WorldWideScience

Sample records for cucumis melo grupo

  1. Agrobacterium mediated transformation of Tunisian Cucumis melo ...

    African Journals Online (AJOL)

    Transgenic Cucumis melo cv. Maazoun containing the neomycin phosphotransferase II (NPT II) chimeric gene conferring resistance to kanamycin were obtained from cotyledons explants inoculated with Agrobacterium tumefaciens (GV3101) that contained the binary vector plasmid pADI. Transformed shoots were obtained ...

  2. Mapping quantitative trait loci for fruit traits and powdery mildew resistance in melon (Cucumis melo)

    National Research Council Canada - National Science Library

    Wang, Yu-Hua; Wu, Dong-Hong; Huang, Jin-Hsing; Tsao, Shing-Jy; Hwu, Kae-Kang; Lo, Hsiao-Feng

    2016-01-01

    ... and disease resistance is required.The F2 populations from the cross of TARI-08874 (Cucumis melo ssp. melo) and ‘Bai-li-gua’ (C. melo ssp. agrestis) were used to map the quantitative trait loci...

  3. Molecular variation in Cucumis melo as revealed by isoenzyme and ...

    African Journals Online (AJOL)

    Molecular variation in Cucumis melo as revealed by isoenzyme and RAPD markers. Tarek M Mohamed. Abstract. No Abstract. The Egyptian Journal of Biochemistry and Molecular Biology Vol. 23(2) 2005: 141-153. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT ...

  4. Quality of landrace melon seeds (Cucumis melo L.)

    OpenAIRE

    Delwing, Andréa Becker; Franke, Lucia Brandao; Barros, Ingrid Bergman Inchausti de

    2007-01-01

    O estudo avaliou a qualidade de sementes de seis acessos de melões crioulos (Cucumis melo L.), oriundos de propriedades de agricultores familiares de diferentes regiões do estado do Rio Grande do Sul. Os ensaios experimentais foram realizados no Laboratório de Análise de Sementes do Ministério da Agricultura (LASO/LANAGRO-RS) e no Laboratório de Sementes do Departamento de Plantas Forrageiras e Agrometereologia da Faculdade de Agronomia da UFRGS. As sementes de cada acesso foram avaliadas qua...

  5. CmMDb: a versatile database for Cucumis melo microsatellite markers and other horticulture crop research.

    Science.gov (United States)

    Bhawna; Chaduvula, Pavan K; Bonthala, Venkata S; Manjusha, Verma; Siddiq, Ebrahimali A; Polumetla, Ananda K; Prasad, Gajula M N V

    2015-01-01

    Cucumis melo L. that belongs to Cucurbitaceae family ranks among one of the highest valued horticulture crops being cultivated across the globe. Besides its economical and medicinal importance, Cucumis melo L. is a valuable resource and model system for the evolutionary studies of cucurbit family. However, very limited numbers of molecular markers were reported for Cucumis melo L. so far that limits the pace of functional genomic research in melon and other similar horticulture crops. We developed the first whole genome based microsatellite DNA marker database of Cucumis melo L. and comprehensive web resource that aids in variety identification and physical mapping of Cucurbitaceae family. The Cucumis melo L. microsatellite database (CmMDb: http://65.181.125.102/cmmdb2/index.html) encompasses 39,072 SSR markers along with its motif repeat, motif length, motif sequence, marker ID, motif type and chromosomal locations. The database is featured with novel automated primer designing facility to meet the needs of wet lab researchers. CmMDb is a freely available web resource that facilitates the researchers to select the most appropriate markers for marker-assisted selection in melons and to improve breeding strategies.

  6. Medieval emergence of sweet melons, Cucumis melo (Cucurbitaceae)

    Science.gov (United States)

    Paris, Harry S.; Amar, Zohar; Lev, Efraim

    2012-01-01

    Background Sweet melons, Cucumis melo, are a widely grown and highly prized crop. While melons were familiar in antiquity, they were grown mostly for use of the young fruits, which are similar in appearance and taste to cucumbers, C. sativus. The time and place of emergence of sweet melons is obscure, but they are generally thought to have reached Europe from the east near the end of the 15th century. The objective of the present work was to determine where and when truly sweet melons were first developed. Methods Given their large size and sweetness, melons are often confounded with watermelons, Citrullus lanatus, so a list was prepared of the characteristics distinguishing between them. An extensive search of literature from the Roman and medieval periods was conducted and the findings were considered in their context against this list and particularly in regard to the use of the word ‘melon’ and of adjectives for sweetness and colour. Findings Medieval lexicographies and an illustrated Arabic translation of Dioscorides' herbal suggest that sweet melons were present in Central Asia in the mid-9th century. A travelogue description indicates the presence of sweet melons in Khorasan and Persia by the mid-10th century. Agricultural literature from Andalusia documents the growing of sweet melons, evidently casabas (Inodorous Group), there by the second half of the 11th century, which probably arrived from Central Asia as a consequence of Islamic conquest, trade and agricultural development. Climate and geopolitical boundaries were the likely causes of the delay in the spread of sweet melons into the rest of Europe. PMID:22648880

  7. Transcriptome sequencing for SNP discovery across Cucumis melo

    Directory of Open Access Journals (Sweden)

    Blanca José

    2012-06-01

    Full Text Available Abstract Background Melon (Cucumis melo L. is a highly diverse species that is cultivated worldwide. Recent advances in massively parallel sequencing have begun to allow the study of nucleotide diversity in this species. The Sanger method combined with medium-throughput 454 technology were used in a previous study to analyze the genetic diversity of germplasm representing 3 botanical varieties, yielding a collection of about 40,000 SNPs distributed in 14,000 unigenes. However, the usefulness of this resource is limited as the sequenced genotypes do not represent the whole diversity of the species, which is divided into two subspecies with many botanical varieties variable in plant, flowering, and fruit traits, as well as in stress response. As a first step to extensively document levels and patterns of nucleotide variability across the species, we used the high-throughput SOLiD™ system to resequence the transcriptomes of a set of 67 genotypes that had previously been selected from a core collection representing the extant variation of the entire species. Results The deep transcriptome resequencing of all of the genotypes, grouped into 8 pools (wild African agrestis, Asian agrestis and acidulus, exotic Far Eastern conomon, Indian momordica and Asian dudaim and flexuosus, commercial cantalupensis, subsp. melo Asian and European landraces, Spanish inodorus landraces, and Piel de Sapo breeding lines yielded about 300 M reads. Short reads were mapped to the recently generated draft genome assembly of the DHL line Piel de Sapo (inodorus x Songwhan Charmi (conomon and to a new version of melon transcriptome. Regions with at least 6X coverage were used in SNV calling, generating a melon collection with 303,883 variants. These SNVs were dispersed across the entire C. melo genome, and distributed in 15,064 annotated genes. The number and variability of in silico SNVs differed considerably between pools. Our finding of higher genomic diversity in wild

  8. Fine genetic mapping of a locus controlling short internode length in melon (Cucumis melo L.)

    Science.gov (United States)

    Compact and dwarfing vining habits in melon (Cucumis melo L.; 2n = 2x = 24) may have commercial importance since they can contribute to the promotion of concentrated fruit set and can be planted in higher plant densities than standard vining types. A diminutive (dwarf) melon mutant line (PNU-D1) wi...

  9. Detection of Papaya ringspot virus type W infecting the cucurbit weed Cucumis melo var. dudaim in Florida

    Science.gov (United States)

    This is the first report of Papaya ringspot virus type W infecting Cucumis melo var. dudaim, a cucurbit weed, in Florida. It provides an overview of this virus reservoir for growers, extension workers, crop consultants and research and regulatory scientists....

  10. Phylogenetics of Cucumis (Cucurbitaceae: Cucumber (C. sativus belongs in an Asian/Australian clade far from melon (C. melo

    Directory of Open Access Journals (Sweden)

    Schaefer Hanno

    2007-04-01

    Full Text Available Abstract Background Melon, Cucumis melo, and cucumber, C. sativus, are among the most widely cultivated crops worldwide. Cucumis, as traditionally conceived, is geographically centered in Africa, with C. sativus and C. hystrix thought to be the only Cucumis species in Asia. This taxonomy forms the basis for all ongoing Cucumis breeding and genomics efforts. We tested relationships among Cucumis and related genera based on DNA sequences from chloroplast gene, intron, and spacer regions (rbcL, matK, rpl20-rps12, trnL, and trnL-F, adding nuclear internal transcribed spacer sequences to resolve relationships within Cucumis. Results Analyses of combined chloroplast sequences (4,375 aligned nucleotides for 123 of the 130 genera of Cucurbitaceae indicate that the genera Cucumella, Dicaelospermum, Mukia, Myrmecosicyos, and Oreosyce are embedded within Cucumis. Phylogenetic trees from nuclear sequences for these taxa are congruent, and the combined data yield a well-supported phylogeny. The nesting of the five genera in Cucumis greatly changes the natural geographic range of the genus, extending it throughout the Malesian region and into Australia. The closest relative of Cucumis is Muellerargia, with one species in Australia and Indonesia, the other in Madagascar. Cucumber and its sister species, C. hystrix, are nested among Australian, Malaysian, and Western Indian species placed in Mukia or Dicaelospermum and in one case not yet formally described. Cucumis melo is sister to this Australian/Asian clade, rather than being close to African species as previously thought. Molecular clocks indicate that the deepest divergences in Cucumis, including the split between C. melo and its Australian/Asian sister clade, go back to the mid-Eocene. Conclusion Based on congruent nuclear and chloroplast phylogenies we conclude that Cucumis comprises an old Australian/Asian component that was heretofore unsuspected. Cucumis sativus evolved within this Australian

  11. Honey bees (Apis mellifera) visiting flowers of yellow melon (Cucumis melo) using different number of hives

    OpenAIRE

    Ribeiro,Márcia de Fátima; Silva,Eva Mônica Sarmento da; Lima Júnior,Ivan de Oliveira; Kiill,Lúcia Helena Piedade

    2015-01-01

    Honey bees (Apis mellifera) pollinate melon (Cucumis melo) and improve production and quality of fruits. However, little is known about bee behavior and number of hives required. The aims of this study were to compare bees visiting flowers in crop areas with different number of hives (0, 1, 2, and 3), and to evaluate which is the best number. Flowers were observed (n=78) from 5 am to 6 pm, for five consecutive days, in four experimental areas (0.5ha each). Comparisons were made for male (MF) ...

