and one standard field soil showed that the 4-d EC50 Co2+ could only be predicted within a factor of four from the observed values, indicating further refinement of the BLM is needed. - Biotic Ligand Models are not only a useful tool to assess metal toxicity in aquatic systems but can also be used for terrestrial plants
Szoboszlay, Márton; Näther, Astrid; Mitterbauer, Esther; Bender, Jürgen; Weigel, Hans-Joachim; Tebbe, Christoph C
2017-08-01
The effect of elevated atmospheric CO 2 concentration [CO 2 ] on the diversity and composition of the prokaryotic community inhabiting the rhizosphere of winter barley (Hordeum vulgare L.) was investigated in a field experiment, using open-top chambers. Rhizosphere samples were collected at anthesis (flowering stage) from six chambers with ambient [CO 2 ] (approximately 400 ppm) and six chambers with elevated [CO 2 ] (700 ppm). The V4 region of the 16S rRNA gene was PCR-amplified from the extracted DNA and sequenced on an Illumina MiSeq instrument. Above-ground plant biomass was not affected by elevated [CO 2 ] at anthesis, but plants exposed to elevated [CO 2 ] had significantly higher grain yield. The composition of the rhizosphere prokaryotic communities was very similar under ambient and elevated [CO 2 ]. The dominant taxa were Bacteroidetes, Actinobacteria, Alpha-, Gamma-, and Betaproteobacteria. Elevated [CO 2 ] resulted in lower prokaryotic diversity in the rhizosphere, but did not cause a significant difference in community structure. © 2017 The Authors. MicrobiologyOpen published by John Wiley & Sons Ltd.
Shahat, Abdelaaty A.; Ibrahim, Abeer Y.; Hendawy, Saber F.; Omer, Elsayed A.; Hammouda, Faiza M.; Abdel-Rahman, Fawzia H.; Saleh, Mahmoud A.
2011-01-01
Essential oils of the fruits of three organically grown cultivars of Egyptian fennel (Foeniculum vulgare var. azoricum, Foeniculum vulgare var. dulce and Foeniculum vulgare var. vulgare) were examined for their chemical constituents, antimicrobial and antioxidant activities. Gas chromatography/mass spectrometry analysis of the essential oils revealed the presence of 18 major monoterpenoids in all three cultivars but their percentage in each oil were greatly different. trans-Anethole, estragol...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
MAO-A promoter polymorphism and idiopathic pulmonary arterial hypertension · Shivani Vadapalli Sujana Katta B. K. S. Sastry Pratibha Nallari · More Details Fulltext PDF. pp e46-e54. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.
Directory of Open Access Journals (Sweden)
Laura Lopez Del Egido
2017-05-01
Full Text Available A comparative analysis was carried out of published methods to assess seed viability using 2,3,5-triphenyltetrazolium chloride (TTC based assays of seed batches. The tests were carried out on seeds of barley (Hordeum vulgare cv. Optic as a model. We established that 10% [w/v] trichloroacetic acid (TCA/methanol is superior to the acetone and methanol-only based methods: allowing the highest recovery of formazan and the lowest background optical density (OD readings, across seed lots comprising different ratios of viable and dead seeds. The method allowed a linear-model to accurately capture the statistically significant relationship between the quantity of formazan that could be extracted using the method we developed and the seed temperature-response, and seed viability as a function of artificially aged seed lots. Other quality control steps are defined to help ensure the assay is robust and these are reported in a Standard Operating Procedure.
DEFF Research Database (Denmark)
Yang, Fen; Jensen, J.D.; Svensson, Birte
2010-01-01
A proteomic analysis was conducted to map the events during the initial stages of the interaction between the fungal pathogen Fusarium graminearum and the susceptible barley cultivar Scarlett. Quantification of fungal DNA demonstrated a sharp increase in fungal biomass in barley spikelets at 3 da...
Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping
2015-06-11
In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong double haploid (DH) population. One QTL, named as qACH, was detected for ACH, and it was located on the position of about 108 cM in chromosome 4H and can explain about 20 % of the phenotypic variation. Two key haze active proteins, BATI-CMb and BATI-CMd were identified by proteomics analysis. Bioinformatics analysis showed that BATI-CMb and BATI-CMd had the same position as qACH in the chromosome. It may be deduced that BATI-CMb and BATI-CMd are candidate genes for qACH, controlling colloidal stability of beer. Polymorphism comparison between Yerong and Franklin in the nucleotide and amino acid sequence of BATI-CMb and BATI-CMd detected the corresponding gene specific markers, which could be used in marker-assisted selection for malt barley breeding. We identified a novel QTL, qACH controlling chill haze of beer, and two key haze active proteins, BATI-CMb and BATI-CMd. And further analysis showed that BATI-CMb and BATI-CMd might be the candidate genes associated with beer chill haze.
Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.
Directory of Open Access Journals (Sweden)
Weiwei Deng
Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.
Williams, Alwyn; Manoharan, Lokeshwaran; Rosenstock, Nicholas P; Olsson, Pål Axel; Hedlund, Katarina
2017-01-01
Agricultural fertilization significantly affects arbuscular mycorrhizal fungal (AMF) community composition. However, the functional implications of community shifts are unknown, limiting understanding of the role of AMF in agriculture. We assessed AMF community composition at four sites managed under the same nitrogen (N) and phosphorus (P) fertilizer regimes for 55 yr. We also established a glasshouse experiment with the same soils to investigate AMF-barley (Hordeum vulgare) nutrient exchange, using carbon ( 13 C) and 33 P isotopic labelling. N fertilization affected AMF community composition, reducing diversity; P had no effect. In the glasshouse, AMF contribution to plant P declined with P fertilization, but was unaffected by N. Barley C allocation to AMF also declined with P fertilization. As N fertilization increased, C allocation to AMF per unit of P exchanged increased. This occurred with and without P fertilization, and was concomitant with reduced barley biomass. AMF community composition showed no relationship with glasshouse experiment results. The results indicate that plants can reduce C allocation to AMF in response to P fertilization. Under N fertilization, plants allocate an increasing amount of C to AMF and receive relatively less P. This suggests an alteration in the terms of P-C exchange under N fertilization regardless of soil P status. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.
Directory of Open Access Journals (Sweden)
Langridge Peter
2007-12-01
Full Text Available Abstract Background Chromosome pairing, recombination and DNA repair are essential processes during meiosis in sexually reproducing organisms. Investigating the bread wheat (Triticum aestivum L. Ph2 (Pairing homoeologous locus has identified numerous candidate genes that may have a role in controlling such processes, including TaMSH7, a plant specific member of the DNA mismatch repair family. Results Sequencing of the three MSH7 genes, located on the short arms of wheat chromosomes 3A, 3B and 3D, has revealed no significant sequence divergence at the amino acid level suggesting conservation of function across the homoeogroups. Functional analysis of MSH7 through the use of RNAi loss-of-function transgenics was undertaken in diploid barley (Hordeum vulgare L.. Quantitative real-time PCR revealed several T0 lines with reduced MSH7 expression. Positive segregants from two T1 lines studied in detail showed reduced MSH7 expression when compared to transformed controls and null segregants. Expression of MSH6, another member of the mismatch repair family which is most closely related to the MSH7 gene, was not significantly reduced in these lines. In both T1 lines, reduced seed set in positive segregants was observed. Conclusion Results presented here indicate, for the first time, a distinct functional role for MSH7 in vivo and show that expression of this gene is necessary for wild-type levels of fertility. These observations suggest that MSH7 has an important function during meiosis and as such remains a candidate for Ph2.
Qiu, Hao; Versieren, Liske; Rangel, Georgina Guzman; Smolders, Erik
2016-01-19
Soil contamination with copper (Cu) is often associated with zinc (Zn), and the biological response to such mixed contamination is complex. Here, we investigated Cu and Zn mixture toxicity to Hordeum vulgare in three different soils, the premise being that the observed interactions are mainly due to effects on bioavailability. The toxic effect of Cu and Zn mixtures on seedling root elongation was more than additive (i.e., synergism) in soils with high and medium cation-exchange capacity (CEC) but less than additive (antagonism) in a low-CEC soil. This was found when we expressed the dose as the conventional total soil concentration. In contrast, antagonism was found in all soils when we expressed the dose as free-ion activities in soil solution, indicating that there is metal-ion competition for binding to the plant roots. Neither a concentration addition nor an independent action model explained mixture effects, irrespective of the dose expressions. In contrast, a multimetal BLM model and a WHAM-Ftox model successfully explained the mixture effects across all soils and showed that bioavailability factors mainly explain the interactions in soils. The WHAM-Ftox model is a promising tool for the risk assessment of mixed-metal contamination in soils.
Directory of Open Access Journals (Sweden)
S. PERTTILÄ
2008-12-01
Full Text Available Both digestibility and performance experiments were carried out to evaluate the nutritive value of triticale for growing-finishing pigs.In experiment 1,the apparent ileal and faecal digestibility of nutrients in barley (Hordeum vulgare cv.Viiviand two triticale (Tritico secale cultivars, Moreno and Ulrika, were measured using six cannulated barrows with a body weight (BWof 82-107 kg.In experiment 2,132 pigs were used over 25-100 kg BW to study the effects of replacing barley in a barley-soyabean meal-based diet with graded amounts of triticale cv.Moreno (25,50,75,or 100% and cv.Ulrika (50 or 100%.The apparent ileal and faecal digestibilities of dry matter and organic matter were higher for both triticale cultivars than for barley (P 0.05.The apparent ileal digestibility of lysine averaged 65.6, 70.8, and 70.5% for barley and triticale cv.Moreno and Ulrika,respectively.The net energy content of triticales (11.5 MJ kg-1 DMwas 0.4 MJ kg -1 DM higher than that of barley.The replacement of barley with the triticale cultivars Moreno and Ulrika exerted a positive quadratic effect on daily weight gain and the feed conversion ratio of pigs from 50 to 100 kg and from 25 to 100 kg BW (P
International Nuclear Information System (INIS)
Mico, C.; Li, H.F.; Zhao, F.J.; McGrath, S.P.
2008-01-01
The influence of soil properties on the bioavailability and toxicity of Co to barley (Hordeum vulgare L.) root elongation was investigated. Ten soils varying widely in soil properties were amended with seven doses of CoCl 2 . Soil properties greatly influenced the expression of Co toxicity. The effective concentration of added Co causing 50% inhibition (EC 50 ) ranged from 45 to 863 mg kg -1 , representing almost 20-fold variation among soils. Furthermore, we investigated Co toxicity in relation to Co concentrations and free Co 2+ activity in soil solution. The EC 50 values showed variation among soils of 17- and 29-fold, based on the Co concentration in soil solution and free Co 2+ activity, respectively. Single regressions were carried out between Co toxicity threshold values and selected soil properties. Models obtained showed that soil effective cation exchange capacity (eCEC) and exchangeable calcium were the most consistent single predictors of the EC 50 values based on soil added Co. - Soil eCEC and exchangeable Ca were found to be the best predictors of the toxicity threshold values of Co to barley root growth on different soils
KESKİNBALTA, Mehmet Anıl; HAMZAOĞLU, Gökhan; ÇELİK, Meryem Yeşim; DERNEKBAŞI, Seval
2015-01-01
Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...
KESKİNBALTA, Mehmet; HAMZAOĞLU, Gökhan; ÇELİK, Meryem; DERNEKBAŞI, Seval
2015-01-01
Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...
Genetic Variability in Barley (Hordeum vulgare l.) Landraces from ...
African Journals Online (AJOL)
segregating progenies with maximum genetic variability for selection. .... cultivar Clipper applied in slots of the first two, the tenth, and the last ... solution (50 ml glacial acetic acid, 200 ml methanol and 250 ml distilled water) ...... Adelaide, South.
Hildebrandt, Ulrich; Marsell, Alexander; Riederer, Markus
2018-04-04
Several anthraquinone derivatives are active components of fungicidal formulations particularly effective against powdery mildew fungi. The antimildew effect of compounds such as physcion and chrysophanol is largely attributed to host plant defense induction. However, so far a direct fungistatic/fungicidal effect of anthraquinone derivatives on powdery mildew fungi has not been unequivocally demonstrated. By applying a Formvar-based in vitro system we demonstrate a direct, dose-dependent effect of physcion, chrysophanol, emodin, and pachybasin on conidial germination and appressorium formation of Blumeria graminis f. sp. hordei (DC.) Speer, the causative agent of barley ( Hordeum vulgare L.) powdery mildew. Physcion was the most effective among the tested compounds. At higher doses, physcion mainly inhibited conidial germination. At lower rates, however, a distinct interference with appressorium formation became discernible. Physcion and others may act by modulating both the infection capacity of the powdery mildew pathogen and host plant defense. Our results suggest a specific arrangement of substituents at the anthraquinone backbone structure being crucial for the direct antimildew effect.
Directory of Open Access Journals (Sweden)
Filip Pošćić
2016-06-01
Full Text Available The implications of metal nanoparticles (MeNPs are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2 and titanium oxide (nTiO2 nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L. kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively. Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production.
Directory of Open Access Journals (Sweden)
Petr Škarpa
2006-01-01
Full Text Available The effect of three different doses of basic fertilisers and a subsequent pre-sowing supplementary fertilisation on production parameters (yield of grain, number of spikes, and thousand grains weight was evaluated using experimental data obtained within the framework of a one-year pot experiment with spring barley (Hordeum vulgare L. established at the Department of Agrochemistry and Plant Nutrition, Faculty of Agronomy, Mendel University of Agriculture and Forestry Brno in 2003. Results of statistical analysis indicated that the yield of grain was significantly influenced by different doses of fertilisers especially on sandy soils. As compared with control, the second highest dose of fertilisers (i.e. 83 kg N, 31 kg P and 92 kg K.ha–1 increased the yield by 91.7 % and the third one (i.e. 113 kg N, 43 kg P and 125 kg K.ha–1 even by 124.8 %. This increase in the grain yield was positively affected above all by increasing doses of nitrogen fertilisers. A pre-sowing application of P, K and Mg showed also a positive effect on grain yield not only on sandy but above all on clay soils (as compared with non-fertilised control, this increase ranged from 40.6 to 50.2%. Fertilisation showed also a marked effect on the number of spikes. This factor showed a similar trend as the yield of grain. The thousand grains weight was not significantly influenced on both soil types. This value was increased (by 2.9% to 14.8% after the application of fertilisers prior to sowing but the difference was statistically non-significant.
Pandey, Bharati; Grover, Abhinav; Sharma, Pradeep
2018-02-12
The WRKY transcription factors are a class of DNA-binding proteins involved in diverse plant processes play critical roles in response to abiotic and biotic stresses. Genome-wide divergence analysis of WRKY gene family in Hordeum vulgare provided a framework for molecular evolution and functional roles. So far, the crystal structure of WRKY from barley has not been resolved; moreover, knowledge of the three-dimensional structure of WRKY domain is pre-requisites for exploring the protein-DNA recognition mechanisms. Homology modelling based approach was used to generate structures for WRKY DNA binding domain (DBD) and its variants using AtWRKY1 as a template. Finally, the stability and conformational changes of the generated model in unbound and bound form was examined through atomistic molecular dynamics (MD) simulations for 100 ns time period. In this study, we investigated the comparative binding pattern of WRKY domain and its variants with W-box cis-regulatory element using molecular docking and dynamics (MD) simulations assays. The atomic insight into WRKY domain exhibited significant variation in the intermolecular hydrogen bonding pattern, leading to the structural anomalies in the variant type and differences in the DNA-binding specificities. Based on the MD analysis, residual contribution and interaction contour, wild-type WRKY (HvWRKY46) were found to interact with DNA through highly conserved heptapeptide in the pre- and post-MD simulated complexes, whereas heptapeptide interaction with DNA was missing in variants (I and II) in post-MD complexes. Consequently, through principal component analysis, wild-type WRKY was also found to be more stable by obscuring a reduced conformational space than the variant I (HvWRKY34). Lastly, high binding free energy for wild-type and variant II allowed us to conclude that wild-type WRKY-DNA complex was more stable relative to variants I. The results of our study revealed complete dynamic and structural information
International Nuclear Information System (INIS)
Reuber, S.; Bornman, J.F.; Weissenböck, G.
1996-01-01
The aim of the present investigation was to define the role of soluble flavonoids as UV-B protectants in the primary leaf of barley (Hordeum vulgare L.). For this purpose we used a mutant line (Ant 287) from the Carlsberg collection of proanthocyanidin-free barley containing only 7% of total extractable flavonoids in the primary leaf as compared to the mother variety (Hiege 550/75). Seven-day-old leaves from plants grown under high visible light with or without supplementary UV-B radiation were used for the determination of UV-B sensitivity. UV-B-induced changes were assessed from parameters of chlorophyll fluorescence of photosystem II, including initial and maximum fluorescence, apparent quantum yield, and photochemical and non-photochemical quenching. A quartz fibre-optic microprobe was used to evaluate the amount of potentially harmful UV-B (310 nm radiation) penetrating into the leaf as a direct consequence of flavonoid deficiency. Our data indicate an essential role of flavonoids in UV-B protection of barley primary leaves. In leaves of the mutant line grown under supplementary UV-B, an increase in 310nm radiation in the mesophyll and a strong decrease in the quantum yield of photosynthesis were observed as compared to the corresponding mother variety. Primary leaves of liege responded to supplementary UV-B radiation with a 30% increase in the major flavonoid saponarin and a 500% increase in the minor compound lutonarin. This is assumed to be an efficient protective response since no changes in variable chlorophyll fluorescence were apparent. In addition, a further reduction in UV-B penetration into the mesophyll was recorded in these leaves
Directory of Open Access Journals (Sweden)
Alex Seguel
2012-09-01
Full Text Available Aluminum phytotoxicity in acid soils is an important environmental stress that negatively affects crop production, but arbuscular mycorrhizal (AM fungi performance would allow plants to better withstand this environmental condition. This study aimed to analyze the effect of soil Al on early AM colonization of wheat (Triticum aestivum L. and barley (Hordeum vulgare L. cultivars. Near-isogenic Crac, Invento, and Porfiado wheat cultivars and Sebastián and Aurora barley cultivars were sown in pots in an acid soil at three Al saturation levels (60, 34, and 11%. At 20 d after sowing (DAS 'Crac' presented higher AM colonization (27% than other cultivars. However, 'Invento' had the fastest colonization at 41 DAS, which was inhibited in short term at lower Al-saturation. Moreover, roots of 'Aurora' were colonized 28 and 51% at 20 and 66 DAS, respectively, and also decreased at lower Al-saturation. In soil with 60% Al-saturation a great spore production was observed at 41 DAS, 'Aurora' had the highest spore density at 66 DAS. At 20 DAS a negative relationship (r = -0.37; p La fitotoxicidad por Al en suelos ácidos es un importante estrés que afecta negativamente la producción de cultivos, pero la actividad de hongos micorrícicos arbusculares (MA permitiría que las plantas soporten mejor esta condición ambiental. Este estudio tuvo como objetivo analizar el efecto del Al en la colonización MA temprana de cultivares de trigo (Triticum aestivum L. y cebada (Hordeum vulgare L.. Cultivares de trigo Crac, Invento, y Porfiado, y de cebada Sebastián y Aurora fueron sembrados en macetas en un suelo ácido con tres niveles de saturación de Al (60, 34, y 11%. A los 20 días después de la siembra (DDS 'Crac' presentó la mayor colonización MA (27%; sin embargo, 'Invento' tuvo la más rápida colonización a los 41 DDS, la cual fue inhibida a corto plazo a una menor saturación de Al. Por otra parte, las raíces de 'Aurora' fueron colonizadas 28 y 51% a los
Development and characterization of polymorphic EST based SSR markers in barley (Hordeum vulgare).
Jo, Won-Sam; Kim, Hye-Yeong; Kim, Kyung-Min
2017-08-01
In barley, breeding using good genetic characteristics can improve the quality or quantity of crop characters from one generation to the next generation. The development of effective molecular markers in barley is crucial for understanding and analyzing the diversity of useful alleles. In this study, we conducted genetic relationship analysis using expressed sequence tag-simple sequence repeat (EST-SSR) markers for barley identification and assessment of barley cultivar similarity. Seeds from 82 cultivars, including 31 each of naked and hulled barley from the Korea Seed and Variety Service and 20 of malting barley from the RDA-Genebank Information Center, were analyzed in this study. A cDNA library of the cultivar Gwanbori was constructed for use in analysis of genetic relationships, and 58 EST-SSR markers were developed and characterized. In total, 47 SSR markers were employed to analyze polymorphisms. A relationship dendrogram based on the polymorphism data was constructed to compare genetic diversity. We found that the polymorphism information content among the examined cultivars was 0.519, which indicates that there is low genetic diversity among Korean barley cultivars. The results obtained in this study may be useful in preventing redundant investment in new cultivars and in resolving disputes over seed patents. Our approach can be used by companies and government groups to develop different cultivars with distinguishable markers. In addition, the developed markers can be used for quantitative trait locus analysis to improve both the quantity and the quality of cultivated barley.
Variability of barley aleurone layer induced by X-rays
Directory of Open Access Journals (Sweden)
Romuald Kosina
2015-05-01
Full Text Available A series of Hordeum vulgare cultivars was irradiated by X-rays to induce mutations in endosperm. Many structural defects of endosperm were revealed in plants irradiated 8 DAF. Change of a cell cycle was especially frequent and this was visible in the form of clones of small or large cells in the aleurone layer. X-irradiation appeared as a successful tool in the study of development.
Leaf rust of cultivated barley: pathology and control.
Park, Robert F; Golegaonkar, Prashant G; Derevnina, Lida; Sandhu, Karanjeet S; Karaoglu, Haydar; Elmansour, Huda M; Dracatos, Peter M; Singh, Davinder
2015-01-01
Leaf rust of barley is caused by the macrocyclic, heteroecious rust pathogen Puccinia hordei, with aecia reported from selected species of the genera Ornithogalum, Leopoldia, and Dipcadi, and uredinia and telia occurring on Hordeum vulgare, H. vulgare ssp. spontaneum, Hordeum bulbosum, and Hordeum murinum, on which distinct parasitic specialization occurs. Although Puccinia hordei is sporadic in its occurrence, it is probably the most common and widely distributed rust disease of barley. Leaf rust has increased in importance in recent decades in temperate barley-growing regions, presumably because of more intensive agricultural practices. Although total crop loss does not occur, under epidemic conditions yield reductions of up to 62% have been reported in susceptible varieties. Leaf rust is primarily controlled by the use of resistant cultivars, and, to date, 21 seedling resistance genes and two adult plant resistance (APR) genes have been identified. Virulence has been detected for most seedling resistance genes but is unknown for the APR genes Rph20 and Rph23. Other potentially new sources of APR have been reported, and additivity has been described for some of these resistances. Approaches to achieving durable resistance to leaf rust in barley are discussed.
Taube, Michał; Pieńkowska, Joanna R.; Jarmołowski, Artur; Kozak, Maciej
2014-01-01
SGT1 is an evolutionarily conserved eukaryotic protein involved in many important cellular processes. In plants, SGT1 is involved in resistance to disease. In a low ionic strength environment, the SGT1 protein tends to form dimers. The protein consists of three structurally independent domains (the tetratricopeptide repeats domain (TPR), the CHORD- and SGT1-containing domain (CS), and the SGT1-specific domain (SGS)), and two less conserved variable regions (VR1 and VR2). In the present study, we provide the low-resolution structure of the barley (Hordeum vulgare) SGT1 protein in solution and its dimer/monomer equilibrium using small-angle scattering of synchrotron radiation, ab-initio modeling and circular dichroism spectroscopy. The multivariate curve resolution least-square method (MCR-ALS) was applied to separate the scattering data of the monomeric and dimeric species from a complex mixture. The models of the barley SGT1 dimer and monomer were formulated using rigid body modeling with ab-initio structure prediction. Both oligomeric forms of barley SGT1 have elongated shapes with unfolded inter-domain regions. Circular dichroism spectroscopy confirmed that the barley SGT1 protein had a modular architecture, with an α-helical TPR domain, a β-sheet sandwich CS domain, and a disordered SGS domain separated by VR1 and VR2 regions. Using molecular docking and ab-initio protein structure prediction, a model of dimerization of the TPR domains was proposed. PMID:24714665
Nakurte, Ilva; Keisa, Anete; Rostoks, Nils
2012-01-01
A simple, sensitive, precise, and specific reverse HPLC method was developed and validated for the determination of plant hormones in barley (Hordeum vulgare L.). The method includes extraction in aqueous organic solvent followed by solid-phase extraction, sample evaporation, and reversed-phase HPLC analysis in a general purpose UV-visible (abscisic acid (ABA)) and fluorescence detection (indole-3-acetic acid (IAA) and indole-3-pyruvic acid (IPA)), high-performance liquid chromatography system. The separation was carried out on Zorbax Eclipse XDB C8 column (150 × 4.6 mm I.D) with a mobile phase composed of methanol and 1% acetic acid (60 : 40 v/v) in isocratic mode at a flow rate of 1 ml min(-1). The detection was monitored at 270 nm (ABA) and at 282 nm (Ex) and 360 nm (Em) (IAA, IPA). The developed method was validated in terms of accuracy, precision, linearity, limit of detection, limit of quantification, and robustness. The determined validation parameters are in the commonly acceptable ranges for that kind of analysis.
Variation in shoot tolerance mechanisms not related to ion toxicity in barley
Tilbrook, Joanne
2017-09-27
Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).
Variation in shoot tolerance mechanisms not related to ion toxicity in barley
Tilbrook, Joanne; Schilling, Rhiannon K.; Berger, Bettina; Garcia, Alexandre F.; Trittermann, Christine; Coventry, Stewart; Rabie, Huwaida; Brien, Chris; Nguyen, Martin; Tester, Mark A.; Roy, Stuart J.
2017-01-01
Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).
Implementation of biochemical screening to improve baking quality of barley
DEFF Research Database (Denmark)
Vincze, Éva; Dionisio, Giuseppe; Aaslo, Per
2011-01-01
Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact on the phys......Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact...... on the physical chemical properties of the bread products due to the poor baking properties of barley flour. As a consequence, the nutritional advantages of barley are not fully exploited. The inferior leavening and baking properties of barley can, in part, be attributed to the physical properties of the storage...... proteins. Changing the storage protein composition can lessen this problem. Our working hypothesis was that exploiting the substantial genetic variation within the gene pool for storage proteins could enable improving the baking qualities of barley flour. We characterised forty-nine barley cultivars...
DEFF Research Database (Denmark)
Linde-Laursen, Ib; Bothmer, R. von
1986-01-01
. The hybrids were stably aneuploid. Both had lost and acquired H. vulgare chromosomes. Thus, somatic elimination of chromosomes was combined with multiplication of chromosomes. The observations of stably aneuploid hybrids have implications for the exploitation of alien germplasm. The activity of non-H. vulgare...
Wang, Qifei; Sun, Genlou; Ren, Xifeng; Wang, Jibin; Du, Binbin; Li, Chengdao; Sun, Dongfa
2017-11-07
Seedling characteristics play significant roles in the growth and development of barley (Hordeum vulgare L.), including stable stand establishment, water and nutrients uptake, biotic resistance and abiotic stresses, and can influence yield and quality. However, the genetic mechanisms underlying seedling characteristics in barley are largely unknown and little research has been done. In the present work, 21 seedling-related characteristics are assessed in a barley double haploid (DH) population, grown under hydroponic conditions. Of them, leaf age (LAG), shoot height (SH), maximum root length (MRL), main root number (MRN) and seedling fresh weight (SFW) were investigated at the 13th, 20th, 27th, and 34th day after germination. The objectives were to identify quantitative trait loci (QTLs) underlying these seedling characteristics using a high-density linkage map and to reveal the QTL expression pattern by comparing the QTLs among four different seedling growth stages. A total of 70 QTLs were distributed over all chromosomes except 4H, and, individually, accounted for 5.01%-77.78% of phenotypic variation. Out of the 70 detected QTLs, 23 showed a major effect on 14 seedling-related characteristics. Ten co-localized chromosomal regions on 2H (five regions), 3H (two regions) and 7H (three regions) involved 39 QTLs (55.71%), each simultaneously influenced more than one trait. Meanwhile, 9 co-localized genomic regions involving 22 QTLs for five seedling characteristics (LAG, SH, MRL, MRN and SFW) at the 13th, 20th, 27th and 34th day-old seedling were common for two or more growth stages of seedling. QTL in the vicinity of Vrs1 locus on chromosome 2H with the favorable alleles from Huadamai 6 was found to have the largest main effects on multiple seedling-related traits. Six QTL cluster regions associated with 16 seedling-related characteristics were observed on chromosome 2H, 3H and 7H. The majority of the 29 regions identified for five seedling characteristics were
Host genotype is an important determinant of the cereal phyllosphere mycobiome
DEFF Research Database (Denmark)
Sapkota, Rumakanta; Knorr, Kamilla; Jørgensen, Lise Nistrup
2015-01-01
The phyllosphere mycobiome in cereals is an important determinant of crop health. However, an understanding of the factors shaping this community is lacking. Fungal diversity in leaves from a range of cultivars of winter wheat (Triticum aestivum), winter and spring barley (Hordeum vulgare...... and location have minor effects. We found many host-specific fungal pathogens, but also a large diversity of fungi that were relatively insensitive to host genetic background, indicating that host-specific pathogens live in a 'sea' of nonspecific fungi....
Resistance to Barley Leaf Stripe
DEFF Research Database (Denmark)
Nørgaard Knudsen, J. C.
1986-01-01
in well adapted Northwest European spring cultivars. Virulence matching two hitherto not overcome resistances was demonstrated. Differences in apparent race nonspecific or partial resistance were also present, changing the percentage of infected plants of susceptible genotypes from about 20 to 44 per cent.......Ten barley [Hordeum vulgare] genotypes were inoculated with twelve isolates of Pyrenophora graminea of diverse European and North African origin. Race specific resistance occurred. Four, possibly five, genetically different sources of race-specific resistance were found, three of them occurring...
Li, Chao; Wang, Aidong; Ma, Xiaoying; Pourkheirandish, Mohammad; Sakuma, Shun; Wang, Ning; Ning, Shunzong; Nevo, Eviatar; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong
2013-03-01
Drought limits plant growth and threatens crop productivity. A barley (Hordeum vulgare) ethylene imine-induced monogenic recessive mutant cer-zv, which is sensitive to drought, was characterized and genetically mapped in the present study. Detached leaves of cer-zv lost 34.2 % of their initial weight after 1 h of dehydration. The transpiration was much higher in cer-zv leaves than in wild-type leaves under both light and dark conditions. The stomata of cer-zv leaves functioned normally, but the cuticle of cer-zv leaves showed increased permeability to ethanol and toluidine blue dye. There was a 50-90 % reduction in four major cutin monomers, but no reduction in wax loads was found in the cer-zv mutant as compared with the wild type. Two F(2) mapping populations were established by the crosses of 23-19 × cer-zv and cer-zv × OUH602. More polymorphisms were found in EST sequences between cer-zv and OUH602 than between cer-zv and 23-19. cer-zv was located in a pericentromeric region on chromosome 4H in a 10.8 cM interval in the 23-19 × cer-zv map based on 186 gametes tested and a 1.7 cM interval in the cer-zv × OUH602 map based on 176 gametes tested. It co-segregated with EST marker AK251484 in both maps. The results indicated that the cer-zv mutant is defective in cutin, which might be responsible for the increased transpiration rate and drought sensitivity, and that the F(2) of cer-zv × OUH602 might better facilitate high resolution mapping of cer-zv.
Energy Technology Data Exchange (ETDEWEB)
Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk
2008-02-01
WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.
Induced mutations for disease resistance in wheat and barley
International Nuclear Information System (INIS)
Hanis, M.; Hanisova, A.; Knytl, V.; Cerny, J.; Benc, S.
1977-01-01
The induction of mutations in cultivars of wheat (Triticum aestivum), barley (Hordeum vulgare), and field beans (Phaseolus vulgaris) has been part of the breeding programme at the Plant Breeding Station at Stupice since 1960. A total of 26 cultivars or selections of winter wheat, 4 cultivars or selections of spring wheat, 2 cultivars of field beans, and 43 selections of spring barley have been treated since 1960. A total of 140 mutant lines of wheat and 37 mutant lines of barley with improved disease resistance of a race-specific type have been obtained. Several mutation programme derived cultivars have been registered in Czechoslovakia (''Diamant'', ''Ametyst'', ''Favorit'', ''Hana'', ''Rapid'', and ''Atlas'' in barley, and ''Alfa'' in field beans), but none of them is a mutation for disease resistance. A series of mutants have been used in crossing programmes. Approaches to improve the efficiency of mutation breeding for disease resistance are suggested. (author)
Studies on /sup 32/P transport and yellow rust resistance in barley
Energy Technology Data Exchange (ETDEWEB)
Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)
1982-01-01
Several cultivars of barley (Hordeum vulgare L.) differing in their resistance to yellow rust were used to study the influence of the infection with Puccinia striiformis West. (strain 24) on /sup 32/P transport in intact plants and isolated leaves. Close correlations exist between transport processes and resistance. For example, resistant plants seem to have a more intensive matter transport than susceptible ones. The importance of the rate of transport to the effectiveness of hypothetic inducers of resistance reactions and defence substances is discussed.
Progress in the evaluation, use in breeding, and genetic analysis of semi-dwarf mutants of barley
International Nuclear Information System (INIS)
Ullrich, S.E.; Muir, C.E.; Washington State Univ., Pullman
1984-01-01
Breeding for reduced height in barley (Hordeum vulgare L.) to primarily reduce lodging susceptibility is ongoing in the Washington State University barley breeding program. Two semi-dwarf winter and spring cultivars have been released and a number of advanced lines are being considered for release. Several semi-dwarf sources are utilized, including those from induced mutants in 'Jotun', 'Piroline' and 'Valticky'. In addition, over 200 putative mutants have been selected in the past four years from M 2 sodium azide-treated populations of local cultivars and advanced lines. These are evaluated in the pedigree breeding program and some have been incorporated into male sterile facilitated recurrent selection populations developed for reduced height. The inheritance of dwarfism in one mutant in the cultivar 'Advance' was determined to be controlled by a single recessive gene. (author)
Directory of Open Access Journals (Sweden)
Žaltauskaitė J.
2013-04-01
Full Text Available The single and combined effects of copper (Cu and cadmium (Cd (0.1-10 mg L−1 in spring barley (Hordeum vulgare L. plants grown in hydroponics are investigated. The aim of the study was to investigate the interactive effect of the binary mixture of Cu and Cd to the growth of H. vulgare and accumulation of these metals by the plants. Single and combined metal treatment led to major effects in the growth of roots and shoots and dry weight of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. It was observed that combined effects of heavy metals to plants are endpoint and concentration depending. The binary mixture Cu+Cd exhibited additive or less than additive interaction for dry weight, root length and shoot height. Analysis of tissue metal concentrations showed that Cu and Cd were mainly accumulated in the roots and the combination of Cu+Cd had less than additive response of metal bioaccumulation in the leaves and roots.
Directory of Open Access Journals (Sweden)
A. Derakhshan
2017-01-01
Full Text Available Introduction: Seed germination is one of the key stages in the life cycle of plants that can ultimately affect their fitness in the environment. The temporal pattern of seed germination is extremely depended on the soil water potential (Ψ of the germination medium, as this determines the equilibrium water content of the seed. As for temperature, there is a minimum Ψ that must be exceeded in order for seeds complete germination, and seeds in a population vary in the value of this minimum or base Ψ. The germination of a seed population in response to the reduced water potential is modeled using the hydrotime model. According to this model, the time to germination for a given seed fraction (g is inversely related to the difference between the current seed Ψ and the base water potential (Ψb for that fraction (Ψb(g. The hydrotime model functions are well in matching both the timing and the percentage of germination of seed populations in relation to their Ψ environment. In addition, the model outputs which are significant physiologically and ecologically and the parameters of the model can be used to characterize the properties of seed populations. Normal distribution of Ψb among seeds within a population is one of the assumptions of the hydrotime model. However, this assumption may not be met in many species and thus can result in poor predictions. We tried to investigate empirically the validity of this assumption, to compare the fit of alternative distributions and make recommendations to improve germination modeling procedures. Materials and Methods: Seed germination of Melilotus officinalis, Sinapis arvensis and Hordeum vulgare were tested across a range of water potentials (0, -0.2, -0.4, -0.6 and -0.8 MPa for M. officinalis and S. arvensis and 0, -0.3, -0.6, -0.9, -1.2 and -1.5 MPa for H. vulgare and germination responses were described by the hydrotime models based on twelve statistical functions including Normal, Beta, Gamma
Rusan, Munir J M; Albalasmeh, Ammar A; Zuraiqi, Said; Bashabsheh, Mohammad
2015-06-01
Olive-mill wastewater (OMW) is a by-product effluent of olive oil extraction process that is produced in large amount in the Mediterranean region. OMW is believed to induce phytotoxic effect on organisms including seed germination and plant growth. The objective of this study was to evaluate the impact of untreated and treated OMW with different techniques on seed germination of barley (Hordeum vulgare L.). The following treatments were investigated: (1) tap water (control); (2) OMW treated by aerobic biological technology in a Jacto Reactor (JR); (3) OMW treated by solar fenton oxidation (SFO); (4) OMW treated by microfiltration followed by nanofiltration (MF+NF); (5) OMW treated by microfiltration followed by reverse osmosis (MF+RO) process; (6) diluted OMW with tap water (25 % OMW); (7) diluted OMW with tap water (50 % OMW); (8) diluted OMW with tap water (75 % OMW); and (9) untreated OMW (100 % OMW). A germination test was conducted in an incubator at temperature of 23 (∘)C. In each petri dish, a filter paper was mounted and ten seeds of barley were placed on the filter paper. Five milliliter of water were added to each petri dish. The seed germination was determined by counting the number of germinated seeds to calculate the percentage of germination (G %). Germination rate index (GRI), seed vigor index (SVI), and phytotoxicity index (PI) were also calculated. Then, the dry weights and lengths of the shoots and the roots of the germinated seeds were measured. The results show that 100, 75, and 50 %OMW were very phytotoxic and completely prohibited seed germination. However, phytotoxicity decreased significantly following treatments of OMW with all techniques investigated and by the 25 % OMW dilution, as results of removing the phenols and other phytotoxic organic compounds from the OMW or by diluting it. This was evidenced by relative enhancement of the dry weights and lengths of shoot and root as well as the G %, GRI, SVG, and PI. It was concluded that if
Delhaize, Emmanuel; Taylor, Phillip; Hocking, Peter J; Simpson, Richard J; Ryan, Peter R; Richardson, Alan E
2009-06-01
Barley (Hordeum vulgare L.), genetically modified with the Al(3+) resistance gene of wheat (TaALMT1), was compared with a non-transformed sibling line when grown on an acidic and highly phosphate-fixing ferrosol supplied with a range of phosphorus concentrations. In short-term pot trials (26 days), transgenic barley expressing TaALMT1 (GP-ALMT1) was more efficient than a non-transformed sibling line (GP) at taking up phosphorus on acid soil, but the genotypes did not differ when the soil was limed. Differences in phosphorus uptake efficiency on acid soil could be attributed not only to the differential effects of aluminium toxicity on root growth between the genotypes, but also to differences in phosphorus uptake per unit root length. Although GP-ALMT1 out-performed GP on acid soil, it was still not as efficient at taking up phosphorus as plants grown on limed soil. GP-ALMT1 plants grown in acid soil possessed substantially smaller rhizosheaths than those grown in limed soil, suggesting that root hairs were shorter. This is a probable reason for the lower phosphorus uptake efficiency. When grown to maturity in large pots, GP-ALMT1 plants produced more than twice the grain as GP plants grown on acid soil and 80% of the grain produced by limed controls. Expression of TaALMT1 in barley was not associated with a penalty in either total shoot or grain production in the absence of Al(3+), with both genotypes showing equivalent yields in limed soil. These findings demonstrate that an important crop species can be genetically engineered to successfully increase grain production on an acid soil.
Directory of Open Access Journals (Sweden)
Peter FERUS
2010-10-01
Full Text Available In order to evaluate effects of different survival strategy and canopy structure on cereal radiation use efficiency (RUE under drought during grain filling, a pot experiment in spring barley (Hordeum vulgare L. of cultivar Dobla (able for escape, no productive tiller and Kompakt (one productive tiller was conducted. There was no difference in current RUE for leaf dry mass (RUEL between main stems of tested cultivars, observed. However, in productive tillers of cultivar Kompakt it was approximately double. Taking together, RUEL for whole plants was significantly higher in cultivar Kompakt than in cultivar Dobla. Current RUE for spike dry mass (RUES in hydrated plants was markedly higher than RUEL, in main stems of cultivar Kompakt with round double values of cultivar Dobla. Productive tillers of cultivar Kompakt were the most efficient PAR (photosynthetic active radiation utilizator for spike growth. Drought decreased RUES in cultivar Kompakt (in main stems as well as productive tillers to a half but in cultivar Dobla 20 %, only. Evaluating final RUE for spikes, almost fivefold higher values in hydrated plants of cultivar Kompakt fell to double ones under drought. In this context, important role played the productive tiller. Thus, model of more intensively tillering cereal crop seems to be more efficient in radiation use.
Microarray Analysis of Late Response to Boron Toxicity in Barley (Hordeum vulgare L.) Leaves
Oz, M.T.; Yilmaz, R.; Eyidogan, F.; Graaff, de L.H.; Yucel, M.; Oktem, H.A.
2009-01-01
DNA microarrays, being high-density and high-throughput, allow quantitative analyses of thousands of genes and their expression patterns in parallel. In this study, Barley1 GereChip was used to investigate transcriptome changes associated with boron (B) toxicity in a sensitive barley cultivar
Two New American Species of Hordeum (Poaceae)
DEFF Research Database (Denmark)
Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke
1985-01-01
Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....
Influence of yellow rust infection on /sup 32/P transport in detached barley leaves
Energy Technology Data Exchange (ETDEWEB)
Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)
1982-01-01
Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of /sup 32/P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general.
Influence of yellow rust infextion on 32P transport in detached barley leaves
International Nuclear Information System (INIS)
Schubert, J.
1982-01-01
Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of 32 P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general. (author)
Occurrence of barley leaf disease and control strategies in Denmark
DEFF Research Database (Denmark)
Jørgensen, Lise Nistrup; Ørum, Jens Erik; Heick, Thies Marten
Barley (Hordeum vulgare) is one of the major crops in Denmark and of special importance for malting and for pig feed. In 2016, the crop was grown covering a total area of 700,000 ha; approximately 25% of arable area in Denmark. To ensure high yield of around 60 dt ha-1, disease-tolerant cultivars...... have proven to be quite effective against all leaf diseases, aside from brown rust and mildew. Denmark has a national record system for pesticide usages. All farmers upload their fungicide use by crop, creating a good basis for assessing the differences in use pattern across different regions...... and fungicide treatments are required. Each year, barley cultivars are assessed for susceptibility towards leaf diseases in national observation plots. The most predominant fungal leaf diseases in Denmark are barley scald (Rhynchosporium secalis), net blotch (Pyrenophora teres), brown rust (Puccinia hordei...
Dicty_cDB: Contig-U03338-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) 486099E06.x1 486 - leaf primordia cDNA library fr... 155 1e-33 1 ( FL885969 ) CCGN6504.b1 CCGN Panicum virgatum eti...( CF272843 ) EST3049 Zea mays sperm cell cDNA library Zea mays... 105 1e-18 1 ( FE623651 ) CBYY4925.g1 CBYY Panicum virgatu...22B2F04.f1 BG01 - normalized library Leymus ... 266 1e-90 2 ( EX580446 ) HDP26H23w HDP Hordeum vulgare subsp. vulgare... 2 ( EX571824 ) HDP35N10T HDP Hordeum vulgare subsp. vulgare cDNA... 287 5e-90 2 ( CV056143 ) BNEL14D8 Barley EST endosperm library... rachis EST library... 161 2e-35 1 ( AU173547 ) Oryza sativa Japonica Group cDNA, parti
African Journals Online (AJOL)
A. Thameur
2012-05-17
adjustment trait variation in barley (Hordeum vulgare L.). Theor. Appl. Genet., 96: 688-698. Thameur A, Ferchichi A, López-Carbonell M (2011). Quantification of free and conjugated abscisic acid in five genotypes of barley. (Hordeum ...
Cultivate In Vitro Of Anthers Of Barley (Hordeum Vulgare L.) Vars. UNAGRO V-PM6 And DISSA
International Nuclear Information System (INIS)
Marquinez Casas, Xavier
1994-01-01
The barley is a autonomous cereal originated of the wild subspecies H. vulgare L. Only at the end of last century it acquired commercial importance with the establishment of the industry brewer (Chaparro and Moreno 1894); at the moment its national production is far from supplying the demand of the market. The Andean area is the most appropriate region for its cultivation in Colombia, mainly between 1800 and 3200 meters on the level of the sea, in the Boyaca, Cundinamarca and Narino departments. Their production is dedicated in a 80 at 85 for the industry brewer and malt industry and of the 15 at 20 for seeds, human food and animal
DEFF Research Database (Denmark)
Dionisio, Giuseppe; Brinch-Pedersen, Henrik
2016-01-01
Protease is commonly used as feed additive. Ronozyme® ProAct, a subtilisin-like serine feed protease is different from the already characterized Bacillus subtilisin-like serine protease. When used in wheat and barley based feed, its degree of efficiency differs according to the cultivar in analys...
Variation of Qingke (Hordeum vulgare linn.var.nudum Hook.f) induced by space flight treatment
International Nuclear Information System (INIS)
Li Xin; Peng Zhengsong; Yang Jun
2007-01-01
108 Dry seeds of Qingke (Hordeum vulgate linn. var. nudum Hook. f) were carried into space by recoverable satellite. after wards, the seeds were germinated into 108 seedlings at room temperature, and root tips were observed with Night microscope, and results and normal mitotic division was found without microkemel at interphase or chromosome bridges at anaphase, which means that chromosomal structure change didn't occur in Qingke seeds during space flight. To investigate whether there were morphology variations taken place, the seedlings were transplanted into field and managed normal. All of plants grew as strong as normal Qingke plants (CK) by eye abservation, except two plants showed abnormal inflorescence morphology, which had two spikes on one tiller. 21 SSR markers on 7 linkage groups were used to analysis the polymorphism of genomic DNA for these Qingke plants. No polymorphism was detected with 20 SSR markers among 63 plants investigated. But varied electrophoretic bands were tested in 10 plants using the marker HVM54 on chromosome 2H, and all the 10 plants showed uniform electrophoretypes. It was concluded that the DNA of the Qingke could be changed during space flight. (authors)
DEFF Research Database (Denmark)
Navrot, Nicolas; Skjoldager, Nicklas; Bunkenborg, Jakob
2015-01-01
Monomeric and dimeric forms of recombinant barley (Hordeum vulgare subsp. vulgare) glutathione peroxidase 2 (HvGpx2) are demonstrated to display distinctly different functional properties in vitro. Monomeric HvGpx2 thus has five fold higher catalytic efficiency than the dimer towards tert-butyl h...
International Nuclear Information System (INIS)
Arabi, M.I.E.
2004-01-01
Seeds from the net blotch (Pyrenophora teres) susceptible cultivar Thibaut were treated by gamma ray radiation and subsequently evaluated for reaction to the pathogen in the M2-M5 generations. Grain yield and agronomic characteristics of putative mutants were compared with Thibaut in two different locations. Genetic variation among some mutant lines/cv Thibaut was estimated using Amplified Fragment Length Polymorphism (AFLP) markers. Sixteen mutant lines and their mother cultivar Thibaut were analyzed with 14 EcoR1-Mse1 primer combinations. A total number of 504 AFLP bands were analyzed for each pair mutant/Thibaut. Narrow genetic variation among all genotypes was detected with an average of genetic similarity of 0.96. Cluster analysis with the entire AFLP data divided all genotypes into two major groups. The resistant mutant lines were grouped in one subcluster with 0.98 similarity index. Some resistant mutant lines to net blotch with good agronomic performances were produced [it
Directory of Open Access Journals (Sweden)
L. Torres Vaz-Freire
2007-01-01
Full Text Available A produção do azeite é uma das actividades agrícolas mais características da região mediterrânea e de importância relevante para a sua economia. O objectivo do trabalho foi o estudo da influência dos métodos da extracção na qualidade do azeite obtido. Incidiu principalmente sobre uma das cultivares recomendadas para os azeites de denominação origem protegida (DOP no Alentejo. Foi extraída azeite da variedade portuguesa, Galega Vulgar (Olea europaea L. subsp. europaea, colhida na região de Elvas nas campanhas de 2001 a 2004. Utilizou-se uma prensa hidráulica (extracção descontínua, Vieirinox, Portugal; e um “decanter” centrífugo de duas fases (extracção contínua, Oliomio, Itália. Nas azeitonas determinou-se o índice de maturação, fez-se o controle de pragas e avaliou-se o Índice de gordura (RMN. No azeite para além das análises químicas de controlo foi realizada a análise Sensorial com painel treinado e uma detecção electrónica de aromas (Alpha Mos Fox 3000. Os resultados preliminares mostram haver diferenças significativas para alguns dos parâmetros analisados no caso dos azeites. De todos os parâmetros em que se detectaram diferenças significativas apenas a acidez demonstrou alterações suficientes para classificar o azeite em outra categoria considerando a classificação estabelecida pelo Regulamento (CE N.º 1989/2003 de 6 de Novembro. Estudos como este são importantes na adaptação da tecnologia à variedade com o intuito de aumentar a eficiência de determinado processo tecnológico.Olive oil production is one of the important agricultural activities on the Mediterranean region and has a real impact on local economies. The objective of this work was the study of extraction methods impact on olive oil final quality. The variety studied is one of the varieties allowed for olive oil with Protected Origin Denomination (DOP production in Alentejo. The Portuguese variety extracted was Galega Vulgar
Hordein gene dose effects in triploid endosperm of barley (Hordeum vulgare L.
Directory of Open Access Journals (Sweden)
Perović Dragan
2009-01-01
Full Text Available The presence of two maternal chromosome sets in triploid barley endosperm allows the distinction of maternal and paternal hordein bands in an electrophoregram: the maternal bands are stronger due to the higher gene dose. In the F1 generation there are differences between reciprocal crosses and in the F2 generation all 16 classes that are theoretically possible for a pair of polymorphic loci can be distinguished. This full classification is rarely possible in genetic studies, and allows more accurate estimates of recombination rates. Two hordein gene clusters (Hor1 and Hor2, corresponding to hordein C and hordein B respectively were analyzed in hybrids obtained by crossing two winter barley cultivars Partizan and HWV-247. Hordein separation was performed by acid-polyacrylamide gel electrophoresis at pH 3.2 (A-PAGE. A set of most informative bands of B and C hordeins was selected in each cross by two criteria: (1 presence or absence of bands in the parents and (2 signal strength to allow doses scoring. The average genetic distance between Hor1 and Hor2 loci was 11 cM. Distances in male and female maps were not significantly different, suggesting a similar recombination rate in male and female meiosis.
International Nuclear Information System (INIS)
Friesl, W.; Friedl, J.; Platzer, K.; Horak, O.; Gerzabek, M.H.