  12. KARAKTERISTIK ES KRIM HASIL MODIFIKASI DENGAN FORMULASI BUBUR TIMUN SURI (Cucumis melo L. DAN SARI KEDELAI [Characteristics of Modified Ice Cream Formulated with Cucumis melo L. Puree and Soybean Milk

    Directory of Open Access Journals (Sweden)

    Oksilia

    2012-06-01

    Full Text Available The objective of this research was to observe the physical and chemical characteristics of ice cream made with various formulations of Cucumis melo L. puree and soybean milk. The experiment was designed using Factorial Randomized Block Design with two treatments and each combination was replicated three times. The factors investigated were formulations of Cucumis melo L. puree (10, 12.5 and 15 % and soybean milk (40, 50 and 60%. The ice cream’s viscosity, overrun and melting time were determined, where as protein, fat and potassium content were analyzed. The results showed that the interaction of Cucumis melo L. puree and soybean milk formulation had significant effect on viscosity and overrun. Modified ice cream made with 12.5% Cucumis melo L. puree and 40% soybean milk was the best formula for producing modified ice cream. The resulted ice cream had viscosity of 1.03 cP, overrun 53.93% and melting time 23,58 minutes, while the protein, fat and potassium content were 5.18%, 70% and 1083.33 mg/L, respectively.

  13. The effect of ripening stages on the antioxidant potential of melon (Cucumis melo L.) cultivar Hikapel

    Science.gov (United States)

    Wulandari, Puji; Daryono, Budi Setiadi; Supriyadi

    2017-06-01

    Melon (Cucumis melo L.) cultivar Hikapel, a new cultivar of melon, is one of non-netted orange-fleshed melon. Non-netted orange-fleshed melon is known as source of several phytochemicals such as phenolics, flavonoids, ascorbic acid, and carotenoids. During the ripening stages there are chemical changes of the fruit including antioxidant properties. The aims of this research were to study the changes of antioxidant activity and antioxidant compound during ripening stages of melon cv. Hikapel. Melon with three ripening stages (27 DAA, 29 DAA, and 32 DAA) were harvested and analyzed their antioxidant activity, ascorbic acid, total-phenolic, -flavonoid, and -carotenoid content. The results showed that ascorbic acid and carotenoid content increased during ripening stages, whereas total phenolic and antioxidant activity decreased. The ripening stages affected antioxidant activity of Cucumis melo L. cv. Hikapel. Antioxidant activity positively correlated with ascorbic acid, total-phenolic, and -flavonoid content. On the other hand, total carotenoid negatively correlated with antioxidant activity.

  14. KARAKTERISTIK PERMEN JELLY TIMUN SURI (Cucumis melo L. DENGAN PENAMBAHAN SORBITOL DAN EKSTRAK KUNYIT (Curcuma domestika Val.

    Directory of Open Access Journals (Sweden)

    Merynda Indriyani Syafutri

    2012-03-01

    Full Text Available 800x600 Normal 0 false false false IN X-NONE X-NONE MicrosoftInternetExplorer4 The objective of this research was to determine the chemical and organoleptic characteristics of Cucumis melo L. jelly candies with the addition of sorbitol and Curcuma domestika Val. extract. This research was conducted in the Chemical Laboratory of Agricultural, Department of Agricultural Technology, Agricultural Faculty, Sriwijaya University, Indralaya, from January 2010 to June 2010. This research used a Factorial Completely Randomized Design with two treatments and three replications for each treatment. S factor was the addition of sorbitol concentration (9%, 16% and 23% and E was the concentration factor addition of Curcuma domestika Val. extract (5%, 7% and 9%. The results showed that the addition of sorbitol concentration had significant effect on the water content, pH, total sugar and antioxidant activity of Cucumis melo L. jelly candies. The addition of Curcuma domestika Val. extract had significant effect on the water content and antioxidant activity of Cucumis melo L. jelly candies. Interaction addition of sorbitol and Curcuma domestika Val. extract had significant effect on the antioxidant activity of jelly candies. S2E2 treatment (sorbitol 20% and 7.5% Curcuma domestika Val. extract was the best treatment with chemical characteristics (water content 36.48%, ash content 3.01%, pH 5.03, total sugar 37.00% and the antioxidant activity 27.09%, and sensory characteristics by scoring preferences (color 3.08, texture 2.88, odour 3.08  and taste 2.88. Key words: Cucumis melo L, Curcuma domestika Val, Jelly candy.

  15. Influence of phosphorus management on melon (Cucumis melo L.) fruit quality.

    Science.gov (United States)

    Martuscelli, Maria; Di Mattia, Carla; Stagnari, Fabio; Speca, Stefano; Pisante, Michele; Mastrocola, Dino

    2016-06-01

    At harvest time, melon quality is related to internal and external parameters, which are very important for consumer attractiveness and marketable yield. Several agronomic factors can affect the quality of melon fruits and among them mineral availability may play a significant role. Therefore the aim of the work was to investigate the effect of phosphorus fertigation on melon fruit (Cucumis melo L.) qualitative characteristics, such as fruit size and yield, pulp colour and firmness, aroma and taste, as well as the accumulation of bioactive antioxidant compounds, namely phenols and carotenoids, and their antiradical properties. Results allowed us to extrapolate the optimal P doses to be used for melon fertigation, to achieve high yield and fruit quality characteristics. Modelling the optimal P dose allowed us to maximize yield and resulted in around 257 kg P2 O5 ha(-1) , even if the quality indices relating to carotenoid content, texture and colour of the melon flesh were not significantly different between samples fertigated with the two highest levels tested. It can be assumed that the level of 200 kg P2 O5 ha(-1) would be a good compromise between optimization of agronomic performance and melon fruit quality. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  16. Pewarisan Ketahanan Melon (Cucumis melo L. Kultivar Melodi Gama 3 terhadap Kyuri green mottle mosaic virus

    Directory of Open Access Journals (Sweden)

    Budi Setiadi Daryono

    2016-12-01

    Full Text Available Melon (Cucumis melo L. belongs to Cucurbitaceae. Melon has high potential to be developed as main horticultural product in Indonesia. Melon is one of important foreign exchange and is the fifth biggest horticulture commodity in Indonesia. One of the problems in melon farming is mosaic disease caused by Kyuri green mottle mosaic virus (KGMMV. KGMMV infection reduces the quality and the amount of melon production. Melon farmers suffered a significant financial loss. Melodi Gama 3 (MG3 is a high yielding melon cultivar from the Genetics Laboratory, Faculty of Biology, Universitas Gadjah Mada. The use of genetically resistant melon cultivar has beneficial outcome for agriculture sector. The aim of this research was to study the resistance’s inherintance to KGMMV in MG3 melon cultivar. Two cultivars of MG3, MG3|5and MG3|8, were cultivated in the greenhouse. MAI, Glamour, Ladika, and Action melon cultivars were used as references. Resistance of KGMMV was analyzed by symptom observation and serological detection using Double Antibody Sandwich Enzyme Linked Immunosorbent Assay (DAS-ELISA. DAS-ELISA result analyzed further to establish resistance category. Description to melon cultivar phenotype variation was done. The result of this research indicates that MG3 melon cultivar is tolerant to KGMMV. The decrease of MG3 optical density was directly related with the lowering of KGMMV symptoms. The character of tolerance to KGMMV was inherited from Melodi Gama 1 (MG1 cultivar.   INTISARI   Melon (Cucumis melo L. merupakan tanaman buah yang tergolong dalam familia Cucurbitaceae. Tanaman melon berpotensi untuk dikembangkan sebagai produk unggulan hortikultura di Indonesia. Tanaman melon juga merupakan salah satu penghasil devisa penting Indonesia dan menempati urutan ke-5 dari kelompok hortikultura. Salah satu kendala yang sering dihadapi oleh petani melon adalah penyakit mosaik yang disebabkan oleh Kyuri green mottle mosaic virus (KGMMV. Infeksi KGMMV pada

  17. The quest for epigenetic regulation underlying unisexual flower development in Cucumis melo

    KAUST Repository

    Latrasse, David

    2017-05-08

    BackgroundMelon (Cucumis melo) is an important vegetable crop from the Cucurbitaceae family and a reference model specie for sex determination, fruit ripening and vascular fluxes studies. Nevertheless, the nature and role of its epigenome in gene expression regulation and more specifically in sex determination remains largely unknown.ResultsWe have investigated genome wide H3K27me3 and H3K9ac histone modifications and gene expression dynamics, in five melon organs. H3K9ac and H3K27me3 were mainly distributed along gene-rich regions and constrained to gene bodies. H3K9ac was preferentially located at the TSS, whereas H3K27me3 distributed uniformly from TSS to TES. As observed in other species, H3K9ac and H3K27me3 correlated with high and low gene expression levels, respectively. Comparative analyses of unisexual flowers pointed out sex-specific epigenetic states of TFs involved in ethylene response and flower development. Chip-qPCR analysis of laser dissected carpel and stamina primordia, revealed sex-specific histone modification of MADS-box genes. Using sex transition mutants, we demonstrated that the female promoting gene, CmACS11, represses the expression of the male promoting gene CmWIP1 via deposition of H3K27me3.ConclusionsOur findings reveal the organ-specific landscapes of H3K9ac and H3K27me3 in melon. Our results also provide evidence that the sex determination genes recruit histone modifiers to orchestrate unisexual flower development in monoecious species.

  18. Enhanced Virulence Gene Activity of Agrobacterium in Muskmelon (Cucumis melo L. cv. ‘Birdie’

    Directory of Open Access Journals (Sweden)

    Abul K.M. MOHIUDDIN

    2011-05-01

    Full Text Available Muskmelon (Cucumis melo L. cultivar ‘Birdie’, was evaluated for its response to the tumorigenic Agrobacterium tumefaciens and the oncogenic A. rhizogenes strains. Stem and petiole of three week-old in vitro-grown muskmelon plants were inoculated with five strains of A. tumefaciens and A. rhizogenes each and observed phenotypic expressions i.e. induction of crown galls and hairy roots. This phenotypic expression was efficaciously increased when virulence gene activity of different strains of two Agrobacterium species was enhanced. Intensive studies on enhancement of virulence gene activity of Agrobacterium found to be correlated to the appropriate light intensity (39.3 μmol m-2 s-1 with a specific concentration of monocyclic phenolic compound, acetosyringone (20 μM. The gene activity was also influenced by several other physical factors e.g. plant tissue type, Agrobacterium species and their strains, and plant tissue-Agrobacterium interaction. Among the different A. tumefaciens strains, LBA4404 showed the best virulence gene activity in both stem and petiole through the formation of higher rate of crown galls. On the other hand, strain 15834 of A. rhizogenes showed better gene activity in stem and 8196 in petiole through the formation of higher rate of hairy roots as well as higher average number of hairy roots. Among the two different types of explants, petiole was more susceptible to both Agrobacterium species. Thus it was concluded that future muskmelon transformation study can efficiently be carried out with LBA4404, 15834 and 8196 strains using petiole explants by adding 20 μM of acetosyringone in the medium.