2006-01-01
Metal contaminated crops from contaminated soils are possible hazards for the food chain. The aim of this study was to find practical and cost-effective measures to reduce metal uptake in crops grown on metal contaminated soils near a former metal smelter in Austria. Metal-inefficient cultivars of crop plants commonly grown in the area were investigated in combination with in-situ soil amendments. A laboratory batch experiment using 15 potential amendments was used to select 5 amendments to treat contaminated soil in a pot study using two Barley (Hordeum vulgare L.) cultivars that differed in their ability to accumulate cadmium. Results from this experiment identified 3 of these amendments for use in a field trial. In the pot experiment a reduction in ammonium nitrate extractable Cd (<41%) and Pb (<49%) compared to the controls was measured, with a concurrent reduction of uptake into barley grain (Cd < 62%, Pb < 68%). In the field extractable fractions of Cd, Pb, and Zn were reduced by up to 96%, 99%, and 99%, respectively in amended soils. - Gravel sludge and red mud, combined with metal-excluding cultivars, can improve contaminated land
Foliar flavonoids from Tanacetum vulgare var. boreale and their geographical variation.
Uehara, Ayumi; Akiyama, Shinobu; Iwashina, Tsukasa
2015-03-01
Foliar flavonoids of Tanacetum vulgare var. boreale were isolated. Eight flavonoid glycosides, 7-O-glucosides of apigenin, luteolin, scutellarein and 6- hydroxyluteolin, and 7-O-glucuronides of apigenin, luteolin, chrysoeriol and eriodictyol were identified. Moreover, eight flavonoid aglycones, apigenin, luteolin, hispidulin, nepetin, eupatilin, jaceosidin, pectolinarigenin and axillarin were also isolated and identified. The flavonoid composition of two varieties of T. vulgare, i.e. var. boreale and var. vulgare, were compared. All samples of var. boreale and one sample of var. vulgare had the same flavonoid pattern, and could be distinguished from almost all the samples of var. vulgare. Thus, the occurrence of chemotypes, which are characterized by either the presence or absence of scutellarein 7-O-glucoside, eriodictyol 7-O-glucuronide and pectolinarigenin was shown in T. vulgare sensu lato.
Foeniculum vulgare Mill (Umbelliferae) Attenuates Stress and ...
African Journals Online (AJOL)
Purpose: To evaluate the anti-stress and memory-enhancing properties of F. vulgare extract in experimental rats. Methods: F. vulgare plant extract was obtained using Soxhlet extraction technique. The extract, at doses of 50, 100 and 200 mg/kg body weight, was administered orally with an orogastric tube. Urinary levels of ...
Marrubium vulgare L.: A review on phytochemical and pharmacological aspects
Directory of Open Access Journals (Sweden)
Santram Lodhi
2017-12-01
Full Text Available Marrubium vulgare L. (family: Lamiaceae, also known as white horehound, is widely used as herbal remedy for chronic coughs and colds. It is used in various disorders related to skin, liver, gastric, heart and immune system. This review abridges phytochemical, pharmacological studies and medicinal uses of M. vulgare and provides scientific proof for various ethnobotanical claims in order to identify gaps, which will give impulsion for novel research on M. vulgare based herbal medicines. This review summarizes selected scientific evidence on phytochemistry and pharmacological properties of M. vulgare over the past 48 years (1968 to 2016. The work reported on M. vulgare was reviewed from various sources like books, internet source i.e. google search engine, pubmed, sciencedirect and chemical abstract. The exhaustive literature was studied and critical analysis was done according to their phytochemical and pharmacological properties. Phytochemical investigations on different parts of M. vulgare have been reported the presence of flavonoids, steroids, terpenoids, tannins, saponins and volatile oils (0.05%. The aerial parts contain marrubiin, together with ursolic acid and choline. Pharmacological activities like, anti-nociceptive, anti-spasmodic, anti-hypertensive, anti-diabetic, gastroprotective, anti-inflammatory, anti-microbial, anti-cancer, antioxidant, and anti-hepatotoxic activity have been reported. M. vulgare has therapeutic potential in the treatment of inflammatory conditions, liver disorders, pain, cardiovascular, gastric and diabetic conditions. Aerial parts of M. vulgare is a good source of labdane type diterpene especially marrubiin which is present in high concentrations. However, further scientific studies are needed to explore clinical efficacy, toxicity and to explore the therapeutic effect of major secondary metabolites like diterpenes, phenylpropanoid and phenylethanoid glycosides of M. vulgare. [J Complement Med Res 2017; 6
Directory of Open Access Journals (Sweden)
Janaína Endres Georg-Kraemer
2011-05-01
Full Text Available Populações duplo-haplóides apresentam especial vantagem para análises genéticas, uma vez que a informação que elas oferecem pode ser maximizada, devido ao fato que todos os locos encontram-se em homozigose. O objetivo deste trabalho foi o desenvolvimento de duas populações duplo-haplóides (DHs de cevada (Hordeum vulgare ssp. vulgare L. segregantes para a atividade das enzimas (1-3, 1-4-β-glucanases, através da técnica de cultura de anteras. Foram realizados dois cruzamentos com cultivares contrastantes para esta característica. As cultivares parentais selecionadas foram 'MN 698' e 'CEV 97047', para o desenvolvimento da população "malte verde" (MV, e 'Embrapa 127' e 'CEV 96025' para o desenvolvimento da população "malte seco" (MS. Foram cultivadas 10.734 anteras da população MS e 4.139 anteras da população MV. A população MV produziu 50% mais plântulas verdes quando comparada à população MS, refletindo a importância do genótipo na resposta à cultura de anteras e na regeneração. A maioria das plantas adultas duplo-haplóides foi obtida através da duplicação espontânea in vitro do genoma haplóide, ocorrendo em 66% das plantas da população MS e 76% das plantas da população MV. Também foram observadas, em menor frequência, plantas haplóides, triplóides e tetraplóides. Através da técnica de cultura de anteras, foram desenvolvidas 204 linhagens duplo-haplóides, das quais 72 linhagens são da população "malte seco" e 132 linhagens são da população "malte verde". Este material constitui um importante germoplasma para o melhoramento genético da cevada.Doubled haploid populations offer special advantages in genetic analyses, since the information they provide may be maximized due to the fact that all loci are homozygous. The aim of this study was to develop two barley (Hordeum vulgare ssp.vulgare L. doubled-haploid (DHs populations segregating to (1-3, 1-4-β-glucanases activity, utilizing the anther
Utilization of Mutagenic Treatments for Improving Barley Disease Resistance to Powdery Mildew
International Nuclear Information System (INIS)
Amer, M.; Fahim, M.M.; Moustafa, N.A.
2008-01-01
This program aims to improve barley (Hordeum vulgar L.) resistance to powdery mildew (Erysiphe graminis f. sp. hordi) using mutation induction technique via physical and chemical mutagens. Grains of two local cultivars were treated with gamma rays (150, 250 GY) at a dose rate of 9.02 Rad/ Sec alone or with the concentrations of chemical mutagens, i.e.,EMS (4 and 8 mM), MH (10 and 20 mM) for two hours. After mass selection for the resistance in M2, the two cultivars were varied in their responses to the fifteen treatments. In M3 generation, the frequencies of plant resistance were increased at 20 mM of MH, 8 mM of EMS or 250 GY with either of them for the cultivar G124. However, the same trend was also found at 10 mM of MH, 250GY alone and with 4 or 8 mM EMS for cultivar G125. Moreover, eight mutants were selected from the progenies of M4 plants and evaluated in M5 generation. These mutants are characterized by highly disease resistance and high yield components, one of them has been characterized by non crytics and awnless .The desirable mutants should go to further evaluation for grain yield and grain quality in subsequent generations. (author)
Czech Academy of Sciences Publication Activity Database
Yeo, F. K. S.; Wang, Y.; Vozábová, Tereza; Huneau, C.; LeRoy, P.; Chalhoub, B.; Qi, X. Q.; Niks, R. E.; Marcel, T. C.
2016-01-01
Roč. 129, č. 2 (2016), s. 289-304 ISSN 0040-5752 Institutional support: RVO:67985939 Keywords : cartial resistance genes * cloning * Hordeum vulgare Subject RIV: EF - Botanics Impact factor: 4.132, year: 2016
Konečná, Hana; Müller, Lukáš; Dosoudilová, Hana; Potěšil, David; Buršíková, Jana; Sedo, Ondrej; Márová, Ivana; Zdráhal, Zbyněk
2012-03-14
Two-dimensional gel electrophoresis in combination with mass spectrometry has already been applied successfully to study beer proteome. Due to the abundance of protein Z in beer samples, prefractionation techniques might help to improve beer proteome coverage. Proteins from four lager beers of different origins were separated by two-dimensional electrophoresis (2-DE) followed by tandem mass spectrometric analysis. Initially 52 proteins mostly from Hordeum vulgare (22 proteins) and Saccharomyces species (25 proteins) were identified. Preparative isoelectric focusing by OFFGEL Fractionator was applied prior to 2-DE to improve its resolution power. As a result of this combined approach, a total of 70 beer proteins from Hordeum vulgare (30 proteins), from Saccharomyces species (31 proteins), and from other sources (9 proteins) were identified. Of these, 37 proteins have not been previously reported in beer samples.
Czech Academy of Sciences Publication Activity Database
Sieper, T.; Forczek, Sándor; Matucha, Miroslav; Kraemer, P.; Hartmann, A.; Schroeder, P.
2014-01-01
Roč. 201, č. 2 (2014), s. 545-555 ISSN 1469-8137 Institutional support: RVO:61389030 Keywords : barley (Hordeum vulgare) * monoclonal antibodies * N-acyl-homoserine lactones (HSLs) Subject RIV: EF - Botanics Impact factor: 6.545, year: 2013
Diversity in boron toxicity tolerance of Australian barley (Hordeum vulgare L.) genotypes.
Hayes, Julie E; Pallotta, Margaret; Garcia, Melissa; Öz, Mehmet Tufan; Rongala, Jay; Sutton, Tim
2015-09-26
Boron (B) is an important micronutrient for plant growth, but is toxic when levels are too high. This commonly occurs in environments with alkaline soils and relatively low rainfall, including many of the cereal growing regions of southern Australia. Four major genetic loci controlling tolerance to high soil B have been identified in the landrace barley, Sahara 3771. Genes underlying two of the loci encode the B transporters HvBot1 and HvNIP2;1. We investigated sequence and expression level diversity in HvBot1 and HvNIP2;1 across barley germplasm, and identified five novel coding sequence alleles for HvBot1. Lines were identified containing either single or multiple copies of the Sahara HvBot1 allele. We established that only the tandemly duplicated Sahara allele conferred B tolerance, and this duplicated allele was found only in a set of nine lines accessioned in Australian collections as Sahara 3763-3771. HvNIP2;1 coding sequences were highly conserved across barley germplasm. We identified the likely causative SNP in the 5'UTR of Sahara HvNIP2;1, and propose that the creation of a small upstream open reading frame interferes with HvNIP2;1 translation in Sahara 3771. Similar to HvBot1, the tolerant HvNIP2;1 allele was unique to the Sahara barley accessions. We identified a new source of the 2H B tolerance allele controlling leaf symptom development, in the landrace Ethiopia 756. Ethiopia 756, as well as the cultivar Sloop Vic which carries both the 2H and HvBot1 B tolerance alleles derived from Sahara 3771, may be valuable as alternative parents in breeding programs targeted to high soil B environments. There is significant diversity in B toxicity tolerance among contemporary Australian barley varieties but this is not related to variation at any of the four known B tolerance loci, indicating that novel, as yet undiscovered, sources of tolerance exist.
Influence of Leaf Tolerance Mechanisms and Rain on Boron Toxicity in Barley and Wheat1[C
Reid, Rob; Fitzpatrick, Kate
2009-01-01
Boron (B) toxicity is common in many areas of the world. Plant tolerance to high B varies widely and has previously been attributed to reduced uptake of B, most commonly as a result of B efflux from roots. In this study, it is shown that the expression of genes encoding B efflux transporters in leaves of wheat (Triticum aestivum) and barley (Hordeum vulgare) is associated with an ability of leaf tissues to withstand higher concentrations of B. In tolerant cultivars, necrosis in leaves occurred at B concentrations more than 2-fold higher than in sensitive cultivars. It is hypothesized that this leaf tolerance is achieved via redistribution of B by efflux transporters from sensitive symplastic compartments into the leaf apoplast. Measurements of B concentrations in leaf protoplasts, and of B released following infiltration of leaves, support this hypothesis. It was also shown that under B-toxic conditions, leaching of B from leaves by rain had a strong positive effect on growth of both roots and shoots. Measurements of rates of guttation and the concentration of B in guttation droplets indicated that the impact of guttation on the alleviation of B toxicity would be small. PMID:19625636
M. T. Tinoco; M. R. Martins; J. Cruz-Morais
2007-01-01
O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva co...
Directory of Open Access Journals (Sweden)
Ming-Zhu Ding
Full Text Available The cooperative adaptation of subcultivated Bacillus cereus and Ketogulonicigenium vulgare significantly increased the productivity of 2-keto-L-gulonic acid, the precursor of vitamin C. The mechanism of cooperative adaptation of the serial subcultivated B. cereus and K. vulgare was investigated in this study by culturing the two strains orthogonally on agar plates. It was found that the swarming distance of B. cereus along the trace of K. vulgare on the plate decreased after 150 days' subcultivation. Metabolomic analysis on these co-cultured B. cereus and K. vulgare strains showed that their cooperative adaptation was accomplished by three key events: (i the ability of nutrients (e.g., amino acids and purines searching and intaking, and proteins biosynthesis is increased in the evolved B. cereus; (ii the capability of protein degradation and amino acids transportation is enhanced in evolved K. vulgare; (iii the evolved B. cereus was found to provide more nutrients (mostly amino acids and purines to K. vulgare, thus strengthening the oxidation and energy generation of K. vulgare. Our results provided novel insights into the systems-level understanding of the cooperative adaptation between strains in synergistic consortium.
COMPARISON OF THE FROST RESISTANCE OF BARLEY ...
African Journals Online (AJOL)
Preferred Customer
immediate recovery of the photosynthetic quantum yield after freezing. Landraces which showed the highest cold tolerance were found to acclimatize best. Key words/phrases: Barley, chlorophyll fluorescence, cold acclimation, Ethiopia, frost tolerance. INTRODUCTION. Barley (Hordeum vulgare L.) is a traditional crop.
Wheat and barley exposure to nanoceria: Implications for agricultural productivity
The impacts of man-made nanomaterials on agricultural productivity are not yet well understood. A soil microcosm study was performed to assess the physiological, phenological, and yield responses of wheat (Triticum aestivum) and barley (Hordeum vulgare L.) exposed to nanoceria (n...
Significance and value of non.traded ecosystem services on farmland
DEFF Research Database (Denmark)
Sandhu, Harpinder; Wratten, Steve; Costanza, Robert
2015-01-01
peas (Pisum sativum), beans (Phaseolus vulgaris), barley (Hordeum vulgare), and wheat (Triticum aestivum). Organic systems were chosen as comparators not because they are the only forms of sustainable agriculture, but because they are subject to easily understood standards. Results. We found...
Studies on the histology of partial resistance in barley to leafrust, Puccinia hordei
Niks, R.E.
1983-01-01
In de gerst (Hordeum vulgare) - dwergroest (Puccinia hordei) relatie zijn twee typen van resistentie te onderscheiden, namelijk overgevoeligheidsresistentie en partiële resistentie. Deze typen kunnen beschouwd worden als voorbeelden van Van der Plank's verticale en horizontale
Directory of Open Access Journals (Sweden)
Zeinab A. Salama
2015-01-01
Full Text Available Field experiment was conducted to study the effect of organic and bio-organic fertilizers on dry weight; yield, total phenolics (TPC, total flavonoids (TFC, vitamin C and on their antioxidant activities of two sweet fennel cultivars Dolce and Zefa fino. Results strongly showed that there were significant differences between sweet fennel cultivars. Generally the highest values of all parameters were obtained when fennel plants were supplemented with 50% NPK + 50% organic fertilizer and bio fertilizer when compared with control treatment. The highest values of TPC, TFC and Vit. C were recorded by Zefa fino cultivar when received 50% NPK + 50% organic treatment. The antioxidant activities of both cultivars were evaluated and Dolce cultivar showed the highest DPPH·− scavenging activity expressed as IC50 compared with Zefa fino cultivar. In addition, Dolce cultivars exhibited the highest value for Fe2+-chelating activities for organic and bio-organic fertilizers followed by Zefa fino when compared to control treatment. Dolce cultivar generally showed superiority than Zefa fino in all measured parameters.
Czech Academy of Sciences Publication Activity Database
Dockter, C.; Gruszka, D.; Braumann, I.; Druka, A.; Franckowiak, J.; Muller, A.H.; Oklešťková, Jana; Schulz, B.; Zakhrabekova, S.; Hansson, M.
2014-01-01
Roč. 166, č. 4 (2014), s. 1912-1927 ISSN 0032-0889 R&D Projects: GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : HORDEUM-VULGARE L. * GIBBERELLIN-SYNTHESIS * SIGNAL-TRANSDUCTION Subject RIV: EF - Botanics Impact factor: 6.841, year: 2014
DEFF Research Database (Denmark)
Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny
2012-01-01
The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe c...
Lifescience Database Archive (English)
Full Text Available me=Ltp1; Synonyms=Papi; Hordeum Vulgare Molecule: Lipid Transfer Protein; Chain: Null; Synonym: Ltp Lipid Tr...ansport M.H.Lerche, F.M.Poulsen M.H.Lerche, F.M.Poulsen Two Different Binding Modes Of Palmitate In The Homologous Mai
Nitrogen accumulation and residual effects of nitrogen catch crops
DEFF Research Database (Denmark)
Jensen, E.S.
1991-01-01
The nitrogen accumulation in Italian ryegrass (Lolium multiflorum Lam.), perennial ryegrass (Lolium perenne L.), white mustard (Sinapis alba L.) and tansy phacelia (Phacelia tanacetifolia L.), under- or aftersown as nitrogen catch crops to spring barley (Hordeum vulgare L.) and field pea (Pisum s...
Wheat and barley seed systems in Ethiopia and Syria
Bishaw, Z.
2004-01-01
Keywords: Wheat,Triticumspp., Barley,Hordeumvulgare L., Seed Systems, Formal Seed Sector, Informal Seed Sector, National Seed Program, Seed Source, Seed Selection, Seed Management, Seed Quality,
DEFF Research Database (Denmark)
Clausen, Sabine Karin; Frenck, Georg; van der Linden, Leon Gareth
2011-01-01
We investigated the effect of elevated [CO2], [O3] and temperature on plant productivity and if these climate factors interacted with each other in multifactor treatments. The climate effects were studied in 14 different cultivars/lines of European spring oilseed rape (Brassica napus L.) and spring...... barley (Hordeum vulgare L.). Seven genotypes of each species were cultivated in six single- and multifactor treatments with ambient or elevated CO2 (385 ppm and 700 ppm), O3 (20 ppb and 60 ppb) and temperature (12/19 °C and 17/24 °C). Growth and production parameters were measured. Elevated CO2 increased....... A significantly decreased yield and thousand grain weight was also seen in barley due to elevated O3. The multifactor combination of elevated CO2, O3 and temperature showed a decrease in growth and production in the two species, though not statistically significant for all parameters. This trend suggests...
Directory of Open Access Journals (Sweden)
E. R. Baseggio
2017-12-01
Full Text Available The use of bioprotectors in the coating of seeds is increasing, and these become an alternative for the use of chemical fungicides. The aim of this work was to evaluate the use of Trichoderma spp., with or without polymerization, in the control of pathogens associated with black oats (Avena strigosa and barley (Hordeum vulgare seeds of the cultivars 'Comum' (black oats and BRS Cauê (barley, 2014 crop. After asepsis and dried of the seeds, the treatments were applied, using a dose of 5 mL of Trichoderma spp. kg-1 and 10 mL of seed polymer kg-1 of seeds. Sanity tests; germination; germination and emergency rate index; length of seedling (shoot and root; and fresh and dry weight were performed. The coating of oat and barley seeds with Trichoderma spp. was efficient in the control of pathogens, as well as increased the germination and development of the seedlings for both cultures evaluated.
Chernobyl Doses. Volume 3. Habitat and Vegetation Near the Chernobyl Nuclear Reactor Station
1993-01-01
Hordeum vulgare, Avena sativa, Fagopyrum esculentum, Beta vulgaris, Solanum tuberosum, Linum usitatissimum , Cannabis satii, Humulus lupulus, Daucus carota... USITATISSIMUM flax It is grown for fiber. Fine-quality fiber can be obtained from plants grown on podzolic and gley soils with considerable fertilizing. In the
Lopez, S.; Davies, D.; Dhanoa, M.S.; Dijkstra, J.; France, J.
2005-01-01
The nutritive value of 17 straws was determined on the basis of their chemical composition, in vitro dry matter (DM) digestibility and rumen fermentation kinetics (from gas production curves measured in vitro). Five roughages were from the cereal species Avena sativa (oat), Hordeum vulgare (barley),
Sequencing of 15622 gene-bearing BACs clarifies the gene-dense regions of the barley genome
Czech Academy of Sciences Publication Activity Database
Munoz-Amatriain, M.; Lonardi, S.; Luo, M.C.; Madishetty, K.; Svensson, J.T.; Moscou, M. J.; Wanamaker, S.; Kudrna, D.; Zheng, J.; Šimková, Hana; Doležel, Jaroslav; Grimwood, J.; Mammadov, J.; Close, T.J.
2015-01-01
Roč. 84, č. 1 (2015), s. 216-227 ISSN 0960-7412 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Barley * Hordeum vulgare L * BAC sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.468, year: 2015
Farmer’s seed sources and seed quality: 2. seed health
Bishaw, Z.; Struik, P.C.; Gastel, van A.J.G.
2013-01-01
The study assessed the health quality of wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) seed samples collected from formal and informal sector in Ethiopia and Syria. In Ethiopia, several seed-borne fungi were found on wheat samples: Cochliobolus sativum, Fusarium avenaceum, F.
Synthesis of the major storage protein, hordein, in barley
DEFF Research Database (Denmark)
Giese, Nanna Henriette; Andersen, B.; Doll, Hans
1983-01-01
A liquid culture system for culturing detached spikes of barley (Hordeum vulgare L.) at different nutritional levels was established. The synthesis of hordein polypeptides was studied by pulse-labeling with [14C]sucrose at different stages of development and nitrogen (N) nutrition. All polypeptides...
DEFF Research Database (Denmark)
Schelde, Kirsten; Ringgaard, Rasmus; Herbst, Mathias
2011-01-01
limit estimate (disregarding dew evaporation) of evapotranspiration on dry days. During a period of 7 wk, the two independent measuring techniques were applied in a barley (Hordeum vulgare L.) field, and six dry periods were identified. Measurements of daily root zone soil moisture depletion were...
Investigation of GMO and ancient Grains for Bioplastic and Food Applications
DEFF Research Database (Denmark)
Sagnelli, Domenico
I dette projekt er der udviklet nye koncepter for helt naturlige bioplast systemer og sunde diætfibre. Termoplastisk stivelse (TPS) fremstilles ved anvendelse af traditionelle processer, såsom ekstrudering. I dette projekt anvendes transgen byg (Hordeum vulgare, Hv) med en stivelse der indeholder...
PLANT REMAINS FROM ASIKLI-HOYUK, A PRE-POTTERY NEOLITHIC SITE IN CENTRAL ANATOLIA
VANZEIST, W; DEROLLER, GJ
Cereal crop plants at Asikli Hayuk included einkorn wheat (Triticum monococcum), emmer wheat (T. dicoccum), free-threshing wheat (T. cf. durum), hulled two-rowed barley (Hordeum distichum) and naked barley (H. vulgare var. nudum). As for pulses, bitter vetch (Vicia ervilia), lentil (Lens culinaris)
Niks, R.E.; Alemu, Sisay K.; Marcel, T.C.; Heyzen, van Skye
2015-01-01
Barley (Hordeum vulgare L.) mapping populations have been developed that are useful to study the inheritance of quantitative resistance to adapted and unadapted rust fungi. In a recent host range study, we found that the parents of those mapping populations also differed in their resistance to
The Role of alpha-Glucosidase in Germinating Barley Grains
DEFF Research Database (Denmark)
Stanley, Duncan; Rejzek, Martin; Næsted, Henrik
2011-01-01
The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementa...
DEFF Research Database (Denmark)
Rötter, R P; Palosuo, T; Kersebaum, K C
2012-01-01
In this study, the performance of nine widely used and accessible crop growth simulation models (APES-ACE, CROPSYST, DAISY, DSSAT-CERES, FASSET, HERMES, MONICA, STICS and WOFOST) was compared during 44 growing seasons of spring barley (Hordeum vulgare L.) at seven sites in Northern and Central...
Effects of free and chelated iron on in vitro androgenesis in barley and wheat
Czech Academy of Sciences Publication Activity Database
Novotný, J.; Vagera, Jiří; Ohnoutková, Ludmila
2000-01-01
Roč. 63, - (2000), s. 35-40 ISSN 0167-6857 R&D Projects: GA ČR GV521/96/K117 Institutional research plan: CEZ:AV0Z5038910 Keywords : ferrous ions * Hordeum vulgare * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 0.444, year: 2000
A new agro-climatic classification for crop suitability zoning in northern semi-arid Ethiopia
Araya, A.; Keesstra, S.D.; Stroosnijder, L.
2010-01-01
The agro-climatic resources of Giba catchment in northern Ethiopia were assessed and characterized. The objectives were (i) to ascertain the suitability of the climate for growing teff (Eragrostis tef) and barley (Hordeum vulgare); (ii) to determine the onset and length of the growing period (LGP),
DEFF Research Database (Denmark)
Andersen, M.K.; Hauggaard-Nielsen, H.; Ambus, P.
2005-01-01
The interspecific complementary and competitive interactions between pea (Pisum sativum L.), barley (Hordeum vulgare L.) and oilseed rape (Brassica napus L.), grown as dual and tri-component intercrops were assessed in a field study in Denmark. Total biomass production and N use at two levels of ...
Classification and salt tolerance analysis of barley varieties
Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Fares, C.; Ceccarelli, S.; Grando, S.; Oweis, T.
2006-01-01
Six varieties of barley (Hordeum vulgare), five of which were provided by ICARDA, were tested in a green house experiment for their salt tolerance. Afterwards the ICARDA variety Melusine, selected from this experiment for its combination of high yield and salt tolerance, was compared in a lysimeter
Yield and grain quality of spring barley as affected by biomass formation at early growth stages
Czech Academy of Sciences Publication Activity Database
Křen, J.; Klem, Karel; Svobodová, I.; Míša, P.; Neudert, L.
2014-01-01
Roč. 60, č. 5 (2014), s. 221-227 ISSN 1214-1178 R&D Projects: GA MZe QI111A133 Keywords : Hordeum vulgare L * above-ground biomass * tillering * grain yield formation * grain protein content Subject RIV: EH - Ecology, Behaviour Impact factor: 1.226, year: 2014
Genomic restructuring in Hordeum chilense durum wheat hybrids ...
Indian Academy of Sciences (India)
ANDREIA DELGADO
4John Innes Centre, Norwich Research Park, Norwich NR4 7UH, UK. 5Departament of Genetics and Biotechnology, University of Tras-os-Montes and Alto ... [Delgado A., Carvalho A., Martín A. C., Martín A. and Lima-Brito J. 2017 Genomic restructuring in F1 Hordeum chilense × durum ...... Academic Press, Burlington,.
PENGARUH INFUS BUAH Foeniculum vulgare Mill PADA SIKLUS ESTRUS DAN BOBOT UTERUS TIKUS PUTIH
Directory of Open Access Journals (Sweden)
Sa'roni Sa'roni
2012-10-01
Full Text Available Buah Foeniculum vulgare Mill (adas secara tradisional untuk obat dan campuran jamu pengatur haid. Diduga buah Foeniculum vulgare Mill mempunyai pengaruh pada sistem reproduksi. Oleh karena itu, kami melakukan penelitian pengaruh infus buah Foeniculum vulgare Mill pada siklus estrus dan bobot uterus tikus putih.Infus diberikan secara oral sekali sehari selama 12 hari dengan dosis setara dengan 7,3 mg, 73 mg dan 219 mg/100 g bobot badan. Selama pemberian bahan, siklus estrus diperiksa setiap hari dan pada hari ke-13 diotopsi dan ditimbang bobot uterusnya.Hasil penelitian menunjukkan bahwa infus buah Foeniculum vulgare Mill setara dengan serbuk 7,3 mg, 73 mg dan 219 mg/100 g bobot badan dapat menghambat fase estrus (masa subur. Infus setara dengan serbuk 7 mg dan 219 mg/100 g bobot badan kelihatan dapat menghambat fase estrus yang sangat nyata dibandingkan dengan akuades. Infus buah Foeniculum vulgare Mill setara dengan serbuk 219 mg/100 g bobot badan dapat menurunkan bobot uterus, tetapi secara statistik tidak berbeda nyata dengan akuades. Kata kunci: Obat tradisional; Foeniculum vulgare Mill; Sistem Reproduksi
Zinc biofortification of cereals: rice differs from wheat and barley
Stomph, T.J.; Jiang, W.; Struik, P.C.
2009-01-01
In their review, mainly focused on bread wheat (Triticum aestivum), durum wheat (Triticum durum) and barley (Hordeum vulgare), Palmgren et al. 1 M.G. Palmgren et al., Zinc biofortification of cereals: problems and solutions, Trends Plant Sci. 13 (2008), pp. 464–473. Article | PDF (905 K) | View
DEFF Research Database (Denmark)
Gerhards, R; Christensen, Svend
2003-01-01
with weed infestation levels higher than the economic weed threshold; a review of such work is provided. This paper presents a system for site-specific weed control in sugarbeet (Beta vulgaris L.), maize (Zea mays L.), winter wheat (Triticum aestivum L.) and winter barley (Hordeum vulgare L.), including...
Czech Academy of Sciences Publication Activity Database
Klem, Karel; Rajsnerová, Petra; Novotná, Kateřina; Míša, P.; Křen, J.
2014-01-01
Roč. 60, č. 2 (2014), s. 50-59 ISSN 0551-3677 R&D Projects: GA MZe QI111A133; GA TA ČR TA02010780 Institutional support: RVO:67179843 Keywords : Hordeum vulgare * spectral reflectance * vertical gradient * vegetation indices * nitrogen * grain yield * protein content Subject RIV: GC - Agronomy
Agricultural drought and spring barley yields in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Trnka, M.; Hlavinka, P.; Semerádová, Daniela; Dubrovský, Martin; Žalud, Z.; Možný, M.
2007-01-01
Roč. 53, č. 7 (2007), s. 306-316 ISSN 1214-1178 Institutional research plan: CEZ:AV0Z30420517 Keywords : Hordeum vulgare L * Palmer Z-index * climatic conditions * yield * drought Subject RIV: DG - Athmosphere Sciences, Meteorology http://journals.uzpi.cz:8050/web/_generovani_8050/pse_2007.htm
Chromosome aberration assays in barley (Hordeum vulgare)
Energy Technology Data Exchange (ETDEWEB)
Constantin, M J [Univ. of Tennessee, Knoxville; Nilan, R A
1982-01-01
Barley is an exceellent organism for studies of induced chromosome aberrations because of its few (2n = 2x = 14) relatively large chromosomes. Root-tip and shoot-tip cells have been used extensively for the study of ionizing radiation-induced chromosome aberrations. The general procedures are well known, the technology is simple and easy to learn, and the assays are relatively quick and inexpensive. Both root tips and shoot tips can be used for the study of chemical mutagens as well as ionizing radiations. Pollen mother cells are well suited for studying the effects of mutagens on meiotic chromosomes. The literature review for the Gene-Tox Program reported on 61 chemicals tested for their effects on barley chromosomes. Of these, 90% were reported to be either positive or positive dose-related, while 7% were negative and 3% were questionable. Barley assays based on chromosomal aberrations are useful to detect the clastogenic potency of chemicals under laboratory conditions. Indications are that the data from barley can be used to corroborate data obtained from other organisms. Among the classes of chemicals assayed were: alcohols and phenols; alkaloids; epoxides; alkyl sulfates; amides and sulfonamides; aromatic amines; aryl halides; aziridines; alkenes; carbamates; hydroazides; nitroaromatics; nitrosamides; nitrosources; phenothiazines; and polycyclic aromatic hydrocarbons.
Radiosensitivity study of cultured barley (hordeum vulgare)
International Nuclear Information System (INIS)
Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang
1991-07-01
For studying the radioactivity, forty seven varieties of dormant barley seeds were irradiated with various doses (0 ∼ 400 Gy) of 137 Cs γ-rays. The results showed that the dose-effects relations of seedling growth inhibition could be fitted by an equation of F(D) = 1 - (1 - e -a 1 D ) N , and the dose-effects of cell-nucleus, the frequency of root tip cell with chromosome aberations and peroxidase isoenzyme band could be expressed by a linear regression equation Y = A + B · X. The radioactivity of naked barley was much higher than of covered barley. According to different radiosensitivities the varieties studied could be divided into five types i.e. extreme resistant, resistant, intermediate, sensitive, and extreme sensitive. The results also showed that there was close relationship between the DNA content of cell-nucleus, peroxidase isoenzyme zymogram and radioactivity. The radiosensitivty was proportional to the DNA content. The volume of cell-nucleus varied inversly as D 50 of nucleus volume and no obvious correlation with the D 50 of seedling growth inhibition
(Hordeum Vulgare) Crop Coefficient and Comparative Assessment
African Journals Online (AJOL)
Bheema
The second prerequisite for sustainable use of water was developing/ ... Following the construction of .... pond capacity, the irrigation method, soil type, major crops grown in the area, and the ... determines the viability of any irrigation project. .... lack of awareness, lack of skill, technology and lack of adequate knowledge in ...
Chemical weed control in barley (hordeum vulgare)
International Nuclear Information System (INIS)
Sarwar, M.; Hassan, S.W.; Abid, A.A.
2008-01-01
Effect of two different pre-emergence herbicides i.e. Terbutryn (lgron-500FW) A, 1.01.25 kg a.t. ha/sup -1/ and Flurochloridone (Racer-25 CS) a 0.31, 0.37, 0.44, 0.50 and 0.56 Kg a.i. ha/sup -1/ on weeds and yield of barley wad studied under field conditions hb/sup -1/. All the herbicides significantly reduce the dry weight of weed Maximum reduction (70%) was observed in terbutryn a 1.0 Kg a.i. ha/sup -1/ Growth and yield parameters like number of spike lets per spike. Number of grams per spike. 1000-grain weight. Biological yield. Grain yield straw yield and harvest index showed significant response to various herbicides doses under study. Application of Flurochloridone (Racer-25 (CS) a 0.44 kg a.i. ha/sup -1/ and Terbutryn (lgran-500 FW) a 1.0 kg a.i). The data further revealed that in general all herbicide application treatments exhibited superior performance in respect of growth and yield over control. (author)
Giemsa C-banded karyotypes of Hordeum taxa from North America
DEFF Research Database (Denmark)
Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.
1986-01-01
submetacentrics than previously reported in Hordeum distinguished the genomes of H. arizonicum and H. brachyantherum (4x) from Newfoundland. A partial inactivation of the nucleolus organizers of one parental genome in interspecific hybrids is considered more common than generally appreciated....
Directory of Open Access Journals (Sweden)
Dongfa Sun
Full Text Available Numerous hybrid and polypoid species are found within the Triticeae. It has been suggested that the H subgenome of allopolyploid Elymus (wheatgrass species originated from diploid Hordeum (barley species, but the role of hybridization between polyploid Elymus and Hordeum has not been studied. It is not clear whether gene flow across polyploid Hordeum and Elymus species has occurred following polyploid speciation. Answering these questions will provide new insights into the formation of these polyploid species, and the potential role of gene flow among polyploid species during polyploid evolution. In order to address these questions, disrupted meiotic cDNA1 (DMC1 data from the allopolyploid StH Elymus are analyzed together with diploid and polyploid Hordeum species. Phylogenetic analysis revealed that the H copies of DMC1 sequence in some Elymus are very close to the H copies of DMC1 sequence in some polyploid Hordeum species, indicating either that the H genome in theses Elymus and polyploid Hordeum species originated from same diploid donor or that gene flow has occurred among them. Our analysis also suggested that the H genomes in Elymus species originated from limited gene pool, while H genomes in Hordeum polyploids have originated from broad gene pools. Nucleotide diversity (π of the DMC1 sequences on H genome from polyploid species (π = 0.02083 in Elymus, π = 0.01680 in polyploid Hordeum is higher than that in diploid Hordeum (π = 0.01488. The estimates of Tajima's D were significantly departure from the equilibrium neutral model at this locus in diploid Hordeum species (P<0.05, suggesting an excess of rare variants in diploid species which may not contribute to the origination of polyploids. Nucleotide diversity (π of the DMC1 sequences in Elymus polyploid species (π = 0.02083 is higher than that in polyploid Hordeum (π = 0.01680, suggesting that the degree of relationships between two parents of a polyploid might be a factor
Responses of growth and primary metabolism of water-stressed barley roots to rehydration
Barley seedlings [Hordeum vulgare L. Brant] were grown in pots in controlled environment chambers and drought treatments were imposed 11 days after sowing. Soil water content decreased from 92% to 10% after an additional 14 days of water stress. Shoot and root growth ceased after 4 and 9 days of wat...
Francia-Martinez, J.R.; Duran Zuazo, V.H.; Martinez-Raya, A.
2006-01-01
Soil erosion, runoff and nutrient-loss patterns over a two-year period (1999¿2000) were monitored in erosion plots on a mountainside with olive (Olea europaea cv. Picual) trees under three different types of soil management: (1) non-tillage with barley (Hordeum vulgare) strips of 4 m width (BS); (2)
Biochemistry, Structure and Function of Non-Wheat Proteins: Case Study of Barley ß-Amylase
The importance of a protein is not always evident and may be due to its multifunctional nature. ß-Amylase in seeds of barley (Hordeum vulgare L.) constitutes approximately 2% of the total protein in mature seeds and is assumed to be important when storage proteins are mobilized to support protein s...
DEFF Research Database (Denmark)
Kaczmarczyk, Agnieszka Ewa
Barley (Hordeum vulgare L.) is cultivated in a range of diverse environments and is widely utilised as feed for animal and as malt in brewing. Nitrogen (N) is a key macronutrient whch directly increases plant growth and is used as a fertiliser to meet the demands for higher yield. However...
Starch and Free Sugars during Kernel Development of Bomi Barley and its High-Lysine Mutant 1508
DEFF Research Database (Denmark)
Kreis, Michael
1978-01-01
At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...
DEFF Research Database (Denmark)
Hansen, Elly Møller; Munkholm, Lars Juhl; Olesen, Jørgen E
2015-01-01
retention did not significantly increase yields, nor did it reduce leaching, while fodder radish (Raphanus sativus L.) as a catch crop was capable of reducing nitrate leaching to a low level. Thus, YSL of winter wheat (Triticum aestivum L.) was higher than for spring barley (Hordeum vulgare L.) grown after...
Directory of Open Access Journals (Sweden)
C.F. Azevedo
2012-01-01
Full Text Available A erva-doce, Foeniculum vulgare Mill. (Apiaceae, é uma erva entouceirada, aromática que apresenta propriedades condimentares e medicinais; tem origem Européia e é amplamente cultivada em todo o Brasil. Devido à deficiência de informações relativas à organização estrutural de plântulas de espécies medicinais, o presente estudo teve como objetivo fornecer informações sobre a anatomia e o desenvolvimento de plântulas de F. vulgare. As sementes de erva-doce foram semeadas em areia e mantidas em casa de vegetação por 25 dias, sendo realizadas regas diárias. Foram selecionadas plântulas normais e de padrão uniforme, que tiveram raiz, zona de transição, caule, cotilédones e primeiras folhas seccionados à mão livre. Este material foi corado e montado em lâminas com glicerina para observação em microscópio. Em todos os órgãos da plântula de erva-doce a epiderme é unisseriada, cuticularizada e com estômatos; sendo que as duas últimas estruturas não são encontradas na raiz, porém esta apresenta pêlos unicelulares e cônicos. Os cotilédones e as folhas apresentam funções fotossintéticas e nutricionais, indicadas pela presença de grande quantidade de estômatos, cloroplastos e amido. A caracterização anatômica de plântulas de F. vulgare auxilia na identificação da espécie e no conhecimento da organização celular, fornecendo informações que auxiliam em estudos fisiológicos, taxonômicos e ecológicos.Fennel, Foeniculum vulgare Mill. (Apiaceae, is a forming clumps herb and presents aromatic, medicinal and condimental properties. It has European origin and is widely cultivated and used in Brazil. Due to lack of information concerning the structural organization of seedlings of medicinal species, this study aimed to provide information about the anatomy and development of F. vulgare seedlings. The seeds fennel was sowed in sand and maintained in greenhouse for 25 days, with daily waterings. Were selected
Chemical Composition of Essential Oil from Marrubium Vulgare L. Leaves
Bayir, Burcu; Gündüz, Hatice; Usta, Tuba; Şahin, Esma; Özdemir, Zeynep; Kayır, Ömer; Sen, Özkan; Akşit, Hüseyin; Elmastaş, Mahfuz; Erenler, Ramazan
2014-01-01
– The essential oils are significant for pharmaceutical, food and cosmetic industries. Marrubium vulgare L. has been used as a traditional medicine to treat the various illnesses. The chemical composition of the essential oil from leaves of Marrubium vulgare L.was obtained by steam distillation using the Clevenger apparatus. The oil was analyzed by gas chromatography and mass spectrometry (GC-MS). The main constituent of the oil was α-pinene (28.85%)
Efficacy of Essential Oils of Thymus vulgaris and Origanum vulgare on Echinococcus granulosus
Directory of Open Access Journals (Sweden)
P. E. Pensel
2014-01-01
Full Text Available The aim of the present work was to determine the in vitro effect of T. vulgaris and O. vulgare essential oils against E. granulosus protoscoleces and cysts. Essential oils were added to the medium resulting in thymol final concentrations of 10 μg/mL. The essential oils had a time-dependent effect provoking the complete loss of protoscolex viability after 72 days of postincubation. The results were confirmed at the ultrastructure level. Loss of infectivity in protoscoleces incubated with O. vulgare after 60 days was observed. On the other hand, the weight of cysts recorded in mice inoculated with T. vulgaris treated protoscoleces was significantly lower than that obtained in control group. Gamma-glutamyl-transpeptidase activity was readily detected in the culture supernatant of protoscoleces treated either with the essential oils or thymol. T. vulgaris and O. vulgare essential oils and thymol can induce cell apoptosis of protoscoleces after short incubation times. The efficacy of T. vulgaris and O. vulgare essential oils was also demonstrated in vitro on E. granulosus murine cysts. Our data suggest that essential oils of T. vulgaris and O. vulgare have anthelmintic effect against protoscoleces and cysts of E. granulosus.
DEFF Research Database (Denmark)
Zerbe, Philipp; Chiang, Angela; Dullat, Harpreet
2014-01-01
Marrubium vulgare (Lamiaceae) is a medicinal plant whose major bioactive compounds, marrubiin and other labdane-related furanoid diterpenoids, have potential applications as anti-diabetics, analgesics or vasorelaxants. Metabolite and transcriptome profiling of M. vulgare leaves identified five...... different candidate diterpene synthases (diTPSs) of the TPS-c and TPS-e/f clades. We describe the in vitro and in vivo functional characterization of the M. vulgare diTPS family. In addition to MvEKS ent-kaurene synthase of general metabolism, we identified three diTPSs of specialized metabolism: MvCPS3...
Directory of Open Access Journals (Sweden)
M. Vazirian
2015-12-01
Full Text Available Background and Objectives: Essential oils are very complex mixture of components and their composition may vary in different species or varieties or even within the same variety. Origanum vulgare L. subsp. vulgare is one of the most distributed subspecies within the genus Origanum and has been found to be a poor-oil, categorized in cymyl, bornane or sabinyl chemotypes with higher proportion of sesquiterpenes. In this experiment, the Iranian sample was studied for the chemical composition of the oil and evaluation of its antioxidant activity. Methods: Essential oil was obtained by hydro-distillation and analyzed by GC/MS for determination of components. Antioxidant activity was evaluated by radical scavenging ability (DPPH method and reducing power (FRAP assay. Results: The sample belonged to “thymol” chemotype with the main components as thymol (37.13%, gama-terpinene (9.67%, carvacrol (9.57%, carvacrol methyl ether (6.88, cis-alpha-bisabolene (6.80%, eucalyptol (3.82%, p-cymene (3.58% and elemol (2.04%. The oil of plant showed very strong antioxidant activity (IC50=2.5 µg/mL in DPPH method, which was stronger than the standard antioxidants (Vit E and BHA, p
Coté, Héloïse; Boucher, Marie-Anne; Pichette, André; Legault, Jean
2017-05-25
Background: Tanacetum vulgare L. (Asteraceae) is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean), Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.
Directory of Open Access Journals (Sweden)
Héloïse Coté
2017-05-01
Full Text Available Background: Tanacetum vulgare L. (Asteraceae is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean, Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.
AFLP genetic polymorphism in wild barley (Hordeum spontaneum) populations in Israel
Turpeinen, T.; Vanhala, T.; Nevo, E.; Nissila, E.
2003-01-01
The genetic diversity produced by the amplified fragment length polymorphism (AFLP) method was studied in 94 genotypes of wild barley, Hordeum spontaneum (C. Koch) Thell., originating from ten ecologically and geographically different locations in Israel. Eight primer pairs produced 204 discernible
Origanum vulgare (Lamiaceae OVICIDAL POTENTIAL ON GASTROINTESTINAL NEMATODES OF CATTLE
Directory of Open Access Journals (Sweden)
Luciana Laitano Dias de Castro
2013-12-01
Full Text Available Due to anthelmintic resistance in nematodes, several research studies have been developed seeking control alternatives to these parasites. This study evaluated the in vitro action of Origanum vulgare on gastrointestinal nematode eggs of cattle. In order to evaluate the ability to inhibit egg hatch, different dried leaves extracts of this plant were tested, such as dye, hydroalcoholic and aqueous extracts at concentrations varying from 0.62 to 80 mg/mL. Each assay was accompanied by control containing levamisole hydrochloride (0.2 mg/mL, distilled water and 70 ºGL grain alcohol at the same concentration of the extracts. Test results showed that the different O. vulgare extracts inhibited egg hatch of cattle gastrointestinal nematodes at a percentage that varied from 8.8 to 100%; dye and hydroalcoholic extract were the most promising inhibitors. In view of this ovicidal property, O. vulgare may be an important source of viable antiparasitic compounds for nematodiosis control in ruminants.
Directory of Open Access Journals (Sweden)
M. T. Tinoco
2007-01-01
Full Text Available O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva composição química. A extracção dos óleos essenciais foi efectuada por hidrodestilação e a sua análise foi feita por GC-FID e GC-MS. No óleo das folhas foram identificados como componentes maioritários os fenilpropanóides anetol, fenchona e estragol e o monoterpeno a-felandreno, enquanto que o óleo dos frutos apresentou como constituintes predominantes anetol e fenchona. A actividade antimicrobiana dos óleos foi avaliada face às estirpes Staphylococcus aureus, Escherichia coli, Saccharomyces spp., Fusarium oxysporum e Penicillium sp.. Os óleos essenciais apresentaram actividade antimicrobiana contra S. aureus, Saccharomyces spp. e Fusarium oxysporum.Foeniculum vulgare Mill. ssp. vulgare is a spontaneous plant of Mediterranean region that belongs to the Apiaceae family. Its essential oil is used as additives in food, pharmaceutical, cosmetic and perfume industries mainly that one obtained from dried seeds. The main goal of this work were to evaluate the antimicrobial activity of essential oils obtained from fresh leaves and unripe seeds of sweet fennel, collected in Évora-Alentejo, in face of their chemical composition. The extraction of the essentials oils was made by hydrodistillation. Chemical analyses were carried out by GC-FID and GCMS. Phenylpropanoides anethole, fenchone, estragole and the monoterpene aphellandrene were the most abundant compounds of leaves essential oil. Seeds essential oil showed as main components
Registration of ‘Kardia’, a Two-Rowed Spring Food Barley
‘Kardia’ (Reg. No. XXXX, XXXX), a two-rowed spring food barley (Hordeum vulgare L.) developed by the USDA-ARS, Aberdeen, ID, in cooperation with the University of Idaho Agricultural Experiment Station, was released in 2015. Kardia is derived from the cross of ‘03AH3054 / 98Ab12019’ and was advanced...
Effects of Net Blotch ( Pyrenophora teres ) on Malt Barley Yield and ...
African Journals Online (AJOL)
Barley (Hordeum vulgare L.) production is constrained by diseases such as net blotch caused by Pyrenophora teres Drechsl. The objectives of this study were to assess the effects of net blotch disease on malt barley yield and grain quality under natural infection. Four malt barley varieties (Beka, HB 120, HB 52 and Holker), ...
Directory of Open Access Journals (Sweden)
Saeide Saeidi
2014-10-01
Full Text Available Background: Herbal medicines are the major remedy in traditional medical systems and made a great contribution in maintaining human health and in preventing many infectious diseases. The present study was carried out to determine the potential antibacterial effect of ethanol extracts and essential oil of Marrubium vulgare L. against Staphylococcus aureus which is antibiotic resistant. Materials and Methods: All 17 strains of S. aureus isolated from nose and throat sample from 160 healthy subjects, hospital staffs and inpatient in the city of Zabol (Amir Al-Momenin hospital, Zabol, south-eastern Iran were screened during years 2010-2011. In this study, the essential oil of Marrubium vulgare L. obtained by hydrodistillation was analyzed by gas chromatography coupled to mass spectrometry (GC-MS in order to determine their chemical composition. The minimum inhibitory concentrations were investigated to characterize the antimicrobial activities of this essential oil and extract. Results: Thirty-one components in the oil of Marrubium vulgare were identified. The results demonstrated that the major components of the essential oil were γ-Eudesmol (11%, Germacrene (10%, D-Citronelly formate (10%, β-Citronellol (8%, Geranyl tiglate (7.1%, Geranyl formate (6.02%. The least MIC value of extract M. vulgare was 2.5 mg/mL and the highest MIC value of essential oil M. vulgare was 2.5 mg/mL. Conclusion: This investigation showed that the M. vulgare essential oil and extract has a potent antimicrobial activity against S. aureus. The present studies confirm the use of this essential oil and extract as antibacterial agent. Further research is required to evaluate the practical values of therapeutic applications.
Directory of Open Access Journals (Sweden)
A. V. Toledo
Full Text Available Se investigó la ocurrencia natural del hongo entomopatógeno Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales en adultos de Delphacodes kuscheli Fennah y D. haywardi Muir (Hemiptera: Delphacidae, criados sobre Hordeum vulgare L. bajo condiciones de invernadero. Los insectos muertos, por una sospechada infección fúngica, fueron recolectados, esterilizados superficialmente, y examinados en el laboratorio. Conidiobolus coronatus fue aislado en cultivos puros, descrito morfológicamente y depositado en colecciones micológicas. Este trabajo presenta el primer registro de C. coronatus contra insectos perjudiciales en la Argentina.The natural occurrence of the entomopathogenic fungus Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales in adults of Delphacodes kuscheli Fennah and D. haywardi Muir (Hemiptera: Delphacidae, reared on Hordeum vulgare L. under greenhouse conditions, was investigated. Dead insects, suspected of fungal infection, were collected, surface sterilized, and examined in the laboratory. Conidiobolus coronatus was isolated in pure cultures, described morphologically, and deposited in mycological collections. This paper presents the first record of C. coronatus against harmful insects in Argentina.
DEFF Research Database (Denmark)
Thomsen, I.K.; Jensen, E.S.
1994-01-01
The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots re...... mineral fertilizer was in the second and third barley crop similar to the recovery of N from incorporated plant residues.......The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots...... receiving (NH4NO3)-N-15-N-15 were included. Plant samples were taken every second week until maturity during the first growing season and at maturity in the two following years. Incorporation of plant material had no significant influence on the above-ground dry matter yield of the barley. The barley...
Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)
DEFF Research Database (Denmark)
Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke
1986-01-01
The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...
Useful mutations in Iraqi black barley
International Nuclear Information System (INIS)
Ibrahim, I.F.
1989-01-01
Full text: Barley (Hordeum vulgare L.) is an important fodder crop in Iraq, with a cultivated area of about 1 392 375 ha and a total production of about 838500 t. The 2-row black barley ''LBB'' is the most desirable one in semi-arid zone in northern part of Iraq, because of its drought tolerance and high protein content. However, this cultivar is susceptible to powdery mildew, and lodges. Gamma rays and EMS were used to induce mutations in ''LBB'' and its hybrid with A rivat''. Nine mutants with improved lodging were selected during the first six generations. Five mutants INRC-BB-1, INRC-BB-3, INRC-BBR-4A, INRC-HB-552 and INRC-HB-553 were resistant to powdery mildew while 2 mutants INRC-BBH-1 and INRC-HBR-3 were moderately resistant. Two mutants INRC-BB-123 and INRC-HBR-3 were also resistant to drought under 350-400 mm rainfall. Three mutants INRC-BB-1, INRC-HBR-3 and INRC-HBR-88 exceeded their original variety in seed weight per spike and TKW. (author)
Exploitation of allelopathy for weed control in annual and perennial cropping systems.
Putnam, A R; Defrank, J; Barnes, J P
1983-08-01
A variety of crops, cultivars, and accessions have been evaluated over the past six years for superior capability to suppress weed growth. The most successful of these approaches has been to grow cover crops of rye (Secale cereale), wheat (Triticum aestivum), sorghum (Sorghum bicolor), or barley (Hordeum vulgare) to a height of 40-50 cm, desiccate the crops by contact herbicides or freezing, and allow their residues to remain on the soil surface. Often, up to 95% control of important agroecosystem weed species was obtained for a 30- to 60-day period following desiccation of the cover crop. The plant residues on the soil surface exhibit numerous physical and chemical attributes that contribute to weed suppression. Physical aspects include shading and reduced soil temperatures which were similarly achieved using poplar (Populus) excelsior as a control mulch. Chemical aspects apparently include direct release of toxins, as well as production of phytotoxic microbial products. Numerous chemicals appear to work in concert or in an additive or synergistic manner to reduce weed germination and growth.
Physiological effects and transport of 24-epibrassinolide in heat-stressed barley
Czech Academy of Sciences Publication Activity Database
Janeczko, A.; Oklešťková, Jana; Pociecha, E.; Koscielniak, J.; Mirek, M.
2011-01-01
Roč. 33, č. 4 (2011), s. 1249-1259 ISSN 0137-5881 R&D Projects: GA AV ČR IAA400550801; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Brassinosteroid transport * Dark respiration * Hordeum vulgare L * PSII efficiency * Metabolic activity Subject RIV: EF - Botanics Impact factor: 1.639, year: 2011
DEFF Research Database (Denmark)
Thomsen, Ingrid K; Pedersen, Asger R; Nyord, Tavs
2010-01-01
, and losses via N2O. Two field experiments were carried out on a loamy sand. Pig slurry was applied to established crops, i.e., to spring barley (Hordeum vulgare L.) in May 2007, and to winter wheat (Triticum aestivum L.) in April 2008. In 2007 the slurry was applied by direct injection using either winged...
Ridging in autumn as an alternative to mouldboard ploughing in a humid-temperate region
DEFF Research Database (Denmark)
Henriksen, Jens Christian Martin Bugge; Rasmussen, Jesper; Søgaard, Carsten
2006-01-01
and ploughing. Residue treatments were stubble, stubble + straw and stubble + liquid manure in order to create a gradient of C/N ratios. From the time of harvest until planting of a subsequent barley crop (Hordeum vulgare L.), inorganic N was determined 11 times in 1998–1999 and 10 times in 1999–2000 in the 0...
International Nuclear Information System (INIS)
Ramulu, K.S.
1980-01-01
The M 2 and M 3 plants derived from both fast neutron and X-ray treatments have been studied to detect and analyse reciprocal translocations in Arabidopsis thaliana (L.) Heynh. cv. Landsberg erecta (2n=10), Hordeum vulgare L. cv. Aramir (2n=14) and Secale cereale L., summer inbred line ZF9 (2n=14). (Auth.)
Czech Academy of Sciences Publication Activity Database
Efimova, N.V.; Vaňková, Radomíra; Kusnetsov, V.; Litvinovskaya, R. P.; Zlobin, Y.L.; Dobrev, Petre; Vedenicheva, N.P.; Savchuk, A. L.; Karnachuk, R. A.; Kudryakova, N.V.; Kuznetsov, V. D.
2017-01-01
Roč. 120, APR (2017), s. 32-40 ISSN 0039-128X Institutional support: RVO:61389030 Keywords : lupinus-luteus cotyledons * arabidopsis-thaliana * de-etiolation * abscisic-acid * brassinosteroid biosynthesis * plant development * hormonal balance * mutant * expression * growth * Brassinosteroids * Cytokinin * Gene expression * Green light * Hordeum vulgare * Transcription Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.282, year: 2016
Giles, Courtney D; Brown, Lawrie K; Adu, Michael O; Mezeli, Malika M; Sandral, Graeme A; Simpson, Richard J; Wendler, Renate; Shand, Charles A; Menezes-Blackburn, Daniel; Darch, Tegan; Stutter, Marc I; Lumsdon, David G; Zhang, Hao; Blackwell, Martin S A; Wearing, Catherine; Cooper, Patricia; Haygarth, Philip M; George, Timothy S
2017-02-01
Phosphorus (P) and nitrogen (N) use efficiency may be improved through increased biodiversity in agroecosystems. Phenotypic variation in plants' response to nutrient deficiency may influence positive complementarity in intercropping systems. A multicomponent screening approach was used to assess the influence of P supply and N source on the phenotypic plasticity of nutrient foraging traits in barley (H. vulgare L.) and legume species. Root morphology and exudation were determined in six plant nutrient treatments. A clear divergence in the response of barley and legumes to the nutrient treatments was observed. Root morphology varied most among legumes, whereas exudate citrate and phytase activity were most variable in barley. Changes in root morphology were minimized in plants provided with ammonium in comparison to nitrate but increased under P deficiency. Exudate phytase activity and pH varied with legume species, whereas citrate efflux, specific root length, and root diameter lengths were more variable among barley cultivars. Three legume species and four barley cultivars were identified as the most responsive to P deficiency and the most contrasting of the cultivars and species tested. Phenotypic response to nutrient availability may be a promising approach for the selection of plant combinations for minimal input cropping systems. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Manzoor A. Rather
2016-11-01
Full Text Available Foeniculum vulgare (Apiaceae commonly known as fennel is a well known and important medicinal and aromatic plant widely used as carminative, digestive, lactogogue and diuretic and in treating respiratory and gastrointestinal disorders. Its seeds are used as flavourings in baked goods, meat and fish dishes, ice cream, alcoholic beverages and herb mixtures. Phenols, phenolic glycosides and volatile aroma compounds such as trans-anethole, estragole and fenchone have been reported as the major phytoconstituents of this species. Different pharmacological experiments in a number of in vitro and in vivo models have convincingly demonstrated the ability of F. vulgare to exhibit antifungal, antibacterial, antioxidant, antithrombotic and hepatoprotective activities, lending support to the rationale behind several of its therapeutic uses. Phenolic compounds isolated from F. vulgare are considered to be responsible for its antioxidant activity while the volatile aroma compounds make it an excellent flavouring agent. The present review is an up-to-date and comprehensive analysis of the chemistry, pharmacology, traditional uses and safety of F. vulgare.
Relationships in the barley genus (Hordeum): An electrophoretic examination of proteins
DEFF Research Database (Denmark)
Bagger Jørgensen, Rikke
1986-01-01
The relationships between all known Hordeum species except H. guatemalense were inferred from the electrophoresis of the six enzyme systems Got, 6-Pgd, Mdh, Idh, .alpha.- and.beta.- amylases. A total of eleven loci were scored for in these systems. Maximum likelihood clusters and Wagner networks...
Han, Jigang; Lakshman, Dilip K; Galvez, Leny C; Mitra, Sharmila; Baenziger, Peter Stephen; Mitra, Amitava
2012-03-09
The development of plant gene transfer systems has allowed for the introgression of alien genes into plant genomes for novel disease control strategies, thus providing a mechanism for broadening the genetic resources available to plant breeders. Using the tools of plant genetic engineering, a broad-spectrum antimicrobial gene was tested for resistance against head blight caused by Fusarium graminearum Schwabe, a devastating disease of wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) that reduces both grain yield and quality. A construct containing a bovine lactoferrin cDNA was used to transform wheat using an Agrobacterium-mediated DNA transfer system to express this antimicrobial protein in transgenic wheat. Transformants were analyzed by Northern and Western blots to determine lactoferrin gene expression levels and were inoculated with the head blight disease fungus F. graminearum. Transgenic wheat showed a significant reduction of disease incidence caused by F. graminearum compared to control wheat plants. The level of resistance in the highly susceptible wheat cultivar Bobwhite was significantly higher in transgenic plants compared to control Bobwhite and two untransformed commercial wheat cultivars, susceptible Wheaton and tolerant ND 2710. Quantification of the expressed lactoferrin protein by ELISA in transgenic wheat indicated a positive correlation between the lactoferrin gene expression levels and the levels of disease resistance. Introgression of the lactoferrin gene into elite commercial wheat, barley and other susceptible cereals may enhance resistance to F. graminearum.
Velada, Isabel; Grzebelus, Dariusz; Lousa, Diana; M Soares, Cláudio; Santos Macedo, Elisete; Peixe, Augusto; Arnholdt-Schmitt, Birgit; G Cardoso, Hélia
2018-02-17
Propagation of some Olea europaea L. cultivars is strongly limited due to recalcitrant behavior in adventitious root formation by semi-hardwood cuttings. One example is the cultivar "Galega vulgar". The formation of adventitious roots is considered a morphological response to stress. Alternative oxidase (AOX) is the terminal oxidase of the alternative pathway of the plant mitochondrial electron transport chain. This enzyme is well known to be induced in response to several biotic and abiotic stress situations. This work aimed to characterize the alternative oxidase 1 (AOX1)-subfamily in olive and to analyze the expression of transcripts during the indole-3-butyric acid (IBA)-induced in vitro adventitious rooting (AR) process. OeAOX1a (acc. no. MF410318) and OeAOX1d (acc. no. MF410319) were identified, as well as different transcript variants for both genes which resulted from alternative polyadenylation events. A correlation between transcript accumulation of both OeAOX1a and OeAOX1d transcripts and the three distinct phases (induction, initiation, and expression) of the AR process in olive was observed. Olive AOX1 genes seem to be associated with the induction and development of adventitious roots in IBA-treated explants. A better understanding of the molecular mechanisms underlying the stimulus needed for the induction of adventitious roots may help to develop more targeted and effective rooting induction protocols in order to improve the rooting ability of difficult-to-root cultivars.
The genetics and mechanism of avoidance of rust infection in Hordeum chilense
Vaz Patto, M.C.
2001-01-01
Hordeum chilense is a perennial species occurring in Chile and Argentina. This wild barley species shows a very wide range of variation of morphological and agronomic characters and crosses easily with other members of the Triticeae
Directory of Open Access Journals (Sweden)
Ezio Riggi
2017-09-01
Full Text Available In the present study, a two-year field trial was carried out with the aim to evaluate daylength and air temperature effects on leaf appearance and related rates in two durum wheat (Triticum durum Desf., two bread wheat (Triticum aestivum L. and two barley (Hordeum vulgare L. cultivars, using six different sowing dates (SD. Significant effects of SD on final main stem leaf number (FLN, thermal leaf appearance rate (TLAR, daily leaf appearance rate (DLAR and phyllochron (PhL were found. Cultivars resulted inversely correlated to mean air temperature in the interval emergence - fifth leaf full expansion (E-V. Linear response of leaf number over days after sowing was shown for all SD and cultivars, with R2 higher than 0.95. FLN linearly decreased from the first to the last SD for durum wheat, while more variable behaviour was observed in bread wheat. TLAR and DLAR showed a linear increment of the rate from the first to the last SD in durum wheat, while did not for bread wheat and barley. PhL in durum wheat decreased from the first to the last SD. Barley and bread wheat showed the highest values on those SDs which did not reach flowering. The increase of TLAR was affected by photoperiod and photothermal units in durum wheat, while by temperatures only in barley and bread wheat. Present results might find practical application in the improvement of phenology simulation models for durum wheat, bread wheat and barley grown in Mediterranean area in absence of water and nutrient stress.
International Nuclear Information System (INIS)
Atanassov, A.; Todorovska, E.; Trifonova, A.; Petrova, M.; Marinova, E.; Gramatikova, M.; Valcheva, D.; Zaprianov, S.; Mersinkov, N.
1998-01-01
Barley, Hordeum vulgare L., is one of the most important crop species for Bulgaria. The characterisation of the genetic pool is of great necessity for the Bulgarian barley breeding programme which is directed toward improving quantitative and qualitative traits. Molecular markers [protein, restriction fragment length polymorphisms (RFLP) and randomly amplified polymorphic DNA (RAPD)] have been applied to characterise the Bulgarian barley cultivars and their regenerants. The changes in DNA loci coding for 26S, 5.8S and 18S rRNA repeats, C hordein locus and mitochondrial DNA organisation have been investigated. The potential for ribosomal DNA length polymorphism in Bulgarian barley cultivars appear to be limited to three different repeat lengths (10.2, 9.5 and 9.0kb) and three plant rDNA phenotypes. Polymorphism was not observed in ribosomal DNA repeat units in somaclonal variants. Variation concerning C hordein electrophoretic pattern was observed in one line from cultivar Jubiley. Analysis of the HorI locus reveals RFLPs in sequences coding for C hordeins in this line. Mitochondrial molecular markers are convenient for detection of DNA polymorphisms in the variant germplasm as well as for the somaclonal variants derived from it. Two lines from Ruen revealed polymorphic bands after hybridisation with mitochondrial DNA probe. RAPD assays have been carried out by using 20 different 10-mer primers. Heritable polymorphism in several tissue culture derived (TCD) lines was observed. RAPD assay is a sensitive and representative approach to distinguish the variability created by tissue culture and mutagenesis
Environmental adaptibility of tansy ( Tanacetum vulgare L ...
African Journals Online (AJOL)
Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for laboratory research ...
Environmental adaptibility of tansy (Tanacetum vulgare L.)
African Journals Online (AJOL)
STORAGESEVER
2009-11-16
Nov 16, 2009 ... Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for.
Faleiro, Leonor; Miguel, Graça; Gomes, Sónia; Costa, Ludmila; Venâncio, Florencia; Teixeira, Adriano; Figueiredo, A Cristina; Barroso, José G; Pedro, Luis G
2005-10-19
Antilisterial activities of Thymbra capitata and Origanum vulgare essential oils were tested against 41 strains of Listeria monocytogenes. The oil of T. capitata was mainly constituted by one component, carvacrol (79%), whereas for O. vulgare three components constituted 70% of the oil, namely, thymol (33%), gamma-terpinene (26%), and p-cymene (11%). T. capitata essential oil had a significantly higher antilisterial activity in comparison to O. vulgare oil and chloramphenicol. No significant differences in L. monocytogenes susceptibilities to the essential oils tested were registered. The minimum inhibitory concentration values of T. capitata essential oil and of carvacrol were quite similar, ranging between 0.05 and 0.2 microL/mL. Antioxidant activity was also tested, the essential oil of T. capitata showing significantly higher antioxidant activity than that of O. vulgare. Use of T. capitata and O. vulgare essential oils can constitute a powerful tool in the control of L. monocytogenes in food and other industries.
DNA replication after mutagenic treatment in Hordeum vulgare.
Kwasniewska, Jolanta; Kus, Arita; Swoboda, Monika; Braszewska-Zalewska, Agnieszka
2016-12-01
The temporal and spatial properties of DNA replication in plants related to DNA damage and mutagenesis is poorly understood. Experiments were carried out to explore the relationships between DNA replication, chromatin structure and DNA damage in nuclei from barley root tips. We quantitavely analysed the topological organisation of replication foci using pulse EdU labelling during the S phase and its relationship with the DNA damage induced by mutagenic treatment with maleic hydrazide (MH), nitroso-N-methyl-urea (MNU) and gamma ray. Treatment with mutagens did not change the characteristic S-phase patterns in the nuclei; however, the frequencies of the S-phase-labelled cells after treatment differed from those observed in the control cells. The analyses of DNA replication in barley nuclei were extended to the micronuclei induced by mutagens. Replication in the chromatin of the micronuclei was rare. The results of simultanous TUNEL reaction to identify cells with DNA strand breaks and the labelling of the S-phase cells with EdU revealed the possibility of DNA replication occurring in damaged nuclei. For the first time, the intensity of EdU fluorescence to study the rate of DNA replication was analysed. Copyright © 2016 Elsevier B.V. All rights reserved.
Coupling amplified DNA from flow-sorted chromosomes to high-density SNP mapping in barley
Czech Academy of Sciences Publication Activity Database
Šimková, Hana; Svensson, J.T.; Condamine, P.; Hřibová, Eva; Suchánková, Pavla; Bhat, P.R.; Bartoš, Jan; Šafář, Jan; Close, T.J.; Doležel, Jaroslav
2008-01-01
Roč. 9, č. 294 (2008), s. 1-9 ISSN 1471-2164 R&D Projects: GA ČR GD521/05/H013; GA MŠk ME 884; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : Flow cytometry * DNA amplification * Hordeum vulgare L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.926, year: 2008
Czech Academy of Sciences Publication Activity Database
Rayapuram, C.; Hemzalová, Vendula; Lyngkjaer, M. E.
2011-01-01
Roč. 93, č. 3 (2011), s. 613-625 ISSN 1125-4653 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blumeria graminis f. sp hordei * Hordeum vulgare * hypersensitive response Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.912, year: 2011 http://sipav.org/main/jpp/index.php/jpp/article/view/1229
Radiation induced early maturing mutants in barley
International Nuclear Information System (INIS)
Kumar, R.; Chauhan, S.V.S.; Sharma, R.P.
1978-01-01
In M 2 generation, two early maturing plants were screened from a single spike progeny of a plant obtained from 20 kR of gamma-ray irradiation of a six-rowed barley (Hordeum vulgare L. var. Jyoti). Their true breeding nature was confirmed in M 3 generation. These mutants flower and mature 38 and 22 days earlier than those of control. (auth.)
Boroomand, Naser; Maleki, Mohammad Reza
2010-05-01
Compared to other cereals, such as wheat and barley cultivars which have low sensitivity to Zn deficiency, cowpea is sensitive to zinc (Zn) deficiency, however it extensively grows even in soils with deficient in Zn. A 8-week greenhouse experiment was conducted to study the response of cowpea and barely to Zn in calcareous soils with different DTPA- Zn. The soil samples were taken from soil surface up to 0.3 m in which their DTPA- Zn ranged from 0.5 to 3.5 mg kg-1. Shoot dry matter, concentration and uptake of Zn were found to be significantly correlated with soil DTPA- Zn in cowpea and barely. Critical deficiency level of Zn in cowpea was 1.3 mg kg-1 in soil and 28.5 mg kg-1 in shoot dry matter, however, to barely symptoms of Zn deficiency was not observed and concentration of Zn was higher than the critical level reported in literatures. Organic carbon (OC), calcium carbonate equivalent (CCE), pH and field capacity soil moisture content(FC) were significantly correlated with plant responses to Zn which were the most influenced characteristics to Zn uptake by plants.
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Sorghum vulgare 名詞 一般 * * * * モロコ...シ モロコシ モロコシ Thesaurus2015 200906063836088318 C LS06/LS72 UNKNOWN_2 Sorghum vulgare
Omslaget - hvid okseøje (Leucanthemum vulgare)
DEFF Research Database (Denmark)
Friis, Ib
2010-01-01
Artiklen redergør for den historiske baggrund for den illustration (tavle 994 fra Flora Danica, udgivet i 1790) af hvid okseøje (Leucanthemum vulgare), der er anvendt som illustration på festskriftets omslag. De illustratorer, der blev anvendt af Martin Vahl, udgiver af Flora Danica da tavle 994...
Foderstater för ökad konsumtion av vallfoder
DEFF Research Database (Denmark)
Hetta, M.; Lund, Peter; Tahir, M.N.
2011-01-01
nedbrytningen från våmmen till tunntarmen. Nedbrytning av stärkelse i tunntarmen leder till högre energieffektivitet i ämnesomsättningen. Stärkelse hos korn (Hordeum Vulgare, L) anses i litteraturen ha en snabb omsättning i våmmen och stärkelse hos majs (Zea Mays, L) anses ha en långsam nedbrytning (Mills et al...
Toxicities of TNT and RDX to Terrestrial Plants in Five Soils with Contrasting Characteristics
2013-07-01
lettuce ( Lactuca sativa (L.)) and barley (Hordeum vulgare (L.)), respectively, at analytically determined soil concentrations up to and including 3320... sativa L.), Japanese millet (J. millet; Echinochloa crus-galli L. [Beauv.]), and perennial ryegrass (Lolium perenne L.) in five natural soils that...of the test. The test species in these studies were Medicago sativa (L.) var. Canada no. 1 (alfalfa), Echinochloa crus-galli (L.) P. Beauv. var
The Phytotoxicity of Designated Pollutants on Plant Species
1984-03-01
Only seeds collected from those flowers exposed during pollin 20. DISTRIBUTION/AVAILABILITY OF ABSTRACT 21. ABSTRACT SECURITY CLASSIFICATION...acid exposure during pollination lowered the germination rate of mature seeds. Plant injury was chiefly a function of acid concentration, but amount...TESTS Species Name Variety Barley Hordeum vulgare L. CM67 Bean Phaseolus vulgaris L. Pinto Citrus Citrus limon (L.) Lupe Lemon Lettuce Lactuca sativa
DEFF Research Database (Denmark)
Christensen, Jesper Bjerg; Dionisio, Giuseppe; Poulsen, Hanne Damgaard
2014-01-01
.3. Solubilized and degraded proteins evaluated by biuret, SDS-PAGE, and differential proteomics revealed that pH 4.3 had the greatest impact on both solubilization and degradation. In order to boost proteolysis, the recombinant barley endoprotease B2 (rec-HvEP-B2) was included after 8 h using the pH 4.3 regime......Nonfermented soaking of barley feedstuff has been established as an in vitro procedure prior to the feeding of pigs as it can increase protein digestibility. In the current study, two feed cultivars of barley (Finlissa and Zephyr) were soaked in vitro either nonbuffered or buffered at pH 3.6 and 4....... Proteolysis evaluated by SDS-PAGE and differential proteomics confirmed a powerful effect of adding rec-HvEP-B2 to the soaked barley, regardless of the genotype. Our study addresses the use of rec-HvEP-B2 as an effective feed enzyme protease. HvEP-B2 has the potential to increase the digestibility of protein...
Directory of Open Access Journals (Sweden)
Jonathan Brassac
Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.
Antibacterial activity of whole plant extract of Marrubium vulgare
African Journals Online (AJOL)
SERVER
2007-11-26
Nov 26, 2007 ... Key words: Disc diffusion, antibacterial activity, Marrubium vulgare. INTRODUCTION .... Glossary of Indian Medicinal. Plants, CSIR, V ed. ... 22. E. coli MTCC 443. 0. 0. 0. 10. 15. 400. 25. P. vulgaris MTCC 426. 0. 0. 0. 11. 16.
Directory of Open Access Journals (Sweden)
Shamkant B. Badgujar
2014-01-01
Full Text Available Foeniculum vulgare Mill commonly called fennel has been used in traditional medicine for a wide range of ailments related to digestive, endocrine, reproductive, and respiratory systems. Additionally, it is also used as a galactagogue agent for lactating mothers. The review aims to gather the fragmented information available in the literature regarding morphology, ethnomedicinal applications, phytochemistry, pharmacology, and toxicology of Foeniculum vulgare. It also compiles available scientific evidence for the ethnobotanical claims and to identify gaps required to be filled by future research. Findings based on their traditional uses and scientific evaluation indicates that Foeniculum vulgare remains to be the most widely used herbal plant. It has been used for more than forty types of disorders. Phytochemical studies have shown the presence of numerous valuable compounds, such as volatile compounds, flavonoids, phenolic compounds, fatty acids, and amino acids. Compiled data indicate their efficacy in several in vitro and in vivo pharmacological properties such as antimicrobial, antiviral, anti-inflammatory, antimutagenic, antinociceptive, antipyretic, antispasmodic, antithrombotic, apoptotic, cardiovascular, chemomodulatory, antitumor, hepatoprotective, hypoglycemic, hypolipidemic, and memory enhancing property. Foeniculum vulgare has emerged as a good source of traditional medicine and it provides a noteworthy basis in pharmaceutical biology for the development/formulation of new drugs and future clinical uses.
Lipoic acid and redox status in barley plants subjected to salinity and elevated CO{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Perez-Lopez, U.; Robredo, A.; Mena-Petite, A.; Munoz-Rueda, A. (Univ. del Pais Vasco/EHU, Dept. de Biologia Vegetal y Ecologia, Bilbao (Spain)); Lacuesta, M. (Univ. del Pais Vasco/EHU, Dept. de Biologia Vegetal y Ecologia, Vitoria-Gasteiz (Spain)); Sgherri, C.; Navari-Izzo, F. (Univ. di Pisa, Dipartimento di Chimica e Biotecnologie Agrarie, Pisa (Italy))
2010-02-15
Future environmental conditions will include elevated concentrations of salt in the soil and an elevated concentration of CO{sub 2}in the atmosphere. Because these environmental changes will likely affect reactive oxygen species (ROS) formation and cellular antioxidant metabolism in opposite ways, we analyzed changes in cellular H{sub 2}O{sub 2} and non-enzymatic antioxidant metabolite [lipoic acid (LA), ascorbate (ASA), glutathione (GSH)] content induced by salt stress (0, 80, 160 or 240 mM NaCl) under ambient (350 mumol mol-1) or elevated (700 mumol mol-1) CO{sub 2}concentrations in two barley cultivars (Hordeum vulgare L.) that differ in sensitivity to salinity (cv. Alpha is more sensitive than cv. Iranis). Under non-salinized conditions, elevated CO{sub 2}increased LA content, while ASA and GSH content decreased. Under salinized conditions and ambient CO{sub 2}, ASA increased, while GSH and LA decreased. At 240 mM NaCl, H{sub 2}O{sub 2} increased in Alpha and decreased in Iranis. When salt stress was imposed at elevated CO{sub 2}, less oxidative stress and lower increases in ASA were detected, while LA was constitutively higher. The decrease in oxidative stress could have been because of less ROS formation or to a higher constitutive LA level, which might have improved regulation of ASA and GSH reductions. Iranis had a greater capacity to synthesize ASA de novo and had higher constitutive LA content than did Alpha. Therefore, we conclude that elevated CO{sub 2}protects barley cultivars against oxidative damage. However, the magnitude of the positive effect is cultivar specific. (author)
International Nuclear Information System (INIS)
Gomez, L.; Aldaba, G.; Yarango, D.; Argumedo, K.; Ibannez, N.; Falconi, J.
2015-01-01
In Peru it is very important to increase the food production in amount and quality, especially in the rural areas where a high poverty and malnutrition problems are usually founded. Mutation induction method is used to improve well adapted cultivars, thru the upgraded in one or two changed characteristics, retaining all its original attributes. Quinoa (Chenopodium quinoa), accession LM 89, was treated with gamma rays at the doses 150 and 250 Gray. In M 2 and following generations mutation in morphological traits were observed and 8 mutant lines were selected among them MQLM89-149 with higher yield equal to 4258.6 Kg/ha, surpassing the witness at 205.63% and MQLM89-42 with 14.7 of grain protein, superior to the parent material with 12.3%. Kiwicha (Amaranthus caudatus) CICA- UNASAC cultivar was irradiated with gamma ray (400 and 600 Gray). Mutations of morphological and physiological characteristics were identified and nine mutant lines with 27 to 50% better yield potential than the parent material were selected. In barley (Hordeum vulgare) mutant lines were developed from the cultivar UNALM 96, through the application of gamma rays at a dose of 200 and 300 Gray. Mutant lines were selected a M 8 generation with higher agronomic performance and nutritive quality adapted to the highland with grain yield within the range of 5100 - 8731 kg/ha, over the value of the parent material with of 4246 kg/ha and had improvement in the content of P-131 mg/g DW, Zn66 mg/g DW, Mn55 mg/g DW, Fe57 mg/g DW and Cu63 ug/g DW. (Author)
Bouton, Joseph H; Wood, Donald T
2012-11-27
A switchgrass cultivar designated EG1101 is disclosed. Also disclosed are seeds of switchgrass cultivar EG1101, plants of switchgrass EG1101, plant parts of switchgrass cultivar EG1101 and methods for producing a switchgrass plant produced by crossing switchgrass cultivar EG1101 with itself or with another switchgrass variety. Methods are also described for producing a switchgrass plant containing in its genetic material one or more transgenes and to the transgenic switchgrass plants and plant parts produced by those methods. Switchgrass cultivars or breeding cultivars and plant parts derived from switchgrass variety EG1101, methods for producing other switchgrass cultivars, lines or plant parts derived from switchgrass cultivar EG1101 and the switchgrass plants, varieties, and their parts derived from use of those methods are described herein. Hybrid switchgrass seeds, plants and plant parts produced by crossing the cultivar EG1101 with another switchgrass cultivar are also described.
Directory of Open Access Journals (Sweden)
Han Jigang
2012-03-01
Full Text Available Abstract Background The development of plant gene transfer systems has allowed for the introgression of alien genes into plant genomes for novel disease control strategies, thus providing a mechanism for broadening the genetic resources available to plant breeders. Using the tools of plant genetic engineering, a broad-spectrum antimicrobial gene was tested for resistance against head blight caused by Fusarium graminearum Schwabe, a devastating disease of wheat (Triticum aestivum L. and barley (Hordeum vulgare L. that reduces both grain yield and quality. Results A construct containing a bovine lactoferrin cDNA was used to transform wheat using an Agrobacterium-mediated DNA transfer system to express this antimicrobial protein in transgenic wheat. Transformants were analyzed by Northern and Western blots to determine lactoferrin gene expression levels and were inoculated with the head blight disease fungus F. graminearum. Transgenic wheat showed a significant reduction of disease incidence caused by F. graminearum compared to control wheat plants. The level of resistance in the highly susceptible wheat cultivar Bobwhite was significantly higher in transgenic plants compared to control Bobwhite and two untransformed commercial wheat cultivars, susceptible Wheaton and tolerant ND 2710. Quantification of the expressed lactoferrin protein by ELISA in transgenic wheat indicated a positive correlation between the lactoferrin gene expression levels and the levels of disease resistance. Conclusions Introgression of the lactoferrin gene into elite commercial wheat, barley and other susceptible cereals may enhance resistance to F. graminearum.
Effect of dietary oregano ( Origanum vulgare L.) essential oil on ...
African Journals Online (AJOL)
Effect of dietary oregano ( Origanum vulgare L.) essential oil on growth performance, cecal microflora and serum antioxidant activity of broiler chickens. ... promoting effects and also displayed potent antibacterial effects against cecal E. coli.
Bouton, Joseph H; Wood, Donald T
2012-11-20
A switchgrass cultivar designated EG1102 is disclosed. The invention relates to the seeds of switchgrass cultivar EG1102, to the plants of switchgrass EG1102, to plant parts of switchgrass cultivar EG1102 and to methods for producing a switchgrass plant produced by crossing switchgrass cultivar EG1102 with itself or with another switchgrass variety. The invention also relates to methods for producing a switchgrass plant containing in its genetic material one or more transgenes and to the transgenic switchgrass plants and plant parts produced by those methods. This invention also relates to switchgrass cultivars or breeding cultivars and plant parts derived from switchgrass variety EG1102, to methods for producing other switchgrass cultivars, lines or plant parts derived from switchgrass cultivar EG1102 and to the switchgrass plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid switchgrass seeds, plants and plant parts produced by crossing the cultivar EG1102 with another switchgrass cultivar.
Directory of Open Access Journals (Sweden)
Stefan Reuscher
Full Text Available The concentrations of both essential nutrients and chemically similar toxic analogues accumulated in cereal grains have a major impact on the nutritional quality and safety of crops. Naturally occurring genetic diversity can be exploited for the breeding of improved varieties through introgression lines (ILs. In this study, multi-element analysis was conducted on vegetative leaves, senesced flag leaves and mature grains of a set of 54 ILs of the wild ancestral Hordeum vulgare ssp. spontaneum in the cultivated variety Hordeum vulgare ssp. vulgare cv. Scarlett. Plants were cultivated on an anthropogenically heavy metal-contaminated soil collected in an agricultural field, thus allowing simultaneous localization of quantitative trait loci (QTL for the accumulation of both essential nutrients and toxic trace elements in barley as a model cereal crop. For accumulation of the micronutrients Fe and Zn and the interfering toxin Cd, we identified 25, 16 and 5 QTL, respectively. By examining the gene content of the introgressions, we associated QTL with candidate genes based on homology to known metal homeostasis genes of Arabidopsis and rice. Global comparative analyses suggested the preferential remobilization of Cu and Fe, over Cd, from the flag leaf to developing grains. Our data identifies grain micronutrient filling as a regulated and nutrient-specific process, which operates differently from vegetative micronutrient homoeostasis. In summary, this study provides novel QTL for micronutrient accumulation in the presence of toxic analogues and supports a higher degree of metal specificity of trace element partitioning during grain filling in barley than previously reported for other cereals.
Czech Academy of Sciences Publication Activity Database
Štroch, Michal; Materová, Z.; Vrábl, D.; Karlický, Václav; Šigut, Ladislav; Nezval, J.; Špunda, Vladimír
2015-01-01
Roč. 96, nov (2015), s. 90-96 ISSN 0981-9428 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LM2010007 Grant - others:EHP(CZ) EHP-CZ02-OV-1-014-2014 Program:CZ02 Institutional support: RVO:67179843 Keywords : barley (Hordeum vulgare L.) * chlorophyll fluorescence * photosynthesis * photosynthetic pigments * UV-A radiation * UV-B radiation Subject RIV: BO - Biophysics Impact factor: 2.928, year: 2015
The Effects of Designated Pollutants on Plants
1978-11-01
Persea americana Mill. Haas and Bacon Barley Hordeum vulgare L. CM 67 Bean Phaseolus vulgaris L. Pinto, U.I. III Briza Briza maxima L. Ornamental...Tagetes patula L. French dwarf double goldie Marigold Tagetes erecta L. American ,Senator Dirksen Petunia Petunia hybrida Vilm. White cascade Radish...Probit analysis of five plant species: citrus seedlings, lemon, orange,, grape, French marigold, American marigold. Probit scale is the probability that a
Green Fodder Production and Water Use Efficiency of Some Forage Crops under Hydroponic Conditions
Ghazi N. Al-Karaki; M. Al-Hashimi
2012-01-01
The objectives of this study were to evaluate five forage crops (alfalfa (Medicago sativa), barley (Hordeum vulgare), cowpea (Vigna unguiculata), sorghum (Sorghum bicolor), and wheat (Triticum aestivum)) for green fodder production and water use efficiency under hydroponic conditions. The experiment has been conducted under temperature-controlled conditions (24 ± 1°C) and natural window illumination at growth room of Soilless Culture Laboratory, Arabian Gulf University, Manama, Bahrain. The r...
Begnini, Karine Rech; Nedel, Fernanda; Lund, Rafael Guerra; Carvalho, Pedro Henrique de Azambuja; Rodrigues, Maria Regina Alves; Beira, Fátima Tereza Alves; Del-Pino, Francisco Augusto Burkert
2014-10-01
Cancer is a leading cause of death and is responsible for one in eight deaths worldwide. The use of herbs as complementary medicine for cancer, especially advanced cancer, has recently increased. The aim of this study was to evaluate in vitro, the antiproliferative effect of Origanum vulgare against human breast adenocarcinoma (MCF-7), and human colon adenocarcinoma (HT-29). The essential oil (EO) was extracted from a bought amount of O. vulgare dried leaves and analyzed in a gas chromatograph interfaced with a mass selective detector. The cytotoxicity test was performed by sulforhodamine B assay. The results show that the EO is composed mostly of 4-terpineol and induces a high cytotoxicity effect in HT-29. In the MCF-7 cell line the EO was less effective. In conclusion, this study showed that O. vulgare main component is 4-terpineol and was effective in inducing cancer cell growth inhibition.
Directory of Open Access Journals (Sweden)
Néstor Orrala B
2015-10-01
Full Text Available En la península de Santa Elena de mayo a diciembre, las temperaturas giran alrededor de 22 ºC, , lo que podría ser un medio adecuado para muchos cultivos andinos. El estudio exploratorio tuvo como objetivo verificar el comportamiento agronómico de variedades de cebada: Terán, Cañicapa 03, Clipper , Grit, Metcalfe y Scarlett en tres ambientes de la provincia de Santa Elena. Variables evaluadas: germinación, ahijamiento, encañado, espigado, maduración, altura de planta, número de macollos, longitud de espiga, cantidad de granos llenos y vanos, peso 1 000 semillas, rendimiento por hectárea, más análisis económico. Los resultados concluyen que las etapas fenológicas son más cortas en la Costa que en la Sierra, pudiéndose afirmar que el ciclo vegetativo de los germoplasmas está determinado por la interacción genotipo-ambiente y por las características varietales de cada cultivar. Las variedades Metcalfe, Scarlett y Clipper alcanzan rendimientos entre 3,55 y 4,35 toneladas por hectárea. El costo de producción por hectárea es mayor con relación a la sierra, lo que se explica en el mayor uso del recurso agua.Palabras claves: Cebada, comportamiento, variedades, épocas, adaptación.
Souza,Evandro Leite de; Stamford,Tânia Lúcia Montenegro; Lima,Edeltrudes de Oliveira
2006-01-01
Origanum vulgare L. (oregano), Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growt...
108-110 Registration of Guta Barley (Hordeium vulgare L.)
African Journals Online (AJOL)
adoption potential by the local farmers. Keywords: Guta; Barley (Hordeium vulgare L); Yield ... evaluated along with Aruso and Shage as the local and standard variety, respectively at altitudinal range of 2400- ... 6. Farmers Evaluation of the Variety. To evaluate the perception and preferences of the local farmers, farmers' ...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...
Indian Academy of Sciences (India)
SDS-PAGE was performed to separate the extracted pro- teins by using 12% separating and 5% stacking gels with a. Mini Protean System from Bio-Rad according to Laemmli modified method (Laemmli 1970). In this study, we adopted constant current electrophoresis instead of constant voltage. The loading of sample was ...
Radiosensitivities of cultured barley of different type (Hordeum vulgare)
International Nuclear Information System (INIS)
Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan
1990-01-01
The dormant seeds (with 13% moisture) of 47 barley varieties were irradiated with various doses (0-40 krad) of 137 Cs γ-rays. The radiosensitivities of naked barley was significantly higher than that of hulled barley. The sensitive coefficients of seedling height were 0.04945 and 0.03667 for naked barley and hulled barley, respectively. The radiosensitivity of four-row naked barley was significantly higher than that of two-row hulled barley and six-row hulled barley. 47 varieties studied could be divided into five types with different radiosensitivities, i.e. extreme resistant, resistant, intermediate, sensitive and extreme sensitive. It was also found that the dose-effect curves of cell nucleus volume had a peal at 30 krad
Lysine-Rich Proteins in High-Lysine Hordeum Vulgare Grain
DEFF Research Database (Denmark)
Ingversen, J.; Køie, B.
1973-01-01
The salt-soluble proteins in barley grain selected for high-lysine content (Hiproly, CI 7115 and the mutants 29 and 86) and of a control (Carlsberg II) with normal lysine content, contain identical major proteins as determined by MW and electrophoretic mobility. The concentration of a protein gro...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...
Indian Academy of Sciences (India)
its nutritional value and low glycemic index (Ullrich 2011). Lebanon belongs to the ... Rim Mzid and Farhat Chibani contributed equally to this work. biochemical accomplished ..... environment interaction of hordein content. J. Cereal Sci. 34,.
Latent manganese deficiency increases transpiration in barley (Hordeum vulgare).
Hebbern, Christopher A; Laursen, Kristian Holst; Ladegaard, Anne H; Schmidt, Sidsel B; Pedas, Pai; Bruhn, Dan; Schjoerring, Jan K; Wulfsohn, Dvoralai; Husted, Søren
2009-03-01
To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements revealed that the quantum yield efficiency of PSII (F(v)/F(m)) was reduced from 0.83 in Mn-sufficient control plants to below 0.5 in Mn-starved plants. Leaf Mn concentrations declined from 30 to 7 microg Mn g(-1) dry weight in control and Mn-starved plants, respectively. Mn-starved plants had up to four-fold higher transpiration than control plants. Stomatal closure and opening upon light/dark transitions took place at the same rate in both Mn treatments, but the nocturnal leaf conductance for water vapour was still twice as high in Mn-starved plants compared with the control. The observed increase in transpiration was substantiated by (13)C-isotope discrimination analysis and gravimetric measurement of the water consumption, showing significantly lower water use efficiency in Mn-starved plants. The extractable wax content of leaves of Mn-starved plants was approximately 40% lower than that in control plants, and it is concluded that the increased leaf conductance and higher transpirational water loss are correlated with a reduction in the epicuticular wax layer under Mn deficiency.
International Nuclear Information System (INIS)
Bansal, Y.K.; Sen, Sumitra
1987-01-01
Rate of replication and transcription between normal and giant endopolyploid nuclei of differentiated tissue of Hordeum vulgare L. (2n=14) roots and Phlox drummondii Hook. (2n=14) and Zea mays L. (2n=20) endosperms were studied by labelling experiments with tritiated thymidine and uridine. The incorporation of thymidine and uridine was identical in both diploid and giant endopolyploid nuclei of the roots of H. vulgare. The endosperm cells of P. drummondii and Z. mays, however, exhibit markedly different labelling pattern in normal (i.e. triploid) and endopolyploid nuclei where both replication and transcription were rather high. The nutritive function of the endosperm is probably responsible for this high degree of activity. (author). 14 refs., 10 figs., 3 tables
Genetic diversity among wild and cultivated barley as revealed by RFLP
DEFF Research Database (Denmark)
Petersen, L.; Østergård, H.; Giese, H.
1994-01-01
Genetic variability of cultivated and wild barley, Hordeum vulgare ssp. vulgare and spontaneum, respectively, was assessed by RFLP analysis. The material consisted of 13 European varietes, single-plant offspring lines of eight land races from Ethiopia and Nepal, and five accessions of ssp. sponta...... an intermediate level. The proportion of gene diversity residing among,geographical groups (F-ST) varied from 0.19 to 0.94 (average 0.54) per RFLP pattern, indicating large diversification between geographical groups....... was estimated and the barley lines clustered into five groups reflecting geographical origin. The geographical groups of land-race lines showed less intragroup variation than the geographical groups of spontaneum lines. The group of European varieties, representing large variation in agronomic traits, showed...
Koleva, Vanya; Dragoeva, Asya; Stoyanova, Zheni; Yordanova, Zhenia; Ali, Selime; Uzunov, Nikolay M.; Melendez-Alafort, Laura; Rosato, Antonio; Enchev, Dobromir D.
2018-03-01
Medicinal plants produce various secondary metabolites as a part of their chemical defence and survival in nature. These compounds have a wide range of biological activities. Nowadays, medicinal plants are used as source of allelochemicals and new effective anticancer agents. Our previous studies revealed allelopathic potential of water extracts of Adonis vernalis L. (Ranunculaceae), Origanum vulgare ssp. vulgare L. and Nepeta nuda subsp. nuda (Lamiaceae). Present study aimed to evaluate the effect of the same extracts in vitro on human hepatoma cell line SK-HEP-1. Cell proliferation/viability was assessed using Premixed WST-1 Cell Proliferation Reagent. Adonis water extract (1.83mg/ml) had notable negative influence on cancer cell line tested. Oregano (3.5 mg/ml) also exerted negative effect, but to a lesser degree. On the contrary, nepeta water extract (6.59 mg/ml) had an opposite effect, stimulating cell proliferation. One possible explanation could be the type of extraction: after treatment with nepeta methanol extract (6.59 mg/ml) cell viability was significantly reduced. In conclusion, Adonis vernalis and Nepeta nuda subsp. nuda possess metabolites with growth inhibitory effect on human hepatoma cell line SK-HEP-1. Further research is needed to clarify biological activity of lower concentrations which are appropriate to enable the design of new anticancer drugs.
DEFF Research Database (Denmark)
Giese, Nanna Henriette; Hejgaard, Jørn
1984-01-01
The accumulation of salt-soluble proteins in the endosperm of developing barley (Hordeum vulgare L.) grains was examined. Detached spikes of barley were cultured at different levels of nitrogen nutrition and pulse-labeled with [14C] sucrose at specific times after anthesis. Proteins were extracted...... to increased nitrogen nutrition. Two major components, β-amylase and protein Z in particular, had a synthesis profile almost identical to that of the endosperm storage protein, hordein....
Vulgarization of popular music tradition in Serbia
Božilović, Nikola
2011-01-01
The vulgarization of tradition in this paper implies the alteration, false representation, and adaptation of tradition in line with the interests of certain individuals or groups in power. The author observes popular music in Serbia (jazz, pop, rock) under a sociological magnifying glass, attempting to explain and motivate the thesis which proposes a valid historical foundation of popular culture and music in the social life of Serbia. In his opinion, this kind of tradition is being 'swept un...
DEFF Research Database (Denmark)
Larsen, Bjarne; Pedersen, Carsten; Ørgaard, Marian
2017-01-01
Abstract We made a genetic analysis of about 500 apple cultivars, which either originate from Denmark or have been of greater importance in Denmark. To study the diversity and parentage among the cultivars, 15 SSR markers were used. A new PCR-based protocol for identification of S-alleles was dev......Abstract We made a genetic analysis of about 500 apple cultivars, which either originate from Denmark or have been of greater importance in Denmark. To study the diversity and parentage among the cultivars, 15 SSR markers were used. A new PCR-based protocol for identification of S...
Mitogen-Activated Protein Kinase Kinase 3 Regulates Seed Dormancy in Barley.
Nakamura, Shingo; Pourkheirandish, Mohammad; Morishige, Hiromi; Kubo, Yuta; Nakamura, Masako; Ichimura, Kazuya; Seo, Shigemi; Kanamori, Hiroyuki; Wu, Jianzhong; Ando, Tsuyu; Hensel, Goetz; Sameri, Mohammad; Stein, Nils; Sato, Kazuhiro; Matsumoto, Takashi; Yano, Masahiro; Komatsuda, Takao
2016-03-21
Seed dormancy has fundamental importance in plant survival and crop production; however, the mechanisms regulating dormancy remain unclear [1-3]. Seed dormancy levels generally decrease during domestication to ensure that crops successfully germinate in the field. However, reduction of seed dormancy can cause devastating losses in cereals like wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) due to pre-harvest sprouting, the germination of mature seed (grain) on the mother plant when rain occurs before harvest. Understanding the mechanisms of dormancy can facilitate breeding of crop varieties with the appropriate levels of seed dormancy [4-8]. Barley is a model crop [9, 10] and has two major seed dormancy quantitative trait loci (QTLs), SD1 and SD2, on chromosome 5H [11-19]. We detected a QTL designated Qsd2-AK at SD2 as the single major determinant explaining the difference in seed dormancy between the dormant cultivar "Azumamugi" (Az) and the non-dormant cultivar "Kanto Nakate Gold" (KNG). Using map-based cloning, we identified the causal gene for Qsd2-AK as Mitogen-activated Protein Kinase Kinase 3 (MKK3). The dormant Az allele of MKK3 is recessive; the N260T substitution in this allele decreases MKK3 kinase activity and appears to be causal for Qsd2-AK. The N260T substitution occurred in the immediate ancestor allele of the dormant allele, and the established dormant allele became prevalent in barley cultivars grown in East Asia, where the rainy season and harvest season often overlap. Our findings show fine-tuning of seed dormancy during domestication and provide key information for improving pre-harvest sprouting tolerance in barley and wheat. Copyright © 2016 Elsevier Ltd. All rights reserved.
Lin, Y S; Kuan, C S; Weng, I S; Tsai, C C
2015-11-25
The genetic relationships among 27 pineapple [Ananas comosus (L.) Merr.] cultivars and lines were examined using 16 simple sequence repeat (SSR) markers. The number of alleles per locus of the SSR markers ranged from 2 to 6 (average 3.19), for a total of 51 alleles. Similarity coefficients were calculated on the basis of 51 amplified bands. A dendrogram was created according to the 16 SSR markers by the unweighted pair-group method. The banding patterns obtained from the SSR primers allowed most of the cultivars and lines to be distinguished, with the exception of vegetative clones. According to the dendrogram, the 27 pineapple cultivars and lines were clustered into three main clusters and four individual clusters. As expected, the dendrogram showed that derived cultivars and lines are closely related to their parental cultivars; the genetic relationships between pineapple cultivars agree with the genealogy of their breeding history. In addition, the analysis showed that there is no obvious correlation between SSR markers and morphological characters. In conclusion, SSR analysis is an efficient method for pineapple cultivar identification and can offer valuable informative characters to identify pineapple cultivars in Taiwan.
The effect of abandoned mining ponds on trace elements dynamics in the soil-plant system
Gabarrón, María; Faz, Ángel; Zornoza, Raúl; Acosta, Jose A.