  19. Heterologous Expression and Biochemical Characterization of Two Lipoxygenases in Oriental Melon, Cucumis melo var. makuwa Makino.

    Directory of Open Access Journals (Sweden)

    Songxiao Cao

    Full Text Available Lipoxygenases (LOXs are a class of non-heme iron-containing dioxygenases that catalyse oxidation of polyunsaturated fatty acids to produce hydroperoxidation that are in turn converted to oxylipins. Although multiple isoforms of LOXs have been detected in several plants, LOXs in oriental melon have not attracted much attention. Two full-length LOX cDNA clones, CmLOX10 and CmLOX13 which have been isolated from oriental melon (Cucumis melo var. makuwa Makino cultivar "Yumeiren", encode 902 and 906 amino acids, respectively. Bioinformatics analysis showed that CmLOX10 and CmLOX13 included all of the typical LOX domains and shared 58.11% identity at the amino acid level with each other. The phylogenetic analysis revealed that CmLOX10 and CmLOX13 were members of the type 2 13-LOX subgroup which are known to be involved in biotic and abiotic stress. Heterologous expression of the full-length CmLOX10 and truncated CmLOX13 in Escherichia coli revealed that the encoded exogenous proteins were identical to the predicted molecular weights and possessed the lipoxygenase activities. The purified CmLOX10 and CmLOX13 recombinant enzymes exhibited maximum activity at different temperature and pH and both had higher affinity for linoleic acid than linolenic acid. Chromatogram analysis of reaction products from the CmLOX10 and CmLOX13 enzyme reaction revealed that both enzymes produced 13S-hydroperoxides when linoleic acid was used as substrate. Furthermore, the subcellular localization analysis by transient expression of the two LOX fusion proteins in tobacco leaves showed that CmLOX10 and CmLOX13 proteins were located in plasma membrane and chloroplasts respectively. We propose that the two lipoxygenases may play different functions in oriental melon during plant growth and development.

  20. Melonet-DB, A Grand RNA-seq Gene Expression Atlas in Melon (Cucumis melo L.).

    Science.gov (United States)

    Yano, Ryoichi; Nonaka, Satoko; Ezura, Hiroshi

    2017-12-04

    Melon (Cucumis melo L.) is an important Cucurbitaceae crop produced world-wide, exhibiting wide genetic variations and comprising both climacteric and non-climacteric fruit types. The muskmelon cultivar "Earl's favorite Harukei-3 (Harukei-3)" known for its sweetness and rich aroma is used for breeding of high-grade muskmelon in Japan. We conducted RNA-seq transcriptome studies in 30 different tissues of the 'Harukei-3' melon. These included root, stems, leaves, flowers, regenerating callus, and ovaries, in addition to the flesh and peel sampled at 7 stages of fruit development. The expression patterns of 20,752 genes were determined with FPKM > 1 in at least one tissue. Principal component analysis distinguished 30 melon tissues based on the global gene expression profile, and further, the weighted gene correlation network analysis classified melon genes into 45 distinct co-expression groups. Some co-expression groups exhibited tissue-specific gene expression. Furthermore, we developed and published web-application tools designated "Gene expression map viewer" and "Coexpression viewer" on our website Melonet-DB (http://melonet-db.agbi.tsukuba.ac.jp/) to promote functional genomics research in melon. By using both the tools, we analyzed melon homologs of tomato fruit ripening regulators such as E8, RIPENING-INHIBITOR (RIN) and NON-RIPENING (NOR). The "Coexpression viewer" clearly distinguished fruit ripening-associated melon RIN/NOR/CNR homologs from those expressed in other tissues. In addition, several other MADS-box, NAM/ATAF/CUC (NAC), and homeobox transcription factor genes were identified as fruit ripening-associated genes. Our tools provide useful information not only for research on melon but also on other fleshy fruit plants. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  1. Genome analysis methods: Cucumis melo [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available Cucumis melo ... 2n=24 450 Mb 2012 Roche GS FLX ... 375 Mb 13.52x Newbler version 2.5 1,...594 29,865 Geneid, SGP2, GlimmerHMM and Augustus 27,427 MELONOMICS; https://melonomics.net CM3.5 CM3.5 10.1073/pnas.1205415109 22753475 ...

  2. Antipyretic effects of hydro-methanol extract of Melia azedarach Linn. seeds and Cucumis melo Linn. seeds in experimental rabbits.

    Science.gov (United States)

    Sultana, Sabira; Akhtar, Naveed; Asif, Hafiz Muhammad

    2017-07-01

    To investigate the antipyretic activity of hydro-methanol extract of Melia azedarach Linn. (HMEMA) seeds and Cucumis melo Linn. (HMECM) seeds in experimental animals. Baker's yeast was used to induce fever in rabbits which were divided into six groups. The animal groups were thereafter administered distilled water (control), paracetamol (reference standard, 150mg/kg), HMEMA (250mg/kg), HMEMA (500mg/kg), HMECM (250mg/kg) and HMECM (500mg/kg) respectively. HMEMA and HMECM were also phytochemically screened for tannins, alkaloids, phenols, flavonoids, saponins and cardiac glycosides. Results indicate that hydro-methanol extract of M. azedarach Linn. Seeds (250mg/kg and 500mg/kg) significantly (pMelia azedarach L. seeds in treating fever. This property can be attributed to the presence of phytochemical constituents present in the hydro-methanol extract of Melia azedarach L. seeds and the exact mechanism need to be evaluated.

  3. Molecular cloning and expression of Cucumisin (Cuc m 1), a subtilisin-like protease of Cucumis melo in Escherichia coli.

    Science.gov (United States)

    Sankian, Mojtaba; Talebi, Farideh; Moghadam, Maliheh; Vahedi, Fatemeh; Azad, Farahzad Jabbari; Varasteh, Abol-Reza

    2011-03-01

    Oral allergy syndrome resulted from plant-derived foods is frequent among adults. Allergy to melon (cucumis melo) is one of the most frequent fruit allergies in Iran. Three different major allergens have been found in Cucumis melo that Cuc m 1 (cucumisin) has been identified as the major allergen of melon. Cucumisin is an alkaline serine protease that it is found as a 78kDa protein in precursor form. The aim of this study was production of recombinant Cuc m 1 in Escherichia coli (E. coli) cells and characterization of its allergenicity property. Production of recombinant Cuc m 1 was carried out by cDNA cloning technique into the pET32b(+) vector using specific primers designed based on cucumisin nucleotide sequence available in Genebank database, cucumisin encoding gene and directional cloning method. Cloned plasmid into E. coli TOP10 was transformed into E. coli BL21 and expression of the protein was induced by IPTG. The recombinant protein was purified via Ni-NTA affinity chromatography using histidine tag in recombinant protein. IgE binding of this protein was assessed by IgE-immunoblotting, ELISA and inhibition ELISA. The directional cloning was resulted in expression of a fusion Cuc m 1. Immunoblotting with sera of patients allergic to melon showed strong reactivity with purified protein band. Inhibition assays demonstrated that purified rCuc m 1 could be the same with natural form of Cuc m 1 in total extract. In the present study, we have provided a functional recombinant cucumisin allergen, rCuc m 1 with 86kDa, which may be used as a standard allergen for clinical diagnosis and study of allergy to melon.

  4. Effets de la durée de l'éclairement artificiel sur la croissance végétative du melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Remadi, M.

    1996-01-01

    Full Text Available Effects of Artificial Light Duration on Vegetative Growth of Muskmelon Cucumis melo L. Two varieties of muskmelon, F1.6802 and Super sprint, were lighted, from cotyledon stage, during 30, 50 and 70 days. The artificial light increased total dry matter and organ dry matter (stem, leaf, root, leaves number per plant and leaf area. It also stimulated stem internodes elongation. Best results were obtained with super sprint plants treated during 70 days.

  5. Etude des caractéristiques botaniques, agronomiques et de la biologie florale du melon africain (Cucumis melo var. L. agrestis Naudin, Cucurbitaceae

    Directory of Open Access Journals (Sweden)

    Baudoin JP.

    2006-01-01

    Full Text Available Study of botanic, agronomic characters and fl oral biology of African melon (Cucumis melo L. var. agrestis Naudin, Cucurbitaceae. African melon, Cucumis melo var. agrestis, is a cultivated crop for which dried seeds are used in preparation of sauce pistachio, a valuable food in Côte dʼIvoire. Few studies are concerned with this crop as compared to melon species cultivated in temperate countries. Agronomic and morphological characteristics of C. melo var. agrestis are studied based on eight characters: germination rate, emergence time, date of fl owering, duration of life cycle, weight of mature berries, mean number of seeds per berry, weight of 100 seeds and seeds shape. Floral biology and mating system are studied on the basis of 19 parameters. Results of these studies showed that C. melo var. agrestis has a life cycle duration of 110 to 150 days varying with seasons. The mean number of berries per plant is variable (5 to 15 and the percentage of seeds per berry is low (6,83%. African melon is andromonoecious with a phenological interval between male and hermaphrodite fl owers occurrence. The pollen grains of hermaphrodite fl owers are viable and the stigmata are mature before fl owers are opening. The implications of fl oral biology on the mating system are discussed in view of yield breeding and study of gene fl ow among individuals on fields.