2017-04-01
In semiarid climate regions lack of vegetation and dryer climate contribute to erosion of abandoned mining surface areas making them up important potential sources of metal pollution into the environment. The objectives of this study were to determine the influence of mine ponds in agriculture and forest soils, and identify the dynamic of metals in the soil-plant system for native plant species (Ballota hirsuta) and crop species (Hordeum vulgare) in two ancient mining districts: La Unión and Mazarrón. To achieve these objectives, wastes samples from mine ponds and soil samples (rhizosphere and non-rhizosphere soils) from natural and agricultural lands were collected. In addition, six plants (Ballota hirsuta) from natural area and 3 plants (Hordeum vulgare) from crops were collected. Physicochemical properties and total, water soluble and bioavailable metals (Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb, and Zn) and arsenic were measured in waste/soil samples. The chemical speciation of metals in soil was estimated by a sequential extraction procedure. For plants analyses, each plant were divided in roots, stem and leaves and metal content measured by ICP-MS. Results indicated that mine, natural and agricultural soils were contaminated by As, Cd, Cu, Pb, and Zn. Chemical partitioning revealed higher mobility of metals in mine ponds than natural and agriculture soils while only Fe and As are completely bound to the soil matrix due to the mineralogical compositions of soils. The accumulation of metals in Ballota hirsuta in La Union decrease as Fe>As>Cr>Ni>Cu>Zn>Cd>Mn>Co>Pb while in Mazarrón did as As>Fe>Cr>Pb>Cu>Ni>Co>Mn>Zn>Cd. Ballota hirsuta showed high ability to bio-accumulate Cu, Cr, Fe, Ni, and As, transferring a large amount to edible parts without exceeding the toxicity limits for animals. Results for barley plants (Hordeum vulgare) showed the ability to absorb and accumulate As, Fe, Mn, Pb and Zn, although the transfer ability of As, Cd and Pb was lower. Although the
Directory of Open Access Journals (Sweden)
ARIEL J FABERI
2011-09-01
Full Text Available The studies of Armadillidium vulgare as pest are virtually null worldwide. However under no-tillage systems this species has found an adequate environment for its development and it has become an important pest in some crops in Argentina. It has been shown that the composition of vegetables affects the isopods biology. Our hypothesis was that soybean leaf litter has high nutritive value which allows A. vulgare to grow faster, survive longer, and have higher fecundity favoring the population increase and turning it into a crop pest. Growth and survivorship of juveniles and adults, egg incubation period, offspring number per female and offspring mean body weight were determined in individuals fed with leaf litter of soybean, sunflower, wheat and pasture. The growth rate coefficient, k, in juveniles was higher for soybean, intermediate for pasture and lower for sunflower. Adult growth was faster under the soybean diet. Survivorship under soybean and pasture was longer than under sunflower and wheat in both juveniles and adults. The reproductive parameters were similar in all diets, food did not generate any change in the reproductive aspects of A. vulgare. Results of the present study represent a source of information about the A. vulgare biology under different diets of agricultural origin to establish the basis for Integrated Management of this species as pest. Under soybean litter provision A. vulgare found the best conditions for faster growth, longer survival and relatively higher fecundity. In fields with soybean as preceding crop or in systems with high frequency of soybean in the crop rotation a more abundant population of A. vulgare would be found as well as with larger individuals which could cause more damage to the following crop in the rotation.Los estudios sobre Armadillidium vulgare como plaga son virtualmente nulos a nivel mundial. Sin embargo, en los sistemas bajo siembra directa esta especie ha encontrado un ambiente adecuado para
Strip Tillage and Early-Season Broadleaf Weed Control in Seeded Onion (Allium cepa)
Sarah Gegner-Kazmierczak; Harlene Hatterman-Valenti
2016-01-01
Field experiments were conducted in 2007 and 2008 near Oakes, North Dakota (ND), USA, to evaluate if strip tillage could be incorporated into a production system of seeded onion (Allium cepa) to eliminate the standard use of a barley (Hordeum vulgare) companion crop with conventional, full width tillage, yet support common early-season weed control programs. A split-factor design was used with tillage (conventional and strip tillage) as the main plot and herbicide treatments (bromoxynil, DCPA...
Salo , Tapio J.; Palosuo , Taru; Kersebaum , Kurt Christian; Nendel , Claas; Angulo , Carlos; Ewert , Frank; Bindi , Marco; Calanca , Pierluigi; Klein , Tommy; Moriondo , Marco; Ferrise , Roberto; Olesen , Jørgen Eivind; Patil , Rasmi H.; Ruget , Francoise; Takac , Jozef
2016-01-01
Eleven widely used crop simulation models (APSIM, CERES, CROPSYST, COUP, DAISY, EPIC, FASSET, HERMES, MONICA, STICS and WOFOST) were tested using spring barley (Hordeum vulgare L.) data set under varying nitrogen (N) fertilizer rates from three experimental years in the boreal climate of Jokioinen, Finland. This is the largest standardized crop model inter-comparison under different levels of N supply to date. The models were calibrated using data from 2002 and 2008, of which 2008 included si...
Isozyme differences in barley mutants
International Nuclear Information System (INIS)
AI-Jibouri, A.A.M.; Dham, K.M.
1990-01-01
Full text: Thirty mutants (M 11 ) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)
Irena Januskaitiene; Jūratė Žaltauskaitė; Austra Dikšaitytė; Gintarė Sujetovienė; Diana Miškelytė; Giedrė Kacienė; Sandra Sakalauskienė; Jurga Miliauskienė; Romualdas Juknys
2018-01-01
This work focuses on the investigation of competition interaction between C3 crop barley (Hordeum vulgare L.) and C4 weed barnyard grass (Echinochloa crus-galli L.) at 2 times higher than ambient [CO2] and +4 0C higher ambient temperature climate conditions. It was hypothesized that interspecific competition will change the response of the investigated plants to increased [CO2] and temperature. The obtained results showed that in the current climate conditions, a higher biomass and photosynth...
Gruszka, Damian; Janeczko, Anna; Dziurka, Michal; Pociecha, Ewa; Fodor, Jozsef
2017-12-07
Drought is one of the most adverse stresses that affect plant growth and yield. Disturbances in metabolic activity resulting from drought cause overproduction of reactive oxygen species. It is postulated that brassinosteroids (BRs) regulate plant tolerance to the stress conditions, but the underlying mechanisms remain largely unknown. An involvement of endogenous BRs in regulation of the antioxidant homeostasis is not fully clarified either. Therefore, the aim of this study was to elucidate the role of endogenous BRs in regulation of non-enzymatic antioxidants in barley (Hordeum vulgare) under control and drought conditions. The plant material included the 'Bowman' cultivar and a group of semi-dwarf near-isogenic lines (NILs), representing mutants deficient in BR biosynthesis or signaling. In general, accumulations of 11 compounds representing various types of non-enzymatic antioxidants were analyzed under both conditions. The analyses of accumulations of reduced and oxidized forms of ascorbate indicated that the BR mutants contain significantly higher contents of dehydroascorbic acid under drought conditions when compared with the 'Bowman' cultivar. The analysis of glutathione accumulation indicated that under the control conditions the BR-insensitive NILs contained significantly lower concentrations of this antioxidant when compared with the rest of genotypes. Therefore, we postulate that BR sensitivity is required for normal accumulation of glutathione. A complete accumulation profile of various tocopherols indicated that functional BR biosynthesis and signaling are required for their normal accumulation under both conditions. Results of this study provided an insight into the role of endogenous BRs in regulation of the non-enzymatic antioxidant homeostasis. © 2017 Scandinavian Plant Physiology Society.
Directory of Open Access Journals (Sweden)
Somayyeh Sadrefozalayi
2014-02-01
Full Text Available Objective: Foeniculum vulgare seed (F. vulgare is a herbal plant which is used with phytoestrogene compounds for polycystic ovary syndrome (PCOS treatment. In this research, renoprotective effect of the aqueous extract of Foeniculum vulgare (AEF in experimental PCOS female rats is studied. Materials and Methods: Forty female rats were randomly divided into five groups. The first group served as control,was injected with an equivalent volume (0.2 ml of normal saline, and received normal diet. Animals in the second group were non poly cystic ovary syndrome (PCOS rats which were treated with intragastric administration of aqueous extract of F. vulgare (150 mg/kg b.w.. In the third group, the rats were treated with intraperitoneal injection of estradiolvalerate (EV (4 mg in 0.2 ml of sesame oil. The fourth groups were treated with EV and AEF (150mg/kg bw with the same route. The fifth groups were treated with EV and AEF (100mg/kg bw. After 4 weeks of study, all of the rats were sacrificed, their kidneys tissues were processed for light microscopy, and some biochemical parameters of serum were measured. Results: The mean values of blood urea nitrogen in PCOS rats treated with low dose of AEF and EV and non-treated, was significantly (p
Oreganum vulgare Linn. leaf: An Extensive Pharmacognostical and Phytochemical Quality Assessment
Directory of Open Access Journals (Sweden)
Veni Bharti
2013-08-01
Full Text Available Purpose: Standardization and detailed pharmacognostical studies of Oreganum vulgare Linn. leaf for authentication and commercial utilization. Methods: Oreganum vulgare Linn. leaf was with standardization according to standard procedures described in WHO, 2011 and I.P. 1996. Results: The physicochemical parameters total ash, acid insoluble ash, water soluble ash and sulphated ash were found to be 11.5%, 11%, 5, 10.5% w/w respectively. Foaming index was found be <100. The trace elements were found to be copper, lead, cadmium, zinc, cobalt, manganese, nickel and copper in ethanol extract and phytochemical screening of aqueous and ethanol extract showed the presence of carbohydrates, flavonoids, anthocyanins, phenolic compounds etc. Conclusion: The standardization parameters viz. physico-chemical parameters, macroscopy, microscopy, taxonomy, anatomy and preliminary phytochemical screening, microbial and aflatoxin count, HPTLC profile is being reported to help in authentication and development of monograph of this plant.
Directory of Open Access Journals (Sweden)
M.B. Cleff
2008-04-01
Full Text Available In vitro activity of the essential oil Origanum vulgare against Sporothrix schenckii was determined by the MIC (Minimum Inhibitory Concentration. For this, seven samples of S. schenckii were studied, two isolated from two cases of human sporotrichosis and five isolated from cats. Analysis of the essential oil was carried out in a gas chromatograph (GC/FID for the identification and quantification of thymol and carvacrol (antifungal agents. MIC was obtained based on the microdilution method according to the adapted document NCCLS-M 27A2 for fitopharmacy. All the isolates presented sensibility to the essential oil. S. schenckii was inhibited in a concentration of 0.25% (250m l/ml. Chromatographic analysis showed that thymol concentration was bigger than carvacrol. The antifungal activity demonstrated by the essential oil of O. vulgare against S. Schenckii stimulates the accomplishment of more studies, including in vivo studies.
Submergence tolerance in Hordeum marinum
DEFF Research Database (Denmark)
Pedersen, Ole; Malik, Al I.; Colmer, Timothy D.
2010-01-01
Floodwaters differ markedly in dissolved CO(2), yet the effects of CO(2) on submergence responses of terrestrial plants have rarely been examined. The influence of dissolved CO(2) on underwater photosynthesis and growth was evaluated for three accessions of the wetland plant Hordeum marinum Huds....... All three accessions tolerated complete submergence, but only when in CO(2) enriched floodwater. Plants submerged for 7 days in water at air equilibrium (18 mM CO(2)) suffered loss of biomass, whereas those with 200 mM CO(2) continued to grow. Higher underwater net photosynthesis at 200 mM CO(2......) increased by 2.7- to 3.2-fold sugar concentrations in roots of submerged plants, compared with at air equilibrium CO(2). Leaf gas films enhancing gas exchange with floodwater, lack of a shoot elongation response conserving tissue sugars and high tissue porosity (24-31% in roots) facilitating internal O(2...
Vaz Patto, M.C.; Aardse, A.; Buntjer, J.; Rubiales, D.; Martin, A.; Niks, R.E.
2001-01-01
In Hordeum chilense Roem. & Schult., a high variation in the level of avoidance to infection of barley leaf rust (Puccinia hordei Otth) occurs. Probably resulting from the properties of the stomata, the rust germ tube overgrows stomata, and the infection process fails in an early stage. In the
Li, X Y; Xu, H X; Chen, J W
2014-04-29
Manual cultivar identification diagram is a new strategy for plant cultivar identification based on DNA markers, providing information to efficiently separate cultivars. We tested 25 pairs of apple EST-SSR primers for amplification of PCR products from loquat cultivars. These EST-SSR primers provided clear amplification products from the loquat cultivars, with a relatively high transferability rate of 84% to loquat; 11 pairs of primers amplified polymorphic products. After analysis of 24 red-fleshed loquat accessions, we found that only 7 pairs of primers could clearly separate all of them. A cultivar identification diagram of the 24 cultivars was constructed using polymorphic bands from the DNA fingerprints and EST-SSR primers. Any two of the 24 cultivars could be rapidly separated from each other, according to the polymorphic bands from the cultivars; the corresponding primers were marked in the correct position on the cultivar identification diagram. This red-flesh loquat cultivar identification diagram can separate the 24 red-flesh loquat cultivars, which is of benefit for loquat cultivar identification for germplasm management and breeding programs.
Energy Technology Data Exchange (ETDEWEB)
Baethgen, W.E. [International Fertilizer Development Center, Muscle Shoals, AL (United States); Magrin, G.O. [Inst. Nacional de Tecnologia Agropecuaria Castelar, Buenos Aires (Argentina). Inst. de Clima y Agua
1995-12-31
Enhanced greenhouse effect caused by the increase in atmospheric concentration of CO{sub 2} and other trace gases could lead to higher global surface temperature and altered hydrological cycles. Most possible climate change scenarios include higher atmospheric CO{sub 2} concentrations, higher temperatures, and changes in precipitation. Three global climate models (GCMs) were applied to generate climate change scenarios for the Pampas region in southern South America. The generated scenarios were then used with crop simulation models to study the possible impact of climate change on wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) production in the Pampas. The authors evaluated the impact of possible climate change scenarios on wheat and barley production in Uruguay for a wide range of soil and crop management strategies including planting dates, cultivar types, fertilizer management, and tillage practices. They also studied the impact of climate change on wheat production across two transects of the Pampas: north to south transect with decreasing temperature, and east to west transect with decreasing precipitation. Finally, sensitivity analyses were conducted for both, the Uruguayan site and the transects, by increasing daily maximum and minimum temperature by 0, 2, and 4 C, and changing the precipitation by {minus}20, 0, and +20%.
International Nuclear Information System (INIS)
Engvild, K.C.; Rasmussen, K.
2005-01-01
Barley mutants without root hairs or with short or reduced root hairs were isolated among M 2 seeds of 'Lux' barley (Hordeum vulgare L.) after acidified sodium azide mutagenesis. Root hair mutants are investigated intensively in Arabidopsis where about 40 genes are known. A few root hair mutants are known in maize, rice, barley and tomato. Many plants without root hairs grow quite well with good plant nutrition, and mutants have been used for investigations of uptake of strongly bound nutrients like phosphorus, iron, zinc and silicon. Seed of 'Lux' barley (Sejet Plant Breeding, Denmark) were soaked overnight, and then treated with 1.5-millimolarsodium azide in 0.1 molar sodium phosphate buffer, pH 3, for 2.5 hours according to the IAEA Manual on Mutation Breeding (2nd Ed.). After rinsing in tap water and air-drying, the M 2 seeds were sown in the field the same day. Spikes, 4-6 per M 1 plant, were harvested. The mutation frequency was similar to that obtained with other barley cultivars from which low-phytate mutants were isolated [5]. Seeds were germinated on black filter paper in tap water for 3 or 4 days before scoring for root hair mutants
Isozyme differences in barley mutants
Energy Technology Data Exchange (ETDEWEB)
AI-Jibouri, A A.M.; Dham, K M [Department of Botany, Nuclear Research Centre, Baghdad (Iraq)
1990-01-01
Full text: Thirty mutants (M{sub 11}) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)
DOES JASMONIC ACID PREVENT THE GERMINATION
ÇAVUŞOĞLU, Kürşat
2009-01-01
Abstract: Effect of jasmonic acid on seed germination and seedling growth of barley (Hordeum vulgare L. cv. Bülbül 89) was investigated in the present study. Jasmonic acid concentrations less than 1500 µM have not inhibited the seed germination, while 1500 and 2000 µM jasmonic acid levels caused atypical germination. The germination was completely inhibited at 3000 µM level of jasmonic acid. However, the seedling growth clearly slowed down with increasing concentrations of jasmonic acid. Furt...
DEFF Research Database (Denmark)
Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny
2012-01-01
The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe......-regimes caused significant differences in both quantity and quality of the storage proteins transcripts. Principal Component Analysis of the amino acid (AA) profiles also indicated dissimilarity in individual AA percentages, correlated to hordein content. The abundance values of proteins of interest confirmed...
Hernández Díaz-Ambrona, Carlos Gregorio
1999-01-01
Este trabajo profundiza en el estudio de los sistemas agrícolas de secano de la Meseta Central. Sobre la base de la alternativa tradicional ce^eal^arbecho, se han estudiado durante tres años de cultivo 1995/96, 1996/97 y 1997/98 seis rotaciones diferentes: monocultivo de cebada (Hordeum vulgare L.), cebada/barbecho, cebada/habas (Viciafaba L.), cebada/guisantes {Pisum sativum L.), cebada/habas/barbecho y cebada/guisantes/barbecho. Entre las rotaciones, se ha comparado la biomasa, el rendimien...
Directory of Open Access Journals (Sweden)
Nan Jia
Full Text Available Bacillus strains have been widely used as the companion strain of Ketogulonigenium vulgare in the process of vitamin C fermentation. Different Bacillus strains generate different effects on the growth of K. vulgare and ultimately influence the productivity. First, we identified that Bacillus endophyticus Hbe603 was an appropriate strain to cooperate with K. vulgare and the product conversion rate exceeded 90% in industrial vitamin C fermentation. Here, we report the genome sequencing of the B. endophyticus Hbe603 industrial companion strain and speculate its possible advantage in the consortium. The circular chromosome of B. endophyticus Hbe603 has a size of 4.87 Mb with GC content of 36.64% and has the highest similarity with that of Bacillus megaterium among all the bacteria with complete genomes. By comparing the distribution of COGs with that of Bacillus thuringiensis, Bacillus cereus and B. megaterium, B. endophyticus has less genes related to cell envelope biogenesis and signal transduction mechanisms, and more genes related to carbohydrate transport and metabolism, energy production and conversion, as well as lipid transport and metabolism. Genome-based functional studies revealed the specific capability of B. endophyticus in sporulation, transcription regulation, environmental resistance, membrane transportation, extracellular proteins and nutrients synthesis, which would be beneficial for K. vulgare. In particular, B. endophyticus lacks the Rap-Phr signal cascade system and, in part, spore coat related proteins. In addition, it has specific pathways for vitamin B12 synthesis and sorbitol metabolism. The genome analysis of the industrial B. endophyticus will help us understand its cooperative mechanism in the K. vulgare-Bacillus strain consortium to improve the fermentation of vitamin C.
Directory of Open Access Journals (Sweden)
Evandro Leite de Souza
2006-12-01
Full Text Available Origanum vulgare L. (oregano, Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growth inhibition zones (30-37 mm. MIC values were between 20-40 µL/mL for the most bacteria strains. Essential oil was able to cause significant (POriganum vulgare L. (orégano, Lamiaceae, tem sido reconhecida como uma espécie vegetal com destacáveis propriedades biológicas por um longo tempo. Este estudo objetivou avaliar a atividade antibacteriana do óleo essencial de Origanum vulgare L. sobre várias bactérias Gram positivas e Gram negativas deteriorantes e/ou patogênicas de interesse em alimentos, bem como observar sua efetividade antimicrobiana em um micromodelo de conservação de alimentos. Os resultados mostraram uma considerável atividade antibacteriana do óleo essencial ensaiado notada por grandes zonas de inibição do crescimento bacteriano (30-37 mm. Os valores de CIM encontrados oscilaram entre 20-40 µL/mL para a maioria das bactérias. A CIM do óleo essencial causou um significante (P<0.05 efeito inibitório sobre a viabilidade bacteriana, sendo caracterizado uma propriedade bacteriostática após 24 horas de exposição. Ainda, a CIM causou uma diminuição significante (P<0.05 da contagem da flora bacteriana autóctone em carne moída armazenada sob refrigeração. Estes dados suportam a possibilidade do uso do óleo essencial de Origanum vulgare L. como composto antimicrobiano alternativo em sistemas de conservação de alimentos.
A weed suppressive index for spring barley (Hordeum vulgare) varieties
DEFF Research Database (Denmark)
Hansen, P K; Kristensen, K; Willas, J
2008-01-01
A screening programme for crop variety competitiveness would ideally be based on only a few, non-destructive measurements of key growth traits. In this study we measured the weed suppressive ability of 79 varieties of spring barley in two ways: (i) directly, by weed coverage assessments under wee...
Isolating Barley ( Hordeum vulgare L.) B1 Hordein Gene Promoter ...
African Journals Online (AJOL)
Promoters play the most important role in determining the temporal and spatial expression pattern and transcript level of a gene. Some strong constitutive promoters, such as cauliflower mosaic virus 35s promoter, are widely used in plant genetic engineering research. However, the expression levels of the foreign genes in ...
Isolating Barley (Hordeum vulgare L.) B1 Hordein Gene Promoter ...
African Journals Online (AJOL)
Yomi
2012-04-10
Apr 10, 2012 ... proline and glutamine (Piston et al., 2004). The four main groups of ... account for approximately 50% of the total protein in the. *Corresponding author. ..... inheritance, chromosomal location, and population dynamics. PNAS,.
Identification of a Phytase Gene in Barley (Hordeum vulgare L.)
Dai, Fei; Qiu, Long; Ye, Lingzhen; Wu, Dezhi; Zhou, Meixue; Zhang, Guoping
2011-01-01
Background Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. Methodology/Principal Findings Quantitative trait loci (QTL) analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP) gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. Conclusions/Significance It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains. PMID:21533044
Identification of a phytase gene in barley (Hordeum vulgare L..
Directory of Open Access Journals (Sweden)
Fei Dai
Full Text Available BACKGROUND: Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. METHODOLOGY/PRINCIPAL FINDINGS: Quantitative trait loci (QTL analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. CONCLUSIONS/SIGNIFICANCE: It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains.
Comparison of stability statistics for yield in barley (Hordeum vulgare ...
African Journals Online (AJOL)
STORAGESEVER
2010-03-15
Mar 15, 2010 ... statistics and yield indicated that only TOP method would be useful for simultaneously selecting for high yield and ... metric stability methods; i) they reduce the bias caused by outliers, ii) ...... Biometrics, 43: 45-53. Sabaghnia N ...
Registration of Food Barley (Hordeum vulgare L.) Variety HB 1307 ...
African Journals Online (AJOL)
Six-rowed food type barley, HB 1307, was developed by Holetta Agricultural Research Center (HARC) from a cross between a landrace line and exotic germplasm (Awra gebs-1 x IBON93/91) and released in 2006 for mid and high altitude areas. The three consecutive years\\' (2002-2004) tests proved its superiority in grain ...
Directory of Open Access Journals (Sweden)
Wiesław Nowakowski
2015-06-01
Full Text Available L'action de I'AIA sur la teneur en azote total et en azote protéinique des graines du Triticum vulgare, d'Hordeum vulgare et d'Avena sativa cultivés a 30%, 60% et 90% de la capacité capillaire en eau du sable a tété étudiée au cours de trois ans (1969, 1970, 1971. La teneur en g-protéines totales liée au rendement des graines de céréales examinees a été plus élevée dans les conditions de sécheresse (30% de la capacite capillaire en eau à la suite d'un traitement auxinique. La teneur (% en azote total et proteinique ne semble pas etre tellement modifiee dans les graines de cereales à la suite d'un traitement auxinique.
Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae
Directory of Open Access Journals (Sweden)
Quanwen Dou
2016-10-01
Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.
Genetic divergence of common bean cultivars.
Veloso, J S; Silva, W; Pinheiro, L R; Dos Santos, J B; Fonseca, N S; Euzebio, M P
2015-09-22
The aim of this study was to evaluate genetic divergence in the 'Carioca' (beige with brown stripes) common bean cultivar used by different institutions and in 16 other common bean cultivars used in the Rede Cooperativa de Pesquisa de Feijão (Cooperative Network of Common Bean Research), by using simple sequence repeats associated with agronomic traits that are highly distributed in the common bean genome. We evaluated 22 polymorphic loci using bulks containing DNA from 30 plants. There was genetic divergence among the Carioca cultivar provided by the institutions. Nevertheless, there was lower divergence among them than among the other cultivars. The cultivar used by Instituto Agronômico do Paraná was the most divergent in relation to the Carioca samples. The least divergence was observed among the samples used by Universidade Federal de Lavras and by Embrapa Arroz e Feijão. Of all the cultivars, 'CNFP 10104' and 'BRSMG Realce' showed the greatest dissimilarity. The cultivars were separated in two groups of greatest similarity using the Structure software. Genetic variation among cultivars was greater than the variation within or between the groups formed. This fact, together with the high estimate of heterozygosity observed and the genetic divergence of the samples of the Carioca cultivar in relation to the original provided by Instituto Agronômico de Campinas, indicates a mixture of cultivars. The high divergence among cultivars provides potential for the utilization of this genetic variability in plant breeding.
Determining the Pollinizer for Pecan Cultivars
Directory of Open Access Journals (Sweden)
Fereidoon Ajamgard
2017-05-01
Full Text Available This study was conducted to determine the best pollinizer for five selected pecan cultivars in southwest of Iran at Safiabad Agricultural Research Center in 2014-2015. The cultivars included: 'GraTex', '10J', 'Wichita 6J', 'GraKing', 'Choctaw' as pollinated cultivars (♀ and 'GraTex', 'Peruque', 'Comanche 4M', '10J', 'Wichita 6J', 'Mohawk', 'Mahan', 'Stuart 2J', '3J', 'Stuart 4J', 'GraKing', 'Choctaw', 'Apache', '6M', 'Wichita 7J' and 'Comanche 5M.' as pollinizer cultivars (♂. In the first step, a pollination chart of cultivars was determined in two years. The pollination chart of cultivars showed that all the cultivars investigated during this study were dichogamous and also protogynous except for the 'Peruque'. ‘GraKing’ had the longest duration of shedding pollen. Pollination chart showed that 'Peruque', ‘GraKing’, and 'Stuart 2J' had flowering overlap with the selected cultivars. Pollen germination test showed that the germination ability was different among the cultivars. It was 45% for 'GraKing' and 35% for 'Peruque', which were both recommended as pollinizers in this study. '6M', 'GraTex' and 'Stuart 4J' cultivars had the highest pollen germination percentage of 65%, 60% and 60%, respectively. The results of controlled pollinationtest showed that different pollen sources had no significant effect on nuts per cluster but self-pollinated all of the cultivars significantly reduced fruit set in first and second years. Based on the present research, pollination in pecan orchard was necessary for adequate yield. Also, 'Peruque', 'GraKing' and 'Stuart 2J' were the best pollinizers for five selected cultivars in southwest of Iran.
Directory of Open Access Journals (Sweden)
Xiao-Wei Zhang
Full Text Available Anthocyanin-rich barley can have great potential in promoting human health and in developing nutraceuticals and functional foods. As different anthocyanin compounds have different antioxidant activities, breeding cultivars with pre-designed anthocyanin compositions could be highly desirable. Working toward this possibility, we assessed and reported for the first time the genetic control of individual anthocyanin compounds in barley. Of the ten anthocyanins assessed, two, peonidin-3-glucoside (P3G and cyanidin-3-glucoside (C3G, were major components in the purple pericarp barley genotype RUSSIA68. Quantitative trait locus (QTL mapping showed that both anthocyanin compounds were the interactive products of two loci, one located on chromosome arm 2HL and the other on 7HS. However, the two different anthocyanin components seem to be controlled by different interactions between the two loci. The effects of the 7HS locus on P3G and C3G were difficult to detect without removing the effect of the 2HL locus. At least one copy of the 2HL alleles from the purple pericarp parent was required for the synthesis of P3G. This does not seem to be the case for the production of C3G which was produced in each of all the different allele combinations between the two loci. Typical maternal effect was also observed in the inheritance of purple pericarp grains in barley. The varied values of different compounds, coupled with their different genetic controls, highlight the need for targeting individual anthocyanins in crop breeding and food processing.
Foeniculum vulgare essential oils: chemical composition, antioxidant and antimicrobial activities.
Miguel, Maria Graça; Cruz, Cláudia; Faleiro, Leonor; Simões, Mariana T F; Figueiredo, Ana Cristina; Barroso, José G; Pedro, Luis G
2010-02-01
The essential oils from Foeniculum vulgare commercial aerial parts and fruits were isolated by hydrodistillation, with different distillation times (30 min, 1 h, 2 h and 3 h), and analyzed by GC and GC-MS. The antioxidant ability was estimated using four distinct methods. Antibacterial activity was determined by the agar diffusion method. Remarkable differences, and worrying from the quality and safety point of view, were detected in the essential oils. trans-Anethole (31-36%), alpha-pinene (14-20%) and limonene (11-13%) were the main components of the essentials oil isolated from F. vulgare dried aerial parts, whereas methyl chavicol (= estragole) (79-88%) was dominant in the fruit oils. With the DPPH method the plant oils showed better antioxidant activity than the fruits oils. With the TBARS method and at higher concentrations, fennel essential oils showed a pro-oxidant activity. None of the oils showed a hydroxyl radical scavenging capacity > 50%, but they showed an ability to inhibit 5-lipoxygenase. The essential oils showed a very low antimicrobial activity. In general, the essential oils isolated during 2 h were as effective, from the biological activity point of view, as those isolated during 3 h.
International Nuclear Information System (INIS)
Liu Weitao; Zhou Qixing; An Jing; Sun Yuebing; Liu Rui
2010-01-01
Variations in cadmium accumulation and translocation among 40 Chinese cabbage cultivars were studied to identify and screen out Cd-safe cultivars (CSCs), i.e. cultivars with low enough accumulation of Cd in their edible parts even when grown in contaminated soils. It was observed in the pot-culture experiment that there was a significant difference (p < 0.05) in shoot Cd concentrations under three Cd treatments (1.0, 2.5 and 5.0 mg/kg), with corresponding average values 0.88, 4.45 and 7.76 mg/kg, respectively. Shoot Cd concentrations in 16 cabbage cultivars were lower than 0.50 mg/kg. The translocation factors (TFs) and the extraction factors (EFs) in five cabbage cultivars were lower than 1.0 in the pot-culture experiment. The field-culture experiment further validated that New Beijing 3 and Fengyuanxin 3 could be considered as CSCs. In particular, the two cultivars can be cultivated in low to moderate Cd-contaminated soils (Cd concentration <1.25 mg/kg) to minimize the Cd accumulation in the food.
Roles of Hydroxynitrile Glucosides in Barley
DEFF Research Database (Denmark)
Roelsgaard, Pernille Sølvhøj
on barley (Hordeum vulgare). Barley accumulates five hydroxynitrile glucosides, including one cyanogenic glucoside, in the epidermal cell layer. Cyanogenic glucosides are classically known as hydrogen cyanide-releasing defense compounds which act against generalist insects and herbivores. However...... is proposed. The results obtained in this Ph.D. study provide a unique insight demonstrating that hydroxynitrile glucosides play a far more complex role in barley defense against and susceptibility to Bgh than previously described. Future studies can build on the platforms established in this study to provide...
Inter-simple sequence repeat (ISSR) loci mapping in the genome of perennial ryegrass
DEFF Research Database (Denmark)
Pivorienė, O; Pašakinskienė, I; Brazauskas, G
2008-01-01
The aim of this study was to identify and characterize new ISSR markers and their loci in the genome of perennial ryegrass. A subsample of the VrnA F2 mapping family of perennial ryegrass comprising 92 individuals was used to develop a linkage map including inter-simple sequence repeat markers...... demonstrated a 70% similarity to the Hordeum vulgare germin gene GerA. Inter-SSR mapping will provide useful information for gene targeting, quantitative trait loci mapping and marker-assisted selection in perennial ryegrass....
In vitro activity of Origanum vulgare essential oil against Candida species
Directory of Open Access Journals (Sweden)
Marlete Brum Cleff
2010-03-01
Full Text Available The aim of this study was to evaluate the in vitro activity of the essential oil extracted from Origanum vulgare against sixteen Candida species isolates. Standard strains tested comprised C. albicans (ATCC strains 44858, 4053, 18804 and 3691, C. parapsilosis (ATCC 22019, C. krusei (ATCC 34135, C. lusitaniae (ATCC 34449 and C. dubliniensis (ATCC MY646. Six Candida albicans isolates from the vaginal mucous membrane of female dogs, one isolate from the cutaneous tegument of a dog and one isolate of a capuchin monkey were tested in parallel. A broth microdilution technique (CLSI was used, and the inoculum concentration was adjusted to 5 x 10(6 CFU mL-1. The essential oil was obtained by hydrodistillation in a Clevenger apparatus and analyzed by gas chromatography. Susceptibility was expressed as Minimal Inhibitory Concentration (MIC and Minimal Fungicidal Concentration (MFC. All isolates tested in vitro were sensitive to O. vulgare essential oil. The chromatographic analysis revealed that the main compounds present in the essential oil were 4-terpineol (47.95%, carvacrol (9.42%, thymol (8.42% and □-terpineol (7.57%. C. albicans isolates obtained from animal mucous membranes exhibited MIC and MFC values of 2.72 µL mL-1 and 5 µL mL-1, respectively. MIC and MFC values for C. albicans standard strains were 2.97 µL mL-1 and 3.54 µL mL-1, respectively. The MIC and MFC for non-albicans species were 2.10 µL mL-1 and 2.97 µL mL-1, respectively. The antifungal activity of O. vulgare essential oil against Candida spp. observed in vitro suggests its administration may represent an alternative treatment for candidiasis.
Directory of Open Access Journals (Sweden)
Chevalier Frédéric
2012-01-01
Full Text Available Abstract Background Wolbachia are vertically transmitted bacteria known to be the most widespread endosymbiont in arthropods. They induce various alterations of the reproduction of their host, including feminization of genetic males in isopod crustaceans. In the pill bug Armadillidium vulgare, the presence of Wolbachia is also associated with detrimental effects on host fertility and lifespan. Deleterious effects have been demonstrated on hemocyte density, phenoloxidase activity, and natural hemolymph septicemia, suggesting that infected individuals could have defective immune capacities. Since nothing is known about the molecular mechanisms involved in Wolbachia-A. vulgare interactions and its secondary immunocompetence modulation, we developed a transcriptomics strategy and compared A. vulgare gene expression between Wolbachia-infected animals (i.e., “symbiotic” animals and uninfected ones (i.e., “asymbiotic” animals as well as between animals challenged or not challenged by a pathogenic bacteria. Results Since very little genetic data is available on A. vulgare, we produced several EST libraries and generated a total of 28 606 ESTs. Analyses of these ESTs revealed that immune processes were over-represented in most experimental conditions (responses to a symbiont and to a pathogen. Considering canonical crustacean immune pathways, these genes encode antimicrobial peptides or are involved in pathogen recognition, detoxification, and autophagy. By RT-qPCR, we demonstrated a general trend towards gene under-expression in symbiotic whole animals and ovaries whereas the same gene set tends to be over-expressed in symbiotic immune tissues. Conclusion This study allowed us to generate the first reference transcriptome ever obtained in the Isopoda group and to identify genes involved in the major known crustacean immune pathways encompassing cellular and humoral responses. Expression of immune-related genes revealed a modulation of host
African Journals Online (AJOL)
Abstract. Ten rice cultivars from the International Rice Germplasm Centre originating from Bangladesh were analysedfor the~r genetics of resistance to bacterial blight. The test cultivars were selected on the basis of their high level ofresistance to races IV & VI ofXanthomonas oryzae pv. oryzae. The mode ofinheri- tance was ...
Competitividade de cultivares de arroz irrigado com cultivar simuladora de arroz-vermelho
Balbinot Junior,Alvadi Antonio; Fleck,Nilson Gilberto; Menezes,Valmir Gaedke; Agostinetto,Dirceu
2003-01-01
Características morfológicas e fisiológicas de plantas cultivadas podem afetar sua habilidade competitiva com plantas daninhas. Este trabalho objetivou investigar a competitividade de cultivares de arroz irrigado (Oryza sativa L.) com cultivar simuladora de arroz-vermelho. Investigou-se na safra 2000/2001 o comportamento de oito genótipos de arroz, cultivados na presença ou ausência da cultivar de arroz EEA 406, que simulou infestação de arroz-vermelho. Aos 45 e aos 60 dias após a semeadura, ...
Jasion, Mateusz; Samecka-Cymerman, Aleksandra; Kolon, Krzysztof; Kempers, Alexander J
2013-10-01
We investigated the possibility of use of Tanacetum vulgare (tansy) as an ecological indicator of metal concentration in a naturally colonized open-pit lignite mine in Bełchatów (Poland). Tanacetum vulgare is the only species growing abundantly and spontaneously in the lignite mine waste dumps. Metal concentrations in roots, stems, leaves, flowers, and soil were measured in dump sites differing in type and time of reclamation and therefore differing in pollution levels. Tanacetum vulgare appeared to be an accumulator of chromium and iron in roots, whereas highest concentrations of manganese and zinc were found in leaves. A high bioaccumulation factor for cadmium (Cd) was observed in dumps and control sites, indicating that even small amounts of Cd in the environment may result in significant uptake by the plant. The lowest concentrations of metals were found in plants from sites situated on dumps reclaimed with argillaceous limestone.
Hein, Jordan A; Sherrard, Mark E; Manfredi, Kirk P; Abebe, Tilahun
2016-11-09
Photosynthetic organs of the cereal spike (ear) provide assimilate for grain filling, but their response to drought is poorly understood. In this study, we characterized the drought response of individual organs of the barley spike (awn, lemma, and palea) and compared them with a vegetative organ (fifth leaf). Understanding differences in physiological and metabolic responses between the leaf and spike organs during drought can help us develop high yielding cultivars for environments where terminal drought is prevalent. We exposed barley plants to drought by withholding water for 4 days at the grain filling stage and compared changes in: (1) relative water content (RWC), (2) osmotic potential (Ψ s ), (3) osmotic adjustment (OA), (4) gas exchange, and (5) metabolite content between organs. Drought reduced RWC and Ψ s in all four organs, but the decrease in RWC was greater and there was a smaller change in Ψ s in the fifth leaf than the spike organs. We detected evidence of OA in the awn, lemma, and palea, but not in the fifth leaf. Rates of gas exchange declined more rapidly in the fifth leaf than awn during drought. We identified 18 metabolites but, only ten metabolites accumulated significantly during drought in one or more organs. Among these, proline accumulated in all organs during drought while accumulation of the other metabolites varied between organs. This may suggest that each organ in the same plant uses a different set of osmolytes for drought resistance. Our results suggest that photosynthetic organs of the barley spike maintain higher water content, greater osmotic adjustment, and higher rates of gas exchange than the leaf during drought.
Directory of Open Access Journals (Sweden)
Nisha Makkar
2017-01-01
Full Text Available Introduction: Oropharyngeal candidiasis is an opportunistic mucosal infection caused by Candida albicans. It usually responds to topical treatments such as clotrimazole troches, topical fluconazole, chlorhexidine mouthwash and nystatin suspension. Piper betel leaf oil and Origanum vulgare essential oil have shown some topical antifungal activity. Aim: To determine and compare the antifungal efficacy of piper betel leaf oil, O. vulgare essential oil and fluconazole suspension against C. albicans. Materials and Methods: The zone of inhibition was measured by the cup–plate diffusion method using 100 μl volume of piper betel leaf oil, O. vulgare essential oil and fluconazole suspension, which were pipetted into the wells of the inoculated Sabouraud’s dextrose agar plates. The zone of inhibition was measured in millimetres using Vernier calliper. Minimum inhibitory concentration (MIC was determined by the broth macro-dilution test by pouring 1 ml of the respective concentrations of the test material to the individual test tubes along with 10 μl of the diluted test organism inoculum. Finally, MIC was calculated using a reflective viewer. Results: The zone of inhibition for O. vulgare essential oil (>40 mm was more than fluconazole suspension (>35 mm. MIC of O. vulgare essential oil, piper betel leaf oil and fluconazole suspension was 1.6%, 0.4% and 0.8%, respectively. Conclusion: O. vulgare essential oil was found to be a more effective antifungal agent than piper betel leaf oil and fluconazole suspension.
Morphological differentiation of non-glandular and glandular trichomes on Marrubium vulgare L.
Directory of Open Access Journals (Sweden)
Marta Dmitruk
2014-04-01
Full Text Available Marrubium vulgare L., commonly known as a white horehound or common horehound, belongs to the plant family Lamiaceae. It is a perennial aromatic herb which grows naturally in Europe, Asia, and America. Since ancient Egypt, this species has been known as a remedy for upper respiratory tract ailments. Nowadays, horehound is used in herbal medicine for treatment of liver diseases, biliary tract disorders, and for increasing the appetite and supporting the function of the stomach. The main biologically active substances in M. vulgare organs are: marrubiin, tannins, essential oils, and ursolic acid. The paper presents micromorphological analyses of non-glandular and glandular trichomes of M. vulgare. The research material was sampled from the plant collection in the Botanical Garden of the Maria Curie-Sklodowska University in Lublin (51°14′ N, 22°34′ E. The above-ground parts of horehound were collected during the flowering period in July 2013. Using light microscopy (LM and scanning electron microscopy (SEM, the types and sizes of trichomes from the stem, leaf, calyx, and corolla were investigated. The results of the microscopic observations show that the surfaces of M. vulgare vegetative and reproductive organs are densely clothed with glandular and non-glandular trichomes. The glandular trichomes are of two main types: peltate and capitate. Peltate trichomes consist of a short stalk cell and a large head with secretory cells arranged in a circle. The height of a mature trichome is about 31.33 μm and the diameter of the head is 31.47 μm. The substance produced by secretory cells passes through the apical walls and accumulates within a space between the cuticle and the cell wall layer. Capitate long trichomes with a basal cell, long stalk, neck cell, and a unicellular head are 36.65 μm long and the diameter of the head is about 15.6 μm. There are two types of short capitate trichomes: with a bicellular head and a unicellular stalk and with
The chemical defoliation of Ligitstrum vulgare L. and Spiraea x arguta Zab. shrubs in nursery
Directory of Open Access Journals (Sweden)
Szczepan Marczyński
2015-06-01
Full Text Available To defoliate Ligustrum vulgare and Spiraea x arguta – ethephon, KJ, Mg(ClO32•6H2O, CuSO4•5H2O and (NH42SO4 in various concentrations were used alone or in mixtures. Treating plants with potassium iodide gave the best results. KJ concentrations of 0.05-0,1% and 0.1-0.% were sufficient to defoliate Spiraea and Ligusturm respectively. Magnesium chlorate at concentration of 0.24 and 2% CuSO4 were also effective, the latter however, proved slight harmful to the plants. Spraying with defoliants on Sept. 26 gave better results than treating plants on Sept. 16. Chemical defoliation decreased negligibly the frost resistance of Ligusturm vulgare shrubs.
Directory of Open Access Journals (Sweden)
Budianto Budianto
2015-10-01
Pada penelitian ini menggunakan ekstrak air dari buah adas untuk mengetahui aktivitas antibakteri terhadap Vibrio harveyi dan Vibrio alginolyticus dengan menggunakan metode uji Minimum Inhibitory Concentration (MIC dan difusi cakram kertas. Hasil yang diperoleh pada uji MIC, konsentrasi terkecil untuk menghambat pertumbuhan adalah 0,060 g/ml, untuk kedua spesies bakteri. Variasi perlakuan pada uji cakram kertas yaitu konsentrasi A (0,065 g/ml, B (0,070 g/ml, C (0,075 g/ml, D (0,080 g/ml, E (0,085 g/ml, F (0,090 g/ml dan kontrol (0,000 g/ml, hasil yang diperoleh adalah konsentrasi 0,090 g/ml memiliki diameter zona hambat tertinggi sebesar 11,17 ± 0,5 mm (V. harveyi dan 12,53 ± 1,14 mm (V. alginolyticus, sehingga dapat disimpulkan bahwa buah adas (F. vulgare Mill memiliki peranan ekologi yang sangat penting sebagai bahan pengobatan alternatif dalam pengendalian penyebaran penyakit Vibriosis yang disebabkan oleh V. harveyi dan V. alginolyticus. Kata kunci: Foeniculum vulgare Mill, Vibrio harveyi, Vibrio alginolyticus, uji MIC dan difusi cakram kertas
The 'Big bang' in the Early Iron Age
Directory of Open Access Journals (Sweden)
Medović Aleksandar
2010-01-01
Full Text Available The Early Iron Age granaries of Tell Gradina upon Bosut exploded in a fire inferno in the 8th century B.C. The result of this catastrophe is 2-5 cm thick layer with mixed carbonized seeds and fruits. Recently, eight samples were taken from Gradina's profile for archaeobotanical analysis. The goal was to obtain basic information on land use and on major crops and weeds of that period. The most abundant were cereals, followed by millets, pulses and oil/fibre plants. The dominant cereals were einkorn (Triticum monococcum and hulled barley (Hordeum vulgare vulgare. Broomcorn millet (Panicum miliaceum was also very important. Pulses were represented with six and oil/fibre plants with three species. Among weeds and ruderals, most common are rye brome (Bromus secalinus, fat hen (Chenopodium album, darnel ryegrass (Lolium temulentum, hairy crabgrass (Digitaria sanguinalis and corncockle (Agrostemma githago.
Weigt, Dorota; Kiel, Angelika; Nawracała, Jerzy; Pluta, Mateusz; Łacka, Agnieszka
2016-01-01
Solid-stemmed spring wheat cultivars ( Triticum aestivum L.) are resistant to the stem sawfly ( Cephus cinctus Nort.) and lodging. Anthers of 24 spring wheat cultivars with varying content of pith in the stem were used in the experiment. All were classified into three groups: solid, medium-solid and hollow stems. There was considerable influence of the cultivar on callus formation and green plant regeneration. The highest efficiency of green plant regeneration (24%) was observed for the solid-stemmed AC Abbey cultivar. There was no regeneration from the explants of four cultivars: CLTR 7027, Alentejano, Marquis and Bombona. Principal component analysis showed no differences between the cases under observation (callus induction and green plant regeneration) in their response to pre-treatment temperatures (4 and 8°C). The examination of the effects of various auxin types in the induction medium on callus formation and green plant regeneration revealed that the strongest stimulation of these processes was observed in the C17 medium with 2,4-D and dicamba. The efficiency of callus formation and green plant regeneration was greater in solid-stemmed cultivars than in hollow-stemmed cultivars.
DEFF Research Database (Denmark)
Bloch, H.A.; Petersen, Marianne Kjerstine; Sperotto, Maria Maddalena
2001-01-01
developed, which combines analysis of alcohol-soluble wheat proteins (gliadins) using matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks. Here we have applied the same method for the identification of both barley (Hordeum vulgare L.) and rye (Secale cereale L.......) varieties. For barley, 95% of the mass spectra were correctly classified. This is an encouraging result, since in earlier experiments only a grouping into subsets of varieties was possible. However, the method was not useful in the classification of rye, due to the strong similarity between mass spectra...
DEFF Research Database (Denmark)
Gallagher, M.W.; Clayborough, R.; Beswick, K.M.
2000-01-01
A relaxed eddy accumulation (REA) system, based on the design by Beverland et al. (Journal of Geophysics Research 101 (D17) 22, 807-22, 815), for the measurement of biogenic VOC species was evaluated by intercomparison with an eddy correlation CO2 flux system over a mature deciduous beech canopy...... (Fagus Sylvatica) during the FOREXNOX program. Measurements from a site where winter wheat and barley (Hordeum Vulgare ann Triticum Aestivum) were being harvested are also presented. The system was inter-compared with two different eddy correlation systems for measuring CO2 fluxes. Good results were...
UCE: A uracil excision (USERTM)-based toolbox for transformation of cereals
DEFF Research Database (Denmark)
Hebelstrup, Kim H; Christiansen, Michael W; Carciofi, Massimiliano
2010-01-01
Background Cloning of gene casettes and other DNA sequences into the conventional vectors for biolistic or Agrobacterium-mediated transformation is hampered by a limited amount of unique restriction sites and by the difficulties often encountered when ligating small single strand DNA overhangs...... (USER cereal), ready for use in cloning of complex constructs into the T-DNA. A series of the vectors were tested and shown to perform successfully in Agrobacterium-mediated transformation of barley (Hordeum vulgare L.) as well as in biolistic transformation of endosperm cells conferring transient...
Effect of sterilization on mineralization of straw and black carbon
Bobul'ská, Lenka; Bruun, Sander; Fazekašová, Danica
2013-01-01
The study was aimed at investigating the role of microorganisms in the degradation of BC (black carbon). CO evolution was measured under sterilized and non-sterilized soil using BC and straw amendments. Black carbon and straw were produced from homogenously C labelled roots of barley (Hordeum vulgare) with a specific activity 2.9 MBq g C. Production of BC was implemented at 300 °C for 24 h in a muffle oven, incubated in soil and C in the evolved CO was measured after 0.5, 1, 2, 4, 8, 16, 26 a...
High-level expression of the native barley alpha-amylase/subtilisin inhibitor in Pichia pastoris
DEFF Research Database (Denmark)
Micheelsen, Pernille Ollendorff; Ostergaard, Peter Rahbek; Lange, Lene
2008-01-01
An expression system for high-level expression of the native Hordeum vulgare alpha-amylase/subtilisin inhibitor (BASI) has been developed in Pichia pastoris, using the methanol inducible alcohol oxidase 1 (AOX1) promoter. To optimize expression, two codon-optimized coding regions have been designed...... and expressed alongside the wild-type coding region. To ensure secretion of the native mature protein, a truncated version of the alpha mating factor secretion signal from Saccharomyces cerevisiae was used. In order to be able to compare expression levels from different clones, single insertion transformants...
Starch bioengineering in Brachypodium distachyon
DEFF Research Database (Denmark)
Tanackovic, Vanja; Svensson, Jan Tommy; Buleon, A
2011-01-01
Brachypodium distachyon was recently introduced as a model plant for temperate cereals (Opanowicz et al., 2008). We aim to establish Brachypodium as a model for cereal starch metabolism. Grain starch from two lines: Bd21 and Bd21-3 are being characterized. Microscopic, chemical and structural data...... including amylopectin chain length distribution, phosphate content and amylose content provided further evidence for the close relationship to temperate cereals even though starch content and starch granule size were considerably lower than that for barley (Hordeum vulgare). Bioinformatics analyses...... in temperate cereals....
GeneCAT--novel webtools that combine BLAST and co-expression analyses
DEFF Research Database (Denmark)
Mutwil, Marek; Obro, Jens; Willats, William G T
2008-01-01
The gene co-expression analysis toolbox (GeneCAT) introduces several novel microarray data analyzing tools. First, the multigene co-expression analysis, combined with co-expressed gene networks, provides a more powerful data mining technique than standard, single-gene co-expression analysis. Second...... orthologs in the plant model organisms Arabidopsis thaliana and Hordeum vulgare (Barley). GeneCAT is equipped with expression data for the model plant A. thaliana, and first to introduce co-expression mining tools for the monocot Barley. GeneCAT is available at http://genecat.mpg.de....
Identification and characterization of barley RNA-directed RNA polymerases
DEFF Research Database (Denmark)
Madsen, Christian Toft; Stephens, Jennifer; Hornyik, Csaba
2009-01-01
in dicot species. In this report, we identi!ed and characterized HvRDR1, HvRDR2 and HvRDR6 genes in the monocot plant barley (Hordeum vulgare). We analysed their expression under various biotic and abiotic stresses including fungal and viral infections, salicylic acid treatment as well as during plant...... development. The different classes and subclasses of barley RDRs displayed contrasting expression patterns during pathogen challenge and development suggesting their involvement in speci!c regulatory pathways. Their response to heat and salicylic acid treatment suggests a conserved pattern of expression...
DEFF Research Database (Denmark)
Vinther, F.P.; Jensen, E.S.
2000-01-01
The input of Nitrogen (N) through symbiotic N-2 fixation (SNF) in grass-clover mixtures was determined in an organic cropping. system for grazing during 3 years. The mixture of perennial ryegrass (Lolium perenne L.) and white clover (Trifolium repens L.) was established by undersowing in spring...... barley (Hordeum vulgare L.) and maintained subsequently for two production years. Dinitrogen fixation was determined using the N-15 isotope dilution techniques and two labelling procedures. Using either pre-labelling of the soil with immobilisation of the N-15 by addition of a carbon source before...
Koldaş, Serkan; Demirtas, Ibrahim; Ozen, Tevfik; Demirci, Mehmet Ali; Behçet, Lütfi
2015-03-15
A detailed phytochemical analysis of Origanum vulgare L. ssp. viride (Boiss.) Hayek was carried out and the antioxidant activities of five different crude extracts were determined. The antiproliferative activities of the extracts were determined using the xCELLigence system (Real Time Cell Analyzer). Differences between the essential oil and volatile organic compound profiles of the plant were shown. The main component of the essential oil was caryophyllene oxide, while the main volatile organic compounds were sabinene and eucalyptol as determined by HS-GC/MS. Phenolic contents of the extracts were determined qualitatively and quantitatively by HPLC/TOF-MS. Ten phenolic compounds were found in the extracts from O. vulgare and Origanum acutidens: rosmarinic acid (in highest abundance), chicoric acid, caffeic acid, p-coumaric acid, gallic acid, quercetin, apigenin-7-glucoside, kaempferol, naringenin and 4-hydroxybenzaldehyde. This study provides first results on the antiproliferative and antioxidant properties and detailed phytochemical screening of O. vulgare ssp. viride (Boiss.) Hayek. © 2014 Society of Chemical Industry.
Honey Antibacterial Effect Boosting Using Origanum vulgare L. Essential Oil
Imtara, Hamada; Elamine, Youssef; Lyoussi, Badiâa
2018-01-01
The appearance of new bacterial strains which cause pathogenic diseases and which are resistant to the most used antibiotics requires probing new antibacterial agents sources. Therefore, the main aim of the present work was to follow the antibacterial activity of honey samples from Palestine and Morocco, after the combination with Origanum vulgare L. essential oil, and figure out whether the honey physicochemical parameters and geographic origin influence the final activity. The results of th...
Aprotosoaie, Ana Clara; Hăncianu, Monica; Poiată, Antonia; Tuchiluş, Cristina; Spac, A; Cioană, Oana; Gille, Elvira; Stănescu, Ursula
2008-01-01
In our study, four samples of volatile oil from Foeniculum vulgare, cultivated in different pedoclimatic conditions, were investigated for their antimicrobial activity and chemical composition. Organisms. Staphylococcus aureus ATCC 25923, Bacillus cereus, Pseudomonas aeruginosa, Escherichia coli ATCC 25922, Candida albicans were included in the report. Antimicrobial susceptibility tests. The comparative inhibitory activity of volatile oil samples with other antimicrobial agents was quantitative determined by minimum inhibitory concentration (MIC). Oil samples are the volatile oils extracted by steam distillation, from two ecological vegetative populations of Foeniculum vulgare. Gas chromatography coupled to mass spectrometry (GC-MS) was used to determine the chemical composition of the essential oils. All oil samples have a good activity against E. coli and S. aureus at low concentrations. Against B. cereus and P. aeruginosa these oil samples are less active. The oil samples were generally bactericidal at a concentration up to twofold or fourfold higher than the MIC value. Significantly synergic activity with amoxicillin or tetracycline showed all fennel samples against E. coli, Sarcina lutea and B. subtilis strains. Fennel oil samples have shown high activity against Candida albicans. No significant antimicrobial activity variations were observed for Foeniculum vulgare volatile oil samples obtained after two or three years cultivation period. The most important identified compounds in all samples of fennel volatile oils were trans-anethole, estragole, fenchone, limonene, alpha-pinene and gamma-terpinene.
Directory of Open Access Journals (Sweden)
Juárez-Cisneros Gladys
2014-11-01
Full Text Available Soil pollution by waste motor oil (WMO caused soil´s lost fertility. The aims of this research where a bioremediation of soil polluted by 10000 ppm of WMO for biostimulation with vermicompost (VC at 3 and 6 % (w/w follow by b phytoremediation (PR of the same soil to eliminate remaining WMO with Sorghum vulgare inoculated with Bacillus cereus and/or Rhizobium etli or Promoting Growth Plant Bacteria (PGPB. At the first step of assay WMO concentration was measured before and after bioremediation. At the second step the same soil phytoremediation was applied for remaining WHO sowing S. vulgare inoculated with PGPB, then at flowering stage its biomass and WHO final concentration was determined. Results showed that soil impacted by WMO biostimulated with VC at 3% was eliminated 8630 ppm of WMO. At the second phase in the same soil PR applied for remaining WMO which was reduced until 210 ppm. Soil polluted by remaining WMO applied PR using S. vulgare plus R. etli WMO was decreased at 260 ppm. While S. vulgare´s biomass inoculated with PGPB was higher compared to S. vulgare grown in soil not polluted by WMO according by ANOVA - Tukey (p > 0.05. These results suggested that soil polluted by WMO could be recovering by applying integrated BR and PR better than just using one type.
Pessegueiro: cultivar BRS kampai
Directory of Open Access Journals (Sweden)
Maria do Carmo Bassols Raseira
2010-12-01
Full Text Available RESUMO O programa de Melhoramento Genético de Pessegueiros da Embrapa Clima Temperado tem, entre seus objetivos, a obtenção de cultivares produtoras de frutas para consumo in natura, com características que satisfaçam às exigências dos consumidores. Alguns dos grandes centros consumidores, como é o caso de São Paulo e Curitiba, preferem pêssegos de polpa branca e sabor doce. A cultivar BRS Kampai, obtida de um cruzamento entre 'Chimarrita' e 'Flordaprince', alia a baixa necessidade em frio, o que é uma vantagem em regiões subtropicais, à boa aparência, com sabor superior a qualquer um dos parentais. A colheita dos frutos desta cultivar inicia-se geralmente, em meados de novembro, em Pelotas-RS (em Atibaia, São Paulo, inicia-se na segunda quinzena de outubro, poucos dias antes das cultivares Rubimel (polpa amarela e Premier (polpa branca, sendo ótima substituta para esta última.
'Galega Vulgar' - yield indices and quality of elementary olive oil
International Nuclear Information System (INIS)
Almeida, F.; Vitorino, M.C.; Henriques, L.R.; Peres, M.F.
1998-01-01
This paper shows the evolution of two olive yield indexes (humidity and fat) and three olive oil quality parameters (acidity, peroxid value and UV absorbances) for cv. Galega vulgar from the olive grove Quinta Senhora de Mercules, Castelo Branco, during the 1995/96 harvest. It shows also the evolution of fatty acid composition of the same olive oil [pt
RADISH CULTIVARS BRED AT VNIISSOK AND THEIR USE
Directory of Open Access Journals (Sweden)
M. I. Fedorova
2016-01-01
Full Text Available On the base of comparative assessment and average data estimation from 2010 to 2015, the characteristics of 11 cultivars bred at VNIISSOK were described regarding yield capacity and its components, variation, interdependencies at two sowing terms winter,spring time, direction of selection and cultivar uses at cultivar maintaining breeding program. Cultivar 'Koroleva Margo' is rather used in breeding program for yield capacity and taste qualities. Cultivar 'Sonata' is a source of such features as early maturity, valuable biochemical content and low nitrate accumulation. Cultivar 'Sofit' is known to bear early maturity and simultaneous seed maturation. 'Ariya' is a source of cylindrical root shape and early maturation. Cultivar 'Teplichnyi Gribovskyi' is used in breeding program for early maturation and simultaneous seed maturation. Cultivar 'Feya' bearsresistance to bolting and valuable biochemical substances. Cultivar 'Variant' has such features as root density, ability to grow under low lighting, short-term storability. Purple-red with white tips is a newmade cultivar 'Mavr' suitable for breeding program for valuable biochemical content, unusual root color, also bearing male sterile forms (MS for heterosis hybrid breeding. Out of all cultivars regarded, 'Mokhovskiy' is only a genetic source to breed radish forms with edible leaves. The positive weak dependence was revealed between cultivar biochemical characteristics, root weight, dry matter content, and nitrate content; whereas the positive middle dependence is revealed with sugar contents and negative dependence with ascorbic acid content. According to iochemical characteristics, the best cultivar population as 'Ariya', 'Sonata' (ascorbic acid; Mavr, Sonata, Variant (dry matter, sugars have been chosen. Cultivars 'Koroleva Margo', Pheya, Sonata, Sophit, Mokhovskiy are the initial breeding accessions for selection of new cultivar population, MS and MF lines needed for heterosis.
Development of DArT-based PCR markers for selecting drought-tolerant spring barley.
Fiust, Anna; Rapacz, Marcin; Wójcik-Jagła, Magdalena; Tyrka, Mirosław
2015-08-01
The tolerance of spring barley (Hordeum vulgare L.) cultivars to spring drought is an important agronomic trait affecting crop yield and quality in Poland. Therefore, breeders require new molecular markers to select plants with lower spring drought susceptibility. With the advent of genomic selection technology, simple molecular tools may still be applicable to screen material for markers of the most important traits and in-depth genome scanning. In previous studies, diversity arrays technology (DArT)-based genetic maps were constructed for F2 populations of Polish fodder and malt barley elite breeding lines, and 15 and 18 quantitative trait loci (QTLs) related to spring drought tolerance were identified, respectively. In this paper, we show the results of a conversion of 30 DArT markers corresponding to 11 QTLs into simple sequence repeat (SSR) and sequence tagged site (STS) markers. Twenty-two polymorphic markers were obtained, including 13 DArT-based SSRs. Additionally, 31 SSR markers, located in close proximity to the DArT markers, were selected from the GrainGenes database and tested. Further analyses of 24 advanced breeding lines with different drought tolerances confirmed that five out of the 30 converted markers, as well as three out of the 31 additional SSR markers, were effective in marker-assisted selection for drought tolerance. The possible function of clones related to these markers in drought tolerance is discussed.
Directory of Open Access Journals (Sweden)
Muhammad B. Gill
2017-11-01
Full Text Available Waterlogging and salinity are two major abiotic stresses that hamper crop production world-wide resulting in multibillion losses. Plant abiotic stress tolerance is conferred by many interrelated mechanisms. Amongst these, the cell’s ability to maintain membrane potential (MP is considered to be amongst the most crucial traits, a positive relationship between the ability of plants to maintain highly negative MP and its tolerance to both salinity and waterlogging stress. However, no attempts have been made to identify quantitative trait loci (QTL conferring this trait. In this study, the microelectrode MIFE technique was used to measure the plasma membrane potential of epidermal root cells of 150 double haploid (DH lines of barley (Hordeum vulgare L. from a cross between a Chinese landrace TX9425 and Japanese malting cultivar Naso Nijo under hypoxic conditions. A major QTL for the MP in the epidermal root cells in hypoxia-exposed plants was identified. This QTL was located on 2H, at a similar position to the QTL for waterlogging and salinity tolerance reported in previous studies. Further analysis confirmed that MP showed a significant contribution to both waterlogging and salinity tolerance. The fact that the QTL for MP was controlled by a single major QTL illustrates the power of the single-cell phenotyping approach and opens prospects for fine mapping this QTL and thus being more effective in marker assisted selection.
Photoperiod-H1 (Ppd-H1) Controls Leaf Size1[OPEN
Digel, Benedikt; Tavakol, Elahe; Verderio, Gabriele; Xu, Xin
2016-01-01
Leaf size is a major determinant of plant photosynthetic activity and biomass; however, it is poorly understood how leaf size is genetically controlled in cereal crop plants like barley (Hordeum vulgare). We conducted a genome-wide association scan for flowering time, leaf width, and leaf length in a diverse panel of European winter cultivars grown in the field and genotyped with a single-nucleotide polymorphism array. The genome-wide association scan identified PHOTOPERIOD-H1 (Ppd-H1) as a candidate gene underlying the major quantitative trait loci for flowering time and leaf size in the barley population. Microscopic phenotyping of three independent introgression lines confirmed the effect of Ppd-H1 on leaf size. Differences in the duration of leaf growth and consequent variation in leaf cell number were responsible for the leaf size differences between the Ppd-H1 variants. The Ppd-H1-dependent induction of the BARLEY MADS BOX genes BM3 and BM8 in the leaf correlated with reductions in leaf size and leaf number. Our results indicate that leaf size is controlled by the Ppd-H1- and photoperiod-dependent progression of plant development. The coordination of leaf growth with flowering may be part of a reproductive strategy to optimize resource allocation to the developing inflorescences and seeds. PMID:27457126
Photoperiod-H1 (Ppd-H1) Controls Leaf Size.
Digel, Benedikt; Tavakol, Elahe; Verderio, Gabriele; Tondelli, Alessandro; Xu, Xin; Cattivelli, Luigi; Rossini, Laura; von Korff, Maria
2016-09-01
Leaf size is a major determinant of plant photosynthetic activity and biomass; however, it is poorly understood how leaf size is genetically controlled in cereal crop plants like barley (Hordeum vulgare). We conducted a genome-wide association scan for flowering time, leaf width, and leaf length in a diverse panel of European winter cultivars grown in the field and genotyped with a single-nucleotide polymorphism array. The genome-wide association scan identified PHOTOPERIOD-H1 (Ppd-H1) as a candidate gene underlying the major quantitative trait loci for flowering time and leaf size in the barley population. Microscopic phenotyping of three independent introgression lines confirmed the effect of Ppd-H1 on leaf size. Differences in the duration of leaf growth and consequent variation in leaf cell number were responsible for the leaf size differences between the Ppd-H1 variants. The Ppd-H1-dependent induction of the BARLEY MADS BOX genes BM3 and BM8 in the leaf correlated with reductions in leaf size and leaf number. Our results indicate that leaf size is controlled by the Ppd-H1- and photoperiod-dependent progression of plant development. The coordination of leaf growth with flowering may be part of a reproductive strategy to optimize resource allocation to the developing inflorescences and seeds. © 2016 American Society of Plant Biologists. All rights reserved.
Directory of Open Access Journals (Sweden)
Mejdoub Hafedh
2011-09-01
Full Text Available Abstract Background In order to validate its antiseptic and anticancer properties with respect to traditional uses, we have screened for the first time the antimicrobial activity of aerial parts of M. vulgare L. essential oil against different pathogenic microorganisms and the cytotoxic activity against HeLa cell lines. Methods The agar disk diffusion method was used to study the antibacterial activity of M. vulgare essential oil against 12 bacterial and 4 fungi strains. The disc diameters of zone of inhibition (DD, the minimum inhibitory concentrations (MIC and the concentration inhibiting 50% (IC50 were investigated to characterize the antimicrobial activities of this essential oil. The in vitro cytotoxicity of M. vulgare essential oil was examined using a modified MTT assay; the viability and the IC50 were used to evaluate this test. Results The antimicrobial activity of the essential oil was investigated in order to evaluate its efficacy against the different tested microorganisms. The present results results showed a significant activity against microorganisms especially Gram (+ bacteria with inhibition zones and minimal inhibitory concentration values in the range of 6.6-25.2 mm and 1120-2600 μg/ml, respectively, whereas Gram (- bacteria exhibited a higher resistance. As far as the antifungal activity, among four strains tested, Botrytis cinerea exhibited the strongest activity with inhibition zones of 12.6 mm. However, Fusarium solani, Penicillium digitatum and Aspergillus niger were less sensitive to M. vulgare essential oil. About the citotoxicity assay, this finding indicate the capability of this essential oil to inhibited the proliferation of HeLa cell lines under some conditions with IC50 value of 0.258 μg/ml. Conclusion This investigation showed that the M. vulgare essential oil has a potent antimicrobial activity against some Gram (+ pathogenic bacteria and Botrytis cinerea fungi. The present studies confirm the use of this
Yield and quality of strawberry cultivars Produtividade e qualidade de cultivares de morangueiro
Directory of Open Access Journals (Sweden)
Luis Eduardo C Antunes
2010-06-01
Full Text Available The strawberry cultivation is an important economic activity in the Rio Grande do Sul State, Brazil, however the number of offered cultivars to the growers is reduced. The yield and quality of strawberry (Fragaria x ananassa Duch. cultivars Camarosa, Galexia, Earlibrite, Festival, Plarionfre and Sabrosa was evaluated under the climatic conditions of Pelotas, Rio Grande do Sul State. We determined the number, mass, total soluble solids (TSS ºBrix, total titratable acidity (TTA, antocianin level and fresh fruits produced in an experimental unit. We also determined the production of fruits per hectare and per plant. The statistical design used in the experiment was of completely randomized blocks with 6 treatments (cultivars and 4 replicates where the experimental unit was composed of 8 plants. The harvest began in the first half of August, extending to the second half of December, totalling 20 weeks. Plarionfre, Earlibrite and Festival cultivars showed higher production from the first half of October until the end of the first half of November. Camarosa reached higher productivity, mass of plants and fruit weight. There were no differences between the evaluated cultivars in the levels of TSS, antocianin, ATT and pH during the period of evaluation.No estado do Rio Grande do Sul o cultivo do morangueiro é uma atividade econômica importante, entretanto o número de cultivares disponíveis no mercado é bastante reduzido. Assim buscou-se com este trabalho avaliar a produtividade e a qualidade dos frutos de cultivares de morangueiro (Fragaria x ananassa Duch., Camarosa, Galexia, Earlibrite, Festival, Plarionfre e Sabrosa, cultivados nas condições climáticas e de solo do município de Pelotas, RS. Determinaram-se, o número, massa fresca e teor de sólidos solúveis totais (SST (expresso em ºBrix, acidez total titulável (ATT (expresso em % de ácido cítrico e teor de antocianinas, dos frutos produzidos por unidade experimental. Determinou
Pathogenic Streptomyces spp. abundance affected by potato cultivars.
Nahar, Kamrun; Goyer, Claudia; Zebarth, Bernie J; Burton, David L; Whitney, Sean
2018-04-16
Potato cultivars vary in their tolerance to common scab (CS), however how they affect CS-causing Streptomyces spp. populations over time is poorly understood. This study investigated the effects of potato cultivar on pathogenic Streptomyces spp. abundance, measured using quantitative PCR, in three spatial locations in a CS-infested field: 1) soil close to the plant (SCP); 2) rhizosphere (RS); and 3) geocaulosphere (GS) soils. Two tolerant (Gold Rush, Hindenburg) and two susceptible cultivars (Green Mountain, Agria) were tested. The abundance of pathogenic Streptomyces spp. significantly increased in late August compared with other dates in RS of susceptible cultivars in both years. Abundance of pathogenic Streptomyces spp., when averaged over locations and time, was significantly greater in susceptible cultivars compared with tolerant cultivars in 2014. Principal coordinates analysis showed that SCP and RS soil properties (pH, organic carbon and nitrogen concentrations) explained 68% and 76% of total variation in Streptomyces spp. abundance among cultivars in 2013, respectively, suggesting that cultivars influenced CS pathogen growth conditions. The results suggested that the genetic background of potato cultivars influenced the abundance of pathogenic Streptomyces spp., with 5 to 6 times more abundant Streptomyces spp. in RS of susceptible cultivars compared with tolerant cultivars, which would result in substantially more inoculum left in the field after harvest. .
Directory of Open Access Journals (Sweden)
Rogério Faria Vieira
2008-06-01
Full Text Available Mungbean cultivar MGS Esmeralda was developed by Asian Vegetable Research and Development Center (Shanhua, Taiwan, as a result of crossing between the lines VC 1973A and VC 2768A. In ten trials conducted in the State of Minas Gerais, Brazil, it produced 13.5% more grains than 'Ouro Verde MG-2' (control cultivar, and its highest yield was 2,550 kg ha-1. The cultivar MGS Esmeralda is more susceptible to lodging, and its pods mature more uniformly than Ouro Verde MG-2 pods. One hundred-seed mass of 'MGS Esmeralda' ranged between 5.5 and 6.8 g. Both cultivars are susceptible to powdery mildew and cercospora leaf spot.A cultivar de mungo-verde MGS Esmeralda foi criada pelo Asian Vegetable Research and Development Center, localizado em Shanhua, Formosa. Ela é resultado do cruzamento entre as linhagens VC 1973A e VC 2768A. Em dez ensaios conduzidos em Minas Gerais, ela produziu 13,5% mais grãos do que a cultivar Ouro Verde MG-2 (testemunha, e sua produtividade mais alta foi 2.550 kg ha-1. A cultivar MGS Esmeralda é mais suscetível ao acamamento do que a Ouro Verde MG-2, mas suas vagens amadurecem mais uniformemente. A massa de 100 grãos da 'MGS Esmeralda' varia de 5,5 a 6,8 g. Ambas as cultivares são suscetíveis ao oídio e à cercosporiose.
Rezayat, Seyed Mahdi; Dehpour, Ahmad-Reza; Motamed, Saeed Mohammadi; Yazdanparast, Maryam; Chamanara, Mohsen; Sahebgharani, Mousa; Rashidian, Amir
2017-10-24
The aim of the present study is to investigate the protective effects of Foeniculum vulgare essential oil on intestinal inflammation through the inhibition of NF-kB pathway in acetic acid-induced rat colitis. Acute colitis was induced by intra-rectal administration of 2 mL of diluted acetic acid (4%) solution. Two hours after the induction of colitis, 0.2% tween 80 in normal saline, dexamethasone (2 mg/kg) and F. vulgare essential oil (100, 200, 400 mg/kg) were administered to the animals by oral gavage and continued for 5 consecutive days. Assessment of macroscopic and microscopic lesions was done. MPO activity was evaluated by biochemical method. Furthermore, TNF-α activity was detected by immunohistochemistry (IHC) and the expression level of p-NF-kB p65 protein was measured by western blot analysis. Dexamethasone and F. vulgare essential oil (200, 400 mg/kg) reduced the macroscopic and microscopic lesions compared to the acetic acid group (p kB p65 protein (p kB pathway.
Directory of Open Access Journals (Sweden)
Meysam Foroozandeh
2015-10-01
Full Text Available Background and Aim: Stroke is one of the most important factors of mortality and disability in the world. Free radicals are produced following ischemic stroke and they play a central role in breaking the blood-brain barrier and causing brain edema formation. The aim of the current study was to evaluate the effect of hydro- alcoholic extract of Origanum vulgare on brain edema and neurologic deficit in a rat stroke model. Materials and Methods: In thisexperimental study, 35 male Wistar rats were randomly divided into 5 equal groups. The first two groups (control and Sham received distilled water, while three treatment groups received oral Origanum vulgare extract for 30days (50,75and 100 mg/kgdaily, respectively. Two hours after the last dose of Origanum vulgare extract,each main group underwent a 60 min middle cerebral artery occlusion. Then, the assessment of blood brain edema, and neurologic deficits analysis were done . Brain edema (brain water content was analyzed by One-Way ANOVA using LSD method and neurologic deficits analysis by means of Mann-Whitney U, and P<0.05 was taken as the significant level. Results: Origanum vulgare extract reduced brain edema in the experimental groups of 50 (82.49±0.47, 75 (80.89±0.63 and 100 mg/kg/day (80.80±0.66 compared to the control group (84.46±0.67. The neurologic deficit scores in the experimental groups of 75and 100mg/kg/day, compared with control group, but neurologic deficit scores did not affect the group receiving the dose 50 mg/kg. Conclusion: The obtained data indicate that Origanum vulgar extract via reduction of brain edema and neurologic deficits scorescan have a protective effect on the stroke model.
Vaz Patto, M.C.; Rubiales, D.; Martin, A.; Hernandez, P.; Lindhout, W.H.; Niks, R.E.; Stam, P.
2003-01-01
In cereals, rust fungi are among the most harmful pathogens. Breeders usually rely on short-lived hypersensitivity resistance. As an alternative, "avoidance" may be a more durable defence mechanism to protect plants to rust fungi. In Hordeum chilense avoidance is based on extensive wax covering of
Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...
African Journals Online (AJOL)
user
2011-01-31
Jan 31, 2011 ... Grain flour starch pasting and malt qualities were analyzed. .... bags and stored in a cool place (ca. ... Pasting properties of four malting barely varieties grain flour starches and the effect of three fungicide (propiconazole) spray.
DEFF Research Database (Denmark)
Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach
2011-01-01
During germination of barley seeds, mobilization of protein is essential and cysteine proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins. Cysteine proteases exist as pro-enzyme and is activated through reduction of the active...... site cysteines and by removal of the pro-domain. The complement of cysteine proteases is comprehensive and for detailed studies of the individual components of this complement, a fast and efficient eukaryotic expression platform is highly desirable. A cDNA clone of the barley key cysteine endoprotease...
Latent manganese deficiency increases transpiration in barley (Hordeum vulgare)
DEFF Research Database (Denmark)
Hebbern, Christopher Alan; Laursen, Kristian Holst; Ladegaard, Anne Hald
2009-01-01
To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements...
Frequency of Aneuploids in Progenies of Autotriploid Barley, Hordeum Vulgare L
DEFF Research Database (Denmark)
Sandfær, J.
1979-01-01
Chromosome counts of 863 progeny plants originating from 68 autotriploid barley plants revealed a considerable variation in chromosome numbers ranging from the diploid number (2n= 14) to 2n= 39. The most frequent groups were plants with 15 and 16 chromosomes each constituting about 27% of all pro...
Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...
African Journals Online (AJOL)
user
2011-01-31
Jan 31, 2011 ... 76.6 to 79.7%). The varieties had a pasting- time and -temperature (Ti) of 4.7 to 5.0 min and 64.7 to .... 16°C) (Termaks chamber KBP 6395F, Bergen, Norway). Each .... varieties in the peak viscosity is in part attributed to the.
Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare
Scheu, Arne Hagen August
2017-01-01
Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.
Phosphorus acquisition by barley (Hordeum vulgare L. at suboptimal soil temperature
Directory of Open Access Journals (Sweden)
Kari Ylivainio
2012-12-01
Full Text Available We studied the effects of soil temperature (8 ºC and 15 ºC on barley growth, barley phosphorus (P uptake and soil P solubility. Barley was grown in a pot experiment in two soils with different P fertilization histories for 22 years. The availability of P was estimated by using 33P-labeled fertilizer and calculating L-values. After cultivation for 22 years at ambient soil temperature without P fertilization (-P, soil L-value had decreased compared to soil that received annual P fertilization (P+. Low soil temperature further reduced the L-values, more in the -P soil than in the +P soil. Our results demonstrated that P fertilization can only partially ameliorate poor growth at low soil temperatures. Thus, applying ample fertilization to compensate for poor growth at low soil temperatures would increase the P content and solubility in the soil, but plant uptake would remain inhibited by cold.
Malt quality of 4 barley ( Hordeum vulgare L.) grain varieties grown ...
African Journals Online (AJOL)
propiconazole) spray intervals (7, 14, 21 day) and no spray control were arranged in a RCBD in 4 replications to assess net blotch (Pyrenophora teres) effect on malt quality. The varieties were grown at Holetta agricultural research center in 2005, ...
BIOCHEMICAL COMPOSITION AND NUTRITIONAL EVALUATION OF BARLEY RIHANE (HORDEUM VULGARE L.).
Lahouar, Lamia; Ghrairi, Fatma; El Arem, Amira; Medimagh, Sana; El Felah, Mouledi; Salem, Hichem Ben; Achour, Lotfi
2017-01-01
Many experimental studies have suggested an important role for barley Rihane(BR)in the prevention of colon cancer and cardiovascular diseases. The objective of this study was to evaluate the physico-chemical properties and nutritional characterizations of BR compared to other varieties grown in Tunisia (Manel, Roho and Tej). Total, insoluble and soluble dietary fiber(β-glucan), total protein, ash and some minerals of BR and Tunisian barley varieties were determined. The results revealed that BR is good source of dietary fiber mainly β-glucan compared to the other varieties. This variety is a relatively rich source of phosphorous and potassium and it contains many important unsaturated fatty acids. BR has higher nutritional value than other varieties. Barley Rihane has significant nutritional characterizations compared to others Tunisian barleys varieties. Abbreviations: BR, Barley Rihane; LDL, low density lipoprotein; HDL, high density lipoprotein; AOM, azoxymethane; TBV, Tunisian barley varieties; TGW, thousand grain weight; SW, weight specific; TDF, total dietary fiber; IDF, insoluble dietary fiber; SDF, soluble dietary fiber; DM, Dry Matter.
Growth and yield of barley (Hordeum vulgare L.) as affected by ...
African Journals Online (AJOL)
Bheema
(2003) reported that about 65% of grain yield variability in barley was attributed to ... of those of the respective non-stressed environments (Cantero-Martínez et ... production stability of barley (Fekadu and Skjelvåg, 2002) and nitrogen and phosphorus are .... of SAS version 9.1 for analysis of variance of non-orthogonal data.
In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species
Directory of Open Access Journals (Sweden)
Ertuğrul Filiz
2013-01-01
Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.
Souza, Evandro Leite de; Stamford, Tânia Lúcia Montenegro; Lima, Edeltrudes de Oliveira
2006-01-01
Origanum vulgare L. (oregano), Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growt...
Cadmium accumulation in different rice cultivars and screening for pollution-safe cultivars of rice.
Yu, Hui; Wang, Junli; Fang, Wei; Yuan, Jiangang; Yang, Zhongyi
2006-11-01
Large areas of contaminated land are being used for agricultural production in some countries due to the high demand for food. To minimize the influx of pollutants to the human food chain through consumption of agricultural products, we propose the concept of pollution-safe cultivars (PSCs), i.e. cultivars whose edible parts accumulate a specific pollutant at a level low enough for safe consumption, even when grown in contaminated soil. We tested the feasibility of the PSC concept by growing 43 cultivars of paddy rice (Oryza sativa L., including 20 normal and 23 hybrid cultivars) under a high (75.69-77.55 mg kg(-1)) and a low (1.75-1.85 mg kg(-1)) cadmium (Cd) exposure. These pot experiments took place in the spring and summer of 2004. At the low level of Cd exposure, 30 out of the 43 tested cultivars were found to be Cd-PSCs. Grain Cd concentrations were highly correlated (price grain is genotype-dependent and that the selection of PSCs is possible, at least at a certain level of soil contamination. No Cd-PSCs were found under the high level of Cd exposure. Yield was enhanced in some cultivars and depressed in others in response to elevated soil Cd, indicating that farmers cannot rely on yield depression as an indicator of toxicity of the grains. It is therefore important and feasible to screen for PSCs and to establish PSC breeding programs to effectively and efficiently reduce the risk of human exposure to soil pollutants, such as Cd, through crop consumption.
Teixeira, Bárbara; Marques, António; Ramos, Cristina; Serrano, Carmo; Matos, Olívia; Neng, Nuno R; Nogueira, José M F; Saraiva, Jorge Alexandre; Nunes, Maria Leonor
2013-08-30
There is a growing interest in industry to replace synthetic chemicals by natural products with bioactive properties. Aromatic plants are excellent sources of bioactive compounds that can be extracted using several processes. As far as oregano is concerned, studies are lacking addressing the effect of extraction processes in bioactivity of extracts. This study aimed to characterise the in vitro antioxidant and antibacterial properties of oregano (Origanum vulgare) essential oil and extracts (in hot and cold water, and ethanol), and the chemical composition of its essential oil. The major components of oregano essential oil were carvacrol, β-fenchyl alcohol, thymol, and γ-terpinene. Hot water extract had the strongest antioxidant properties and the highest phenolic content. All extracts were ineffective in inhibiting the growth of the seven tested bacteria. In contrast, the essential oil inhibited the growth of all bacteria, causing greater reductions on both Listeria strains (L. monocytogenes and L. innocua). O. vulgare extracts and essential oil from Portuguese origin are strong candidates to replace synthetic chemicals used by the industry. © 2013 Society of Chemical Industry.
Esterase polymorphism marking cultivars of Manihot esculenta, Crantz
Directory of Open Access Journals (Sweden)
Adriana Gazoli Resende
2004-07-01
Full Text Available Esterase isozymes were used to detected substrate-preference polymorphism in twenty cultivars of Manihot esculenta, and to show cultivar-specific variation of this species. A relatively complex extraction solution of proteins from leaves was needed to show a larger number of esterase isozymes. Similarity between cultivars from six groups ranged from 51 to 96%. The cultivars identified by the same name seemed to be biochemically different regarding esterase isozymes. Esterase isozyme electrophoretic patterns could, therefore, be used to discriminate the cultivars identified by the same name, and to monitor the vegetative propagation of cultivars maintained in the germplasm collection. In breeding strategies, isoesterase analysis could be used to avoid intercrossing between the similar genotypes.Isoenzimas esterases foram usadas no presente estudo, para detectar polimorfismos específicos para diferentes substratos em vinte cultivares de Manihot esculenta, e para mostrar variações específicas de cultivares nesta espécie. Os diferentes cultivares de M. esculenta tem sido mantidos na coleção de germoplasma do Departamento de Agronomia da Universidade Estadual de Maringá (Maringá, PR, e foram provenientes de cultivares tradicionais coletados nas regiões sudoeste e noroeste do Estado. Foi necessário a utilização de uma solução de extração de proteínas relativamente mais complexa, para evidenciar um maior número de isoenzimas esterases. A similaridade entre os cultivares variou de 51 a 96%. Cultivares identificados pelo mesmo nome parecem ser bioquimicamente diferentes para as isoenzimas esterases. Os padrões eletroforéticos das isoesterases podem, portanto, serem usados para discriminar os cultivares que são identificados pelo mesmo nome, e para monitorar a propagação vegetativa dos cultivares mantidos na coleção de germoplasma. A análise das isoesterases pode também ser usada para evitar cruzamentos entre genótipos mais
Dracatos, Peter M; Khatkar, Mehar S; Singh, Davinder; Park, Robert F
2014-12-20
Barley is an important cereal crop cultivated for malt and ruminant feed and in certain regions it is used for human consumption. It is vulnerable to numerous foliar diseases including barley leaf rust caused by the pathogen Puccinia hordei. A temporarily designated resistance locus RphCantala (RphC) identified in the Australian Hordeum vulgare L. cultivar 'Cantala' displayed an intermediate to low infection type (";12 = N") against the P. hordei pathotype 253P- (virulent on Rph1, Rph2, Rph4, Rph6, Rph8 and RphQ). Phenotypic assessment of a 'CI 9214' (susceptible) x 'Stirling' (RphC) (CI 9214/Stirling) doubled haploid (DH) population at the seedling stage using P. hordei pathotype 253P-, confirmed that RphC was monogenically inherited. Marker-trait association analysis of RphC in the CI 9214/Stirling DH population using 4,500 DArT-seq markers identified a highly significant (-log10Pvalue > 17) single peak on the long arm of chromosome 5H (5HL). Further tests of allelism determined that RphC was genetically independent of Rph3, Rph7, Rph11, Rph13 and Rph14, and was an allele of Rph12 (Rph9.z), which also maps to 5HL. Multipathotype tests and subsequent pedigree analysis determined that 14 related Australian barley varieties (including 'Stirling' and 'Cantala') carry RphC and that the likely source of this resistance is via a Czechoslovakian landrace LV-Kvasice-NA-Morave transferred through common ancestral cultivars 'Hanna' and 'Abed Binder'. RphC is an allele of Rph12 (Rph9.z) and is therefore designated Rph9.am. Bioinformatic analysis using sequence arrays from DArT-seq markers in linkage disequilibrium with Rph9.am identified possible candidates for further gene cloning efforts and marker development at the Rph9/Rph12/Rph9.am locus.
Directory of Open Access Journals (Sweden)
Zbigniew Borecki
2013-12-01
Full Text Available The severe winter which occurred in Poland in 1986-1987 damaged the most part of scab resistant apple cultivars and selected apple hybrids. Cold hardiness studied in 1987 and 1988 showed significant differences in degree of frost injury on stem, branches, twigs and buds of apple trees. Two scab-resistance cultivars, namely Florina and Sir Prize, as well as two check culuvars, Idared and Golden Delicious, were killed by frost. Strong damages were noted in cultivars: Prima, Primula, and Priam. Lower susceptibility showed: Jonafree, Gavin, Liberty Sister and three hybrids selected from crosses of Bankroft with scab-resistant Primula. Relatively frost resistant was Novamac and three hybrids of U-breeding line: U-1101 and U-50, originated from crosses of polish culrivar Fantazja (McIntosh x Linda with Primula, Highest resistance to frost showed cultivars: Freedom. Liberty. new polish cultivar Witos (Fantazja x Primula and three hybrids: U-337, U-237 and U-1098. During the 1987 and 1988 seasons severe infection of apple trees by numerous fungi was noted. Twelve species of isolated fungi were identified as pathogens of apple trees bark and wood.
Sensitivity of tomato cultivars to sulfur dioxide
Energy Technology Data Exchange (ETDEWEB)
Howe, T.K.; Woltz, S.S.
1982-04-01
The sensitivity of 26 cultivars of tomato (Lycopersicon esculentum Mill.) were compared at 2 concentrations of SO/sub 2/in specially designed exposure greenhouses. Cultivars studied included fresh market, processing, and specialty types. Insensitive and sensitive cultivars were identified by assessment of acute SO/sub 2/-induced foliar necrosis. Cultivars found to be insensitive to SO/sub 2/ included: 'Ace', 'Bonanza', 'Heinz 1350', 'Tarquinia Tondino', and 'VF 145-B 7879'. Cultivars found to be sensitive to SO/sub 2/ included: 'Bellarina', 'Chico III', 'Flora-Dade', 'Red Cherry Large' 'Sub-Arctic Delight', and 'Vetomold. 10 figures, 1 table.
UEL 7: nova cultivar de Dendrobium UEL 7: a new Dendrobium cultivar
Directory of Open Access Journals (Sweden)
Ricardo Tadeu de Faria
2011-09-01
Full Text Available UEL 7 é uma cultivar de Dendrobium nobile desenvolvida no Departamento de Agronomia da Universidade Estadual de Londrina resultante do cruzamento das plantas matrizes D3 x D8 e selecionada pela coloração das flores amarelas e com largura e comprimento semelhantes (7,0 cm, formando praticamente um círculo. As plantas foram polinizadas artificialmente, e as sementes semeadas em meio de cultura in vitro. A cultivar apresenta flores de coloração amarela, labelo com o centro marrom escuro e o pseudobulbo apresenta em mé dia 11 flores. As flores têm durabilidade de aproximadamente 30 dias.UEL 7 is a Dendrobium nobile's cultivar developed at The Department of Agronomy of Universidade Estadual de Londrina and is the result of the crossing between D3 x D8 and selected for its yellow flowers and format with similar width and length (7.0 cm, almost forming a circle. The plants were pollinated artificially, and the seeds sowed in growth media in vitro. The cultivar presents flowers of yellow coloration, labelo with the center dark brown color and the pseudobulb presents 11 flowers on average. The flowers durability is about 30 days.
Weigt, Dorota; Kiel, Angelika; Nawraca?a, Jerzy; Pluta, Mateusz; ?acka, Agnieszka
2016-01-01
Solid-stemmed spring wheat cultivars (Triticum aestivum L.) are resistant to the stem sawfly (Cephus cinctus Nort.) and lodging. Anthers of 24 spring wheat cultivars with varying content of pith in the stem were used in the experiment. All were classified into three groups: solid, medium?solid and hollow stems. There was considerable influence of the cultivar on callus formation and green plant regeneration. The highest efficiency of green plant regeneration (24%) was observed for the solid-s...
Mercury in mercury(II)-spiked soils is highly susceptible to plant bioaccumulation.
Hlodák, Michal; Urík, Martin; Matúš, Peter; Kořenková, Lucia
2016-01-01
Heavy metal phytotoxicity assessments usually use soluble metal compounds in spiked soils to evaluate metal bioaccumulation, growth inhibition and adverse effects on physiological parameters. However, exampling mercury phytotoxicity for barley (Hordeum vulgare) this paper highlights unsuitability of this experimental approach. Mercury(II) in spiked soils is extremely bioavailable, and there experimentally determined bioaccumulation is significantly higher compared to reported mercury bioaccumulation efficiency from soils collected from mercury-polluted areas. Our results indicate this is not affected by soil sorption capacity, thus soil ageing and formation of more stable mercuric complexes with soil fractions is necessary for reasonable metal phytotoxicity assessments.
Does heavy traffic have long term implications for crop yields?
DEFF Research Database (Denmark)
Nielsen, J. Aa.; Munkholm, Lars Juhl; Schjønning, Per
Danish soils are subject to increasingly heavier traffic. Today, wheel loads of 6-12 tons are common on e.g. slurry tankers, combines and sugar beet harvesters. Field trials were started in Denmark in spring 2010 to answer the question: "does heavy traffic have long term implications for crop...... by the contractors delivering the machinery for the experimentation. Each year, spring barley (Hordeum vulgare L.) was established after the compaction treatments. s.ince 2013, investigations on biological tillage (root growth by pioneering crops) have been added to the trials. Significant yield losses up to 12.5 dt...
Adaptation of cotton cultivars | Wondimu | African Crop Science ...
African Journals Online (AJOL)
For each cultivar a linear regression of yield on the mean yield of all cultivars for each year was computed to measure cultivar adaptation. The cultivars with the highest mean yield exhibited a similar degree of adaptation to different environments with regression coefficient close to 1.0. For example, the breeding lines, Acala ...
Directory of Open Access Journals (Sweden)
Evandro Leite de Souza
2008-06-01
Full Text Available Origanum vulgare L. (oregano, Lamiaceae, essential oil has a variety of biological properties and its antimicrobial activity has received a renewed interest for use in food conservation. The aim of this study was to evaluate the interference of heating on the antimicrobial activity and chemical composition of O. vulgare essential oil. The antimicrobial activity of the essential oil kept at room temperature and exposed to different heating temperatures (60, 80, 100 and 120 °C during 1 hour was evaluated by observing antimicrobial effectiveness at absolute concentration and determining MIC values by the solid medium diffusion procedure. The essential oil chemical composition analysis was performed by GC-MS. O. vulgare essential oil showed interesting antimicrobial activity on all assayed microbial strains (Candida albicans, C.krusei, C. tropicalis, Bacillus cereus, Escherichia coli, Staphylococcus aureus, Yersinia enterocolitica, Salmonella enterica, Serratia marcencens, noted by large growth inhibition zones (30-42 mm. Heating treatment showed no significant interference (p O óleo essencial de Origanum vulgare L. Lamiaceae (orégano apresenta variadas propriedades biológicas, de modo que seu potencial antimicrobiano tem despertado interesse para uso na conservação de alimentos. Este estudo objetivou avaliar a interferência de diferentes tratamentos térmicos (60, 80, 100 e 120 °C/1 hora sobre a efetividade antimicrobiana e composição química do óleo essencial de O. vulgare. A efetividade antimicrobiana do óleo essencial exposto aos diferentes tratamentos térmicos foi avaliada através da observação de sua atividade antimicrobiana em concentração absoluta e através da determinação da sua CIM utilizando-se a técnica de difusão em meio sólido. O estudo da composição do óleo essencial foi realizado através de GC-MS. O óleo essencial apresentou intensa atividade antimicrobiana sobre todas as amostras microbianas ensaiadas
CULTIVAR RELEASE - BRSMG União: common bean cultivar with jalo grain for the state of Minas Gerais
Directory of Open Access Journals (Sweden)
Magno Antonio Patto Ramalho
2012-12-01
Full Text Available The bean cultivar BRSMG União as a new option of a bean cultivar with jalo grains for the state of Minas Gerais. The cultivar BRSMG União had an average grain yield of 9.8% above the mean of the controls (Jalo EEP 558 and BRS Radiante and was resistant to powdery-mildew.
Ramos, Guadalupe E; Lopez, Martin H; Flores, Antonio M; Figueroa, Guadalupe T; De Leon, Fernando G
2010-01-01
Xochimilco is an area of Mexico City fulfilling important ecological functions. However, the water of the canal network in the lacustrine zone of Xochimilco is supplied by the water treatment plants of the city, implying a risk of accumulated contaminants in the sediments. This study reports the effect of lixiviates obtained from sediments collected in the canals of Xochimilco on the growth of the alga Selenastrum capricornutum and the angiosperm Origanum vulgare. Three factors were tested: (a) water source in terms of the effluent from the two water treatment plants (urban waste-water, located at Cerro de la Estrella (CE) and urban-rural waters at San Luis Tlaxialtemalco (SLT); (b) sampling season (January, dry season; May and September, rainy season; and (c) distances from the water discharge point in the Xochimilco's main canal (5200 and 1000 m for CE, and 0, 200 m for SLT). The chemical water properties analyzed were: pH, electrical conductivity, N-NO(3), N-NH(3), N(Total), P-PO(4) and P(Total). The alga was more sensitive to the contaminants than O. vulgare, showing growth inhibition of 93-100%. The effect of sampling season on the inhibition of algal growth was ordered as follows: September > May > January. Lixiviates obtained from sediment samples 200 and 1000 m from the main point of water discharge caused a higher algal growth inhibition than the samples obtained at the source point. Lixiviate promoted the growth of seedlings of O. vulgare.
International Nuclear Information System (INIS)
Wu Huibin; Tang Shirong; Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai; Smith, Donald L.
2009-01-01
The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO 2 (860 μL L -1 ) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg -1 ). The results showed that elevated CO 2 not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO 2 treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO 2 could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO 2 , increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.
Morphological, mechanical and antioxidant properties of Portuguese almond cultivars
DEFF Research Database (Denmark)
Oliveira, Ivo; Meyer, Anne S.; Afonso, Silvia
2018-01-01
The aim of this study was to evaluate morphological (of fruit and kernel), mechanical (namely shell rupture force) and antioxidant properties (including phenolics and flavonoid content) of five Portuguese almond cultivars, comparing them with two commercial cultivars (Glorieta and Ferragnès). Of ...... high kernel weight, low percentages of double kernels or losses during shelling and considerable higher phenolics and flavonoids content may be considered by industry during selection of almond.......). Of the analyzed traits, nut and kernel dimensions varied substantially and were used to describe cultivars. However, some traditional cultivars recorded similar (Pegarinhos), or even higher (Amendoão, Casanova and Refêgo) nut and kernel weight than commercial cultivars. Furthermore, shelling percentage...... of traditional cultivar (Bonita) was higher than commercial cultivars. Rupture force necessary to break fruits of all traditional cultivars was higher than commercial ones, and was correlated to nut weight cultivars. The phenolics, flavonoids content and antioxidants were higher for Casanova. Parameters like...
Directory of Open Access Journals (Sweden)
D.F Biffe
2010-12-01
Full Text Available É importante avaliar a tolerância de variedade de mandioca a novas alternativas de controle químico, com o intuito de ampliar as opções disponíveis. Este trabalho teve como objetivo avaliar a seletividade de herbicidas aplicados em pré-emergência, para duas importantes variedades de mandioca cultivadas no Estado do Paraná. Os herbicidas e respectivas doses (g i.a. ha-1 avaliadas foram: diuron (400 e 800, metribuzin (360 e 720, isoxaflutole (60, atrazine (720, S-metolachlor (1.920 e as misturas ametryn + clomazone (1.350+1.900, ametryn+trifluralin (1.500+1.350, isoxaflutole+metribuzin (60+320, isoxaflutole+diuron (60+400, combinados com uso de uma testemunha dupla adjacente a cada tratamento. Os cultivares utilizados neste trabalho foram Fécula Branca e Fibra. Apenas o herbicida S-metolachlor, para ambos os cultivares, e metribuzin (360 g i.a. ha-1, para o cultivar Fibra, não provocaram injúrias. Atrazine provocou redução de estande para o cultivar Fécula Branca aos 60 DAP, mas não foi detectada redução na altura de plantas. Tanto atrazine (para os dois cultivares quanto diuron na dose de 800 g i.a. ha-1 (para o cultivar Fécula Branca afetaram a produtividade de raízes. Dessa forma, atrazine foi considerado não seletivo para ambos os cultivares, e a maior dose de diuron foi também considerada não seletiva para o cultivar Fécula Branca. Há diferenças de tolerância entre os cultivares, sendo o Fibra, de modo geral, mais tolerante aos herbicidas avaliados.It is important to evaluate the tolerance of cassava varieties under new weed chemical control alternatives. Thus, this study aimed to evaluate the selectivity of herbicides, applied at pre-emergence, for two important cassava varieties grown in the state of Paraná, Brazil. The herbicides and respective doses (g a.i. ha-1 were: diuron (400 and 800, metribuzin (360 and 720, isoxaflutole (60, atrazine (720, S-metolachlor (1,920 and mixtures ametryn+clomazone (1
Brassac, Jonathan; Blattner, Frank R
2015-09-01
Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.
Directory of Open Access Journals (Sweden)
LÓPEZ, A.N.
2012-04-01
Full Text Available ResumenLa colza (Brassica napus, B. campestris en siembra directa (SD representa una alternativa en los sistemas de rotación actuales. Armadillidium vulgare es una de las plagas principales de los cultivos en SD. El objetivo de este trabajo fue evaluar cebos de acción combinada como estrategia alternativa de control de dicha especie.Se realizaron ensayos de laboratorio y de campo con los siguientes tratamientos: testigo sin tratamiento químico; testigo químico (4 kg/ha de Carbaryl 8%, MataBiBos Acay; 3, 4 y 5 kg/ha de cebo de acción combinada (Carbaryl 8% + Metaldehído 4%, Dual Acay. Se evaluó el número de individuos de A. vulgare muertos, de plantas dañadas y de plantas sanas. En el laboratorio, a los 2, 3, 7 y 9 días después de la aplicación de los cebos, los tratamientos químicos se diferenciaron del testigo y no mostraron diferencias significativas entre ellos. Los tratamientos con aplicaciones de cebos presentaron un número de plantas sanas y totales mayorcon respecto al testigo. En el campo, se detectaron diferencias en el número de individuos muertos entre los tratamientos químicos y el testigo. No se observaron diferencias en la proporción de individuos muertos ni de plantas dañadas entre los tratamiento químicos, sí respecto al testigo. La presencia del molusquicida en el cebo de acción combinada no interfirió en el control de A. vulgare. Se concluye que el cebo de acción combinada representa una alternativa de control de A. vulgare eficaz, que permite la protección del cultivo de colza. AbstractOilseed rape (Brassica napus, B. campestris under No-Tillage (NT represents an alternative in the current crop rotation systems. Armadillidium vulgare is a principal pest in crops under NT. The aim of this study was to evaluate combined action baits as alternative strategy in the control of that species. Laboratory and fields traits were carried out with five treatments: control treatment without chemicals, positive
Directory of Open Access Journals (Sweden)
Lucía Delgadillo Ruíz
2017-01-01
Full Text Available Introducción . Los extractos de algunas plantas han demostrado tener propiedades antimicr o bianas relacionadas a ciertos compuestos químicos como son el timol, carvacrol, limoneno, linalol y terpineno. El objetivo del presente trabajo fue determinar la concentración de estos compue s tos en los extractos de Larrea tridentata , Origanum vulgare , Artemisa ludoviciana y Ruta graveolens ; así como evaluar su efecto antimicrobiano en Escherichia coli , Acinetoba c ter baumanii , Pseudomona sp y Staphyloc o ccus aureus . Método . Los extractos se obtuvieron por destilación simple empleando alcohol etílico como solvente, la composición química se evaluó mediante cromatografía de gases. La actividad antimicrobia na de cada uno de los extractos de plantas se realizó por los métodos difusión en pozo y difusión en disco. Resultados . Las bacterias mostraron diferentes grados de sensibilidad a los extractos, prese n tando inhibición de crecimiento S. aureus con el extra cto de O. vulgare y R. graveolens , mientras que la bacteria Pseudomona sp. , con los extracto s de A. ludoviciana, L. tridentata y O. vulgare . Discusión . La mayor concentración de timol y carvacrol se encontró en los extractos de O. vulgare y L. tridentata . El compuesto linalol se encontró en una proporción mayor en O. vulgare y en menor proporción en A. ludoviciana . Limoneno se encontró en los extractos de O. vulgare y R. graveolens . De las cuatro plantas evaluadas, el extracto de L. tridentata fue mejor , de bido a que presenta la mayor inhibición en comparación con los otros extractos; y con un efecto similar a los aceites empleados como control. La técnica de dif u sión en disco, permitió observar mejor los efectos inhibitorios de los extra c tos y los aceites s obre cada una de las bacterias empleadas en comparación con el método de difusión en pozo.