  6. Qualidade de melão rendilhado (Cucumis melo L. em função do sistema de cultivo Quality of net melon (Cucumis melo L. in function of the culture system

    Directory of Open Access Journals (Sweden)

    Pablo Forlan Vargas

    2008-02-01

    Full Text Available Objetivou-se com este trabalho avaliar a qualidade de frutos de cinco cultivares de melão rendilhado (Cucumis melo L., cultivados em casa de vegetação, em função do sistema de produção. O experimento foi instalado em casa de vegetação na UNESP-FCAV, Jaboticabal-SP, no período de novembro de 2005 à fevereiro de 2006. O experimento foi delineado em esquema fatorial 5 X 2, em blocos casualizados com quatro repetições. Os tratamentos resultaram da combinação de cinco híbridos de melão rendilhado: Maxim, Bônus 2, Shinju 200, Fantasy e Louis e dois sistemas de cultivo: no solo e em substrato de fibra da casca de coco. As características avaliadas foram: massa fresca do fruto, espessura de mesocarpo, intensidade de rendilhamento da casca, pH, sólidos solúveis totais, acidez titulável, índice de maturação (RATIO, e vitamina C. Não houve interação significativa entre os sistemas de cultivo e cultivares para nenhuma das características avaliadas. O cultivo de melão em substrato resultou em frutos com qualidade superior ao cultivo em solo. Os híbridos Louis e Fantasy foram os que apresentaram melhor desempenho qualitativo de frutos.The aim of this study was to evaluate the fruit quality of five net melon (Cucumis melo L. cultivars, grown in a greenhouse, in function of production system. The study was carried out in a greenhouse at UNESP-FCAV, Jaboticabal-SP, Brazil, during the period of November, 2005 to February, 2006. The study was carried out using a 5 x 2 factorial scheme, in randomized complete block design with four repetitions. The treatments resulted the combination of five net melon hybrids: Maxim, Bônus 2, Shinju 200, Fantasy and Louis and two cultivations systems: in soil and in coconut fiber substrate. The characters evaluated were: fresh weight of fruit, mesocarp thickness, fruit shape index, pH, total soluble solids, titratable acidity, maturation index (RATIO; and vitamin C. No interactions were observed

  7. Intestinal cell targeting of a stable recombinant Cu-Zn SOD from Cucumis melo fused to a gliadin peptide.

    Science.gov (United States)

    Intes, Laurent; Bahut, Muriel; Nicole, Pascal; Couvineau, Alain; Guette, Catherine; Calenda, Alphonse

    2012-05-31

    The mRNA encoding full length chloroplastic Cu-Zn SOD (superoxide dismutase) of Cucumis melo (Cantaloupe melon) was cloned. This sequence was then used to generate a mature recombinant SOD by deleting the first 64 codons expected to encode a chloroplastic peptide signal. A second hybrid SOD was created by inserting ten codons to encode a gliadin peptide at the N-terminal end of the mature SOD. Taking account of codon bias, both recombinant proteins were successfully expressed and produced in Escherichia coli. Both recombinant SODs display an enzymatic activity of ~5000U mg(-1) and were shown to be stable for at least 4h at 37°C in biological fluids mimicking the conditions of intestinal transit. These recombinant proteins were capable in vitro, albeit at different levels, of reducing ROS-induced-apoptosis of human epithelial cells. They also stimulated production and release in a time-dependent manner of an autologous SOD activity from cells located into jejunum biopsies. Nevertheless, the fused gliadin peptide enable the recombinant Cu-Zn SOD to maintain a sufficiently sustained interaction with the intestinal cells membrane in vivo rather than being eliminated with the flow. According to these observations, the new hybrid Cu-Zn SOD should show promise in applications for managing inflammatory bowel diseases. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. Characterization of endophytic bacteria from cucurbit fruits with potential benefits to agriculture in melons (Cucumis melo L.).

    Science.gov (United States)

    Glassner, Hanoch; Zchori-Fein, Einat; Compant, Stéphane; Sessitsch, Angela; Katzir, Nurit; Portnoy, Vitaly; Yaron, Sima

    2015-07-01

    Endophytes are microorganisms that mainly colonize vegetative parts, but are also found in reproductive and disseminating organs, and may have beneficial characteristics. To identify microorganisms associated with the agriculturally important family, Cucurbitaceae, endophytes were initially determined in fruits of Cucumis melo Reticulatus Group 'Dulce' by a cultivation-independent approach based on fluorescence in situ hybridization using double labeling of oligonucleotide probes. Alpha-, Beta-, Gammaproteobacteria, Firmicutes and Actinobacteria were localized inside the fruits. Culturable bacteria were further isolated and identified from fruit tissues of 'Dulce', from fruits of other cultivated and wild-field-grown Cucurbitaceae, and from wild fruits growing under natural conditions. Low densities of culturable bacteria were detected in the investigated fruits, especially in four out of the five wild species, regardless of their growing environment. Substantial differences were observed between the wild and cultivated cucurbit taxa in regard to the number of colonized fruits as well as the type of endophytes. Bacillus was the most dominant genus of endophytes colonizing fruits of Cucurbitaceae. The antagonistic effects of isolated endophytes were assessed against cucurbit disease agents in dual-culture assays. Several bacterial isolates exhibited antagonistic properties against the tested plant pathogens. The identified bacteria may be useful for protecting plants not only in the field, but also for post-harvest. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  9. Caractéristiques physiques de la production du melon cantaloup Cucumis melo L., cultivé sous serre

    Directory of Open Access Journals (Sweden)

    Hannachi, C.

    1994-01-01

    Full Text Available Physical Characteristics Of Muskmelon Production, Cucumis melo L., Cultivated Under Greenhouse- Tunisia. Seven varieties of cantaloup muskmelon (Pancha, Sugdor, Supersprint, F^6802, Gallicum, Polidor, Pallas were cultivated in plastic house and tested for yield and fruit quality (fruit weight, index of refraction, thickness of flesh. Supersprint, Pancha and Sugdor were the more productive varieties. Their early yield represents 61 %, 62 %> and 53 %> of total yield : 4, 2 ; 5, 2 and 5, 7 kg/m2 respectively. Fruits had a commercial weight of more than 500 g and an acceptable gustative quality ; IR> 10. Fruit weight was positively correlated with viable seed number (pancha : IR was appreciated for Pancha, Sugdor and F^802 (IR> 12. The flesh of these three varieties was well developped, and it was probably influenced by the important seed number (523-610 seeds/fruit. It was 3 cm wide and 6 times as thick as the cortex (0, 5 cm. Pancha was significantly distinguished from others by the fruit number (6 fruits/plant. The introduction of honey bees may improve pollination of flowers and allowed to exploit better its potentialities.

  10. Development of microsatellite markers from an enriched genomic library for genetic analysis of melon (Cucumis melo L.).

    Science.gov (United States)

    Ritschel, Patricia Silva; Lins, Tulio Cesar de Lima; Tristan, Rodrigo Lourenço; Buso, Gláucia Salles Cortopassi; Buso, José Amauri; Ferreira, Márcio Elias

    2004-05-18

    Despite the great advances in genomic technology observed in several crop species, the availability of molecular tools such as microsatellite markers has been limited in melon (Cucumis melo L.) and cucurbit species. The development of microsatellite markers will have a major impact on genetic analysis and breeding of melon, especially on the generation of marker saturated genetic maps and implementation of marker assisted breeding programs. Genomic microsatellite enriched libraries can be an efficient alternative for marker development in such species. Seven hundred clones containing microsatellite sequences from a Tsp-AG/TC microsatellite enriched library were identified and one-hundred and forty-four primer pairs designed and synthesized. When 67 microsatellite markers were tested on a panel of melon and other cucurbit accessions, 65 revealed DNA polymorphisms among the melon accessions. For some cucurbit species, such as Cucumis sativus, up to 50% of the melon microsatellite markers could be readily used for DNA polymophism assessment, representing a significant reduction of marker development costs. A random sample of 25 microsatellite markers was extracted from the new microsatellite marker set and characterized on 40 accessions of melon, generating an allelic frequency database for the species. The average expected heterozygosity was 0.52, varying from 0.45 to 0.70, indicating that a small set of selected markers should be sufficient to solve questions regarding genotype identity and variety protection. Genetic distances based on microsatellite polymorphism were congruent with data obtained from RAPD marker analysis. Mapping analysis was initiated with 55 newly developed markers and most primers showed segregation according to Mendelian expectations. Linkage analysis detected linkage between 56% of the markers, distributed in nine linkage groups. Genomic library microsatellite enrichment is an efficient procedure for marker development in melon. One

  11. Development of microsatellite markers from an enriched genomic library for genetic analysis of melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Buso Gláucia

    2004-05-01

    Full Text Available Abstract Background Despite the great advances in genomic technology observed in several crop species, the availability of molecular tools such as microsatellite markers has been limited in melon (Cucumis melo L. and cucurbit species. The development of microsatellite markers will have a major impact on genetic analysis and breeding of melon, especially on the generation of marker saturated genetic maps and implementation of marker assisted breeding programs. Genomic microsatellite enriched libraries can be an efficient alternative for marker development in such species. Results Seven hundred clones containing microsatellite sequences from a Tsp-AG/TC microsatellite enriched library were identified and one-hundred and forty-four primer pairs designed and synthesized. When 67 microsatellite markers were tested on a panel of melon and other cucurbit accessions, 65 revealed DNA polymorphisms among the melon accessions. For some cucurbit species, such as Cucumis sativus, up to 50% of the melon microsatellite markers could be readily used for DNA polymophism assessment, representing a significant reduction of marker development costs. A random sample of 25 microsatellite markers was extracted from the new microsatellite marker set and characterized on 40 accessions of melon, generating an allelic frequency database for the species. The average expected heterozygosity was 0.52, varying from 0.45 to 0.70, indicating that a small set of selected markers should be sufficient to solve questions regarding genotype identity and variety protection. Genetic distances based on microsatellite polymorphism were congruent with data obtained from RAPD marker analysis. Mapping analysis was initiated with 55 newly developed markers and most primers showed segregation according to Mendelian expectations. Linkage analysis detected linkage between 56% of the markers, distributed in nine linkage groups. Conclusions Genomic library microsatellite enrichment is an

  12. The Effect of CmLOXs on the Production of Volatile Organic Compounds in Four Aroma Types of Melon (Cucumis melo)

    Science.gov (United States)

    Tang, Yufan; Zhang, Chong; Cao, Songxiao; Wang, Xiao; Qi, Hongyan

    2015-01-01

    Lipoxygenases (LOXs) play important role in the synthesis of volatile organic compounds (VOCs), which influence the aroma of fruit. In this study, we elucidate that there is a positive relationship between LOXs activity and VOC production in melon (Cucumis melo), and CmLOX genes are involved in fruit aroma generation in melon. To this end, we tested four aroma types of melon that feature a thin pericarp: two aromatic cultivars of the oriental melons (C. melo var. makuwa Makino), ‘Yu Meiren’ (YMR) and ‘Cui Bao’ (CB); a non-aromatic oriental pickling melon (C. melo var. conomon), ‘Shao Gua’ (SHAO); and a non-aromatic snake melon (C. melo L. var. flexuosus Naud), ‘Cai Gua’ (CAI). A principal component analysis (PCA) revealed that the aromas of SHAO and CAI are similar in nature because their ester contents are lower than those of YMR and CB. Ethyl acetate, benzyl acetate, (E, Z)-2, 6-nonadienal and menthol are four principal volatile compounds that affect the aromatic characteristics of these four types of melons. The LOX activity and total ester content in YMR were the highest among the examined melon varieties. The expression patterns of 18 CmLOX genes were found to vary based on the aromatic nature of the melon. Four of them were highly expressed in YMR. Moreover, we treated the fruit disks of YMR with LOX substrates (linoleic acid and linolenic acid) and LOX inhibitors (n-propyl gallate and nordihydroguariaretic acid). Substrate application promoted LOX activity and induced accumulation of hexanal, (2E)-nonenal and straight-chain esters, such as ethyl acetate. In contrast, LOX inhibitors decreased the levels of these compounds. The effect of CmLOXs in the biosynthesis of esters in melons are discussed. PMID:26599669

  13. The Effect of CmLOXs on the Production of Volatile Organic Compounds in Four Aroma Types of Melon (Cucumis melo.

    Directory of Open Access Journals (Sweden)

    Yufan Tang

    Full Text Available Lipoxygenases (LOXs play important role in the synthesis of volatile organic compounds (VOCs, which influence the aroma of fruit. In this study, we elucidate that there is a positive relationship between LOXs activity and VOC production in melon (Cucumis melo, and CmLOX genes are involved in fruit aroma generation in melon. To this end, we tested four aroma types of melon that feature a thin pericarp: two aromatic cultivars of the oriental melons (C. melo var. makuwa Makino, 'Yu Meiren' (YMR and 'Cui Bao' (CB; a non-aromatic oriental pickling melon (C. melo var. conomon, 'Shao Gua' (SHAO; and a non-aromatic snake melon (C. melo L. var. flexuosus Naud, 'Cai Gua' (CAI. A principal component analysis (PCA revealed that the aromas of SHAO and CAI are similar in nature because their ester contents are lower than those of YMR and CB. Ethyl acetate, benzyl acetate, (E, Z-2, 6-nonadienal and menthol are four principal volatile compounds that affect the aromatic characteristics of these four types of melons. The LOX activity and total ester content in YMR were the highest among the examined melon varieties. The expression patterns of 18 CmLOX genes were found to vary based on the aromatic nature of the melon. Four of them were highly expressed in YMR. Moreover, we treated the fruit disks of YMR with LOX substrates (linoleic acid and linolenic acid and LOX inhibitors (n-propyl gallate and nordihydroguariaretic acid. Substrate application promoted LOX activity and induced accumulation of hexanal, (2E-nonenal and straight-chain esters, such as ethyl acetate. In contrast, LOX inhibitors decreased the levels of these compounds. The effect of CmLOXs in the biosynthesis of esters in melons are discussed.

  14. Caracterización química y sensorial de vino artesanal de melón (Cucumis melo L. var. reticulatus Naud., cv. Ovation)

    OpenAIRE

    C. Padín; J. Goitia; Hernández, R; Leal, I

    2012-01-01

    En los últimos años la producción de melón (Cucumis melo L.) ha experimentado un notable aumento generando excedentes en el mercado y no siempre se consigue vender a los mejores precios, por lo que los porcentajes de pérdidas poscosecha son altos (Martínez, 2007). El objetivo de esta investigación fue caracterizar química y sensorialmente vino de melón. La intención fue generar una tecnología sencilla para la producción de una bebida alcohólica de alta calidad a partir de este fruto y con ell...

  15. Estimativa do plastocrono em meloeiro (Cucumis melo L. cultivado em estufa plástica em diferentes épocas do ano

    Directory of Open Access Journals (Sweden)

    Streck Nereu Augusto

    2005-01-01

    Full Text Available O meloeiro (Cucumis melo L. é uma hortaliça de alto valor econômico. A emissão de nós é um componente importante em modelos matemáticos de simulação do crescimento e desenvolvimento de culturas de hábito de crescimento decumbente como o meloeiro e outras cucurbitáceas. A emissão de nós pode ser calculada utilizando-se o conceito do plastocrono, que é o intervalo de tempo entre o aparecimento de nós sucessivos em uma haste de dicotiledôneas. Quando a soma térmica é usada como medida de tempo fisiológico em plantas, o plastocrono tem como unidades degreesC dia nó-1. Estudos anteriores mostraram que o plastocrono em meloeiro varia com o genótipo e a época de cultivo. Este trabalho teve por objetivo estimar o plastocrono em meloeiro transplantado em diferentes épocas de cultivo no interior de estufa plástica. Foram realizadas 12 épocas de semeadura e transplante no interior de uma estufa plástica de 10m X 25m, coberta com polietileno transparente de baixa densidade, localizada no Campo Experimental do Departamento de Fitotecnia da Universidade Federal de Santa Maria, RS. O híbrido utilizado foi o HY-MARK (grupo Cantaloupe. Em 12 plantas etiquetadas por época de transplante, contou-se o número de nós visíveis (NN na haste principal da planta duas vezes por semana. A soma térmica diária (STd, degreesC dia foi calculada levando-se em conta as temperaturas cardinais de aparecimento de nós em meloeiro (10, 34 e 45degreesC. A soma térmica acumulada (STa, degreesC dia, a partir da data de transplante das plântulas, foi calculada somando-se a STd. O plastocrono foi calculado como sendo o inverso do coeficiente angular da regressão linear entre NN e STa para cada época. O plastocrono calculado variou entre as épocas de cultivo de 13,4 a 21,8degreesC dia nó-1, com um valor médio de 18,6 (?2,3degreesC dia nó-1. Esta diferença de plastocrono entre as épocas de cultivo pode representar vários dias do calendário civil

  16. Steering nitrogen fertilisation by means of portable chlorophyll meter reduces nitrogen input and improves quality of fertigated cantaloupe (Cucumis melo L. var. cantalupensis Naud.).

    Science.gov (United States)

    Gianquinto, Giorgio; Fecondini, Marco; Mezzetti, Mirco; Orsini, Francesco

    2010-02-01

    Farming is considered one of the main causes of land degradation and underground water pollution. The increased availability of agricultural inputs has led to a dramatic rise in yields, which has resulted in soil fertility spoilage and overuse of fertilisers. Therefore horticultural practice improvement must consider appropriate nitrogen (N) management. This paper reports results on the application of an optical diagnostic system (N-tester) to guide N fertilisation in muskmelon (Cucumis melo L.) over a 3 year trial. Results on fresh and postharvest quality are also presented. Fertilisation events mirrored increases in N-tester values during the season, and a significant linear relationship (R(2) = 0.628) was observed between N-tester readings and leaf chlorophyll content. The N-tester-guided fertilisation treatments were characterised by yields comparable to the control, but with significantly lower applications of N (down to 17-66% of the N distributed in the control). Moreover, the N-tester treatments yielded fruits with higher sugar content. This was also true after storage, when N-tester fruits also showed reduced weight loss associated with lower transpiration and ethylene emission rates. Through the use of 'spy plots' kept at optimal nutritional status and the adoption of a threshold for N application throughout the growing cycle of muskmelon, the N supply was significantly reduced. Therefore a correct application of N-tester allowed the plant N requirement to be reduced and the fruit sugar content and storability to be increased without adversely affecting the yield.

  17. An oligo-based microarray offers novel transcriptomic approaches for the analysis of pathogen resistance and fruit quality traits in melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Garcia-Mas Jordi

    2009-10-01

    Full Text Available Abstract Background Melon (Cucumis melo is a horticultural specie of significant nutritional value, which belongs to the Cucurbitaceae family, whose economic importance is second only to the Solanaceae. Its small genome of approx. 450 Mb coupled to the high genetic diversity has prompted the development of genetic tools in the last decade. However, the unprecedented existence of a transcriptomic approaches in melon, highlight the importance of designing new tools for high-throughput analysis of gene expression. Results We report the construction of an oligo-based microarray using a total of 17,510 unigenes derived from 33,418 high-quality melon ESTs. This chip is particularly enriched with genes that are expressed in fruit and during interaction with pathogens. Hybridizations for three independent experiments allowed the characterization of global gene expression profiles during fruit ripening, as well as in response to viral and fungal infections in plant cotyledons and roots, respectively. Microarray construction, statistical analyses and validation together with functional-enrichment analysis are presented in this study. Conclusion The platform validation and enrichment analyses shown in our study indicate that this oligo-based microarray is amenable for future genetic and functional genomic studies of a wide range of experimental conditions in melon.

  18. An oligo-based microarray offers novel transcriptomic approaches for the analysis of pathogen resistance and fruit quality traits in melon (Cucumis melo L.).

    Science.gov (United States)

    Mascarell-Creus, Albert; Cañizares, Joaquin; Vilarrasa-Blasi, Josep; Mora-García, Santiago; Blanca, José; Gonzalez-Ibeas, Daniel; Saladié, Montserrat; Roig, Cristina; Deleu, Wim; Picó-Silvent, Belén; López-Bigas, Nuria; Aranda, Miguel A; Garcia-Mas, Jordi; Nuez, Fernando; Puigdomènech, Pere; Caño-Delgado, Ana I

    2009-10-12

    Melon (Cucumis melo) is a horticultural specie of significant nutritional value, which belongs to the Cucurbitaceae family, whose economic importance is second only to the Solanaceae. Its small genome of approx. 450 Mb coupled to the high genetic diversity has prompted the development of genetic tools in the last decade. However, the unprecedented existence of a transcriptomic approaches in melon, highlight the importance of designing new tools for high-throughput analysis of gene expression. We report the construction of an oligo-based microarray using a total of 17,510 unigenes derived from 33,418 high-quality melon ESTs. This chip is particularly enriched with genes that are expressed in fruit and during interaction with pathogens. Hybridizations for three independent experiments allowed the characterization of global gene expression profiles during fruit ripening, as well as in response to viral and fungal infections in plant cotyledons and roots, respectively. Microarray construction, statistical analyses and validation together with functional-enrichment analysis are presented in this study. The platform validation and enrichment analyses shown in our study indicate that this oligo-based microarray is amenable for future genetic and functional genomic studies of a wide range of experimental conditions in melon.