Salt Tolerance of Six Switchgrass Cultivars
Directory of Open Access Journals (Sweden)
Youping Sun
2018-04-01
Full Text Available Panicum virgatum L. (switchgrass cultivars (‘Alamo’, ‘Cimarron’, ‘Kanlow’, ‘NL 94C2-3’, ‘NSL 2009-1’, and ‘NSL 2009-2’ were evaluated for salt tolerance in two separate greenhouse experiments. In experiment (Expt. 1, switchgrass seedlings were irrigated with a nutrient solution at an electrical conductivity (EC of 1.2 dS·m−1 (control or a saline solution (spiked with salts at an EC of 5.0 dS·m−1 (EC 5 or 10.0 dS·m−1 (EC 10 for four weeks, once a week. Treatment EC 10 reduced the tiller number by 32% to 37% for all switchgrass cultivars except ‘Kanlow’. All switchgrass cultivars under EC 10 had a significant reduction of 50% to 63% in dry weight. In Expt. 2, switchgrass was seeded in substrates moistened with either a nutrient solution of EC 1.2 dS·m−1 (control or a saline solution of EC of 5.0, 10.0, or 20.0 dS·m−1 (EC 5, EC 10, or EC 20. Treatment EC 5 did not affect the seedling emergence, regardless of cultivar. Compared to the control, EC 10 reduced the seedling emergence of switchgrass ‘Alamo’, ‘Cimarron’, and ‘NL 94C2-3’ by 44%, 33%, and 82%, respectively. All switchgrass cultivars under EC 10 had a 46% to 88% reduction in the seedling emergence index except ‘NSL 2009-2’. No switchgrass seedlings emerged under EC 20. In summary, high salinity negatively affected switchgrass seedling emergence and growth. Dendrogram and cluster of six switchgrass cultivars indicated that ‘Alamo’ was the most tolerant cultivar, while ‘NSL 2009-2’ was the least tolerant cultivar at both seedling emergence and growth stages. A growth-stage dependent response to salinity was observed for the remaining switchgrass cultivars. ‘NSL 2009-1’ and ‘NL 94C2-3’ were more tolerant to salinity than ‘Cimarron’ and ‘Kanlow’ at the seedling emergence stage; however, ‘Kanlow’ and ‘Cimarron’ were more tolerant to salinity than ‘NSL 2009-1’ and ‘NL 94C2-3’ at the seedling growth
BRS Ana: cultivar de batata de duplo propósito BRS ANA: A dual purpose potato cultivar
Directory of Open Access Journals (Sweden)
Arione da S Pereira
2010-12-01
Full Text Available O genótipo BRS Ana é uma nova cultivar de batata adequada para fritura à francesa, com potencial de processamento na forma de palitos pré-fritos congelados e de flocos, liberada em 2007. Foi desenvolvida pelo Programa de Melhoramento de Batata da Embrapa (Clima Temperado, Pelotas-RS, Transferência de Tecnologia - Escritório de Canoinhas-SC e Hortaliças, Brasília-DF, com base na aparência e rendimento de tubérculos, peso específico e qualidade de fritura. Os tubérculos têm película vermelha, levemente áspera, polpa branca, formato oval e olhos rasos. O potencial produtivo é alto. No ecossistema subtropical, apresentou maior produtividade (31,2 t ha-1 que as cultivares mais plantadas no país, quando cultivada no outono, e não diferiu na primavera. Em ecossistema tropical, plantio da seca, a cultivar BRS Ana foi tão produtiva (33,8 t ha-1 quanto as demais cultivares avaliadas. Produziu maior percentagem de tubérculos graúdos (55,6% e peso médio dos tubérculos (108,4 g que as testemunhas no outono do ecossistema subtropical. Em ambos os ecossistemas, a cultivar BRS Ana apresentou elevados valores de peso específico (1,086 e conteúdo de matéria seca (19,7%. Nos testes sensoriais mostrou-se adequada à fritura na forma de palitos, tanto no preparo doméstico, quanto na industrialização. É moderadamente suscetível à requeima (Phytophthora infestans e tem boa resistência à pinta-preta (Alternaria solani. A reação à podridão-mole (Pectobacterium sp. é similar à das cultivares mais plantadas. Apresenta baixa degenerescência de sementes por viroses, conferida pela resistência moderadamente alta ao PVY e baixa incidência do PLRV. Suscetibilidade a distúrbios de origem fisiológica nos tubérculos não tem sido observada. No ecossistema subtropical a tuberização é mais tardia na primavera, devendo portanto ser plantada mais cedo.The genotype BRS Ana is a new potato cultivar adequate for French fries, with
Pukalskas, A.; Venskutonis, P.R.; Salido, S.; Waard, de P.; Beek, van T.A.
2012-01-01
In an earlier screening of Lithuanian plants, horehound (Marrubium vulgare) showed good antioxidant activity and as this species is used in herbal teas and cough pastilles it was selected for further investigation. Some fractions of the aerial parts were strong scavengers of the model free radicals
Pyrrolizidine Alkaloids from Echium vulgare in Honey Originate Primarily from Floral Nectar.
Lucchetti, Matteo A; Glauser, Gaetan; Kilchenmann, Verena; Dübecke, Arne; Beckh, Gudrun; Praz, Christophe; Kast, Christina
2016-06-29
Pyrrolizidine alkaloids (PAs) in honey can be a potential human health risk. So far, it has remained unclear whether PAs in honey originate from pollen or floral nectar. We obtained honey, nectar, and plant pollen from two observation sites where Echium vulgare L. was naturally abundant. The PA concentration of honey was determined by targeted analysis using a high pressure liquid chromatography-mass spectrometry system (HPLC-MS/MS), allowing the quantification of six different PAs and PA-N-oxides present in E. vulgare. Echium-type PAs were detected up to 0.153 μg/g in honey. Nectar and plant pollen were analyzed by nontargeted analysis using ultrahigh pressure liquid chromatography-high resolution-mass spectrometry (UHPLC-HR-MS), allowing the detection of 10 alkaloids in small size samples. Echium-type PAs were detected between 0.3-95.1 μg/g in nectar and 500-35000 μg/g in plant pollen. The PA composition in nectar and plant pollen was compared to the composition in honey. Echimidine (+N-oxide) was the main alkaloid detected in honey and nectar samples, while echivulgarine (+N-oxide) was the main PA found in plant pollen. These results suggest that nectar contributes more significantly to PA contamination in honey than plant pollen.
Distinguishing Nonpareil marketing group almond cultivars through multivariate analyses.
Ledbetter, Craig A; Sisterson, Mark S
2013-09-01
More than 80% of the world's almonds are grown in California with several dozen almond cultivars available commercially. To facilitate promotion and sale, almond cultivars are categorized into marketing groups based on kernel shape and appearance. Several marketing groups are recognized, with the Nonpareil Marketing Group (NMG) demanding the highest prices. Placement of cultivars into the NMG is historical and no objective standards exist for deciding whether newly developed cultivars belong in the NMG. Principal component analyses (PCA) were used to identify nut and kernel characteristics best separating the 4 NMG cultivars (Nonpareil, Jeffries, Kapareil, and Milow) from a representative of the California Marketing Group (cultivar Carmel) and the Mission Marketing Group (cultivar Padre). In addition, discriminant analyses were used to determine cultivar misclassification rates between and within the marketing groups. All 19 evaluated carpological characters differed significantly among the 6 cultivars and during 2 harvest seasons. A clear distinction of NMG cultivars from representatives of the California and Mission Marketing Groups was evident from a PCA involving the 6 cultivars. Further, NMG kernels were successfully discriminated from kernels representing the California and Mission Marketing Groups with overall kernel misclassification of only 2% using 16 of the 19 evaluated characters. Pellicle luminosity was the most discriminating character, regardless of the character set used in analyses. Results provide an objective classification of NMG almond kernels, clearly distinguishing them from kernels of cultivars representing the California and Mission Marketing Groups. Journal of Food Science © 2013 Institute of Food Technologists® No claim to original US government works.
Directory of Open Access Journals (Sweden)
Suhartati Djarkasi1
2008-12-01
Full Text Available The aims of this research were to study the effect of temperature and storage on the oxidative stability of crude and refined canarium nut oil extracted from the seeds of Canarium indicum and Canarium vulgare. The experiment was designed to include storage of two type of canarium nut oil at two different temperatures for up to 35 days. The oils (crude and refined used had the similar condition. Parameter used for oxidative deterioration indicators were two peroxide value, TBARS (thiobarbituric acid reactive substances, and free fatty acid value. The result showed that refining oil can decrease component natural antioxidant of canarium oil cause more sensitive to the oxidation. Increased storage temperature can raise oxidation of crude and refined oils from both species Canarium. The peroxide values of crude and refined oils both Canarium indicum and Canarium vulgare stored at 30 °C were 2.17, 4.35, 3.36 and 3.77 meq O2/kg oil, respectively. When they were stored at 4C the similar results were 6.21, 19.09, 8.12 and 17.23 meq O2/kg oil. Furthermore, TBARS value of crude and refined oils both for Canarium indicum and Canarium vulgare stored 30C were 4.55, 7.78, 5.70 and 6.58 µmol MDA/kg oil. When they were stored at 40 °C the similar results were 9.99, 55.46, 12.46 and 43.62 µmol MDA/kg oil.
Performance of blueberry cultivars under mild winter conditions
Directory of Open Access Journals (Sweden)
José Gilberto Sousa Medeiros
2017-08-01
Full Text Available ABSTRACT: Evaluation of yield performance is important to find the most adapted blueberry cultivars in a particular region. This research aimed to evaluate the flowering and hasvesting periods, the production per plant, and fruit quality of eight rabbiteye blueberry cultivars (Aliceblue, Bluebelle, Bluegem, Briteblue, Climax, Delite, Powderblue, and Woodard and two highbush blueberries (Georgiagem and O’Neal, in mild winter conditions in Pinhais-PR. Flowering and harvesting periods, production, berry weight, size, pH, soluble solids, titratable acidity, ratio and color of the fruits were evaluated in the 2013/2014 and 2014/2015 growing seasons, when the plants had two and three years old, respectively. Cultivars flowered from August to September, and harvest was concentrated in November and December. Berry weight, size, pH, soluble solids and acidity varied among the cultivars. The average ratios of 14.97 and 13.39 for each crop proved that the cultivars have good fruit quality. There was little variation in fruit color in the two years evaluated. Blueberry cultivars showed the staining characteristics and physical and chemical attributes of quality compatible to blueberry from other traditional regions. Under mild winter conditions, young plants of rabbiteye blueberry cultivars, Climax, Delite, Bluegem and Powderblue, are the most productive, while the highbusch cultivars bear few fruits.
Directory of Open Access Journals (Sweden)
Isac N Rodrigues
2008-12-01
Full Text Available Na avaliação de cultivares de hortaliças, os rendimentos médios mais elevados nos ensaios de competição, associados a fatores de qualidade, são utilizados como critérios de recomendação para plantio. O presente trabalho teve como objetivo avaliar as cultivares de alface Frisella, Deisy, Tender Green, Lollo Bionda, Itapuã 401, Marisa, Verônica, Banchu New Red Fire e Hortência nas condições climáticas da região de Manaus, sob cultivo protegido e a campo. Foram avaliadas as características: massa fresca total, massa fresca comercial, diâmetro da cabeça e altura. As cultivares de alface Marisa, Itapuã 401 e Hortência são opções mais adequadas para o cultivo protegido e a campo na região, incluindo-se para o cultivo a campo a cultivar Verônica, a qual apresentou a melhor produção na avaliação realizada neste ambiente.In the evaluation of vegetable cultivars, the high average yield in the competition assays associated to quality factors are utilized as criteria to recommend cultivars. In the present work we evaluated the lettuce cultivars Frisella, Deisy, Tender Green, Lollo Bionda, Itapuã 401, Marisa, Verônica, Banchu New Red Fire and Hortência under the climatic conditions of the region of Manaus, under protected and conventional cultivation. The evaluated characteristics were: total and commercial weight, plant diameter and height. The lettuce cultivars Marisa, Itapuã 401 and Hortência presented higher production in both environments adding Verônica with best production under conventional cultivation.
Carrot Cultivar Evaluation: Soilless Media vs. Hydroponics
Pinnock, Derek R.; Bugbee, Bruce
2002-01-01
Nine cultivars of carrots were grown in a growth chamber. Each cultivar was grown both in hydroponic and soil-less media root-zone for sixty days. Three 30L tubs were used for each root-zone treatment. Three cultivars were planted in each tub, initially at 180 plants m-2 then thinned to 90 plants m-2 on day 45.
Cassiano Busatta; Altemir José Mossi; Maria Regina Alves Rodrigues; Rogério Luis Cansian; José Vladimir de Oliveira
2007-01-01
This work reports antimicrobial activity of oregano (Origanum vulgare) essential oil against several bacteria in sausage. The in vitro minimum inhibitory concentration (MIC) was determined for 9 selected aerobic heterotrofic bacteria. The antimicrobial activity of distinct concentrations of the essential oil on the basis of the highest MIC found was tested in a food system comprised of fresh sausage. Batch food samples were also inoculated with Escherichia coli with a fixed concentration and ...
BIODIVERSITY OF NATIONAL SQUASH CULTIVAR ACCESSIONS
Directory of Open Access Journals (Sweden)
A. F. Bukharov
2017-01-01
Full Text Available The squash is one of the most ancient plants, bearing numerous qualities. The squash gave high yield and is unpretentious plant, the fruit of which is long-stored and can be used as boiled, stewed, baked, fried product, and be added to bread, mush and pudding, and be prepared as puree, jam, candied fruit and other meals. Owing to useful characteristics the squash is a valuable source or raw material for food canning industry, for health-care and functional foodstuff production. Its best cultivar accessions contain to 30% of dry matter, to 12% of sugars and to 36% of carotene. The species of squash includes 4 subspecies and 20 varieties. One accession that came from Spain in 1937 served as an initial breeding accession for many other table cultivars for long time. For 80 years of national breeding program the many cultivars for table use have been released. There are the classic cultivars, such as ‘Mramornaya’, ‘Stolovaya Zimnaya’, Gribovskaya Zimnaya’, ‘Donskaya Sladkaya’, ‘Michurinskaya’ that are selected or developed from first Spanish accession. This richness and originality of cultivar squash accessions should be carefully preserved. There are the new generation cultivars, such as ‘Kroshka’, ‘Malishka’, ‘Rossiyanka’, ‘Konfetka’, ‘Moskvichka’, ‘Vnuchka’ and many others, which are short-tendrils and suitable for modern mechanized cultivation technology. Moreover the development of new cultivars, bearing resistance to biotic and abiotic stress is the main goal of nearest breeding program.
African Journals Online (AJOL)
Yomi
2012-08-30
Aug 30, 2012 ... 2National Engineering Research Center for Floriculture, Beijing, China. Accepted 6 August, 2012 ... hybrids lily cultivar 'eyeliner' was selected as the materials. By using the ... of sterilization was not ideal which led to higher.
Directory of Open Access Journals (Sweden)
Loyana Silva Godinho
2014-01-01
Full Text Available Schistosomiasis, a parasitic disease caused by trematode flatworms of the genus Schistosoma, affects more than 200 million people worldwide, and its control is dependent on a single drug, praziquantel. Tanacetum vulgare (Asteraceae is used in folk medicine as a vermifuge. This study aimed to investigate the in vitro schistosomicidal activity of the crude extract (TV and the essential oil (TV-EO from the aerial parts of T. vulgare. TV-EO was obtained by hydrodistillation and analyzed by GC/MS, which allowed the identification of β-thujone (84.13% as the major constituent. TV and TV-EO, at 200 μg/mL, decreased motor activity and caused 100% mortality of all adult worms. At 100 and 50 μg/mL, only TV caused death of all adult worms, while TV-EO was inactive. TV (200 μg/mL was also able to reduce viability and decrease production of developed eggs. Confocal laser scanning microscopy showed morphological alterations in the tegument of the S. mansoni surface after incubation with TV (50 and 100 μg/mL. Quantitative analysis on the schistosomes tegument showed that TV caused changes in the numbers of tubercles of S. mansoni male worms in a dose-dependent manner. The findings suggest that T. vulgare is a potential source of schistosomicidal compounds.
NS Pudarka: A new winter wheat cultivar
Directory of Open Access Journals (Sweden)
Hristov Nikola
2014-01-01
Full Text Available The high-yielding, medium late winter wheat cultivar NS Pudarka was developed by crossing genetic divergent parents: line NMNH-07 and cv. NS 40S and Simonida. In cultivar NS Pudarka genes responsible for high yield potential, very good technological quality, resistance to lodging, low temperature and diseases, were successfully combined. It was registered by Ministry of agriculture, forestry and water management of Serbia Republic in 2013. This cultivar has wide adaptability and stability of yield that enable growing in different environments with optimal agricultural practice. On the base of technological quality this cultivar belongs to the second quality class, A2 farinograph subgroup and second technological group.
Sensory profile of eleven peach cultivars Perfil sensorial de onze cultivares de pêssegos
Directory of Open Access Journals (Sweden)
Francine Lorena Cuquel
2012-03-01
Full Text Available The goal of this study was to evaluate the sensory profile of eleven peach cultivars grown in an experimental orchard located in the city of Lapa (PR, Brazil in two seasons. The peach cultivars analyzed were Aurora I, Chimarrita, Chiripá, Coral, Eldorado, Granada, Leonense, Maciel, Marli, Premier, and Vanguarda. The sensory analysis was performed by previously trained panelists; 20 of them in the first season and 10 in the second season. The sensory evaluation was performed using Quantitative Descriptive Analysis, in which the following attributes were measured: appearance, aroma, flesh color, flesh firmness, flavor, and juiciness. The results showed preference for sweet, soft, and juicy fruits. Chimarrita, Chiripá, and Coral fruits showed better sensorial performance than the other peach cultivars. It was also verified that the analysis of the attributes aroma, flesh firmness, and flavor is enough for performing the sensory profile of peach fruits for in natura consumption.Este trabalho teve como objetivo avaliar o perfil sensorial de onze cultivares de pêssego produzidos em duas safras em um pomar experimental implantado na Lapa (PR, Brasil. Os cultivares analisados foram Aurora I, Chimarrita, Chiripá, Coral, Eldorado, Granada, Leonense, Maciel, Marli, Premier e Vanguarda. As análises sensoriais foram realizadas por julgadores previamente treinados, sendo 20 julgadores na primeira safra e 10 na segunda. O método de avaliação empregado foi a Análise Descritiva Quantitativa na qual foram mensurados os atributos aparência, aroma, cor de polpa, firmeza de polpa, sabor e suculência dos frutos. Os resultados obtidos demonstraram a preferência por frutos de sabor adocicado, com polpa macia e suculenta. Os cultivares Chimarrita, Chiripá e Coral obtiveram o melhor desempenho nas análises sensoriais. Foi verificado ainda que os atributos aroma, firmeza de polpa e sabor são considerados suficientes para a avaliação do perfil sensorial de
Developing native Vaccinium crops and cultivars
Vaccinium species have long been harvested from the wild. Breeding and cultivar development, however, did not begin until about 1911 in New Jersey with efforts to commercially cultivate northern highbush blueberry (Vaccinium corymbosum). Cultivar development spread to cranberry (V. macrocarpon) and ...
Newly registered small grains cultivars from Zaječar
Directory of Open Access Journals (Sweden)
Dodig Dejan
2006-01-01
Full Text Available The paper presents principal properties of 5 new cultivars of small grains created in the Center for Agricultural and Technological Research in Zaječar. They are as follows: Arena (winter bread wheat, Premium (winter malting barley, Tango (winter triticale, Center (spring oat and Balsa (spring naked barley. In 2004 and 2005 these cultivars were registered by the Ministry of Agriculture, Forestry and Water Management of the Republic of Serbia. The Arena cultivar has good indices of technological quality and high yield genetic potential which is successfully preserved even in dry years. The Premium cultivar, besides high yield capacity, has a very low protein grain content what makes it especially suitable for brewers industry. Triticale Tango is intended, in the first place, for animal feeds and like Arena cultivar. is highly tolerant to draught. Spring oat Center is Zaječar's first made oat cultivar in this group of small grains. Cultivar Balsa is the first spring six-row naked barley in Serbia and Montenegro. Creating of Balsa cultivar is the attempt to meet the future demands on the market. By the act of registering above mentioned cultivars the Center in Zajecar has completed and enlarged its already existing variety of small grains assortment.
Directory of Open Access Journals (Sweden)
Nádia Izumi Terabe
2008-04-01
Full Text Available O conhecimento do comportamento natural da nogueira Pecan às principais doenças é de suma importância para o estabelecimento do planejamento da implantação da cultura. O controle fitossanitário e tratos culturais devem ser realizados de modo a não comprometerem a qualidade do produto final, as amêndoas. Foram avaliadas nozes produzidas na safra de 2005 e oriundas de Uraí-PR, pelas cultivares Burkett, Frotscher e Moneymaker, para identificar e quantificar os microrganismos associados à amêndoas e cascas dos frutos, bem como observar diferenças entre organismos colonizadores das cultivares. Os frutos foram avaliados na pós-colheita, aos trinta dias de armazenamento em ambiente, através da metodologia do papel de filtro, sendo submetidos ou não à assepsia superficial. O fungo Cladosporium caryigenum, promotor da rancificação das amêndoas foi observado, em amêndoas e cascas, nas cultivares Burkett, Frotscher e Moneymaker; Fusarium sp., foi encontrado em porcentuais elevados, tanto em amêndoas quanto em cascas das três cultivares estudadas; Cephalothecium roseum, causador do mofo róseo em amêndoas, na cultivar Frotscher. Aspergillus sp. e Penicillium sp., causadores de emboloramento e produtores de aflotoxinas foram observados em porcentuais representativos, em amêndoas da cultivar Frotscher e em amêndoas e cascas das cultivares Frotscher, Burkett e Moneymaker, respectivamente. Os maiores porcentuais de perda do rendimento foram observados na cultivar Burkett, por causa da incidência de Colletotrichum sp., causador da antracnose em amêndoas, que acarreta escurecimento e deterioração do produto final, levando-o ao descarte.The knowledgement of the natural behavior of the main diseases of Pecan nut is of utmost importance for the stablishment of an implantation plan for that culture. The phytosanitary control and cultural treatments should be performed in order not to change the quality of the final product. Nuts harvest
Frederiks, T M; Christopher, J T; Sutherland, M W; Borrell, A K
2015-06-01
Radiant frost is a significant production constraint to wheat (Triticum aestivum) and barley (Hordeum vulgare), particularly in regions where spring-habit cereals are grown through winter, maturing in spring. However, damage to winter-habit cereals in reproductive stages is also reported. Crops are particularly susceptible to frost once awns or spikes emerge from the protection of the flag leaf sheath. Post-head-emergence frost (PHEF) is a problem distinct from other cold-mediated production constraints. To date, useful increased PHEF resistance in cereals has not been identified. Given the renewed interest in reproductive frost damage in cereals, it is timely to review the problem. Here we update the extent and impacts of PHEF and document current management options to combat this challenge. We clarify terminology useful for discussing PHEF in relation to chilling and other freezing stresses. We discuss problems characterizing radiant frost, the environmental conditions leading to PHEF damage, and the effects of frost at different growth stages. PHEF resistant cultivars would be highly desirable, to both reduce the incidence of direct frost damage and to allow the timing of crop maturity to be managed to maximize yield potential. A framework of potential adaptation mechanisms is outlined. Clarification of these critical issues will sharpen research focus, improving opportunities to identify genetic sources for improved PHEF resistance. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Nida Toufiq
Full Text Available Abstract Agricultural crops suffer many diseases, including fungal and bacterial infections, causing significant yield losses. The identification and characterisation of pathogenesis-related protein genes, such as chitinases, can lead to reduction in pathogen growth, thereby increasing tolerance against fungal pathogens. In the present study, the chitinase I gene was isolated from the genomic DNA of Barley (Hordeum vulgare L. cultivar, Haider-93. The isolated DNA was used as template for the amplification of the ∼935 bp full-length chitinase I gene. Based on the sequence of the amplified gene fragment, class I barley chitinase shares 93% amino acid sequence homology with class II wheat chitinase. Interestingly, barley class I chitinase and class II chitinase do not share sequence homology. Furthermore, the amplified fragment was expressed in Escherichia coli Rosetta strain under the control of T7 promoter in pET 30a vector. Recombinant chitinase protein of 35 kDa exhibited highest expression at 0.5 mM concentration of IPTG. Expressed recombinant protein of 35 kDa was purified to homogeneity with affinity chromatography. Following purification, a Western blot assay for recombinant chitinase protein measuring 35 kDa was developed with His-tag specific antibodies. The purified recombinant chitinase protein was demonstrated to inhibit significantly the important phytopathogenic fungi Alternaria solani, Fusarium spp, Rhizoctonia solani and Verticillium dahliae compared to the control at concentrations of 80 µg and 200 µg.
Directory of Open Access Journals (Sweden)
Franziska Kuhlmann
Full Text Available Studying plant-aphid interactions is challenging as aphid feeding is a complex process hidden in the plant tissue. Here we propose a combination of two well established methods to study nutrient acquisition by aphids focusing on the uptake of isotopically labelled nitrogen ((15N. We combined the Electrical Penetration Graph (EPG technique that allows detailed recording of aphid feeding behaviour and stable isotope ratio mass spectrometry (IRMS to precisely measure the uptake of nitrogen. Bird cherry-oat aphids Rhopalosiphum padi L. (Hemiptera, Aphididae fed for 24 h on barley plants (Hordeum vulgare L., cultivar Lina, Poaceae that were cultivated with a (15N enriched nutrient solution. The time aphids fed in the phloem was strongly positive correlated with their (15N uptake. All other single behavioural phases were not correlated with (15N enrichment in the aphids, which corroborates their classification as non-feeding EPG phases. In addition, phloem-feeding and (15N enrichment of aphids was divided into two groups. One group spent only short time in the phloem phase and was unsuccessful in nitrogen acquisition, while the other group displayed longer phloem-feeding phases and was successful in nitrogen acquisition. This suggests that several factors such as the right feeding site, time span of feeding and individual conditions play a role for the aphids to acquire nutrients successfully. The power of this combination of methods for studying plant-aphid interactions is discussed.
Wang, Yongming; Lin, Xiuyun; Dong, Bo; Wang, Yingdian; Liu, Bao
2004-01-01
RAPD (randomly amplified polymorphic DNA) and ISSR (inter-simple sequence repeat) fingerprinting on HpaII/MspI-digested genomic DNA of nine elite japonica rice cultivars implies inter-cultivar DNA methylation polymorphism. Using both DNA fragments isolated from RAPD or ISSR gels and selected low-copy sequences as probes, methylation-sensitive Southern blot analysis confirms the existence of extensive DNA methylation polymorphism in both genes and DNA repeats among the rice cultivars. The cultivar-specific methylation patterns are stably maintained, and can be used as reliable molecular markers. Transcriptional analysis of four selected sequences (RdRP, AC9, HSP90 and MMR) on leaves and roots from normal and 5-azacytidine-treated seedlings of three representative cultivars shows an association between the transcriptional activity of one of the genes, the mismatch repair (MMR) gene, and its CG methylation patterns.
Choudhary, Manoj Kumar; Kataria, Jyoti; Sharma, Shweta
2017-10-01
A facile biomimetic approach for the synthesis of gold nanoparticles (AuNPs) using aqueous extract of fennel ( Foeniculum vulgare) seeds have been reported in this article. The seeds of F. vulgare are rich in various plant secondary metabolites (phytochemicals) such as polyphenolic acids, flavonoids, and saponins. The phytochemicals of F. vulgare seeds play dual role of reducing and stabilizing agents. The formation of gold nanoparticles was evidenced from the appearance of intense purple color at room temperature with λ max around 550 nm in the UV-Vis absorption spectra. The stable AuNPs were further characterized by X-ray diffraction (XRD), Fourier transform infrared (FT-IR) spectroscopy and transmission electron microscopy (TEM) analysis. The synthesized nanoparticles were observed to be polydispersed, spherical and ranged from 10 to 30 nm with an average size of 20 ± 2 nm, as obtained from TEM images. The catalytic activity of gold nanoparticles was investigated by studying the reduction of anthropogenic dyes such as methylene blue (MB) and rhodamine B (Rh-B) with sodium borohydride. Results showed the possible applications of biogenic AuNPs in environment related problems.
Cell size and cell number in dwarf mutants of barley (Hordeum vulgare)
International Nuclear Information System (INIS)
Blonstein, A.D.; Gale, M.D.
1984-01-01
Sixteen height mutants, induced by sodium azide treatment of the two-rowed barley variety Proctor, have been used to investigate the relationship between the extent and nature of stem shortening with alterations in cell size and cell number, and the pleiotropic effects of dwarfing genes on vegetative development and agronomic performance. The studies on epidermal cell number and cell length in the developmentally earliest and latest elongated vegetative tissues - the coleoptile and peduncle resprectively - suggest that cell number may be the primary determinant of plant height. One semi-prostrate and one erectoides mutant are used to illustrate different cell number/cell size strategies and their relationships with gibberellin sensitivity, growth rate and lodging resistance are discussed. (author)
Effects of aerial pollutants on cereal growth. [Hordeum vulgare var. Maris Otter
Energy Technology Data Exchange (ETDEWEB)
1975-01-01
Winter barley, var. Maris Otter, was grown at Woburn Experimental Farm in three closed plastic chambers with either filtered, ambient or sulfur dioxide-polluted air. The mean sulfur dioxide levels were 7.2 ..mu..g m/sup -3/, 37 ..mu..g m/sup -3/ for the filtered and ambient chambers respectively. In the field the mean value was 51.5 ..mu..g m/sup -3/ . Temperature and relative humidity in these closed houses differed from the outside. No visible damage occurred on any of the plants grown in the filtered or ambient air. In the fumigated chamber a high dose of sulfur dioxide was given for one week (19-25 April 1975), producing a mean concentration of 951 ..mu..g m/sup -3/, at the four-leaf stage. It caused severe necrosis of the leaves. The plants subsequently recovered and no further fumigations were given. At final harvest these plants were not significantly lower in total dry weight and grain weight from the ambient plants. The dry matter yield of the plants grown in filtered air was higher than that of plants in ambient air.
Analysis of chlorophyll mutations induced by γ-rays in barley (hordeum vulgare)
International Nuclear Information System (INIS)
Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang
1991-06-01
Thirty varieties of dormant barley seeds were irradiated with 137 Cs γ-rays. Dose-effect relations of chlorophyll mutation frequency in M 2 seedling and differences resulting from cultured types or radiosensitive types were investigated. Experimental results show that the relations between chlorophyll mutation frequency and doses can be fitted by a linear regression equation Y = A + BX. According to analysis of covariance, there is no considerable difference in various cultured types, but the difference of five different radiosensitive types is remarkable. The sensitive and intermediate types need much lower doses than other types to induce maximum chlorophyll mutation
Cell wall polysaccharides hydrolysis of malting barley (Hordeum vulgare L.: a review
Directory of Open Access Journals (Sweden)
Jamar, C.
2011-01-01
Full Text Available Malting quality results from the different steps of the malting process. Malting uses internal changes of the seed occurring during germination, such as enzymes synthesis, to obtain a good hydrolysis process and the components required. Among the three main hydrolytic events observed, that are namely starch degradation, cell wall breakdown and protein hydrolysis, an efficient cell wall polysaccharides hydrolysis is an essential condition for a final product of quality. Indeed, because of the physical barrier of the cell wall, cell wall polysaccharides hydrolysis is one of the first steps expected from the process to gain access to the cell components. Moreover, viscosity problem and haze formation in malting industry are related to their presence during the process when inefficient degradation occurs, leading to increased production time and cost. Understanding the key elements in cell wall degradation is important for a better control. (1-3,1-4-β-glucans and arabinoxylans are the main constituents of cell wall. (1-3,1-4-β-glucans are unbranched chains of β-D-glucopyranose residues with β-(1,3 linkages and β-(1,4 linkages. Arabinoxylan consists in a backbone of D-xylanopyranosyl units linked by β-(1-4 bonds connected to single L-arabinofuranose by α-(1→2 or α-(1→3-linkages. Degradation of (1-3,1-4-β-glucans is processed by the (1-3,1-4-β-glucanases, the β-glucosidases and the β-glucane exohydrolases. It seems that the (1-3-β-glucanases are also involved. Arabinoxylans are mainly decomposed by (1-4-β-xylan endohydrolase, arabinofuranosidase and β-xylosidase.
DEFF Research Database (Denmark)
Frandsen, T P; Lok, F; Mirgorodskaya, E
2000-01-01
in the transition state complex. Mass spectrometry of tryptic fragments assigned the 92-kD protein to a barley cDNA (GenBank accession no. U22450) that appears to encode an alpha-glucosidase. A corresponding sequence (HvAgl97; GenBank accession no. AF118226) was isolated from a genomic phage library using a c......High-isoelectric-point (pI) alpha-glucosidase was purified 7, 300-fold from an extract of barley (Hordeum vulgare) malt by ammonium sulfate fractionation, ion-exchange, and butyl-Sepharose chromatography. The enzyme had high activity toward maltose (k(cat) = 25 s(-1)), with an optimum at pH 4...
DEFF Research Database (Denmark)
Jensen, E.S.
1996-01-01
Nitrogen acquisition by field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) grown on a sandy loam soil and availability of N in three subsequent sequences of a cropping system were studied in an outdoor pot experiment. The effect of crop residues on the N availability was evaluated....... The dry matter production and total N uptake of a spring barley crop following pea or barley, with a period of unplanted soil in the autumn/winter, were significantly higher after pea than after barley. The barley crop following pea and barley recovered 11% of the pea and 8% of the barley residue N...
Barbour, Margaret M; Warren, Charles R; Farquhar, Graham D; Forrester, Guy; Brown, Hamish
2010-07-01
Leaf internal, or mesophyll, conductance to CO(2) (g(m)) is a significant and variable limitation of photosynthesis that also affects leaf transpiration efficiency (TE). Genotypic variation in g(m) and the effect of g(m) on TE were assessed in six barley genotypes (four Hordeum vulgare and two H. bulbosum). Significant variation in g(m) was found between genotypes, and was correlated with photosynthetic rate. The genotype with the highest g(m) also had the highest TE and the lowest carbon isotope discrimination as recorded in leaf tissue (Delta(p)). These results suggest g(m) has unexplored potential to provide TE improvement within crop breeding programmes.
Phenotypic profiles of Armenian grape cultivars
Directory of Open Access Journals (Sweden)
Aroutiounian Rouben
2015-01-01
Full Text Available The conservation and sustainable use of grapevine biodiversity in Armenia is particularly important due to the large number of traditional local varieties. Being partially different from European grapevine gene pool, the material of Armenian local cultivars significantly contributes to the understanding of the genetic variation and is valuable source for target selection. During last years many Armenian grapevine cultivars have been already described and their genotypes determined, but some local varieties and wild accessions remain unidentified and their phenotypic characteristics overlooked. The comprehensive analysis of phenotypes is essential for research, including genetic association studies, cultivar evaluation and selection. The goal of our research was the phenotyping on the base of reproductive, carpological and analytical characteristics of 80 Armenian aboriginal and new grape cultivars. Description of phenotypic profiles is important step towards identification and conservation of genetic resources of Armenian grapes. In future, these data can be applied for breeding of improved grape varieties targeted to fresh consumption and wine production.
Energy Technology Data Exchange (ETDEWEB)
Wu Huibin [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); College of Resources and Environment, Huazhong Agricultural University, 430070 Wuhan, Hubei Province (China); Tang Shirong, E-mail: tangshir@hotmail.com [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, The Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Smith, Donald L. [Plant Science Department, McGill University, Macdonald Campus, 21111 Lakeshore Road, Ste. Anne de Bellevue, Quebec, H9X 3V9 (Canada)
2009-10-30
The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO{sub 2} (860 {mu}L L{sup -1}) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg{sup -1}). The results showed that elevated CO{sub 2} not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO{sub 2} treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO{sub 2} could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO{sub 2}, increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.
Directory of Open Access Journals (Sweden)
Djail Santos
2011-12-01
Full Text Available Um aspecto importante na escolha de cultivares para uma determinada condição ambiental é a determinação da produção comercial, que indica o potencial de produção por área. O objetivo do trabalho foi avaliar a produção comercial de cultivares de alface nas condições de solo e clima de Bananeiras, Paraíba, durante a estação chuvosa. Foram avaliadas oito cultivares (Cindy, Elba, Grand Rapids, Kaesar, Mimosa, Sabrina, Summer Green e Verônica, no delineamento experimental de blocos casualizados, com quatro repetições. As parcelas tinham 27 plantas, espaçadas de 30 cm entre fileiras e entre linhas. Aos 51 dias após o transplante, as plantas foram colhidas e avaliadas quanto à massa fresca total e comercial, massa seca de folhas, número de folhas, diâmetro da planta, índice comercial e produção comercial. Os maiores valores de massa fresca total e comercial, de diâmetro da planta e produção comercial foram verificados para a cultivar Kaesar. Quanto à massa seca, 'Kaesar' e 'Elba' apresentaram os valores mais elevados. Os maiores números de folha foram obtidos com 'Mimosa', 'Elba', 'Sabrina' e 'Summer Green'. As cultivares Grand Rapids, Verônica e Kaesar mostraram-se mais suscetíveis à septoriose, principalmente nas folhas mais velhas. Considerando-se os resultados e a preferência dos consumidores, 'Kaesar' e 'Summer Green' foram as mais promissoras para introdução e testes em áreas de produção comercial de alface.An important issue when choosing cultivars for specific environmental conditions is to estimate the marketable production, which indicates the potential production per area. The objective of this study was to evaluate the marketable production of lettuce cultivars under the soil and climatic conditions of Bananeiras, Paraíba, Brazil, during the rainy season. The experiment was carried out as a complete randomized blocks design with eight cultivars (Cindy, Elba, Grand Rapids, Kaesar, Mimosa, Sabrina
Composición química y actividad antibacteriana del aceite esencial del Origanum vulgare (orégano
Directory of Open Access Journals (Sweden)
Emilia Albado Plaus
2001-01-01
Full Text Available Objetivo: Determinar la actividad antimicrobiano en el aceite esencial (Carvacrol del Origanum vulgare. Material y métodos: El aceite esencial se obtuvo por destilación por arrastre con vapor de agua, a partir de las hojas y flores desecadas de O. vulgare; se determinó la gravedad especifica con un pinnómetro y el índice de refracción con refractómetro de Abbc; la composición química se evaluó mediante cromatografía de gas con detector de masa (GL-SM. La actividad antimicrobiana del aceite de O. vulgare se realizó por el método semicuantitativo de incorporación y de disco difusión en agar. Resultados: La densidad especifica del producto resultó 0.9234 a 20°C y el índice de refracción 1.4774; el cromatograma mostró un contenido de 9% de Carvacrol, 12.19% de Terpineol, 6.86% de P-cimeno y la presencia de otros compuesto relacionados metabolicamente con los tres antes citados. Las bacterias gram-negativas: Escherichia coli, Pseudomona aeruginosa, Salmonella tiphymurium, Salmonella cholerae suis y Vibrio cholerae y las bacterias gram-positivas: Staphylococcus aureus y Bacillus cereus, mostraron diferentes grados de sensibilidad. De los microorganismos evaluados solo pseudomonas aeruginosa mostró resistencia. Conclusión: El aceite esencial posee actividad microbiana contra todas las bacterias evaluadas, excepto antes para P. aeruginosa.(Rev Med Hered 2001; 12: 16-19 .
Directory of Open Access Journals (Sweden)
Saghi
2015-02-01
Full Text Available Background Infection due to Acinetobacter baumannii has become a significant challenge to modern healthcare systems. The rapid emergence and global dissemination of A. baumannii as a major nosocomial pathogen is remarkable and it demonstrates its successful adaptation to the 21st century hospital environment. Recent studies have discussed about essential oil of Origanum vulgare against a range of bacteria, including various species of Staphylococcus, Pseudomonas, Bacillus and Escherichia coli. Objectives The present study aimed to investigate the inhibitory effects O. vulgare essence against multidrug-resistant (MDR strains of A. baumannii from selected hospitals in Tehran, Iran. Materials and Methods This oil was obtained using the hydrodistillation method and analyzed by gas chromatography mass spectrography (GC/MS. The antimicrobial activity against MDR isolates was achieved using disc diffusion method and macro-broth dilution assay. Results Analysis of the essential oil revealed the presence of pulegone (68.59% piperitone (7.8%, piperitenone (7.8%, 1, 8-cineole (1.3%, and carvacrol (1.6% as the major components. The results showed a significant activity against MDR A. baumannii with inhibition zones and minimal inhibitory concentration values in the ranges of 7-15 mm and 20-35 µL/mL respectively. Conclusions This investigation showed that the essence oil of O. vulgare had a potent antimicrobial activity against MDR A. baumannii. Further research is required to evaluate the practical values of therapeutic applications.
Directory of Open Access Journals (Sweden)
Nilson Lemos de Menezes
1995-01-01
Full Text Available O teste de fenol é recomendado para a identificação de cultivares de trigo em laboratório e se baseia na reação de compostos presentes no pericarpo das sementes. Devido à reação constante para cada cultivar, o teste serve para caracterização rápida e fácil de materiais com reações diferentes. No presente trabalho, com o objetivo de facilitar a identificação varietal em trigo, determinou-se a reação ao fenol de 42 cultivares, que estiveram ou estão em recomendação no Brasil.The phenol test is recommended for wheat cultivar identification and is based on the reaction of compounds present in the seeds pericarp. Due to the constant reaction for each cultivar, the test may be used for a rapid and easy characterization of different reactions materiais. In this essay, the phenol reaction was determined in 42 brazilian wheat varieties aiming to facilitate its identification.
Energy Technology Data Exchange (ETDEWEB)
Silva, Tulibio F. da; Silva Neto, Helio F. da; Tasso Junior, Luiz C.; Marques, Diogo; Marques, Marcos O. [Universidade Estadual Paulista (FCAV/UNESP), Jaboticabal, SP (Brazil). Fac. de Ciencias Agrarias e Veterinarias], E-mail: tulibio_fernandes@yahoo.com.br
2010-07-01
In order to diversify energy sources, the residue of sugarcane gathers attributes that qualify its use. Therefore, this study was to evaluate the potential of bagasse production in late cultivars of sugarcane. The experimental design was a randomized block design with 6 treatments (cultivars) and 3 replications. The experiment was carried out at FCAV/UNESP Jaboticabal. To calculate the productivity, it was counted the number of stems in a row linear meter, it was obtained the weight of stems. The percentage of fiber for each cultivar was determined by a calculation of estimated production and productivity of mulch. Using these values to estimate the number of people who would benefit from the energy generated from the combustion of bagasse in a process of cogeneration power. The results were submitted to analysis of variance by F test and averages compared by Tukey test at 5% probability. Cultivars RB867515, RB72454 and CTC6 showed the best performance, indicating its greater potential for power cogeneration. Cultivars CTC IAC94-2 and 2101 were lower when considering the results obtained. (author)
Productive performance of blackberry cultivars in altitude region
Directory of Open Access Journals (Sweden)
Jéssica de Oliveira
2017-11-01
Full Text Available ABSTRACT: Information on the production performance of blackberry in less colder regions are fundamentals to the expansion of the cultivated area and extension of management practices for cultivars adapted to climate conditions in Brazil. The research was carried out with the aim to evaluate the productive performance of different blackberries cultivars in altitude region of 1,387m with mild temperatures, situate at 18º14’56”S, 43º36’0”W, in Minas Gerais State, Brazil. It was carried during the seasons 2013/2014, 2014/2015 and 2015/2016. The blackberry cultivars evaluated were the following ones ‘Brazos’, ‘Guarani’, ‘Tupy’ and ‘Xavante’. Flowering and harvesting of cultivars were evaluated as well as climatological data of the area in order to relate the number of hours of accumulated cold less than 13°C, 10°C and 7.2°C with production and crop time. To determine the production, the mass of blackberries harvested per plant was measured. Production of blackberry cultivars was extended in altitude region with similar productivity to the other producing regions in Brazil. Productive performance of the cultivars varied according to the accumulation of cold hours with mild temperatures that occurred in cultivation region. ‘Brazos’, ‘Guarani’, ‘Tupy’ and ‘Xavante’ showed good adaptation, being ‘Brazos’ the cultivar most productive.
Directory of Open Access Journals (Sweden)
Rachel Benetti Queiroz Voltan
1996-01-01
Full Text Available Foi realizado um estudo de caracterização botânica em seis cultivares de morangueiro (Fragaria X ananassa Duch. quatro desenvolvidos no Brasil - 'Campinas (IAC-2712', 'Guarani (IAC-5074', 'AGF 080' e 'IAC Princesa Isabel' - e dois introduzidos - 'Reiko', do Japão, e 'Sequóia', dos Estados Unidos - visando sua distinção taxonômica. Os experimentos foram desenvolvidos na Estação Experimental de Monte Alegre do Sul (SP durante os anos agrícolas de 1992/93. Os caracteres morfológicos que se mostraram úteis na diferenciação dos seis cultivares foram os seguintes: tipo de planta; número de folíolos; coloração da folha; razão entre o comprimento e a largura dos folíolos medianos; ângulo da base do limbo do folíolo mediano; comprimento das estipulas; posição das flores primárias em relação à folhagem; número de pétalas das flores primárias; razão entre o comprimento e a largura das pétalas; receptáculo do ovário; forma das infrutescências e da base da infrutescência; posição do cálice e calículo; espaços vazios no interior da infrutescência e comprimento e largura da infrutescência. Para a identificação dos cultivares, foi elaborada uma chave analítica. Os cultivares AGF 080 e Campinas não foram distinguidos com base nos caracteres analisados.Six strawberry cultivars (Fragaria X ananassa Duch., four developed in Brazil (AGF 080, Campinas, Guarani and IAC Princesa Isabel and two introduced (Reiko from Japan and Sequoia from USA were botanically evaluated in order to screening morphological vegetativa and reproductive characters to get the taxonomical distinction of them. Two experiments were carried out in 1992 and 1993 at the Experimental Station of Monte Alegre do Sul, Instituto Agronômico (IAC, State of São Paulo, Brazil. The following morphological characters were screened to distinguish the cultivars studied: growing habit; leaflet number; leaf colour; middle leaflet length and width ratio; middle
POTENCIAL PRODUTIVO DE CULTIVARES DE MORANGUEIRO
Directory of Open Access Journals (Sweden)
AMANDA GONÇALVES GUIMARÃES
2015-03-01
Full Text Available RESUMO O objetivo foi avaliar o potencial produtivo de cultivares de morangueiro em região representativa do Alto Jequitinhonha. O experimento foi conduzido na fazenda Mape Frutas Ltda., localizada no município de Datas-MG, em delineamento em blocos ao acaso, com oito cultivares de morangueiro em quatro repetições, para verificar a produção de mudas e de frutos. A contagem da produção de estolões e de mudas foi realizada aos 180 dias após o plantio. A avaliação das variáveis relacionadas à produção de frutos foi feita duas vezes por semana, no período de maio a outubro de 2012. Das cultivares de dias curtos (Festival, Campinas, Toyonoka, Dover, Oso Grande e Camarosa e dias neutros (Diamante e Aromas, apenas Toyonoka foi a que apresentou menor desempenho para as variáveis. A significativa superioridade das cultivares Camarosa e Festival, para praticamente todas as variáveis avaliadas, permite recomendá-las para regiões com características edafoclimáticas semelhantes às da região onde o experimento foi conduzido. Dentre as cultivares avaliadas, as mais precoces tenderam a apresentar maior desempenho para variáveis relacionadas à produção de frutos.