  19. Study of Bokashi’s Type and Dosages to Growth and Harvest Yield Honey Dews (Cucumis Melo L. In Low Land

    Directory of Open Access Journals (Sweden)

    Ana Amiroh

    2016-12-01

    Full Text Available Recently, most cultivation and planting of Melon (Cucumis melo L. by farmers using inorganic fertilizers with an excessive dosage, and this causes the lowland productivity decrease with consequent. The soil organic matter decreased as low as time increasing. Application and using of mature organic matter are an alternative to solve these problems in order the lowland become more conducive and productive for growth of melon. But increasing pests and diseases attaching to the plants may caused by adding immature organic matters into soil. Sources to make bokashi like as paddy straw and water hyacinth is immense but it’s not yet used. This research was aimed to study, know and usage of paddy straw and water hyacinth bokashi’s on melon growing at lowland. Experiment was conducted at Lowland Experiment Station of Agricultural Faculty, Brawijaya, in Jatikerto Village, Kromengan Distric, Malang, from April-June 2015. Experiment was applied in a Randomized Block Design (RBD with double factors Types and Dosages of Bokashis. There is seven combinations of treatment with three replications, each treatment consisted four individual plants. Result showed there is significant difference between types and dosages of bokashi on plant length at 28, 35, 42 dan 49 days after planting (d,a,p respectively. The significant difference between treatment also shown by leaf area at 28 - 49 (d.a.p.. Application of paddy straw bokashi was better than hyacinth bokashi on melon growth. The best yield shows that by using paddy straw bokashi with 5 ton/ha of dosage gives melon with 2,56 kg /plant fresh weight.

  20. Effect of CRC::etr1-1 transgene expression on ethylene production, sex expression, fruit set and fruit ripening in transgenic melon (Cucumis melo L.).

    Science.gov (United States)

    Switzenberg, Jessica A; Beaudry, Randy M; Grumet, Rebecca

    2015-06-01

    Ethylene is a key factor regulating sex expression in cucurbits. Commercial melons (Cucumis melo L.) are typically andromonoecious, producing male and bisexual flowers. Our prior greenhouse studies of transgenic melon plants expressing the dominant negative ethylene perception mutant gene, etr1-1, under control of the carpel- and nectary-primordia targeted CRAB'S CLAW (CRC) promoter showed increased number and earlier appearance of carpel-bearing flowers. To further investigate this phenomenon which could be potentially useful for earlier fruit production, we observed CRC::etr1-1 plants in the field for sex expression, fruit set, fruit development, and ripening. CRC::etr1-1 melon plants showed increased number of carpel-bearing open flowers on the main stem and earlier onset by 7-10 nodes. Additional phenotypes observed in the greenhouse and field were conversion of approximately 50% of bisexual buds to female, and elongated ovaries and fruits. Earlier and greater fruit set occurred on the transgenic plants. However, CRC::etr1-1 plants had greater abscission of young fruit, and smaller fruit, so that final yield (kg/plot) was equivalent to wild type. Earlier fruit set in line M5 was accompanied by earlier appearance of ripe fruit. Fruit from line M15 frequently did not exhibit external ripening processes of rind color change and abscission, but when cut open, the majority showed a ripe or overripe interior accompanied by elevated internal ethylene. The non-ripening external phenotype in M15 fruit corresponded with elevated etr1-1 transgene expression in the exocarp. These results provide insight into the role of ethylene perception in carpel-bearing flower production, fruit set, and ripening.

  1. A consensus linkage map for molecular markers and Quantitative Trait Loci associated with economically important traits in melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Schaffer Arthur

    2011-07-01

    Full Text Available Abstract Background A number of molecular marker linkage maps have been developed for melon (Cucumis melo L. over the last two decades. However, these maps were constructed using different marker sets, thus, making comparative analysis among maps difficult. In order to solve this problem, a consensus genetic map in melon was constructed using primarily highly transferable anchor markers that have broad potential use for mapping, synteny, and comparative quantitative trait loci (QTL analysis, increasing breeding effectiveness and efficiency via marker-assisted selection (MAS. Results Under the framework of the International Cucurbit Genomics Initiative (ICuGI, http://www.icugi.org, an integrated genetic map has been constructed by merging data from eight independent mapping experiments using a genetically diverse array of parental lines. The consensus map spans 1150 cM across the 12 melon linkage groups and is composed of 1592 markers (640 SSRs, 330 SNPs, 252 AFLPs, 239 RFLPs, 89 RAPDs, 15 IMAs, 16 indels and 11 morphological traits with a mean marker density of 0.72 cM/marker. One hundred and ninety-six of these markers (157 SSRs, 32 SNPs, 6 indels and 1 RAPD were newly developed, mapped or provided by industry representatives as released markers, including 27 SNPs and 5 indels from genes involved in the organic acid metabolism and transport, and 58 EST-SSRs. Additionally, 85 of 822 SSR markers contributed by Syngenta Seeds were included in the integrated map. In addition, 370 QTL controlling 62 traits from 18 previously reported mapping experiments using genetically diverse parental genotypes were also integrated into the consensus map. Some QTL associated with economically important traits detected in separate studies mapped to similar genomic positions. For example, independently identified QTL controlling fruit shape were mapped on similar genomic positions, suggesting that such QTL are possibly responsible for the phenotypic variability

  2. A consensus linkage map for molecular markers and quantitative trait loci associated with economically important traits in melon (Cucumis melo L.).

    Science.gov (United States)

    Diaz, Aurora; Fergany, Mohamed; Formisano, Gelsomina; Ziarsolo, Peio; Blanca, José; Fei, Zhanjun; Staub, Jack E; Zalapa, Juan E; Cuevas, Hugo E; Dace, Gayle; Oliver, Marc; Boissot, Nathalie; Dogimont, Catherine; Pitrat, Michel; Hofstede, René; van Koert, Paul; Harel-Beja, Rotem; Tzuri, Galil; Portnoy, Vitaly; Cohen, Shahar; Schaffer, Arthur; Katzir, Nurit; Xu, Yong; Zhang, Haiying; Fukino, Nobuko; Matsumoto, Satoru; Garcia-Mas, Jordi; Monforte, Antonio J

    2011-07-28

    A number of molecular marker linkage maps have been developed for melon (Cucumis melo L.) over the last two decades. However, these maps were constructed using different marker sets, thus, making comparative analysis among maps difficult. In order to solve this problem, a consensus genetic map in melon was constructed using primarily highly transferable anchor markers that have broad potential use for mapping, synteny, and comparative quantitative trait loci (QTL) analysis, increasing breeding effectiveness and efficiency via marker-assisted selection (MAS). Under the framework of the International Cucurbit Genomics Initiative (ICuGI, http://www.icugi.org), an integrated genetic map has been constructed by merging data from eight independent mapping experiments using a genetically diverse array of parental lines. The consensus map spans 1150 cM across the 12 melon linkage groups and is composed of 1592 markers (640 SSRs, 330 SNPs, 252 AFLPs, 239 RFLPs, 89 RAPDs, 15 IMAs, 16 indels and 11 morphological traits) with a mean marker density of 0.72 cM/marker. One hundred and ninety-six of these markers (157 SSRs, 32 SNPs, 6 indels and 1 RAPD) were newly developed, mapped or provided by industry representatives as released markers, including 27 SNPs and 5 indels from genes involved in the organic acid metabolism and transport, and 58 EST-SSRs. Additionally, 85 of 822 SSR markers contributed by Syngenta Seeds were included in the integrated map. In addition, 370 QTL controlling 62 traits from 18 previously reported mapping experiments using genetically diverse parental genotypes were also integrated into the consensus map. Some QTL associated with economically important traits detected in separate studies mapped to similar genomic positions. For example, independently identified QTL controlling fruit shape were mapped on similar genomic positions, suggesting that such QTL are possibly responsible for the phenotypic variability observed for this trait in a broad array of

  3. Una nueva especie de Meloe Linnaeus, 1758 del suroeste de Marruecos incluida en el grupo de M. (Eurymeloe rugosus Marsham, 1802 (Coleoptera: Meloidae

    Directory of Open Access Journals (Sweden)

    Ruiz, José L.

    2015-06-01

    ínez de la Escalera. El estudio morfológico del material del género Meloe Linnaeus, 1758 (Coleoptera: Meloidae revela la existencia de poblaciones morfológicamente diferenciadas en las regiones costeras de Essaouira e Ifni. Estas poblaciones se encuadran en el grupo de Meloe rugosus Marsham, 1802 dentro del subgénero Eurymeloe Reitter, 1911. Sus características diferenciales y constantes respecto al resto de las especies norteafricanas y europeas del grupo, permiten tratar a este conjunto de poblaciones como una entidad taxonómicamente independiente que se describe aquí, Meloe baamarani n. sp. Esta especie nueva se caracteriza por presentar la coloración del cuerpo y apéndices negra, de aspecto mate; pilosidad negra, corta; cabeza ancha y de sienes ampliamente redondeadas, sin surco longitudinal medio; antenas largas, con los artejos III a VIII más largos que anchos, subcilíndricos; pronoto transverso, con los lados netamente convergentes hacia atrás, sin surco mediano; punteado de cabeza y pronoto denso; edeago estrecho, lóbulo medio largo y robusto, sinuado dorsalmente, con los dientes ventrales próximos al ápice. En la región occidental del noroeste africano M. baamarani puede confundirse únicamente con Meloe mediterraneus Müller, 1925, especie con la que comparte un aspecto general similar, pero de la que se diferencia por numerosos caracteres morfológicos, entre los que se incluyen la microrreticulación del tegumento, la ausencia de surco medio en la cabeza, la morfología y macroescultura del pronoto, y la configuración de la genitalia masculina. urn:lsid:zoobank.org:pub:D5A8AFFA-D7E9-4E65-8E73-C6AC58AF20B6

  4. Crescimento e mudanças físico-químicas durante a maturação de frutos de meloeiro (Cucumis melo var. cantalupensis Naud. híbrido Torreon Growth and physicochemical changes during the ripening of hybrid Torreon muskmelon fruits (Cucumis melo var. cantalupensis Naud.