Directory of Open Access Journals (Sweden)
Carlos Antonio Fernandes Santos
2010-01-01
Full Text Available O objetivo deste trabalho foi estabelecer padrões alélicos e estimar as distâncias genéticas baseadas em marcador SSR de 44 cultivares de cebola adaptadas às condições de cultivo tropicais e subtropicais do Brasil. Para visualização da similaridade genética, utilizou-se o dendrograma UPGMA gerado da matriz de distâncias do coeficiente de Jaccard, com base em 40 alelos de 13 locos SSR. O DNA total foi extraído pelo método CTAB 2x, e os produtos de PCR foram analisados em géis de poliacrilamida desnaturante 6% e corados com nitrato de prata. O número de pares de bases foi estimado pelo método da mobilidade inversa, com base em regressão de produtos de tamanho conhecido. A média da heterozigosidade dos locos SSR foi 0,58. Os 40 alelos dos 13 locos SSR foram suficientes para distinguir as 44 cultivares de cebola. O maior número de alelos em comum foi observado entre as cultivares Yellow Granex e Henry's Special PRR e o menor, entre as cultivares Baia Periforme Super Precoce e Excel. Os sete grupos principais de cultivares identificados no dendrograma apresentaram concordância com a genealogia conhecida e o tipo agronômico das cultivares avaliadas. Os locos SSR selecionados são adequados para melhoramento e proteção de cultivares da espécie.The objective of this work was to establish allelic patterns and to estimate genetic distances based on the SSR marker in 44 onion cultivars adapted to Brazil's tropical and subtropical growing conditions. An UPGMA dendrogram generated from the distance matrix of the Jaccard's coefficient, based on 40 alleles of 13 SSR loci, was used for visualizing genetic similarities. Total DNA was extracted according to the CTAB 2x protocol, and the PCR products were analyzed in 6% denaturing polyacrylamide gels and stained with silver nitrate. The number of base pairs was estimated by the inverse mobility method, based on regression of products of known size. The heterozygosity mean was 0.58 for all
Directory of Open Access Journals (Sweden)
Flávio Zanette
2010-04-01
Full Text Available The aim of this work was to characterize the phenological cycle of nine Vitis rotundifolia cultivars during the 2004/2005 season. The cultivars were Bontiful, Creek, Dixie, Magnolia, Magoon, Noble, Regale, Roanoke e Topsail. The experiment was performed on an orchard implanted in 1999 at the Canguiri Experimental Station of the Federal University of Paraná in Pinhais-PR. The phenology of two adult plants of each cultivar was monitored. The recorded phenological stages were: 1 Dormant bud; 2 Swollen bud; 3 Wool bud; 4 Green tip; 5 Bud burst (first leaf appearance; 6 Two to three leaves unfolded; 7 Five to six leaves unfolded; 8 Fully developed inflorescence; 9 Trace bloom (flowerhoods detached; 10 Full flowering (50% of the flowerhoods fallen; 11 Fruit set; 12 Groat-sized berries; 13 Pea-sized berries; 14 50% filled berries (beginning to touch berries; 15 Final size; 16 Color change; 17 Berries ripe for harvest; and 18 End of harvesting. A very long phenological cycle was observed when compared to species such as Vitis vinifera and Vitis labrusca. These evaluations allowed us to conclude that: a there is no difference in the phenological cycle periods between bronze and dark skinned cultivars; b cultivars presented desuniform wool bud to full flowering cycle, ranging from 25 days (‘Regale’ to 81 days (‘Creek’; c the cultivar Regale presented the longest cycle (203 days from full flowering to harvest and the cultivar Creek the shortest (136 days. The evaluated cultivars additionally presented desuniform ripening and a tendency to drop berries. O objetivo foi caracterizar o ciclo fenológico de nove cultivares de Vitis rotundifolia avaliadas na safra de 2004/2005. As cultivares estudadas foram as seguintes: Bontiful, Creek, Dixie, Magnolia, Magoon, Noble, Regale, Roanoke e Topsail. O trabalho foi realizado em um pomar do Setor de Fruticultura da Estação Experimental do Canguiri da Universidade Federal do Paraná, em Pinhais-PR, sendo que
Metabolomics-Driven Nutraceutical Evaluation of Diverse Green Tea Cultivars
Ida, Megumi; Kosaka, Reia; Miura, Daisuke; Wariishi, Hiroyuki; Maeda-Yamamoto, Mari; Nesumi, Atsushi; Saito, Takeshi; Kanda, Tomomasa; Yamada, Koji; Tachibana, Hirofumi
2011-01-01
Background Green tea has various health promotion effects. Although there are numerous tea cultivars, little is known about the differences in their nutraceutical properties. Metabolic profiling techniques can provide information on the relationship between the metabolome and factors such as phenotype or quality. Here, we performed metabolomic analyses to explore the relationship between the metabolome and health-promoting attributes (bioactivity) of diverse Japanese green tea cultivars. Methodology/Principal Findings We investigated the ability of leaf extracts from 43 Japanese green tea cultivars to inhibit thrombin-induced phosphorylation of myosin regulatory light chain (MRLC) in human umbilical vein endothelial cells (HUVECs). This thrombin-induced phosphorylation is a potential hallmark of vascular endothelial dysfunction. Among the tested cultivars, Cha Chuukanbohon Nou-6 (Nou-6) and Sunrouge (SR) strongly inhibited MRLC phosphorylation. To evaluate the bioactivity of green tea cultivars using a metabolomics approach, the metabolite profiles of all tea extracts were determined by high-performance liquid chromatography-mass spectrometry (LC-MS). Multivariate statistical analyses, principal component analysis (PCA) and orthogonal partial least-squares-discriminant analysis (OPLS-DA), revealed differences among green tea cultivars with respect to their ability to inhibit MRLC phosphorylation. In the SR cultivar, polyphenols were associated with its unique metabolic profile and its bioactivity. In addition, using partial least-squares (PLS) regression analysis, we succeeded in constructing a reliable bioactivity-prediction model to predict the inhibitory effect of tea cultivars based on their metabolome. This model was based on certain identified metabolites that were associated with bioactivity. When added to an extract from the non-bioactive cultivar Yabukita, several metabolites enriched in SR were able to transform the extract into a bioactive extract
Energy Technology Data Exchange (ETDEWEB)
Lebre, Antonio Carlos Pereira; Siva Neto, Helio Francisco da; Marques, Diogo; Marques, Marcos Omir; Tasso Junior, Luiz Carlos [Universidade Estadual Paulista (FCAV /UNESP), Jaboticabal, SP (Brazil). Fac. de Ciencias Agrarias e Veterinarias. Dept. de Tecnologia], E-mail: antoniocplebre8@hotmail.com
2010-07-01
In the search for sustainability a major concern relates to the sugarcane agroindustry waste, and their potential use as an energy source. In this sense, the objective was to identify the production and productivity of bagasse of different sugarcane cultivars, aimed at the completion of the cogeneration of electricity. The experimental design was a randomized block design with 6 treatments (cultivars) and 3 replications. The experiment was carried out at FCAV/UNESP-Jaboticabal. To calculate the productivity, the number of stems was counted in a meter, obtaining the weight of stems. The percentage of fiber for each cultivar was determined by calculating the estimated production and productivity of mulch. Using these values to estimate the potential number of people who could benefit from the electricity that would be produced by the combustion of bagasse generated within a system of cogeneration of electricity put in practice by the sugar mills and ethanol distilleries. Cultivars with the best performance IAC91-1099 and CEC 15 who obtained the highest production and productivity of mulch increases the number of people benefited. Cultivars IAC94-4004-5000 and IAC95 showed intermediate results and the cultivars SP81-3250 and RB855536 obtained less satisfactory results. (author)
Directory of Open Access Journals (Sweden)
Silvio Júlio de Rezende Chagas
2004-02-01
Full Text Available Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L., conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%, acidez titulável (%, ácido pirúvico (µmol/g, açúcares totais, redutores e não-redutores (% e índice industrial dos bulbos. As cultivares Crioula, Baia Periforme, Pira Ouro e Jubileu apresentaram as maiores concentrações de sólidos totais e solúveis. A acidez mais elevada foi observada nas cultivares Crioula (0,370% e Pira Ouro (0,315%. Os maiores índices industriais foram apresentados pelas cultivares Crioula (0,87 e Baia Periforme (0,75, e os menores, pelas cultivares Texas Grano 502 (0,51 e Granex 33 (0,32.This study was carried out from March to September of 1995, in the Experimental Field of EPAMIG, Lavras-MG, Brazil, with the objective of determining the physico-chemical and chemical composition of onions from different cultivars (Allium cepa L.. The experimental design was completely randomized blocks with four repetitions and six cultivars as follow: Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu and Texas Grano 502. After the cure it was evaluated the pH, soluble and total solids (%, titrate acidity (%, pyruvic acid (µmol/g, total sugar, reducers and non reducers (% and industrial index. The cultivars Crioula, Baia Periforme, Pira Ouro and Jubileu showed the largest concentrations of total and soluble solids. The highest acidity indexes were observed in the cultivars Crioula (0.370% and Pira Ouro (0.315%. The largest industrial indexes were found in the cultivars Crioula (0.87 and Baia Periforme (0.75, and the smallest ones in the
Directory of Open Access Journals (Sweden)
Glauco Vieira Miranda
2003-06-01
Full Text Available O objetivo deste trabalho foi avaliar o potencial de melhoramento e a divergência genética de nove cultivares tropicais de milho-pipoca. A divergência genética foi estimada por meio da técnica de análise multivariada e as cultivares foram agrupadas com base na distância generalizada de Mahalanobis (DGM, utilizando o método de otimização de Tocher e a dispersão gráfica. Com produtividade de grãos acima de 3 t/ha, destacaram-se as cultivares CMS 43, IAC 112, Viçosa, CMS 42 e Branco, e com índices de capacidade de expansão acima de 24 (v/v, as cultivares IAC 112, RS 20 e Zélia. As estimativas da DGM indicaram (RS 20 e Beija-flor e (Rosa-claro e RS 20 os pares de cultivares mais distantes geneticamente, e (IAC 112 e Viçosa e (Branco e CMS 42, os pares mais similares. Foram identificados três ou quatro grupos divergentes dependendo do método de agrupamento. Para o melhoramento de milho-pipoca, as cultivares com maiores potenciais são RS 20, Zélia, IAC 112 e Beija-flor. As cultivares apresentam divergência genética.The objective of this paper was to evaluate the potential of breeding and genetic divergence in nine tropical popcorn cultivars. The genetic divergence was estimated using multivariate analysis techniques and the cultivars were grouped based in Mahalanobis' generalized distance (MGD, using Tocher's optimization and graphic dispersion. The best cultivars concerning the yield grain above 3 ton/ha were CMS 43, IAC 112, Viçosa, CMS 42 and Branco, and to popping expansion above 24 (v/v were IAC 112, RS 20 and Zélia. The estimates of MGD indicated the pairs genetically more distant (RS 20, Beija-flor and (Rosa-claro, RS 20 as well as pairs genetically more similar (IAC 112, Viçosa and (Branco, CMS 42. Tree or four genetic divergences groups were formed depending on the method. To popcorn breeding, cultivars with best potential are RS 20, Zélia, IAC 112, and Beija-flor. The cultivars show genetic divergence.
Directory of Open Access Journals (Sweden)
Jana Luíza Toscano Mendes de Oliveira
2009-02-01
Full Text Available This study aimed to evaluate the antibacterial activity of Origanum vulgare L. and O. majorana L. essential oils on Staphylococcus aureus, S. coagulase negative, Enterobacter spp., Proteus spp., Acinetobacter spp., Klebsiella spp. isolated from the patients with conjunctivitis. The results showed a prominent inhibitory effect of both the essential oils on all the bacterial strains, noted by the large bacterial growth inhibition zones (15-32mm. The Minimum Inhibitory Concentrations (MIC values were between 5-20µL/mL and 2.5-10 µL/mL for O. vulgare and O. majorana essential oil, respectively. The MIC were able to cause significant (PEste estudo objetivou analisar a atividade antibacteriana do óleo essencial de O. vulgare L. and O. majorana L. sobre cepas bacterianas (Staphylococcus aureus, S. coagulase negative, Enterobacter spp., Proteus spp., Acinetobacter spp., Klebsiella spp. isoladas de pacientes com conjuntivite. Os resultados mostraram um destacável efeito inibitório de ambos os óleos essenciais ensaiadossobre todas as cepas bacterianas, notado pela formação de amplas zonas de inibição do crescimento bacteriano (15-32 mm. Os valores de Concentração Inibitória Mínima - CIM encontradas estiveram entre 5-20µL/mL e 2.5-10 µL/mL para o óleo essencial de O. vulgare e O. majorana, respectivamente. Os valores de CIM foram capazes de causar significante efeito inibitório sobre a viabilidade celular de Klebisiella spp., Proteus spp. e S. aureus causando uma total eliminação do inóculo microbiano em um tempo máximo de 24 h de exposição. Estes resultados mostraram a efetividade antibacteriana dos óleos essenciais de O. vulgare e O. majorana, bem como suporta a possibilidade do uso de tais produtos como fontes de compostos antimicrobianos.
LEAF MINERAL CONCENTRATION OF FIVE OLIVE CULTIVARS GROWN ON CALCAREOUS SOIL
Directory of Open Access Journals (Sweden)
Igor Pasković
2013-12-01
Full Text Available There are limited numbers of scientific publication regarding genotypic differences which exist among olive cultivars concerning nutrient uptake and translocation. For that purpose, the object of our study was to determine possible differences between leaf mineral content of five selected olive cultivars since leaf nutrient analysis is consider being the best method for diagnosing olive tree nutritional status. Plant material was obtained from an olive collection, grown on calcareous soil maintained at Institute of Adriatic Crops and Karst Reclamation, Split, Croatia. The study was conducted with two Croatian autochthonous olive cultivars (“Istarska bjelica”, “Lastovka”, two Italian cultivars (“Pendolino”, “Leccino” and one Spanish cultivar (“Hojiblanca”. Completely randomized design was applied. This study has shown questionably low Mg concentration in all olive cultivars with exception for “Hojiblanca” cultivar. Also, only Croatian cultivars “Istarska bjelica” and “Lastovka” as well as Spanish cultivar “Hojiblanca” recorded sufficient levels of iron leaf mineral content. Regarding other elements studied (P, K, Ca, Zn, Mn, Cu all cultivars were above literature cited thresholds for possible deficiencies. Selected olive cultivars in our experiment demonstrated different nutrient leaf concentration, which is of particular importance for fertilization requirements and fertilization practice in Croatian orchards grown on calcareous soil.
New cultivars of jujube induced by mutation
International Nuclear Information System (INIS)
Hoang, V.T.; Tuynh, N.V.
1989-01-01
Full text: Mutation breeding of jujube (Ziziphus mauritiana Lin.) received attention by the Food Crops Research Institute since 1978. Mutations can be directly released as new cultivars or indirectly as bud grafting source. N-methyl-N-nitroso urea (MNH) was used at a concentration of 0.02-0.04% for 12 h treatment of pre-germinated seeds of different jujube cultivars. Some useful mutants were selected and directly released as new cultivars to farmers. Of the selected mutants two cultivars, ''Ma hong'' and ''Dao tien'', are the most preferable and popularly grown in the country. ''Ma hong'' is a mutant of ''Gia Loc'', a very popular cultivar. Main useful traits of ''Gia Loc'' such as early maturing, two crops of fruits per year are maintained (harvest in December and August). ''Ma hong'' has round-formed, pink rose coloured, sweeter fruits and stable fruit yield in off-season (Aug.) as compared with oval-formed, yellow-coloured and sour fruit of ''Gia Loc''. ''Dao tien'' is a mutant of the local variety ''Thien Phien'' with quite different traits. The original cultivar is late maturing (harvested in Feb.) with one crop of fruit per year and has small fruits (mean wt. of fruit at harvest 20 g). ''Dao tien'' is one month earlier in maturing allowing two crops of fruit per year (harvested in Jan. and Nov.). Fruits are round-formed, bigger (mean wt. of fruit: 25 g) and more tasteful (peach-flavored and brittle). (author)
Morphological diversity in fourteen cultivars Tiron village, Kediri, Indonesia
Directory of Open Access Journals (Sweden)
Nur Azis Fuad
2016-01-01
Full Text Available Tiron village, Kediri is one of central mangoes in Indonesia. Many cultivar of mangoes encountered at this location. This study aims to look at the diversity of mango cultivars in the Tiron Village, Kediri, Indonesia. Mangoes diversity is based on qualitative and quantitative character of each cultivar. The diversity among cultivar indicated by the standard deviation and variance in the eleven quantitative characters of mango. Mango cultivars categorized by phylogeny morphological characters. The method used for phylogeny analysis is an UPGMA method (unweighted pair group method with arithmetic mean. Phylogenic analysis is based by the qualitative character of the plant. The results showed there were fourteen cultivars of mango in the village of Tiron Kediri have high diversity. Fourteen mango cultivars were categorized four groups. Based on a qualitative character, there are four classes of mango. The first group is the Katul, Podang Urang, and Podang Lumut. The second group is the Gadung, Jaran, Madu, Endog, Pakel, Dodonilo, Ireng, Lanang and Cantek. Santok Kapur into groups to form groups of three and Kopyor fourth. The high diversity in the village mango Tiron Kediri potential for resource in situ germplasm.
Understanding rhizosphere processes to enhance phytoextraction of germanium and rare earth elements
Wiche, Oliver
2017-04-01
Germanium (Ge) and rare earth elements (REEs) are economically valuable raw materials that are not actually rare in terms of concentrations in soils but they are hardly available for plant uptake due to interactions with organic matter (SOM), secondary soil constituents such as Fe/Mn oxides and P bearing soil fractions. Processes in the rhizosphere might influence availability of Ge and REEs in the soil-plant system, since lowering of the pH and presence of carboxylates and siderophores (small molecules that strongly chelate Fe and other elements) strongly influences the chemical speciation of Ge and REEs in soil and consequently this comprehensive knowledge helps us to improve phytomining. In a series of field and greenhouse experiments 16 plant species from the functional groups of grasses, herbs and legumes were tested with regard to their accumulation efficiency of Ge and REEs in shoots. Subsequently, we conducted mixed culture experiments in which inefficient species (e.g. cereals like Avena sativa, Hordeum vulgare, Panicum miliaceum) were cultivated in mixed cultures with efficient species (Lupinus albus, Lupinus angustifolius). Based on the plant concentrations a principal component analysis (PCA) was performed to identify significant factors that explain the accumulation behavior of different plant species with regard to Ge, REEs, Si, Fe and Mn. In this analysis Mn was used to identify plant species with efficient mechanisms to access sparingly available P-resources in soils. Particularly in nonmycorrhizal species concentrations of Mn in leaves often indicate a carboxylate based P-mobilising strategy. Herbaceous plant species accumulated significantly higher amounts of REEs while grasses accumulated significantly higher amounts of Ge. Concentrations of Ge in shoots of grasses correlated significantly positive with Si, but negatively with concentrations of Mn. Indeed, the results of the PCA clearly show that plants with high Mn concentrations tend to have
Luxury as the opposite of vulgarity:a trio of perspectives on luxury brands
Reyneke, Mignon
2011-01-01
This thesis, entitled “Luxury as the opposite of vulgarity: A trio of perspectives on luxury brands” considers luxury brands in a trio of contemporary contexts. Despite the academic research surrounding luxury brands being limited, the existent research most often studies luxury brands in a traditional retail context. That is, luxury is viewed from a perspective where the products are sold in luxury retail stores. However, the landscape that these brands function within has changed significan...
Hadjer Kadri; Salah Eddine Djilani; Abdelouaheb Djilani
2013-01-01
Background.Arisarum vulgare is screened and its total phenolic compounds and total flavonoid contents were measured. In addition, the antioxidant capacity of the methanol-water (7:3) extract of this plant is evalu- ated by DPPH (2,2-diphenyl-1 picrylhydrazyl) and ABTS (2,2’-azino-bis(3-ethylbenzothiazoline-6-sulfon- ic)) tests expressed by Vitamin C Equivalent Antioxidant Capacity (VCEAC). HPLC analyses are carried out to identify some polyphenols. The aim of this study is to identify, ...
Molecular characterization of olive cultivars grown in Iraq using ...
African Journals Online (AJOL)
The results of this research confirmed AFLP and SSR to be useful tools in genetic relationships among olive cultivars, in creating a molecular database for Iraqi olive cultivars, in breeding strategies and in correct cultivar identification. Keywords: Olea europaea, genetic diversity, amplified fragment length polymorphism ...
Directory of Open Access Journals (Sweden)
Nei Peixoto
1999-03-01
Full Text Available Seis ensaios de competição de cultivares de tomate para processamento industrial foram conduzidos nos municípios goianos de Anápolis, Jataí, Porangatú e Santa Isabel, em 1990, e Anápolis e Porangatu, em 1991. O delineamento experimental utilizado foi de blocos casualizados com quatro repetições, tendo as parcelas 80 plantas em 1990 e 70 em 1991. Em Porangatu, em 1990, as plantas foram mais precoces, florescendo 35 e 41 dias após a semeadura e iniciando-se a colheita 38 dias após a antese. Em Anápolis, também em 1990, a floração iniciou-se de 54 a 60 dias após a semeadura e, a colheita, 46 dias após a antese. As cultivares Petomech, IPA 6 e Topmech Melhorado destacaram-se entre as mais produtivas, apresentando frutos firmes, seguidas das cultivares IPA 5 e Agrocica 72. As cultivares Roma VFN, Rossol e Agrocica 08, por outro lado, revelaram-se produtivas, mas com frutos pouco firmes, sendo impróprias para o transporte a longa distância. Com exceção da cultivar Itaparica, que apresentou melhor desempenho relativo nos ambientes menos favoráveis, os genótipos apresentaram, para rendimento, resposta diretamente proporcional à melhoria do ambiente, caracterizado pela média geral dos genótipos dentro de cada experimento. As cultivares Agrocica 08, IPA 5, Nemadoro e UC 204, foram as mais influenciadas pelas variações do ambiente, enquanto as cultivares Agrocica 33, Calmec VF, IPA 6, Rio Fuego, Santa Adélia, Topmec Melhorado e UC 82 foram as mais estáveis.Six field trials were carried out to evaluate processing tomato cultivars in four counties in the State of Goiás, Brazil (Anápolis, Jataí, Porangatú and Santa Isabel, in 1990, and Anápolis and Porangatu, in 1991. The experiment was conducted as a randomized block design, with four replications, and plots of 80 plants in 1990 and 70 plants in 1991. The plant cycle was shorter in Porangatu (1990, where temperatures were higher than Anápolis. In Porangatu, plant flowering
Institute of Scientific and Technical Information of China (English)
ALEXANDRE DE ALMEIDA E SILVA; ELENICE MOURO VARANDA; JOS(E) RICARDO BAROSELA
2006-01-01
Biology of the aphid Therioaphis maculata was studied on alfalfa (Medicago sativa L.), including four resistant (Mesa-Sirsa, CUF101, Baker and Lahontan) and two susceptible (ARC and Caliverde) alfalfa cultivars, and one of the most cropped Brazilian cultivars, Crioula. Under controlled conditions, antibiosis (i.e., reduced longevity, fecundity and increased mortality of the aphid) was observed mainly on the resistant alfalfa cultivars,except on Lahontan. Crioula seemed to be tolerant to aphids. Present data support geographic limitation usage of cultivars, and we suggest Baker and Mesa-Sirsa as sources of antibiosis,and provide biological information of a tropical T. maculata biotype on alfalfa.
Directory of Open Access Journals (Sweden)
Carlos Eduardo Rossi
2004-03-01
Full Text Available Pesquisaram-se as reações de 11 cultivares de rabanete a Meloidogyne javanica e sua patogenicidade a uma dessas cultivares. No estudo de reações, os tratamentos/cultivares foram 'Comprido Branco', 'Crimson Gigante', 'Ponta Branca', 'Comprido Vermelho', 'Serrano', 'Gigante Wurzburgo', 'Saxa', 'Redondo Vermelho', 'Redondo Gigante', 'Cometo' e 'Akamaru Hatsuka'. Determinaram-se os índices de galhas (IG e de massas de ovos (IMO, o número de nematóides no sistema radicular (NSR e por grama de raiz (NGR e o fator de reprodução (FR 53 dias após a inoculação artificial com 2.000 ovos do parasito. Em outro experimento, avaliaram-se os efeitos de três densidades populacionais do nematóide [0, 500 (nível populacional baixo e 10.000 (nível populacional alto ovos/planta] sobre as massas frescas e secas de túberas e de parte aérea da cultivar 'Redondo Gigante', 39 dias após a inoculação. Os resultados mostraram que todas as cultivares permitiram a reprodução de M. javanica, sendo portanto consideradas suscetíveis. Valores de IG e IMO foram maiores ou iguais a 2,5 e os de FR, maiores do que 8,0 para todas as cultivares estudadas. O parasito causou diminuição significativa nas massas frescas e secas de túberas e de partes aéreas nos dois níveis populacionais estudados comparados com o controle não inoculado. As médias dos tratamentos contendo níveis populacionais baixo e alto do nematóide também diferiram estatisticamente entre si, comprovando-se, assim, a sua ação patogênica sobre a cultivar avaliada.Experiments were conducted under greenhouse conditions to determine the reaction of eleven radish (Raphanus sativus cultivars to Meloidogyne javanica and the pathogenicity of this nematode to a previously selected cultivar. The cultivars tested were 'Comprido Branco', 'Crimson Gigante', 'Ponta Branca', 'Comprido Vermelho', 'Serrano', 'Gigante Wurzburgo', 'Saxa', 'Redondo Vermelho', 'Redondo Gigante', 'Cometo' and 'Akamaru
Directory of Open Access Journals (Sweden)
E Bijanzadeh
2011-01-01
Full Text Available Abstract Salt stress is a major stress influencing wheat seedling establishment. A laboratory experiment was conducted to evaluate the response of 20 cultivars of wheat to two levels of salinity (8 and 16 dS/m NaCl, at the College of Agriculture, Shiraz University, Shiraz, Iran in 2008. Maximum root length was obtained in Dabira (5.73 mm at 16dS/m salinity level. In control, durum wheat cultivars including D81-17, Yavaros, D82-16, D79-15 and Taro3 had the maximum root length compared to bread wheat, however, with increasing salinity level to 16dS/m, minimum root length was observed in D82-16 (0.3 mm. In all cultivars, with increasing salinity level, shoot length was decreased and minimum shoot length was observed in D82-16 and D79-15. Under control conditions, Taro 3 cultivar had maximum seedling dry weight (108.6 mm, however, at 8 and 16 dS/m salinity levels, seedling dry weight of this cultivar was decreased to 92.33 and 78.43 mg, respectively. All seeds (100% were germinated in D82-16, Taro3, Bolani Cross, and Chamran cultivars under 16 dS/m but in Marvdasht cultivar, seed germination percentage under 8 and 16 dS/m reached to 65 and 50%, respectively. Shiraz (10.8 seeds/day, Adl Cross(10 seeds/day, and Bolani Cross (9.1 seeds/day had maximum germination rate under 16 dS/m salinity level. Differences among wheat cultivars also found in germination stress index (germination rate under stress divided by germination rate under control and Shiraz, Adl Cross and Bolani Cross had maximum germination stress index, while Yavaros and D82-16 had minimum germination stress index. Furthermore, with increasing salinity level, different responses were observed among wheat cultivars in root and shoot length, germination rate and germination stress index which demonstrated the genetic diversity among wheat cultivars. It appeared that durum wheat cultivars, compared to bread wheat cultivars, had lower germination stress index and germination rate. Among what
Directory of Open Access Journals (Sweden)
Francisco J. da S. Lédo
2000-11-01
Full Text Available Devido às condições ambientais verificadas no estado do Acre, caracterizado pela ocorrência de temperaturas elevadas e alta precipitação, as cultivares tradicionalmente utilizadas pelos produtores apresentam baixo rendimento e qualidade. O objetivo do presente trabalho foi avaliar o comportamento das novas cultivares de alface disponíveis no mercado, em termos de características agronômicas e rendimento, nas condições edafoclimáticas de Rio Branco, Acre. Para isso foram realizados dois ensaios no campo experimental da Embrapa Acre, em um solo do tipo Argissolo Vermelho-Escuro, textura argilosa. O primeiro de maio a julho de 1996 (período seco e o segundo de dezembro de 1996 a fevereiro de 1997 (período chuvoso. Foram avaliadas as cultivares Babá de Verão, Brisa, Carolina AG-576, Elisa, Lucy Brown, Marisa AG-216, Piracicaba 65, Regina 71, Tainá, Simpson, Vanessa e Verônica, sendo que 'Regina 71' e 'Elisa' foram incluídas apenas no ensaio do período seco. O delineamento experimental foi o de blocos casualizados, com três repetições. No período seco, as cultivares Simpson, Lucy Brown e Regina 71 apresentaram os maiores pesos médios (373; 362 e 341 g, respectivamente e produções comerciais de 49,8; 48,3 e 45,5 t/ha, respectivamente. Em geral, as cultivares dos tipos lisa sem cabeça e lisa com cabeça apresentaram maior índice de ataque de nematóide (Meloidogyne javanica quando comparadas às do tipo crespa. No ensaio realizado no período chuvoso, as cultivares Marisa AG-216, Verônica, Lucy Brown, Brisa, Tainá e Piracicaba-65 apresentaram os maiores pesos médios e produções comerciais. Entretanto, as médias obtidas foram bem inferiores às verificadas no ensaio do período seco, variando de 164 a 198 g para o peso médio, e 21,9 a 25,9 t/ha para produção comercial. Dentre as cultivares avaliadas no período seco, Regina 71 (lisa, sem cabeça e Carolina AG-576 (lisa, com cabeça destacaram-se entre as do tipo
Stem rust seedling resistance genes in Ethiopian wheat cultivars ...
African Journals Online (AJOL)
Thirty durum wheat (19 commercial cultivars and 11 breeding lines) and 30 bread wheat (20 commercial cultivars and 10 breeding lines) were tested for gene postulation. Stem rust infection types produced on wheat cultivars and breeding lines by ten Pgt races was compared with infection types produced on 40 near ...
Directory of Open Access Journals (Sweden)
Wagner F. da Mota
2005-07-01
Full Text Available Efetuou-se a caracterização físico-química dos frutos de quatro cultivares de quiabo neste estudo. O delineamento utilizado foi de blocos casualizados, sendo os tratamentos constituídos pelas cultivares Amarelinho, Red Velvet, Star of David e Mammoth Spinless, com cinco repetições. Na maturidade comercial os frutos da cultivar Star of David tiveram maior diâmetro, peso fresco total e teor de matéria seca, menor comprimento, teor de umidade e de vitamina C comparado com as demais cultivares. A cultivar Red Velvet teve o menor diâmetro, peso fresco, teor de matéria seca, açúcares redutores e teores de clorofilas a, b e total, e maior teor de umidade e vitamina C. Frutos da cultivar Mammoth Spinless apresentaram os maiores teores de clorofilas a, b e total. A cultivar Amarelinho teve maior comprimento e menores teores de clorofila, a, b e total. As cultivares Amarelinho e Mammoth Spinless apresentaram maiores teores de açúcares redutores.In an experiment some physical and chemical characteristics of four okra cultivars were evaluated. The experimental design was of randomized blocks, where the treatments were the cultivars Amarelinho, Red Velvet, Star of David and Mammoth Spinless with five replications. At commercial maturity fruits of the cultivar Star of David presented the largest diameter, total fresh matter, content of dry matter, smallest length, content of water and vitamin C in comparison to the other cultivars. The cultivar Red Velvet presented the smallest diameter, total fresh matter, content of dry matter, reducing sugars and content of chlorophyll a, b and total, but the largest content of water and vitamin C. The cultivar Amarelinho produced the longest fruits and the smallest content of chlorophyll a, b and total. The cultivars Amarelinho and Mammoth Spinless showed higher contents of total reducing sugars.
Instrumental neutron activities analysis of Marrubium vulgare L., a valuable medicinal herb
Energy Technology Data Exchange (ETDEWEB)
Nedjimi, Bouzid [Djelfa Univ. (Algeria). Lab. of Exploration and Valorization of Steppe Ecosystem; Beladel, Brahim [Djelfa Univ. (Algeria). Dept. of Physics
2016-08-01
Twenty two chemical elements were identified by Instrumental neutron activation analysis in Marrubium vulgare (Lamiaceae) a traditional medicine plant, used indigenously in Mediterranean basin to cure several diseases. The precision of the results was assessed by analyzing the certified reference material GBW 07605 (GSV-4) Tea leaves. Results showed that K was the dominant chemical element in studied plant (4.40%). The Ca and Fe mass fractions were also relatively high. However potential toxic elements in this Lamiaceae plant were within the safety limits suggested by WHO/FAO.
Directory of Open Access Journals (Sweden)
Raquel SC Nunes
2012-03-01
Full Text Available Taro (Colocasia esculenta is a tuberous plant belonging to the Araceae family whose tuber is the 14th most consumed food crop in the world. Characterized as an unconventional vegetable, taro is grown in Brazil as a subsistence crop, but in recent years began to gain commercial importance, especially in the states of Espirito Santo, Minas Gerais and Rio de Janeiro. To avoid loss of genetic diversity of the local varieties traditionally grown in Brazil a core collection for taro germplasm has been developed by the Instituto Capixaba de Pesquisa, Assistência Técnica e Extensão Rural do estado do Espirito Santo (Incaper. The aim of this study was to perform a molecular characterization of the seven regional core collections. Genetic diversity of the cultivars was investigated by using SSR (Simple Sequence Repeats polymorphisms, in seven loci (Xuqtem55, Xuqtem73, Xuqtem84, Xuqtem88, Xuqtem91, Xuqtem97 and Xuqtem110. Genetic diversity of the cultivars, based on the seven microsatellite alleles, was evaluated by using the software GelCompar II, showed that the loci Xuqtem73, Xuqtem88 and Xuqtem110 were the most informative, featuring 7, 10 and 8 alleles, respectively, a percentage of cultivars with polymorphic alleles of 85, 57 and 100% and identical PIC of 0.91. Based on Xuqtem110 locus analysis, the seven cultivars were grouped in two clusters. Chinês Regional Incaper cultivar was originated from Chinês cultivar which originated the São Bento cultivar, corroborating previous results. Macaquinho and Chinês cultivars were shown to be the primitive ones originating the allelic collections found in the states of Mato Grosso do Sul and Espirito Santo.O taro (Colocasia esculenta é uma hortaliça da família Araceae cujo rizoma é o décimo quarto alimento vegetal mais consumido no mundo. Caracterizado como uma hortaliça não convencional, o taro é cultivado no Brasil como uma cultura de subsistência, mas nos últimos anos começou a ser
Evaluation of Garlic Cultivars for Polyphenolic Content and Antioxidant Properties
Cheng, Siqiong; Li, Panpan; Du, Junna; Chang, Yanxia; Meng, Huanwen
2013-01-01
Two phenolic compound parameters (total phenolic and flavonoid contents) and 5 antioxidant parameters (DPPH [2, 2-diphenyl-1-picrylhydrazyl] radical scavenging activity, HRSC (hydroxyl radical scavenging capacity), FRAP (ferric ion reducing antioxidant power), CUPRAC (cupric ion reducing antioxidant capacity), and MCA (metal chelating activity) were measured in bulbs and bolts of 43 garlic cultivars. The bulbs of cultivar ‘74-x’ had the highest phenolic content (total phenolic, flavonoids) and the strongest antioxidant capacity (DPPH, FRAP, and CUPRAC), followed by bulbs of cultivar ‘Hanzhong purple’; the bulbs of cultivar ‘Gailiang’ had the lowest phenolic content and antioxidant capacity (FRAP, CUPRAC, MCA). The bolts of ‘Hanzhong purple’ also had higher phenolic content. Principal components analysis (PCA) separated the cultivars into 3 groups according to phenolic and flavonoid contents and strength of antioxidant activity. The first group had higher HRSC, FRAP, and flavonoid content; the second group had higher total phenolic content and MCA; some cultivars in the third group had higher HRSC and FRAP. All 8 test garlic bulb extracts successfully prevented Human Vascular Endothelial Cell death and significantly prevented reactive-oxygen species (ROS) formation in oxidative stress model, in which cultivar ‘74-x’ had highest protection capability, following by cultivar ‘Hanzhong purple’, and the bulbs of cultivar ‘No. 105 from Korea’ had the lower protection capability against cell death and ROS formation. The protection capability in vivo of these garlic cultivars was consistent with their phenolic content and antioxidant capacity. PMID:24232741
Secondary metabolism responses in two Pisum sativum L. cultivars ...
African Journals Online (AJOL)
Both cultivars were grown in the absence or presence of Fe with the addition of bicarbonate for twelve days. Higher concentrations of phenols and flavonoids were observed in Fe-deficient tissues of both cultivars; however, the increase was greater in the tolerant cultivar than in the susceptible one. The activity of shikimate ...
Spiridon, Iuliana; Colceru, Svetlana; Anghel, Narcis; Teaca, Carmen Alice; Bodirlau, Ruxanda; Armatu, Alice
2011-10-01
The study reported here presents a comparative screening of three medicinal plants including oregano (Origanum vulgare L.), lavender (Lavandula angustifolia) and lemon balm (Melissa officinalis) having the same geographical origin, the Southeast region of Romania, and growing in the same natural conditions. The contents of total phenolics and total flavonoids for the extracts of these were determined. Furthermore, the total antioxidant capacity was also evaluated. It was found that Origanum vulgare and Melissa officinalis extracts present the most effective antioxidant capacity in scavenging DPPH radicals, while Lavandula angustifolia is less active. High performance liquid chromatography-mass spectrometry analysis was used to identify the components of extracts. Major phenolic acids identified in the analysed species were ferulic, rosmarinic, p-coumaric and caffeic, while predominant flavonoids were quercetin, apigenin kaempherol, which were present as glucosides.
Directory of Open Access Journals (Sweden)
D. Agostinetto
2004-06-01
Full Text Available O objetivo deste trabalho foi avaliar os efeitos de cultivares de arroz irrigado e de épocas de adubação nitrogenada durante o ciclo da cultura sobre a habilidade competitiva do cereal em relação ao cultivar EEA 406, usado como simulador da planta daninha arrozvermelho. Para isso, conduziu-se experimento em campo, na estação de crescimento 2001/02. Os tratamentos, dispostos em esquema fatorial, constaram de cultivares de arroz (BRS-38 Ligeirinho, IRGA 417 e BR-IRGA 409, épocas de aplicação do nitrogênio (N (100% do N na semeadura, 50% do N na semeadura mais 50% no início da diferenciação da panícula (IDP, 100% no IDP e testemunha sem o adubo e populações do cultivar simulador do arroz-vermelho. Para relacionar as perdas de produtividade de grãos de arroz com populações do cultivar simulador, utilizou-se o modelo de regressão da hipérbole retangular, ajustado de modo independente para os fatores estudados. Verificou-se que a época de aplicação do N influenciou na habilidade competitiva dos cultivares de arroz. Cultivares de ciclo muito curto e curto apresentaram maior habilidade competitiva com o cultivar simulador, quando a adubação foi realizada na semeadura, enquanto o cultivar de ciclo médio se beneficiou do fracionamento da adubação na semeadura e no IDP.The objective of this study was to evaluate the effects of flooded rice cultivars and timings of nitrogen fertilizer application during the crop cycle on the competitive ability of this cereal in relation to EEA 406 cultivar, used as a mimicker of red rice. Thus, a field experiment was carried out during the 2001/02 growing season. The treatments were arranged in a factorial design,comprising the rice cultivars (BRS-38 Ligeirinho, IRGA 417, and BR-IRGA 409, nitrogen (N application timings (100% at sowing, 50% at sowing plus 50% at the beginning of panicle differentiation (BPD, 100% at BPD, and check without fertilizer, and densities of the mimicker cultivar. In
Production of cultivars of Anthurium andraeanum in Acorizal-MT conditions
Directory of Open Access Journals (Sweden)
Carmen Lúcia Ferreira Fava
2014-11-01
cover with sugarcane bagasse. The cultivars Eidibel and Supremo were the most productive with 2,4 stalks/month/plant; the bigger spathe was obtained by the cultivar Brasão with 17,2 cm of width and 12,6 cm length; and the cultivar Sonata presents the bigger spadix with 7,6 cm. The seven cultivars of anthurium, as a cut flower, develop and bloom satisfactorily.
Maryam Mohajerani (PhD); Afsaneh Aghae i ( MSc )
2016-01-01
Background and objective: Peroxidases catalyze protein oxidation and lipid peroxidation. The activity of these enzymes in nerve cells is involved in causing disorders such as Alzheimer's and Parkinson's disease. This study investigated the effect of Citrus aurantium, Foeniculum vulgare and Rosmarinus officinalis essential oils on activity of peroxidase enzyme. Methods: All three medicinal plants were dried at room temperature. Their essential oil was extracted by steam distillation ...
Oil and fatty acid composition of peanut cultivars grown in Pakistan
International Nuclear Information System (INIS)
Hassan, F.; Ahmed, M.
2012-01-01
Quality and flavor of edible peanuts and its products are affected by fatty acid composition of oil. The information related to chemical composition of Peanut grown in the country are scarce, therefore, the present investigation was designed to determine the oil and fatty acid composition of some commonly grown peanut cultivars in Pakistan. Seven Peanut cultivars were grown during 2008 in randomized complete block design replicated thrice. The tested cultivars differed significantly for oil content which ranged from 49.83 to 53.06% on dry weight basis, thus showing differences of 7% among cultivars. The saturated fatty acids (Palmetic and Stearic acid) in different cultivars ranged between 9.95 to 10.79% and 1.63 to 2.19%, respectively. Differences among cultivars for oleic acid exhibited significance which ranged between 49.34 to 54.83%. Similarly, cultivars differed statistically for linoleic ac id which showed a range of 28.99 to 34.23%, thus depicted difference of 7%. Significant differences among tested cultivars may be attributed to the place of origin of particular cultivar. An inverse relationship was exhibited between oleic and linoleic acid, similar to other edible oils. (author)
CULTIVAR RELEASE-BRS 217 Flora: Early-maturing soybean cultivar
Directory of Open Access Journals (Sweden)
Plínio Itamar de Mello de Souza
2008-01-01
Full Text Available The soybean (Glycine max L. Merr. cultivar BRS 217 Flora was developed by Embrapa and released forproduction in the states of Goiás, Minas Gerais, Bahia, Mato Grosso and the Distrito Federal, Brazil. It is resistant to stemcanker, frog-eye leaf spot, bacterial pustule, and partially resistant to powdery mildew.
Variation between cut chrysanthemum cultivars in response to suboptimal temperature
Ploeg, van der A.; Kularathne, R.J.K.N.; Carvalho, S.M.P.; Heuvelink, E.
2007-01-01
To breed for more energy-efficient cut chrysanthemum (Chrysanthemum morifolium Ramat.) cultivars it is important to know the variation of the temperature response existing in modern cultivars. In a greenhouse experiment with 25 chrysanthemum cultivars, a significant variation was observed in
Detection of alien genetic introgressions in bread wheat using dot-blot genomic hybridisation.
Rey, María-Dolores; Prieto, Pilar
2017-01-01
Simple, reliable methods for the identification of alien genetic introgressions are required in plant breeding programmes. The use of genomic dot-blot hybridisation allows the detection of small Hordeum chilense genomic introgressions in the descendants of genetic crosses between wheat and H. chilense addition or substitution lines in wheat when molecular markers are difficult to use. Based on genomic in situ hybridisation, DNA samples from wheat lines carrying putatively H. chilense introgressions were immobilised on a membrane, blocked with wheat genomic DNA and hybridised with biotin-labelled H. chilense genomic DNA as a probe. This dot-blot screening reduced the number of plants necessary to be analysed by molecular markers or in situ hybridisation, saving time and money. The technique was sensitive enough to detect a minimum of 5 ng of total genomic DNA immobilised on the membrane or about 1/420 dilution of H. chilense genomic DNA in the wheat background. The robustness of the technique was verified by in situ hybridisation. In addition, the detection of other wheat relative species such as Hordeum vulgare , Secale cereale and Agropyron cristatum in the wheat background was also reported .
Directory of Open Access Journals (Sweden)
Zeni Fonseca Pinto Tomaz
2009-12-01
Full Text Available A insuficiência de estudos sobre compatibilidade de porta-enxertos é um dos fatores limitantes ao desenvolvimento da cultura da pereira (Pyrus sp. no Brasil. A utilização do marmeleiro (Cydonia oblonga como porta-enxerto para a cultura da pereira apresenta inúmeras vantagens, entre as quais a redução do vigor e a rápida entrada em produção; todavia, sua combinação com algumas cultivares copa apresenta problemas de incompatibilidade de enxertia, podendo ocasionar a ruptura do caule das plantas no pomar. Objetivou-se, neste trabalho, avaliar a compatibilidade de enxertia de algumas cultivares de marmeleiros ('Quince C' e 'Adams' com pereiras ('Packham's Triumph' e 'Kieffer'. As variáveis analisadas foram: diâmetro da secção do tronco no ponto de enxertia, 5 cm abaixo e 5 cm acima do ponto de enxertia, diferença do diâmetro entre porta-enxerto e copa, altura das plantas, volume e massa seca da copa e raízes. Além disso, efetuou-se a observação da conexão vascular no ponto de enxertia através da imersão da base das plantas (abaixo do ponto de enxertia, em solução corante de Ácido Fuccínico 0,08%. Concluiu-se que a cultivar 'Packham's Triumph'apresenta compatibilidade de enxertia com o marmeleiro cultivares 'Adams'e 'Quince C', enquanto o híbrido 'Kieffer' apresentou sintomas morfológicos de incompatibilidade de enxertia com o marmeleiro cultivares 'Quince C' e 'Adams'.The lack of studies on compatibility of pear cultivars and rootstocks is one of the limiting factors on the development of the pear crop in Brazil. The use of quinces as rootstocks for pear cultivars has several advantages, among them the reduction in vigor and earlier bearing trees, however, its combination with some scions cultivars results in problems of incompatibility , such as lost of trees of the orchard due to break of the graft union. The objective of this study was to determine the compatibility between pears cvs. Packham's Triumph and Kieffer
Performance of different tomato cultivars under organic and inorganic regimes
International Nuclear Information System (INIS)
Ali, I.; Khattak, A. M.; Ali, M.; Ullah, K.
2015-01-01
To study the performance of different tomato cultivars under organic and inorganic regimes an experiment was conducted at New Developmental Farm, The University of Agriculture, Peshawar, Pakistan during the summer 2013-14. The experiment was laid out in RCBD with split plot arrangement having four replications. Organic regimes (FYM, poultry manure and mushroom compost) and inorganic (NPK) regimes were allotted to main plot, while cultivars (Roma VF, Roma, Super Classic, Bambino and Rio Grande) were subjected to sub plots. Organic and Inorganic regimes significantly (P ≤ 0.01) influenced all the studied attributes of tomato cultivars. Among different cultivars, Roma gave maximum plant survival (93.8 percentage), number of leaves plant (84.1), number of flower inflorescence (5.4), number of fruits inflorescence (4.3), number of fruit plant (25.4), fruit size (63.9 cm) fruit weight plant (9.1 kg) and total yield (22.9 t ha). However, it was closely followed by cultivar Rio Grande for number of leaves plant (79.6), number of flower inflorescence (5.1), number of fruits inflorescence (4.0) and number of fruits plant (24.9). Cultivar Super Classic produced minimum number of leaves plant (67.7), flower inflorescence (4.8), fruit size (60.6 cm), fruit weight plant (8.6 kg) and total yield (21.7 t ha). Similarly, highest plant survival (90.0 percentage), number of flower inflorescence (5.1), number of fruits inflorescence (4.0), number of fruit plant (25.4), fruit size (62.4 ml), fruit weight plant (8.90 kg) and total yield (22.9 t ha) were recorded in plants provided with organic conditions Roma cultivar performed better than other cultivars under the agro climatic condition of Peshawar followed by cultivar Rio Grande. Therefore, organic tomato production, and these two cultivars are recommended to be grown in Peshawar area. (author)
Mutation breeding of autotetraploid Achimenes cultivars
International Nuclear Information System (INIS)
Broertjes, C.
1976-01-01
Colchicine-induced autotetraploids of three Achimenes cultivars were irradiated with X-rays or fast neutrons. The results were compared, in one cultivar, with those of the irradiated diploid form. The mutation frequency after irradiation of the autotetraploid was a 20-40 fold higher as compared to the corresponding diploid. These results may open new possibilities for mutation breeding, though they are hard to explain. Several promising mutants were selected. (author)
International Nuclear Information System (INIS)
Kal'chenko, V.A.; Lotareva, O.V.; Spirin, D.A.; Karaban', R.T.; Mal'tseva, L.N.; Ignat'ev, A.A.
1988-01-01
Effect of combined action of of gamma-irradiation and sulfur dioxide or N-methyl-N-nitro-N-nitrosoguanidin on baceria (Bacillus subtilis) and higher plants (Hordeum vulgare L., Pinus sylvestris L.) have been studied. The number of barley germ root cells with chromosomal aberrations depends on the order of treatment with the studied agents. The coefficients of SO 2 and gamma-irradiation correlation fluctuate from 1,3 to 2,6 in the above experiments. In experiments with pine seedlings, these correlation coefficients were similar to additive ones. The data obtained suggest that the pattern of action of the agents is determined by the radiation sensitivity of objects and the order of action of the agents
Long-term rotation and tillage effects on soil structure and crop yield
DEFF Research Database (Denmark)
Munkholm, Lars Juhl; Heck, R; Deen, B
2013-01-01
long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Topsoil measurements were carried out for three different rotations: R1, (C–C–C–C) continuous corn (Zea mays L.), R6, (C–C–O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare L.) and R8, (C......–C–S–S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard ploughing, MP. Topsoil structural quality...
DEFF Research Database (Denmark)
Munkholm, Lars Juhl; Heck, Richard; Deen, Bill
year old long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Measurements were carried out in the topsoil for three different rotations: R1 (C-C-C-C) continuous corn (Zea mays L.), R6. (C-C-O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare...... L.) and R8, (C-C-S-S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard plowing, MP. Topsoil...
Biochemical and Molecular Characterization of a Barley Seed ß-Glucosidase
DEFF Research Database (Denmark)
Leah, R.; Kigel, J.; Svendsen, I.
1995-01-01
blot analysis with the cDNA as probe indicated that BGQ60 is encoded by a single gene, and that BGQ60 mRNA only accumulates in the starchy endosperm tissue of late developing seeds. The bgq60 structural gene of approximately 5 kilobases contains an open reading frame encoding 485 amino acids...... during barley seed development and germination are discussed.......A 60-kDa ß-glucosidase (BGQ60) was purified and characterized from seeds of barley (Hordeum vulgare L.). BGQ60 catalytic activity was restricted to the cleavage of short-chain oligosaccharides composed of(1, 2) -,(1, 2, 3) -, and/or(1, 2, 3, 4) -ß-linked glucose or mannose units...
Santos, Adrian Richard Schenberger; Etto, Rafael Mazer; Furmam, Rafaela Wiegand; Freitas, Denis Leandro de; Santos, Karina Freire d'Eça Nogueira; Souza, Emanuel Maltempi de; Pedrosa, Fábio de Oliveira; Ayub, Ricardo Antônio; Steffens, Maria Berenice Reynaud; Galvão, Carolina Weigert
2017-09-01
Soil bacteria colonization in plants is a complex process, which involves interaction between many bacterial characters and plant responses. In this work, we labeled Azospirillum brasilense FP2 (wild type) and HM053 (excretion-ammonium) strains by insertion of the reporter gene gusA-kanamycin into the dinitrogenase reductase coding gene, nifH, and evaluated bacteria colonization in barley (Hordeum vulgare). In addition, we determined inoculation effect based on growth promotion parameters. We report an uncommon endophytic behavior of A. brasilense Sp7 derivative inside the root hair cells of barley and highlight the promising use of A. brasilense HM053 as plant growth-promoting bacterium. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
International Nuclear Information System (INIS)
Mohammed, M.M.A.
2010-01-01
This study was conducted to evaluate the modulating efficacy of prolonged oral administration of Foeniculum vulgare Mill. essential oil (FEO) against gamma irradiation-induced biochemical changes in male rats. Essential oil of Foeniculum vulgare Mill. was orally administrated at dose level of 250 mg/kg body wt/day for 21 days before irradiation and 7 days post exposure (6.5 Gy single dose). Rats exposed to ionizing radiation exhibited a potential elevation of serum aspartate aminotransferase (AST) and alkaline phosphatase (ALP) activities, bilirubin, urea and creatinine levels, lipid abnormalities, and an increase in tissue lipid peroxidation (LPO) and metallothioneins (MTs). On the other hand, noticeable drop in liver and kidney glutathione content and serum total protein, albumin and testosterone levels were recorded. Tissue organs displayed some changes in trace element concentrations, which may be due to the radiation ability to induce oxidative stress. The data obtained from rats treated with fennel oil before and after whole body gamma irradiation revealed significant modulation in the biochemical tested parameters and profound improvement in the activity of antioxidant status, glutathione and metallothioneins. The treatment of irradiated rats with fennel oil also appeared to be effective in minimizing the radiation-induced increase in lipid peroxidation as well as changes in essential trace elements in some tissue organs. In addition to its containing many chemical antioxidant constituents such as polyphenols, fennel was found to contain detectable concentrations of essential trace elements (Zn, Cu, Fe, Se, Mg, Mn and Ca) which may be involved in multiple biological processes as constituents of enzymes system including superoxide dismutase (Cu, Zn, Mn, SODs), oxide reductase, glutathione (GSP, GSH, GST), metallothionein MTs, etc. Overall, it could be concluded that Foeniculum vulgare Mill. essential oil exerts beneficial protective role against radiation
Seed storage effects on germination for two forage kochia cultivars
The cultivar ‘Snowstorm’ forage kochia was released by the USDA-ARS in 2012. It is a synthetic cultivar selected for stature, forage production, and adaptation to semiarid environments. Similar to the earlier released (1984) ‘Immigrant’ cultivar it can increase rangeland productivity magnitudes when...
Intraspecific responses of 188 rice cultivars to enhanced UVB radiation
International Nuclear Information System (INIS)
Dai, Q.; Peng, A.; Chavez, A.Q.; Vergara, B.S.
1994-01-01
Phytotron studies were conducted to determine the intraspecific variation in sensitivity of rice (Oryza sativa L.) to enhanced UVB and to test the hypothesis that rice cultivars originating from regions with higher ambient UVB radiation are more tolerant to enhanced UVB. Out of the 188 rice cultivars (from various rice growing regions and ecosystems) tested, 143 had significantly reduced plant height, 52 had smaller leaf area, 61 had lower plant dry weight and 41 had less tiller number under elevated UVB radiation (13.0 kJ m −2 day −1 ) for 3 weeks. Six cultivars showed significant positive growth response to enhanced UVB radiation, although the mechanism is not clear at present. These six cultivars were from the summer rice crop of Bangladesh and from high elevation rice areas where prevailing UVB radiation is most likely to be greater. However, there was no correlation between the dry matter changes under enhanced UVB and the ambient UVB level at the origin of the cultivar across the 188 cultivars tested. Therefore, cultivars originating from regions with higher ambient UVB are not necessarily more tolerant to enhanced UVB radiation. (author)
Bread-Making Quality of Standard Winter Wheat Cultivars
Ćurić, Duška; Novotni, Dubravka; Bauman, Ingrid; Krička, Tajana; Jukić, Željko; Voća, Neven; Kiš, Darko
2009-01-01
The purpose of this study was to define an impact of the cultivar, year and cultivation area of the standard Croatian winter wheat on the bread-making quality. The bread-making quality of cultivars ‘Divana’, ‘Žitarka’ and ‘Sana’ from the crop years 1998, 2000, 2002, 2004 and 2006, and from Zagreb and Osijek location was analyzed. Wheat from the cultivar tests cultivated under the same agro technological conditions was used for this testing. The tested winter wheat bread-making quality primari...
banana cultivar distribution in rwanda abstract résumé
African Journals Online (AJOL)
Administrator
Gisubi (ABB), Gros Michel (AAA), and 'Kamaramasenge'. (AAB) were the most abundant. Farms with a higher proportion of Gisubi contained fewer other cultivars. Also, new cultivars were identified and these should be added to the National Banana germplasm collection. Key Words: Cultivars, diversity indexes, germplasm, ...