    Directory of Open Access Journals (Sweden)

    Ricardo Fabiano Hettwer Giehl

    2008-04-01

    Full Text Available Objetivou-se neste trabalho avaliar o crescimento e as mudanças físico-químicos durante a maturação de melões (Cucumis melo var. cantalupensis Naud., híbrido Torreon. As plantas foram cultivadas no sistema hidropônico NFT ("Nutrient Film Technique", em Santa Maria, RS, durante o período de janeiro a abril. Diariamente, foram marcadas as flores pistiladas em antese, anotando-se a data desse evento. Foram efetuadas as medidas lineares do diâmetro longitudinal e transversal dos frutos a cada três dias, iniciando-se após a antese. A partir dos 25 dias após a antese (DAA, realizou-se, a cada três dias, a colheita de 10 frutos, aleatoriamente. Foram analisados os parâmetros: síntese de etileno, respiração, firmeza da polpa, teor de sólidos solúveis totais, acidez total titulável e coloração da polpa. O aumento no diâmetro longitudinal e transversal dos frutos ocorreu até aproximadamente os 26-29 DAA. A partir desse momento, iniciou-se o processo de maturação dos frutos. Nessa fase, verificou-se intenso incremento na síntese de etileno, com pico aos 37 DAA (44 ± 4,6mL kg-1 h-1, o que culminou no aumento da respiração e na diminuição da acidez total titulável e da firmeza de polpa. Além disso, a cor da polpa dos frutos tornou-se gradativamente mais vermelha. Os frutos desprenderam da planta aproximadamente aos 37 DAA, quando apresentaram uma média de 10,5°Brix de sólidos solúveis totais.This research had the aim of evaluating the physicochemical growth and changes during maturation of hybrid Torreon melons (Cucumis melo var. cantalupensis Naud.. Melon plants were cultivated in the NFT (Nutrient Film Technique hidroponic system from January to April 2004 in Santa Maria, RS, Brazil. Flowers in anthesis were daily tagged and linear measures of longitudinal and transverse diameter were made at a 3-day interval, beginning at anthesis. Starting from 25 days after anthesis (DAA, 10 fruits were randomly harvested each 3

  5. Qualidade de melões (Cucumis melo L. var. cantalupensis Naud., híbrido Torreon, produzidos em hidroponia e armazenados em embalagens de polietileno Quality of Torreon hybrid melon fruits (Cucumis melo L. var. cantalupensis Naud. grown in hydroponic system and stored in polyethylene packaging

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2006-08-01

    Full Text Available Este experimento teve por objetivos avaliar a permeabilidade de filmes de polietileno de diferentes espessuras e densidades ao O2 e ao CO2, a composição gasosa (O2, CO2 e etileno formada no interior das embalagens e a qualidade físico-química de melões (Cucumis melo L. var. cantalupensis Naud., híbrido Torreon, produzidos no sistema hidropônico "Nutrient Film Technique" (NFT e armazenados em embalagens de polietileno. Os tratamentos avaliados foram: (1 armazenamento refrigerado (sem uso de filme; (2 polietileno de baixa densidade (PEBD de 40µm; (3 PEBD de 60µm; (4 PEBD de 90µm; (5 polietileno de média densidade (PEMD de 40µm; (6 PEMD de 60µm. Os frutos permaneceram armazenados durante 25 dias a 3,8±0,2°C e por mais dois dias a 20°C. Os filmes de PEBD de 60 e 90µm e o PEMD de 60µm apresentaram menor permeabilidade ao CO2, mantendo as maiores concentrações de CO2 nas embalagens. O filme de PEBD de 90µm apresentou menor permeabilidade ao O2. A menor concentração de etileno foi obtida com o uso de PEBD de 40µm. O uso de filmes reduziu drasticamente a perda de massa dos frutos, quando comparados aos frutos não embalados. Os frutos acondicionados na embalagem de PEBD de 40µm mantiveram uma maior firmeza da polpa após o período de armazenamento, não diferindo estatisticamente dos frutos armazenados em PEMD de 40µm. Já a incidência de podridões foi significativamente menor nos frutos armazenados em PEMD de 60µm. De modo geral, os filmes avaliados mantêm semelhante a qualidade físico-química de melões híbrido Torreon produzidos hidroponicamente no sistema NFT.This study was carried out to evaluate the permeability to O2 and CO2, and gas composition (O2, CO2 and ethylene inside packages of different thickness and density polyethylene films. Moreover, the physical and chemical quality of Torreon hybrid melon fruit (Cucumis melo L. var. cantalupensis Naud. grown in a Nutrient Film Technique hydroponic system and stored

  6. Caracterización química y sensorial de vino artesanal de melón (Cucumis melo L. var. reticulatus Naud., cv. Ovation

    Directory of Open Access Journals (Sweden)

    C. Padín

    2012-12-01

    Full Text Available En los últimos años la producción de melón (Cucumis melo L. ha experimentado un notable aumento generando excedentes en el mercado y no siempre se consigue vender a los mejores precios, por lo que los porcentajes de pérdidas poscosecha son altos (Martínez, 2007. El objetivo de esta investigación fue caracterizar química y sensorialmente vino de melón. La intención fue generar una tecnología sencilla para la producción de una bebida alcohólica de alta calidad a partir de este fruto y con ello aportar una alternativa de comercialización en la región Falconiana y otras regiones productoras del país. Los ensayos se condujeron, para las variables químicas, en un diseño completamente aleatorizado con 3 tratamientos. Los vinos se elaboraron a partir de 8 L de jugo puro de melón de concentración inicial de sólidos solubles totales 16, 20 y 25 ºBx, acidez total (5,5 g/L y pH (3,8 ajustados, respectivamente denominados tratamientos V1, V2, V3 (3 repeticiones. Colocados en fermentadores de 9 L de capacidad, estériles. Inoculados con 1 g/L de Saccharomyces cerevisiae, e incubados a 28 ºC por 10 días; seguido de trasiego, embotellado, encorchado y almacenamiento por 2 meses. El jugo de melón mostró, sólidos solubles totales 8,00 ºBx, acidez total titulable 0,15 % y pH 5,20. Los vinos, respectivamente V1, V2 y V3, presentaron las siguientes características: grado alcohólico 7, 8, 10 ºGL; alcohol metílico 0,008; 0,002; 0,004 g/L; acetato de etilo 0,02; 0,04; 0,08 mg/L; azúcares totales 20, 40, 58 g/L; acidez volátil 0,814; 0,854; 0,815 g/L; acidez total 6,26; 6,08; 6,00 g/L; acidez iónica 4,00; 3,91; 3,93. Se evidenciaron diferencias estadísticamente significativas (p ≤ 0,05 entre los tratamientos. Los 3 vinos de melón cumplieron con los requisitos: grado alcohólico, alcohol metílico, acetato de etilo, acidez volátil y acidez total establecidos en la norma venezolana COVENIN 3342-1997. V1 y V2 presentaron caracter

  7. Caracterización química y sensorial de vino artesanal de melón (Cucumis melo L. var. reticulatus Naud., cv. Ovation

    Directory of Open Access Journals (Sweden)

    C. Padín

    2012-01-01

    Full Text Available En los últimos años la producción de melón (Cucumis melo L. ha experimentado un notable aumento generando excedentes en el mercado y no siempre se consigue vender a los mejores precios, por lo que los porcentajes de pérdidas poscosecha son altos (Martínez, 2007. El objetivo de esta investigación fue caracterizar química y sensorialmente vino de melón. La intención fue generar una tecnología sencilla para la producción de una bebida alcohólica de alta calidad a partir de este fruto y con ello aportar una alternativa de comercialización en la región Falconiana y otras regiones productoras del país. Los ensayos se condujeron, para las variables químicas, en un diseño completamente aleatorizado con 3 tratamientos. Los vinos se elaboraron a partir de 8 L de jugo puro de melón de concentración inicial de sólidos solubles totales 16, 20 y 25 ºBx, acidez total (5,5 g/L y pH (3,8 ajustados, respectivamente denominados tratamientos V1, V2, V3 (3 repeticiones. Colocados en fermentadores de 9 L de capacidad, estériles. Inoculados con 1 g/L de Saccharomyces cerevisiae, e incubados a 28 ºC por 10 días; seguido de trasiego, embotellado, encorchado y almacenamiento por 2 meses. El jugo de melón mostró, sólidos solubles totales 8,00 ºBx, acidez total titulable 0,15 % y pH 5,20. Los vinos, respectivamente V1, V2 y V3, presentaron las siguientes características: grado alcohólico 7, 8, 10 ºGL; alcohol metílico 0,008; 0,002; 0,004 g/L; acetato de etilo 0,02; 0,04; 0,08 mg/L; azúcares totales 20, 40, 58 g/L; acidez volátil 0,814; 0,854; 0,815 g/L; acidez total 6,26; 6,08; 6,00 g/L; acidez iónica 4,00; 3,91; 3,93. Se evidenciaron diferencias estadísticamente significativas (p ≤ 0,05 entre los tratamientos. Los 3 vinos de melón cumplieron con los requisitos: grado alcohólico, alcohol metílico, acetato de etilo, acidez volátil y acidez total establecidos en la norma venezolana COVENIN 3342-1997. V1 y V2 presentaron caracter

  8. Plantas hospederas de los virus más importantes que infectan el melón, Cucumis melo (Cucurbitaceae en Costa Rica

    Directory of Open Access Journals (Sweden)

    M.V. Sánchez

    1998-03-01

    Full Text Available Las especies hospederas naturales de los virus (PRSV, WMV-2, CMV y ZYMV que infectan el cultivo de melón (Cucumis melo L. para la exportación en Costa Rica se identificaron en plantaciones comerciales de dos fincas ubicadas, una en la provincia de Guanacaste, y la otra en la provincia de Puntarenas. En ambas fincas se cultiva el melon con irrigación durante la época seca, pero su manejo cultural es diferente. La finca A con una larga trayectoria en el cultivo de melón en rotación con maíz, sorgo y arroz, y con poco control de malezas; mientras que la finca B con una corta trayectoria en la producción del melón y un mayor control de malezas. La diversidad de especies vegetales fue estudiada en cuadrantes de 100 m2 en cinco diferentes comunidades de plantas previamente seleccionadas en la finca A (cultivo, canal de drenaje, charral, potrero mejorado, y semi-bosque y tres en la finca B (cultivo, charral, pastizal natural, semi-bosque. El número de cuadrantes estudiados dependió del área total cultivada en cada una de las fincas. Todas las especies de plantas representadas en cada cuadrante se recolectaron e identificaron pero solo aquellas especies que presentaron síntomas virales en el campo fueron analizadas por ELISA para determinar la presencia de los cuatro virus estudiados. La diversidad de especies, porcentaje de cobertura y época de aparición de las especies hospederas fue monitoreada durante un año calendario en cinco fechas diferentes. Un total de 86 y 72 especies de plantas fueron identificadas en las fincas A y B respectivamente. Catorce encontradas positivas por lo menos para uno de los cuatro virus. Los cuatro virus fueron encontrados en cada finca en cada fecha de muestreo indicando que la permanencia y abundancia de algunas especies hospederas garantiza la permanencia de los cuatro virus en el campo como fuente de inóculo primario para la próxima siembra. Varias especies de plantas hospederas silvestres previamente

  9. Dissipation kinetics, pre-harvest residue limits, and hazard quotient assessments of pesticides flubendiamide and fluopicolide in Korean melon (Cucumis melo L. var. makuwa) grown under regulated conditions in plastic greenhouses.