An Acylated Kaempferol Glycoside from Flowers of Foeniculum vulgare and F. Dulce
Soliman, Fathy M.; Shehata, Afaf H.; Khaleel, Amal E.; Ezzat, Shahera M.
2002-01-01
An acylated kaempferol glycoside, namely kaempferol-3-O-α-L-(2”,3”-di-E-pcoumaroyl)-rhamnoside (1) was isolated from the flowers of Foeniculum vulgare Mill. and F. dulce DC. It is thus isolated for the first time from family Apiaceae. In addition, the different organs of both plants afforded six flavonoid glycosides - namely afzelin (kaempferol-3-O-α-L-rhamnoside) (2), quercitrin (3), isorhamnetin-3-O-β-D-glucoside (4), isoquercitrin (5), rutin (6), and miquelianin (quercetin-3...
Directory of Open Access Journals (Sweden)
Sebastião Martins Filho
2008-09-01
Full Text Available Neste trabalho foi utilizada a metodologia Bayesiana para ajustar o modelo não-linear logístico para dados de crescimento de duas cultivares de feijoeiro, "Neguinho" e "Carioca". O delineamento experimental utilizado foi o inteiramente casualizado, com vinte repetições, no esquema de parcelas subdivididas, sendo que os tratamentos principais foram constituídos pelas cultivares e as subparcelas foram constituídas por 17 períodos de avaliações, do plantio até aos 85 dias. A metodologia permitiu comparar as curvas de crescimentos sem utilizar a teoria assintótica e estes resultados mostraram um maior incremento em altura para a cultivar "Carioca".In this paper the Bayesian methodology was used to fit the logistic nonlinear model to growth data of two common bean cultivars, 'Neguinho' and 'Carioca'. The experiment was a split plot under a completely randomized design with twenty replicates, being the main treatments constituted by cultivars and the sub plots constituted by seventeen periods of evaluations, from planting to 85 days. The methodology allowed comparing the growth curves without using the asymptotic theory, and these results showed a larger height increment for the 'Carioca' cultivar.
Directory of Open Access Journals (Sweden)
Ignácio Lund Gabriel da Silva Carmo
2015-10-01
Full Text Available Production of the watermelon is important in all regions of Brazil. However, productive and qualitative information for fruit of different cultivars grown in the same environment is still scarce, especially in the State of Roraima, a fact that makes it necessary to carry out studies in order to meet this need. As a result, this study aimed to evaluate the agronomic performance of watermelon cultivars produced in the Cerrado at Boa Vista, Roraima. The experiment was conducted at the Agua Boa Experimental Farm of Embrapa Roraima, from December 2013 to February 2014. The experimental design was of randomised blocks (DBC, with six replications. The treatments comprised six watermelon cultivars: Verena, Explore, Elisa, Juliane, Crimson Sweet and Crimson Sweet Super, for which the productive, physical, chemical and physicochemical characteristics of the fruit were evaluated. There was no difference between cultivars in yield, number of fruit ha-1 or the number of fruit with a weight of between 6 and 9 kg. The cultivars differed as to physical characteristics (weight, size and number of seeds per fruit. There were differences between cultivars for all the chemical and physicochemical characteristics of the fruit. The cultivar Elisa displayed the highest levels for total soluble solids (12.58 °Brix. Fruits of the cultivars Explore and Crimson Sweet Super showed the greatest ratio between total soluble solids and titratable acidity. The fruits of the cultivars Explore and Elisa had the highest pH. The conditions of soil and climate in the Cerrado at Boa Vista favour the productive and qualitative characteristics of the cultivars being analysed. = A produção de melancia é consolidada em todas as regiões do Brasil. Porém, as informações sobre produtividade e qualidade dos frutos, de diferentes cultivares no mesmo ambiente, ainda são tímidas, sobretudo em Roraima, tornando necessária a realização de estudos para suprir essa carência. Objetivou
Directory of Open Access Journals (Sweden)
O.M. Yamashita
2005-12-01
Full Text Available Avaliou-se a resposta de nove cultivares de algodoeiro, de importância econômica no Estado do Mato Grosso, quanto à intoxicação causada por subdoses de glyphosate. Os cultivares de algodoeiro utilizados foram Fabrika, Makina, ITA-90, FM 986, FM 966, Delta Opal, BRS Facual, Antares e Coodetec 407. As plantas foram cultivadas em tubetes preenchidos com substrato de solo e mantidas em casa telada, tendo recebido a aplicação do glyphosate aos 20 dias após a emergência, época em que apresentavam quatro folhas verdadeiras. As subdoses de glyphosate, simulando deriva, foram de 270 e 540 g ha-1. Também foi utilizada testemunha, sem aplicação do herbicida, para efeito de comparação. Foram realizadas avaliações semanais até 42 dias após a aplicação dos tratamentos (DAA, período em que também foi tomada a altura das plantas. Os sintomas visuais de intoxicação iniciaram-se aos 3 DAA, caracterizados pelo amarelecimento das pontas das folhas mais novas, seguido de murchamento do ápice das plantas. Na dose de 270 g ha-1 esses sintomas foram de baixa intensidade, mas a 540 g ha-1 causaram, na maioria dos casos, toxidez "preocupante" a "muito alta". Os cultivares BRS Facual e FM 986 mostraram-se os mais suscetíveis. A altura das plantas foi mais afetada quando se aplicou a menor dose de glyphosate. Houve recuperação de todos os cultivares tratados com 270 g ha-1 de glyphosate até os 42 DAA. Quando tratados com 540 g ha-1 de glyphosate, os cultivares Fabrika, Coodetec 407, BRS-Facual e ITA-90 foram mais sensíveis, apresentando redução de altura entre 84 e 90% aos 42 DAA. Os cultivares menos sensíveis na dose de 270 g ha-1 de glyphosate não foram os mesmos para a dose de 540 g ha-1.The response of nine cotton cultivars economically important in the state of Mato Grosso was evaluated in relation to the toxicity caused by reduced rates of glyphosate. The cotton cultivars used were Fabrika, Makina, ITA-90, FM 986, FM 966, Delta Opal
Celiac disease (CD) is prevalent in 0.5 to 1.26% of adolescents and adults. The disease develops in genetically susceptible individuals as a result of ingestion of gluten forming proteins found in cereals such as, wheat (Triticum aestivum L.), rye (Secale cereale L.) and barley (Hordeum sativum L.)...
Energy Technology Data Exchange (ETDEWEB)
Santin, Ivan; Silva Neto, Helio F. da; Tasso Junior, Luiz Carlos; Marques, Diogo; Marques, Marcos O. [Universidade Estadual Paulista (FCAV/UNESP), Jabotical, SP (Brazil). Fac. de Ciencias Agrarias e Veterinarias. Dept. de Tecnologia], E-mail: santinivan@hotmail.com
2010-07-01
The success of energy generation from biomass of sugarcane is related to the amount of bagasse produced and the improvements of the equipment involved in the thermal balance of the sugarcane industrialization process. In this sense, the objective of this study was to quantify the production and productivity of bagasse in different early cultivars of sugarcane. The experimental design was a randomized block design with 6 treatments (cultivars) and 3 replications. The experiment was carried out at FCAV/UNESP-Jaboticabal. To calculate the productivity, the number of stems was counted in a meter, the weight of stems was obtained. The percentage of fiber for each cultivar was determined by calculating the estimated production and productivity of mulch. Using these values to estimate the potential number of people who would benefit from the energy generated by the combustion of bagasse an evolving process of cogeneration power. Cultivar CTC 16 (best results), showed the highest value of TCH (100.66 t ha{sup -1}), production of bagasse (315.66 kg t {sup -1}), any product residue (32.00 t ha{sup -1}) and people who could benefit (9.33 x 106). The Cultivars SP91-1049 and IACSP93-3046 presented the results less satisfactory. (author)
Molecular characterisation of radish cultivars
Directory of Open Access Journals (Sweden)
Sara Michelly Cruz
Full Text Available The radish has been gaining importance in the Brazilian market due to its use as a green manure and cover crop, and also due to its potential for the production of biodiesel, however there are only two registered cultivars, which are morphologically very similar. Determination of genetic purity is a prerequisite in marketing seeds as it ensures uniformity of the crop and is important in breeding programs. The aim of this work therefore was to evaluate the similarity and genotype patterns which permit differentiation of the commercial radish cultivars IPR 116 and CATI AL-1000. In order to do this, isoenzyme electrophoretic patterns were analysed in dry seeds, soaked seeds, seedling leaves and young leaves; the isoenzymes used being: superoxide dismutase, catalase, esterase, glutamate-oxalocetate, malate dehydrogenase and isocitrate lyase. Thirty-seven RAPD primers and 10 ISSR primers in leaves of the CATI AL-1000 and IPR-116 cultivars were analysed. Among the isoenzymes under study, the most polymorphic were glutamate oxalocetate, malate dehydrogenase, esterase and superoxide dismutase, with the superoxide dismutase system giving the best characterisation for all stages of development. The catalase isoenzyme system did not make it possible to differentiate between cultivars at any stage of development, and isocitrate lyase was not revealed by the protocol used. In analysis of the markers, 27 RAPD primers and eight ISSR primers showed polymorphism. The results indicate that it is possible to determine reliable descriptors based on isoenzymes at different stages of development of the radish and with the use of RAPD and ISSR primers.
Cytomorphological characterization of tea cultivars
International Nuclear Information System (INIS)
Rahman, H.; Khalil, I.H.; Shah, S.M.A.; Khanzada, T.Z.; Abbasi, F.M; Ahmad, H.; Shah, Z.
2010-01-01
Cytomorphological characterization was performed on tea cultivars, three each of Camellia sinensis and Camellia assamica species. For plant morphological study, one and a half year old healthy shoots were obtained from the selected mother bushes of the six tea cultivars. The field experiment conducted in randomized complete block design having four replications was aimed at evaluating plant height, number of leaves plant-l, number of branches plant-l, number of flowers plant-1, fresh and dry leaf weight plant-I. The data indicated significant difference between the two species with narrow leaved cultivars having increased plant height, number of leaves and branches plant-I than the broad leaved cultivars, but less number of flowers plant-l, fresh and dry leaf weight. Karyotype analysis indicated that both the groups are diploid with 2n = 30. On the basis of chromosome morphology, C. assamica had larger chromosomes (3-10.5 mu m) as compared to C. sinensis (3.9-8 mu m). C. assamica has relatively advanced features as compared to C. sinensis. However, both the groups possessed mostly median to sub-median centromeres with no secondary constrictions which possibly indicates that little or no evolutionary changes have taken place in tea and that the karyotype is still at a primitive stage, with C. sinensis being more primitive than C. assamica. Our results suggest that both the groups are different from each other in morphological as well as cytological attributes and could therefore generate more germplasm if the two species could be involved in tea breeding programs. (author)
Milk production potential of two ryegrass cultivars with different total ...
African Journals Online (AJOL)
The aim of the study was to compare a new Italian ryegrass (Lolium multiflorum) cultivar (Enhancer), bred to contain a high total non-structural carbohydrate content, with the cultivar, Dargle, in terms of dry matter (DM) production, nutritional value, carrying capacity and milk production. The ryegrass cultivars were sown (25 ...
Register of New Fruit and Nut Cultivars List 46. Rambutan.
The Register of New Fruit and Nut Varieties 46 is a compilation of descriptions of new fruit and nut cultivars from around the world. In this edition, 8 newly released rambutan cultivars are described in terms of their origins, important fruit traits and yield. Of the eight described cultivars, one ...
Energy Technology Data Exchange (ETDEWEB)
Wieneke, J.
1994-07-01
Hydroponic experiments were conducted with seedlings of barley (Hordeum vulgare L.), comparing the wild type and an NR-deficient mutant (AZ 12/70), to monitor the NO{sub 3}{sup -} influx/efflux relations and the response to tungstate treatment using {sup 13}N-labelling. Upon treatment with the arginyl-residue-binding inhibitor phenylglyoxal both genotypes responded with an immediate depression of NO{sub 3}{sup -} influx. At low external NO{sub 3}{sup -} concentrations efflux was small (5-15% of the influx) and did not differ substantially between the two genotypes. Although the mutant was distinguished from the wild type by a thinner root system and a reduced shoot length, the total N distribution between roots and shoots and the N concentrations in the root and shoot tissues were fairly comparable. Substantially higher extractable NO{sub 3}{sup -} concentration in the shoots (but not roots) of the mutant may indicate that the capacity to reduce NO{sub 3}{sup -} was restricted due to the very low but still detectable NR activity in the root and shoot tissue. Nevertheless, the mutant must have had supplementary means of assimilating considerable amounts of NO{sub 3}{sup -} over the experimental growth period. At the induced stage, both barley genotypes responded to tungstate treatments with a comparable but not complete depression of the NO{sub 3}{sup -} influx. Part of the NO{sub 3}{sup -} influx appears to be independent of the function of NR since an acceleration of the NO{sub 3}{sup -} uptake capacity to almost half the level of the controls occurred in both cultivars upon induction in spite of pretreatment with 150 micromolar WO{sub 4}{sup 2-} in a molybdenum-free solution prior to NO{sub 3}{sup -} induction. However, 600 micromolar tungstate treatment during the induction phase reduced NO{sub 3}{sup -} influx further (below 20%), but the plants of both cultivars were still able to recover almost completely. (author)
Synonyms and homonyms of Malvasia cultivars (Vitis vinifera L.) existing in Spain
Energy Technology Data Exchange (ETDEWEB)
Rodriguez Torres, I.; Ibanez, J.; Andres, M. T. de; Rubio, C.; Borrego, J.; Cabello, F.; Zerolo, J.; Munoz Organero, G.
2009-07-01
Malvasia is a common name for different grape cultivars that have long been grown in Spain. In many cases, these cultivars are noted as being aromatic, sweet, and similar to Muscat in flavour. However, not all grapes that share this name exhibit these characteristics. This study compares the Malvasia cultivars in the Spanish Denominations of Origin with those grape cultivars grown in the grapevine collection of El Encin (Alcala de Henares, Spain) using morphological, iso enzymatic, and micro satellite analysis as well as a large bibliographic search of the studied cultivars. Despite their Malvasia denomination, some cultivars have been identified as synonyms of Macabeo, Alarije, Dona Blanca, Chasselas, or Planta Nova, all included on the official Spanish list of commercial grape cultivars. Malvasia de Sitges and Malvasia de Lanzarote have the characteristic flavour of Malvasia grapes and no synonyms were found among the cultivars grown in Spain, whereas Malvasia Rosada resulted from a colour mutation in Malvasia de Sitges. (Author) 26 refs.
Effects of Site and Cultivar on Consumer Acceptance of Pomegranate.
Chater, John M; Merhaut, Donald J; Jia, Zhenyu; Arpaia, Mary Lu; Mauk, Peggy A; Preece, John E
2018-05-01
Pomegranate (Punica granatum L.) is an important fruit in many cultures. The fruit and juice have risen in popularity as it was discovered that pomegranate has relatively high antioxidant activity compared to most other fruits. In this study, six cultivars were utilized to determine consumer acceptance compared to the industry standard, 'Wonderful,' which comprises 90% to 95% of commercial production in the United States. Fruit were sourced from 2 cultivar field trials, one in inland Riverside, California, and one in coastal Ventura County, California. Cultivars selected for the study included 'Eversweet,' 'Green Globe,' 'Haku Botan,' 'Loffani,' 'Phoenicia,' 'Wonderful,' and 'cv. 857,' an heirloom cultivar from Ventura County, CA, U.S.A. Pomegranate arils were subject to sensory evaluation by 87 untrained consumer panelists in late 2016. Panelists were given pomegranate arils and asked to score the samples using a 9-point Hedonic scale for the following fruit quality traits: aril color, sweetness, tartness, seed hardness, bitterness, and overall desirability. There were significant differences among cultivars for all traits assessed by the sensory panelists. There were differences in acceptance among consumers for 'Wonderful' depending on if it was grown on the coast versus inland, and consumers preferred inland- versus coastal-grown 'Wonderful.' 'Wonderful' pomegranate was associated with cultivars that consumers scored low on desirability for bitterness. Cultivars that scored well in overall desirability compared with 'Wonderful' were 'cv. 857,' 'Eversweet,' 'Green Globe,' and 'Phoenicia.' Consumer sensory panels are important to determine scientifically which cultivars are desired by the public. These panels allowed for the determination of which pomegranate cultivars are liked or disliked by consumers and why. If the pomegranate growers know the most desirable cultivars for consumers, they are more likely to adopt and plant them, thus potentially increasing the
Brennan, M; Shepherd, T; Mitchell, S; Topp, C F E; Hoad, S P
2017-10-23
At ripeness, the outer husk of "covered" barley grains firmly adheres to the underlying caryopsis. A cuticular cementing layer on the caryopsis is required for husk adhesion, however the quality of adhesion varies significantly among cultivars which produce the cementing layer, resulting in the economically important malting defect, grain skinning. The composition of the cementing layer, and grain organ development have been hypothesised to influence the quality of husk adhesion. Plants of Hordeum vulgare 'Concerto' were grown at different temperatures pre- and post-anthesis to effect changes in the development of the husk, caryopsis and cuticular cementing layer, to determine how these variables influence the quality of husk-to-caryopsis adhesion. Warm conditions pre-anthesis decreased the quality of husk adhesion, and consequently increased the incidence of grain skinning. Cool post-anthesis conditions further decreased the quality of husk adhesion. The composition of the cementing layer, rather than its structure, differed with respect to husk adhesion quality. This cementing layer was produced at the late milk stage, occurring between nine and 29 days post-anthesis, conditional on the temperature-dependent growth rate. The compounds octadecanol, tritriacontane, campesterol and β-sitosterol were most abundant in caryopses with high-quality husk adhesion. The differences in adhesion quality were not due to incompatible husk and caryopsis dimensions affecting organ contact. This study shows that husk-to-caryopsis adhesion is dependent on cementing layer composition, and implies that this composition is regulated by temperature before, and during grain development. Understanding this regulation will be key to improving husk-to-caryopsis adhesion.
Starch accumulation in hulless barley during grain filling.
Zheng, Xu-Guang; Qi, Jun-Cang; Hui, Hong-Shan; Lin, Li-Hao; Wang, Feng
2017-12-01
Starch consists of two types of molecules: amylose and amylopectin. The objective of this study was increase understanding about mechanisms related to starch accumulation in hulless barley (Hordeum vulgare L.) grain by measuring temporal changes in (i) grain amylose and amylopectin content, (ii) starch synthase activity, and (iii) the relative expressions of key starch-related genes. The amylopectin/amylose ratio gradually declined in both Beiqing 6 and Kunlun 12. In both cultivars, the activities of adenosine diphosphate glucose pyrophosphorylase, soluble starch synthase (SSS), granule bound starch synthase (GBSS), and starch branching enzyme (SBE) increased steadily during grain filling, reaching their maximums 20-25 days after anthesis. The activities of SSS and SBE were greater in Ganken 5 than in either Beiqing 6 or Kunlun 12. The expression of GBSS I was greater in Beiqing 6 and Kunlun 12 than in Ganken 5. In contrast, the expression of SSS I, SSS II and SBE I was greater in Ganken 5 than in Beiqing 6 and Kunlun 12. The peak in GBSS I expression was later than that of SSS I, SSS II, SBE IIa and SBE IIb. The GBSS I transcript in Kunlun 12 was expressed on average 90 times more than the GBSS II transcript. The results suggest that SBE and SSS may control starch synthesis at the transcriptional level, whereas GBSS I may control starch synthesis at the post transcriptional level. GBSS I is mainly responsible for amylose synthesis whereas SSS I and SBE II are mainly responsible for amylopectin synthesis in amyloplasts.
Marrão, Ana Rita Galante de Abreu
2016-01-01
The Internet became an inherent part of people’s daily life and the major source of transformation in the relation between consumers and brands. However, in the luxury branding context, the introduction of prestige brands into a mass channel such as the Internet might bring the risk of vulgarization, loss of control over the brand, loss of the high-luxury appeal, jeopardizing brand equity. Hence, the present thesis paper proposes to answer the dilemma between the imperative of going online an...
Directory of Open Access Journals (Sweden)
Angela Maria Cangiani Furlani
1996-01-01
Full Text Available Este trabalho, desenvolvido em solução nutritiva, em casa de vegetação, no Centro Experimental de Campinas, Instituto Agronômico, objetivou definir parâmetros para avaliação e diferenciação de cultivares de milho quanto à exigência em zinco. Desenvolveram-se 24 cultivares durante 30 dias em solução nutritiva completa, com dois níveis de zinco (0,125 e 0,350 mg/L de Zn. O experimento seguiu o delineamento em blocos ao acaso, com parcelas subdivididas, com duas repetições por parcela e quatro plantas de cada cultivar por parcela. Os níveis de zinco ocuparam as parcelas e os cultivares, as subparcelas. Determinaram-se as seguintes variáveis: altura de planta, produção de massa seca da parte aérea, teores e conteúdos de zinco na parte aérea. Observaram-se reduções na produção de massa seca, na altura das plantas e nos teores e conteúdos de zinco, para o nível inferior do micronutriente na solução nutritiva. Os cultivares D-468, ICI-791152 e C-701 mostraram as menores reduções em altura em função do baixo nível de zinco e, C-808, Hatã-2000, OC-5045-6 e BR-201, as maiores respostas ao nível mais alto de zinco. A variação na altura das plantas (sintoma característico da deficiência de zinco revelou alta correlação (r = 0,86 com a variação no conteúdo de zinco da parte aérea dos diferentes cultivares. A altura das plantas e o conteúdo de zinco constituíram as melhores variáveis para discriminação dos cultivares; entretanto, a técnica em solução nutritiva necessita ser aperfeiçoada para permitir quantificar, com maior precisão, as diferenças detectadas na exigência em zinco.This experiment was conducted in a greenhouse, in nutrient solution, at the Experimental Center of Campinas, Instituto Agronômico, State of São Paulo, Brazil, in order to define variables and parameters to evaluate and differentiate corn cultivars as to zinc requirement. Twenty four corn cultivars were grown in complete
Comparison between four blackberry (Rubus sp.) cultivars to light variation
International Nuclear Information System (INIS)
Enciso, B.E.; Gómez, C.
2004-01-01
Abstract: This paper compares four Colombian blackberry cultivars- (Rubus sp.) light compensation points, leaf area, chlorophyll concentration and photosynthetic capacity. Time can be saved and efficiency improved by adapting different cultivars to differing luminosity once these parameters have been determined and established. The four cultivars involved were -Guarne-, -San Antonio-, -Sara 3- and -Pacho 2- forming part of Corpoica-s blackberry collection at the Sena farm in Manizales. The results revealed that all four cultivars had different light compensation points. They also showed that net photosynthesis varied amongst cultivars, even when grown in the same environmental conditions and that total chlorophyll and leaf area may be used as indicators of response to the conditions being evaluated. Key words: Photosynthesis, leaf area, radiation, compensation point, photons flow density (PFD), chlorophyll [es
Improving nitrogen use efficiency in barley (Hordeum vulgare L.) through the cisgenic approach
DEFF Research Database (Denmark)
Kichey, Thomas Michel René; Holme, Inger; Møller, Inge Skrumsager
2009-01-01
into the pGreenII binary vector. The genes have been inserted into barley by Agrobacterium-mediated transformation using the hygromycin phosphotransferase gene for selection of transformed lines on hygromycin. In this system, the resistance gene is placed on the helper plasmid pSoup allowing for separate...
Diversity for seedling vigor in wild barley (hordeum vulgare L. subs. simpatina) germplasm
International Nuclear Information System (INIS)
Tyagi, K.; Park, M.R.; Lee, H.J.; Lee, C.A.; Rehman, S.; Steffenson, B.; Lee, K.J.; Yun, S.J.
2011-01-01
Seedling vigor is important for improving stand establishment of barley crops, particularly in arid regions and areas where the soil temperature is low at sowing time. Three hundred and fifteen wild barley accessions from the Wild Barley Diversity Collection (WBDC) were evaluated for nine seedling vigor traits in a poly house and growth chamber under hydroponic conditions. The accessions exhibited significant differences for all traits investigated. Traits showing greatest phenotypic variation were seedling visual score, plant height, shoot fresh weight, shoot dry weight and shoot length. Seed weight exhibited the least variation. Seed weight was significantly correlated with visual seedling score and shoot and seedling fresh and dry weight. Correlation analysis showed that the visual seedling score was a reliable method for estimating seedling vigor in wild barley. The first three principal components (PC) explained 82.3% of the variation present in the WBDC with PC1(54.0%) associated with shoot fresh weight, shoot dry weight, seedling dry weight, seedling fresh weight, shoot length and seedling length. Accessions from the southwest portion of the Fertile Crescent, like WBDC020 (Turkey), WBDC238 (Jordan) and WBDC244 (Jordan) exhibited the highest positive values for most of the plant vigor traits investigated. These wild barley accessions likely carry alleles that will be useful for the improvement of plant vigor traits in cultivated barley. (author)
Construction of a map-based reference genome sequence for barley, Hordeum vulgare L.
Czech Academy of Sciences Publication Activity Database
Beier, S.; Himmelbach, A.; Colmsee, C.; Zhang, X. Q.; Barrero, R. A.; Hastie, A.; Šimková, Hana; Staňková, Helena; Vrána, Jan; Chan, S.; Zhou, G.; Poland, J.; Bellgard, M. I.; Houben, A.; Doležel, Jaroslav; Ayling, S.; Lonardi, S.; Scholz, U.; Stein, N.; Mascher, M.
2017-01-01
Roč. 4, APR 27 (2017), č. článku 170044. ISSN 2052-4463 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : BACTERIAL ARTIFICIAL CHROMOSOMES * PHYSICAL MAP * LIBRARIES Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 4.836, year: 2016
Directory of Open Access Journals (Sweden)
Я. М. Мукан
2014-04-01
Full Text Available In 2011 to 2013 a study was completed for the impact of varying rates of fertilizing onto the indices of productivity for barley agrophytocenosis of Helios and Commandor, in particular, such its components as a number of productive stems, number of seeds per ear, potential biological activity of ear and photosynthetic apparatus. It is found that the level of spring barley agrophytocenosis productivity is subject both to varietal peculiarities and the rate of mineral fertilizer application. When applying N 60P 60K 60 і N 90P 90K 90 the highest potential and biological productivity of Helios and Commandor was recorder as compared against the control. Impact of varying application rates for fertilizers onto the components of ear biological productivity has been scrutinized. The qualitative composition of ear is a clear expression of variety phenotype and identifies the level of biological yield for spring barley. Application of N 60 P 60 K 60 і N 90 P 90 K 90 mineral fertilizers fairly increased the average leaf surface, photosynthetic lead capacity of varieties in 2 to 2.5 times, as well as FAR efficiency coefficient in 1.5 to 2.0 times as against control that thus contributed to the development of highest biological yield of Helios variety phytomass at the level of 14.9 to 15.0, grain – 7.8 to 8.0 ton per ha and, respectively, 12.7 and 7.5 tons per ha for Comandor variety.
Effect of gamma irradiation (60CO) on quatitative characters of barley (Hordeum vulgare)
International Nuclear Information System (INIS)
Santana, T.C.; Gonzalez, F.C.
1984-01-01
Seeds od f a barley line were irradiated with doses ranging from O to 64 Kr of gamma radiation for three consecutive generations (R1,R2 and R3). From these, several mutant generations were obtained in the field, planting at a commercial density and without selection. (M.A.C.) [pt
AFLP marker linked to water-stress-tolerant bulks in barley (Hordeum vulgare L.
Directory of Open Access Journals (Sweden)
A. Altinkut
2003-01-01
Full Text Available The amplified fragment length polymorphism (AFLP assay is an efficient method for the identification of molecular markers, useful in the improvement of numerous crop species. Bulked Segregant Analysis (BSA was used to identify AFLP markers associated with water-stress tolerance in barley, as this would permit rapid selection of water-stress tolerant genotypes in breeding programs. AFLP markers linked to water-stress tolerance was identified in two DNA pools (tolerant and sensitive, which were established using selected F2 individuals resulting from a cross between water-stress-tolerant and sensitive barley parental genotypes, based on their paraquat (PQ tolerance, leaf size, and relative water content (RWC. All these three traits were previously shown to be associated with water-stress tolerance in segregating F2 progeny of the barley cross used in a previous study. AFLP analysis was then performed on these DNA pools, using 40 primer pairs to detect AFLP fragments that are present/absent, respectively, in the two pools and their parental lines. One separate AFLP fragment, which was present in the tolerant parent and in the tolerant bulk, but absent in the sensitive parent and in the sensitive bulk, was identified. Polymorphism of the AFLP marker was tested among tolerant and sensitive F2 individuals. The presence of this marker that is associated with water-stress tolerance will greatly enhance selection for paraquat and water-stress tolerant genotypes in future breeding programs.
Amplifying the benefits of agroecology by using the right cultivars.
Noguera, D; Laossi, K-R; Lavelle, P; De Carvalho, M H Cruz; Asakawa, N; Botero, C; Barot, S
2011-10-01
Tropical soils are particularly vulnerable to fertility losses due to their low capacity to retain organic matter and mineral nutrients. This urges the development of new agricultural practices to manage mineral nutrients and organic matter in a more sustainable way while relying less on fertilizer inputs. Two methods pertaining to ecological engineering and agroecology have been tested with some success: (1) the addition of biochar to the soil, and (2) the maintenance of higher earthworm densities. However, modern crop varieties have been selected to be adapted to agricultural practices and to the soil conditions they lead to and common cultivars might not be adapted to new practices. Using rice as a model plant, we compared the responsiveness to biochar and earthworms of five rice cultivars with contrasted selection histories. These cultivars had contrasted responsivenesses to earthworms, biochar, and the combination of both. The mean relative increase in grain biomass, among all treatments and cultivars, was 94% and 32%, respectively, with and without fertilization. Choosing the best combination of cultivar and treatment led to a more than fourfold increase in this mean benefit (a 437% and a 353% relative increase in grain biomass, respectively, with and without fertilization). Besides, the more rustic cultivar, a local landrace adapted to diverse and difficult conditions, responded the best to earthworms in terms of total biomass, while a modern common cultivar responded the best in term of grain biomass. This suggests that cultivars could be selected to amplify the benefit of biochar- and earthworm-based practices. Overall, selecting new cultivars interacting more closely with soil organisms and soil heterogeneity could increase agriculture sustainability, fostering the positive feedback loop between soils and plants that has evolved in natural ecosystems.
Directory of Open Access Journals (Sweden)
M Hajipoor
2017-03-01
Full Text Available Introduction Barely (Hordeum vulgare is the fourth most important cereal after wheat, corn and rice. Regarding the role of breeding to increase barley grain yield a large number of studies have been done in different countries. However, a few studies have been performed across Golestan Province, in Iran. Therefore, this study was conducted to know what barley traits have changed with grain yield during recent years. How these traits will further improve the barley grain yield in the future breeding programs? Materials and Methods In order to study barely grain yield improvement during the last half century across Golestan Province, this expriment carried out at randomized complete block desing with 4 replications in Gonbad kavous university research field in 2013-2014. Treatments were included nine barley cultivars: Sahra, Dasht, Torkaman, Gorgan4, Nimruz, Mahoor, Khoram, Reyhan and Yousef. We analysed the results using ANOVA in the statistical software package SAS. Step by step regression analysis and pathway analysis was done to evaluate the relative proportion of different traits on yield and direct and indirect impacts of yield components on grain yield, respectively. Results and Discussion The results showed that the values of the studied parameters were significantly different in different cultivars. Results illustrated that the hieghest and the lowest grain weight were related to Mahoor (37.33 mg and Torkaman (22.66 mg, respectively. Due to the high number of rows per spike in barely cultivars, grains are closer together and there are less space for growth and phothosynthetic material storage. In addition, total assimilation was not enough to fill the grain of cultivars which have the more grain numbers per spike and it caused low grain weight. Although thousand grain weight is among the main grain yield components with high heritability, it influenced by other components such as the number of spikes and its length. The highest and the
Directory of Open Access Journals (Sweden)
Rafael Hansen Madail
2011-02-01
Full Text Available O objetivo deste trabalho foi determinar descritores morfológicos que possibilitassem a caracterização de cultivares de bananeira provenientes de micropropagação ainda na fase juvenil. Foram utilizadas 12 cultivares de bananeira de diferentes grupos genômicos e graus de ploidia, que foram cultivadas in vitro e posteriormente aclimatizadas em casa de vegetação. Após o período de três meses, foram avaliadas características morfológicas quantitativas e caracteres descritivos das plantas. Com base nos resultados obtidos, foi possível separar todas as cultivares estudadas e elaborar uma chave analítica que permite a identificação dessas cultivares após o período de apenas três meses de aclimatização.The aim of this study was to determine morphological descriptors that could enable the characterization of banana cultivars from micropropagation process during the juvenile phase. Twelve cultivars from different genomic groups and with different ploidy levels were grown in vitro and acclimatized in greenhouse for three months. After this period, plants quantitative morphological and descriptive characteristics were evaluated. The results allowed ranking the cultivars and preparing an analytical key to identify these cultivars after the period of three months of acclimatization.
Common bean cultivars and lines interactions with environments
Directory of Open Access Journals (Sweden)
Carbonell Sérgio Augusto Morais
2004-01-01
Full Text Available The performance of bean lines brought forth in breeding programs or of cultivars in use can be affected by environmental variability. The adaptability and stability of grain yield of 18 common bean cultivars and lines in 23 environments (combinations of seasons, years and locations were evaluated in the State of São Paulo, Brazil. 'IAC-Carioca' and 'IAC-Carioca Eté' were used as standard cultivars for the carioca grain type, while 'FT-Nobre' and 'IAC-Una' represented the standard for black grains. The experiment was set up in a randomized complete block design with four replications and plots consisting of two, two central five meters rows flanked by border rows. Stability parameters were estimated by the methods Maximum Yield Deviations (MYD and by the Additive Main Effects and Multiplicative Interaction Analysis (AMMI. For the identification of the most stable cultivars, the two methods led to consistent results, although by MYD the highest stability was always associated to the highest yield. 'MAC-733327' and 'LP 9637' were the most suitable cultivars and lines for the joint seasons, while 'LP 9637' and 'FT-Nobre' were the most suitable for the dry season. The MYD method combined a simple procedure, easiness of result interpretation, uniqueness of parameters, and association between stability and yield. On the other hand, the AMMI method simplified the identification of stable cultivars by visual inspection, also providing information on the environments. However, the complex nature which combines uni-and multivariate techniques hampers its widespread use in breeding programs.
Vernalização em cinco cultivares de morangueiro Vernalization on five cultivars of strawberry
Directory of Open Access Journals (Sweden)
Marcelo Fontanetti Verdial
2007-08-01
Full Text Available A produção de morango é sazonal, e os melhores preços dos frutos são obtidos fora da estação. Buscando obter frutos fora da estação, o objetivo deste trabalho foi avaliar o efeito da vernalização em mudas de cinco cultivares de morangueiro. As mudas foram produzidas no sistema de vasos suspensos. O delineamento experimental utilizado foi blocos ao acaso em fatorial 5x2x4, com cinco cultivares ("IAC-Campinas", "Dover", "Sweet Charlie", "Cartuno" e "Oso Grande", dois tratamentos (com e sem vernalização das mudas e quatro tempos, com quatro repetições. Para vernalização, as mudas foram levadas para câmara fria à temperatura de 10+2°C e fotoperíodo de 8h de luz dia-1 durante 28 dias, e em seguida transplantadas. Foram avaliadas as percentagens de sobrevivência, florescimento, frutificação, emissão de estolhos, a massa e o número de frutos produzidos por planta. A sobrevivência de mudas não foi afetada pela vernalização. Houve efeito significativo no florescimento e na frutificação das plantas vernalizadas. O estolonamento de plantas foi mais precoce nas mudas vernalizadas. Para todas as cultivares e tratamentos, a produção de frutos foi insignificante e comercialmente inviável.The strawberry production is seasonal, and the best fruit prices are obtained during the off season. Seeking to get fruits off season, this research was aimed at evaluating the effect of the seedling vernalization of five strawberry cultivars. The strawberry seedling were produced in suspended pot system. The experimental design was is completely randomized blocks with the factorial design 5x2x4, with five strawberry cultivars (IAC-Campinas, Dover, Sweet Charlie, Cartuno and Oso Grande, two treatments (with and without strawberry runners vernalization and four times. For vernalization, the strawberry seedling was taken to cold chamber at 10±2°C, and photoperiod of 8h of light day-1 for 28 days, after this they were transplanted. The
Directory of Open Access Journals (Sweden)
Lilian R Descamps
2011-09-01
Full Text Available The bird cherry-oat aphid Rhopalosiphum padi L. (Homoptera: Aphididae is one of the main pests in a number of crops in the semiarid Pampas of Argentina. In the present study, the effect of different host plants, including Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L., and Secale cereale L. on biological parameters of R. padi L. was studied in the laboratory at 24 ± 1 °C, 65 ± 10% RH and a 14:10 photoperiod. Longevity, intrinsic rate of natural increase (r m, net reproductive rate (R0, mean generation time (T, doubling time (DT, and finite rate of increase (λ of the bird cherry-oat aphid on the different cereal crops were estimated. Differences in fertility life table parameters of R. padi among host plants were analyzed using pseudo-values, which were produced by Jackknife re-sampling. Results indicated that beer barley might be the most suitable food for R. padi due to greater adult longevity (20.88 d, higher fecundity (41 nymphs female-1, higher intrinsic rate of natural increase (0.309 females female-1 d-1, lower doubling time (2.24, and lower nymphal mortality (22.2%. Therefore, it can be concluded from the present study that R. padi prefers beer barley for fast and healthy development over other cereal crops.El áfido Rhopalosiphum padi L. (Homoptera: Aphididae es una de las principales plagas de numerosos cultivos de la región semiárida pampeana de Argentina. En el presente trabajo se estudió el efecto de diferentes cereales incluidos Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L. and Secale cereale L. sobre los parámetros biológicos de R. padi en laboratorio. Se estimaron longevidad, tasa intrínseca de crecimiento natural (r m, tasa neta de reproducción (R0, tiempo generacional medio (T, tiempo de duplicación (TD, y tasa finita de incremento (λ del pulgón de la avena en diferentes cereales. Las diferencias de
Effects of Soybean Cultivars on Soymilk Quality
Directory of Open Access Journals (Sweden)
Aziadekey, M.
2001-01-01
Full Text Available Soymilk was prepared from twelve soybean cultivars grown under the same environmental conditions to evaluate their effects on soymilk characteristics. Significant correlations were observed between the Chemical composition of the seeds and the resultant soymilk. Soymilk solids were significantly affected by seed size and seed phosphorus contents. Cultivars with dark hilum produced soymilk with less attractive colour.
Traditional versus modern apple cultivars – a comparison of juice composition
Dobrowolska-Iwanek Justyna; Gąstoł Maciej; Adamska Agnieszka; Krośniak Mirosław; Zagrodzki Paweł
2015-01-01
Apples are rich in components that are important for human health, such as polyphenols, organic acids and microelements, but their chemical composition varies with different apple cultivars. We aimed to find out if there is any superiority in traditionally grown apple cultivars in terms of their fruits’ bioactive components content. Juice from two traditionally grown apple cultivars, ‘Mutsu’ and ‘Reinette Simirenko’, was compared to eight popular apple cultivars, ‘Jonagold’, ‘Jonagold Decosta...
Genetic diversity of high performance cultivars of upland and irrigated Brazilian rice.
Coelho, G R C; Brondani, C; Hoffmann, L V; Valdisser, P A M R; Borba, T C O; Mendonça, J A; Rodrigues, L A; de Menezes, I P P
2017-09-21
The objective of this study was to analyze the diversity and discrimination of high-performance Brazilian rice cultivars using microsatellite markers. Twenty-nine rice cultivars belonging to EMBRAPA Arroz e Feijão germplasm bank in Brazil were genotyped by 24 SSR markers to establish their structure and genetic discrimination. It was demonstrated that the analyzed germplasm of rice presents an expressive and significant genetic diversity with low heterogeneity among the cultivars. All 29 cultivars were differentiated genetically, and were organized into two groups related to their upland and irrigated cultivation systems. These groups showed a high genetic differentiation, with greater diversity within the group that includes the cultivars for irrigated system. The genotyping data of these cultivars, with the morphological e phenotypical data, are valuable information to be used by rice breeding programs to develop new improved cultivars.
Assessment of inter- and intra-cultivar variations in olive using SSR markers
Directory of Open Access Journals (Sweden)
Ahmet Ipek
2012-10-01
Full Text Available Olive (Olea europaea L. production in the world has been made by using many cultivars, and the genetic uniformity of commercial cultivars is important for standard olive oil and table olive production. The genetic variation among and within commonly cultivated olive cultivars in Turkey was analyzed using SSR markers. A total of 135 leaf samples were collected from 11 commonly cultivated olive cultivars from 11 provinces in four geographical regions of Turkey. Seven SSR primer pairs generated 46 SSR markers, and the number of SSR markers per primer pair ranged from 4 (UDO-14 to 9 (GAPU-89 with an average of 6.57. This high level of SSR polymorphism suggests that olive production in Turkey has been made using genetically diverse olive cultivars and this high level of genetic variation is probably due to the location of Turkey in the center of the origin of olive. The UPGMA dendrogram, developed to visualize the estimated genetic relationships among the 135 samples, demonstrated that the clustering of olive cultivars was not based on geographical regions of cultivation. Presence of genetic variation was detected within a nationwide grown Turkish olive cultivar, called 'Gemlik'. Olive growers successfully discriminated olive cultivars with distinct morphological and pomological characters. However, there was some confusion about the identification of cultivars with similar phenotypic traits. To prevent misidentification of olive cultivars and to minimize intra-cultivar variation, certified propagation materials which were characterized using DNA based molecular markers should be used during the establishment of new olive orchards.
Directory of Open Access Journals (Sweden)
Cleber M. Guimarães
2008-10-01
Full Text Available O objetivo do trabalho foi avaliar, fenotipicamente, as cultivares de arroz tradicionais Guarani e Caiapó, e as modernas, CIRAD L(-141, Maravilha, BR IRGA 409 e Metica 1, por meio da associação entre os vários componentes da produtividade de grãos, para prover base de seleção genética em populações de plantas. O estudo foi conduzido na estação chuvosa do ano agrícola de 2003-2004, na área experimental da Embrapa Arroz e Feijão, em Santo Antônio de Goiás, GO. Em condições de sequeiro, com suplementação hídrica, as cultivares de arroz de terras altas CIRAD L(-141, Guarani, Caiapó e Maravilha, apresentaram maiores índices de colheita e menores percentagens de esterilidade de espiguetas que as de arroz irrigado BR IRGA 409 e Metica 1. Concluiu-se que a maior produção de biomassa pelas cultivares de arroz irrigado não se refletiu na produtividade de grãos. A CIRAD L(-141 por apresentar alta área foliar, panículas densas com alto número de grãos e um comportamento intermediário em todos os componentes avaliados, como índice de colheita, massa dos grãos, fertilidade de perfilhos, perfilhamento, esterilidade de espiguetas e taxa de crescimento, produziu 12,5% a mais que a segunda mais produtiva. O aumento do índice de colheita e da massa dos grãos e a redução da esterilidade das espiguetas devido às suas altas correlações com a produtividade, são considerados prioritários em programas de melhoramento de arroz que visem obter cultivares mais produtivas.The objective of this study was to phenotypically evaluate the traditional rice cultivars Guarani and Caiapó, and the modern rice cultivars CIRAD L(-141, Maravilha, BR IRGA 409, and Metica 1 through association among various yield components to establish a genetic selection base in plant population. The study was conducted during the rainy season of 2003-2004, at the Embrapa Rice & Beans experimental station, in Santo Antônio de Goiás, Goiás, Brazil. With
Directory of Open Access Journals (Sweden)
Jony Eishi Yuri
2004-04-01
Full Text Available Com o objetivo de avaliar o desempenho de cultivares de alface tipo americana (Lactuca sativa L. em cultivo de outono, foi conduzido um experimento no município de Santana da Vargem, MG, no período de março a junho de 2002. Utilizou-se o delineamento de blocos ao acaso com treze tratamentos (cultivares Adal, 4553 R7, AEL 10, Iglo, Rocco RZ, Rubette, RX 66, RPT 3030, RPT 2020, Paloma, Sandy, Legacy e Raider e três repetições. As cultivares 45-53R7, RPT 2020, Paloma, Raider e RPT 3030 apresentaram massa fresca total estatisticamente maiores que as demais cultivares, com produtividades de 1.016,9; 1.029,4; 1.044,9; 1.075,2 e 1.105,2 g planta-1, respectivamente. As cultivares 45-53R7, RPT 2020, Paloma, Raider, RPT 3030, AEL 10 e Rocco, com produtividade de massa fresca comercial oscilando entre 599,1 a 739,1 g planta-1, foram estatisticamente mais produtivas que as demais cultivares. A cultivar 45-53R7, com circunferência de cabeça comercial de 49,2 cm, sobressaiu-se das demais. Não houve diferenças significativas entre os materiais quanto ao comprimento de caule. Quanto à simetria da cabeça comercial, as cultivares RPT 2020, Raider e RPT 3030, com notas 4,6; 5,0 e 5,0, respectivamente, foram mais simétricas do que as demais cultivares.With the objective of evaluating iceberg lettuce (Lactuca sativa L. cultivars grown under autumn condition, an experience in Santana da Vargem, MG, Brazil, was carried out from March to June of 2002. The experimental design was in randomized complete blocks with thirteen treatments (cultivars Adal, 4553 R7, AEL 10, Iglo, Rocco RZ, Rubette, RX 66, RPT 3030, RPT 2020, Paloma, Sandy, Legacy e Raider and three replicates. The cultivars 45-53R7, RPT 2020, Paloma, Raider and RPT 3030 showed statistically higher total fresh matter than the other cultivars, with the yield ranging 1,010.9; 1,029.4; 1,044.9; 1,075.2 and 1105.2 g plant-1, respectively. The cultivars 45-53R7, RPT 2020, Paloma, Raider, RPT 3030, AEL
When GIS zooms in: spatio-genetic maps of multipaternity in Armadillidium vulgare.
Bech, Nicolas; Depeux, Charlotte; Durand, Sylvine; Debenest, Catherine; Lafitte, Alexandra; Beltran-Bech, Sophie
2017-12-01
Geographic information system (GIS) tools are designed to illustrate, analyse and integrate geographic or spatial data, usually on a macroscopic scale. By contrast, genetic tools focus on a microscopic scale. Because in reality, landscapes have no predefined scale, our original study aims to develop a new approach, combining both cartographic and genetic approaches to explore microscopic landscapes. For this, we focused on Armadillidium vulgare, a terrestrial isopod model in which evolutionary pressures imposed by terrestrial life have led to the development of internal fertilisation and, consequently, to associated physiological changes. Among these, the emergence of internal receptacles, found in many taxa ranging from mammals to arthropods, allowed females to store sperm from several partners, enabling multipaternity. Among arthropods, terrestrial isopods like the polygynandrous A. vulgare present a female structure, the marsupium, in which fertilised eggs migrate and develop into mancae (larval stage). To test our innovative combined approach, we proposed different males to four independent females, and at the end of incubation in the marsupium, we mapped (using GIS methods) and genotyped (using 12 microsatellite markers) all the incubated mancae. This methodology permitted to obtain spatio-genetic maps describing heterozygosity and spatial distribution of mancae and of multipaternity within the marsupial landscape. We discussed the interest of this kind of multidisciplinary approach which could improve in this case our understanding of sexual selection mechanisms in this terrestrial crustacean. Beyond the interesting model-focused insights, the main challenge of this study was the transfer of GIS techniques to a microscopic scale and our results appear so as pioneers rendering GIS tools available for studies involving imagery whatever their study scale.
Directory of Open Access Journals (Sweden)
Geane Dias Gonçalves
2001-05-01
Full Text Available O experimento teve por objetivo avaliar a desidratação de cultivares de Cynodon spp. (Poaceae durante o processo de fenação. Foram realizadas amostragens nos tempos zero (momento do corte, 3, 6, 21, 24, 27 e 30 horas após o corte, a fim de se determinar a curva de desidratação e os teores de proteína bruta (PB da planta inteira e das frações folhas e colmos. Determinou-se também a espessura dos colmos de cada cultivar. Utilizou-se o delineamento experimental em blocos completamente casualizados em esquema fatorial 3x7 (cultivares x tempos de amostragens, com três repetições. A velocidade de perda de água foi semelhante para os cultivares avaliados, tanto para a planta como para as frações colmos e folhas. Não houve efeito para os teores de PB com o avanço nos tempos de secagem. Porém, houve diferença para a relação L/C, onde o Tifton 85 apresentou maior valor. Já para o diâmetro do colmo, o Tifton 44 foi superior em relação aos demais cultivares.Dehydration of cultivars of the genus Cynodon (Poaceae and the possible variations of chemical composition of forages during the haymaking process were evaluated. Three cultivars of Cynodon, Tifton 85, Coast cross and Tifton 44 were used, in plots of 15 m2, with three randomized blocks. Samples at 0 (cutting time, 3, 6, 21, 24, 27 and 30 hours after cutting were taken to determine the dehydration curve of whole plant, leaves and stem. Speed in water loss in plant, leaves and stem segments was similar in all cultivars. Drying did not affect CP taxes. There was, however, a difference for the leaves/stem relationship in which Tifton 85 had the highest value. Tifton 44 was higher in the other cultivars with regard to stem diameter.
Solanum cultivar responses to arbuscular mycorrhizal fungi: growth ...
African Journals Online (AJOL)
A greenhouse experiment was carried out in a sandy soil with a low available phosphorus to evaluate responsiveness of four Solanum aethiopicum cultivars to indigenous arbuscular mycorrhizal fungi. Results showed clear interaction between genetic variability of cultivars and fungal isolates on shoot biomass and on ...
Identification of cowpea cultivars for low phosphorus soils of Nigeria
International Nuclear Information System (INIS)
Afolabi, N.O.; Ogunbodede, B.A.; Adediran, J.A.
1996-01-01
Twenty cultivars of cowpea, Vigna unguiculata, adapted to the Nigerian ecologies were screened to identify cultivars which can give high and sustainable yields when grown on soils with low available phosphorus in a sub-humid climate. Some cultivars including TVX3236, AFB1757, Ogunfowokan and K-28 gave three to four times higher grain yields than the other cultivars at zero phosphorus supply. While phosphorus application reduced grain yield in most of the cultivars with marked reduction in the higher yielding cultivars, low yielding cultivars tended to show some yield increase. Phosphorus use efficiency of the roots, stem or leaves was not significantly correlated with grain yield when 60 KgP/ha was applied. Reduction in yield due to phosphorus application might be due to induced Zn deficiency as Zn supply in these soils has been found to be inherently low. High grain yielding capacity without fertilizer phosphorus application was generally positively correlated with high vegetative shoot dry matter production. However, no clear relationship could be found between grain yield and root dry matter at maturity. It is concluded that selection for phosphorus efficiency in cowpea can substantially contribute to higher cowpea productivity and the farmers income on soils low in available phosphorus in the sub-humid areas of Nigeria. (author). 5 refs, 2 figs, 2 tabs