    Science.gov (United States)

    Kabir, Md Humayun; Abd El-Aty, A M; Rahman, Md Musfiqur; Kim, Sung-Woo; Lee, Han Sol; Chung, Hyung Suk; Do, Jung Ah; Jeong, Ji Hoon; Chang, Byung-Joon; Chang, Moon Ik; Shin, Ho-Chul; Shim, Jae-Han

    2017-08-10

    The dissipation kinetics, pre-harvest residue limits, and hazard quotient (HQ) assessments of the pesticides flubendiamide and fluopicolide were conducted for Korean melon (Cucumis melo L. var. makuwa) cultivated at two different sites. A single extraction and cleanup procedure was carried out using acetone (partitioned with dichloromethane) and amino solid-phase extraction cartridges, respectively. Residue analysis was performed by HPLC with ultraviolet detection. Both pesticides showed excellent linearity with correlation coefficients of 0.9999 and 0.9996 for flubendiamide and fluopicolide, respectively. The accuracy (expressed as recovery %) at three spiking levels was 92.0-103.6 and 82.8-105.3%, and the precision (expressed as relative standard deviation) was 1.7-3.4 and 2.7-5.3% for flubendiamide and fluopicolide, respectively. The initial residues of flubendiamide/fluopicolide were 0.326/0.376 and 0.206/0.298 mg/kg at sites 1 and 2, respectively. These amounts were substantially lower than the maximum residue limits (MRLs = 1 and 0.5 mg/kg for flubendiamide and fluopicolide, respectively) established by the Korean Ministry of Food and Drug Safety. The half-lives of flubendiamide were 5.8 and 6.5 days, and those of fluopicolide were 6.7 and 9.1 days at sites 1 and 2, respectively. The shorter half-lives were attributed to seasonal variations (higher temperatures) and enzymatic and metabolic profiling. The risk assessment HQs of flubendiamide were 0.217/0.249 on day 0, which decreased to 0.102/0.168 on day 5, and to 0.065/0.88 on day 10; the HQ values for fluopicolide were 0.029/0.042, 0.022/0.025, and 0.010/0.019 on day 0, day 5, and day 10, for sites 1/2, respectively. From this data, we concluded that the fruits could be consumed safely.

  10. Beneficios socioeconómicos al utilizar plástico en el cultivo del melón (Cucumis melo L. en el municipio Miranda del estado Zulia

    Directory of Open Access Journals (Sweden)

    Juan Carlos Nava

    2011-01-01

    Full Text Available Se condujo un experimento con la finalidad de determinar los beneficios socioeconómicos al utilizar plástico en el cultivo del melón (Cucumis melo L. en la comunidad de Villa Hermosa del Municipio Miranda, estado Zulia en el segundo semestre del año 2008. Se determinaron los costos de producción por hectárea, ingresos, número de aplicaciones de agroquímicos, utilización de mano de obra, días de germinación de las plántulas y masa fresca acumulada. En un área de 2 hectáreas con riego por goteo, se cultivaron plantas de melón híbrido Ovación. Se determinaron dos tratamientos, uno con la utilización del acolchado plástico y el otro sin el uso del plástico. El ensayo se condujo como un experimento de bloques al azar, cada unidad experimental estuvo constituida por 20 plantas seleccionadas al azar. Las evaluaciones se realizaron semanalmente. El análisis estadístico detectó diferencias entre los tratamientos evaluados para la variable masa fresca acumulada, el mayor valor de esta variable se obtuvo con el uso del acolchado plástico (1,67 Kg, cuando no se utilizó plástico fue de 0.80 Kg. Las plántulas germinaron en campo a los tres días para los dos tratamientos, por lo que el plástico no influyó en la germinación. Los productores obtienen mejores ingresos por hectárea (17.704 Bs F en cada ciclo, con menor número de aplicaciones de agroquímicos (10, viéndose menos expuestos al contacto con los productos y utilizando menor cantidad de personal, siendo una alternativa en cuanto al problema existente en el municipio Miranda de escasez de mano de obra.

  11. The genome of melon (Cucumis melo L.).

    Science.gov (United States)

    Garcia-Mas, Jordi; Benjak, Andrej; Sanseverino, Walter; Bourgeois, Michael; Mir, Gisela; González, Víctor M; Hénaff, Elizabeth; Câmara, Francisco; Cozzuto, Luca; Lowy, Ernesto; Alioto, Tyler; Capella-Gutiérrez, Salvador; Blanca, Jose; Cañizares, Joaquín; Ziarsolo, Pello; Gonzalez-Ibeas, Daniel; Rodríguez-Moreno, Luis; Droege, Marcus; Du, Lei; Alvarez-Tejado, Miguel; Lorente-Galdos, Belen; Melé, Marta; Yang, Luming; Weng, Yiqun; Navarro, Arcadi; Marques-Bonet, Tomas; Aranda, Miguel A; Nuez, Fernando; Picó, Belén; Gabaldón, Toni; Roma, Guglielmo; Guigó, Roderic; Casacuberta, Josep M; Arús, Pere; Puigdomènech, Pere

    2012-07-17

    We report the genome sequence of melon, an important horticultural crop worldwide. We assembled 375 Mb of the double-haploid line DHL92, representing 83.3% of the estimated melon genome. We predicted 27,427 protein-coding genes, which we analyzed by reconstructing 22,218 phylogenetic trees, allowing mapping of the orthology and paralogy relationships of sequenced plant genomes. We observed the absence of recent whole-genome duplications in the melon lineage since the ancient eudicot triplication, and our data suggest that transposon amplification may in part explain the increased size of the melon genome compared with the close relative cucumber. A low number of nucleotide-binding site-leucine-rich repeat disease resistance genes were annotated, suggesting the existence of specific defense mechanisms in this species. The DHL92 genome was compared with that of its parental lines allowing the quantification of sequence variability in the species. The use of the genome sequence in future investigations will facilitate the understanding of evolution of cucurbits and the improvement of breeding strategies.

  12. Agrobacterium mediated transformation of Tunisian Cucumis melo ...

    African Journals Online (AJOL)

    SERVER

    2007-09-19

    Sep 19, 2007 ... 1Department of Biology, Laboratory of Plant Biotechnology, National Institute of Applied Science and Technology. (INSAT), Centre Urbain Nord, B.P. ... frequency of chimeric plants. (Ray et al., 1993; Simandjuntak et al., 1996). .... electrophoresis. DNA was visualized under UV and photographed. RESULTS.

  13. The genome of the cucumber, Cucumis sativus L

    DEFF Research Database (Denmark)

    Huang, Sanwen; Li, Ruiqiang; Zhang, Zhonghua

    2009-01-01

    Cucumber is an economically important crop as well as a model system for sex determination studies and plant vascular biology. Here we report the draft genome sequence of Cucumis sativus var. sativus L., assembled using a novel combination of traditional Sanger and next-generation Illumina GA...... ancestral chromosomes after divergence from Cucumis melo. The sequenced cucumber genome affords insight into traits such as its sex expression, disease resistance, biosynthesis of cucurbitacin and 'fresh green' odor. We also identify 686 gene clusters related to phloem function. The cucumber genome provides...... a valuable resource for developing elite cultivars and for studying the evolution and function of the plant vascular system....

  14. Medieval herbal iconography and lexicography of Cucumis (cucumber and melon, Cucurbitaceae) in the Occident, 1300—1458

    OpenAIRE

    Paris, Harry S.; Janick, Jules; Daunay, M-Christin

    2011-01-01

    Background The genus Cucumis contains two species of important vegetable crops, C. sativus, cucumber, and C. melo, melon. Melon has iconographical and textual records from lands of the Mediterranean Basin dating back to antiquity but cucumber does not. Our goal was to obtain an improved understanding of the history of these crops in the Occident. We examined medieval images purportedly of Cucumis, determined their specific identity, and compared them for originality, accuracy, and the lexicog...

  15. Marques de Melo: El inventor de tradiciones

    Directory of Open Access Journals (Sweden)

    Gustavo Cimadevilla

    2008-12-01

    Full Text Available Este texto es un acercamiento académico, emotivo y grato, del autor al maestro. Marques de Melo es un inventor de tradiciones simbólicas, icónicas que están en la realidad y que son las forjadoras de una cultura que se resiste a ser vencida.

  16. Molecular Cloning, Characterization, and Expression of Cuc m 2, a Major Allergen in Cucumis melo

    Directory of Open Access Journals (Sweden)

    Mojtaba Sankian

    2013-05-01

    Full Text Available Background: Several studies reported the clinical features of IgE-mediated hypersensitivity after ingestion of melon. Melon allergy is a common IgE-mediated fruit allergy in Iran. This prompted us to investigate immunochemical and molecular properties of the major allergen in melon fruit, to compare the IgE-binding capacity of the natural protein with the recombinant allergen, and to determine cross-reactivity of the major allergen with closely-related allergens from other plants displaying clinical cross-reactivity with melon. Methods: Identification and molecular characterization of the major melon allergen were performed using IgE immunoblotting, allergen-specific ELISA, affinity-based purifications, cross-inhibition assays, cloning, and expression of the allergen in Escherichia coli. Results: Melon profilin was identified and isolated as a major IgE-binding component and designated as Cuc m 2. Sequencing corresponding cDNA revealed an open reading frame of 363 bp coding for 131 amino acid residues and two fragments of 171 bp and 383 bps for the 5’and 3’ UTRs, respectively. Significant cross-reactivity was found between melon profilin and Cynodon dactylon, tomato, peach, and grape profilins in cross-inhibition assays. Although the highest degree of amino acid identity was revealed with watermelon profilin, there was no significant cross-reactivity between melon and watermelon profilins. Conclusion: Melon profilin is the major IgE-binding component in melon extract, and the recombinant and natural forms exhibited similar IgE-binding capacities. A part of the fruit-fruit and pollen-fruit cross-reactions could be explained by the presence of this conserved protein; however, sequence homology provides insufficient information to predict IgE cross-reactivity of profilins.

  17. Pectin from muskmelon (Cucumis melo var. reticulatus) peels: extraction optimization and physicochemical properties.

    Science.gov (United States)

    Muthukumaran, Chandrasekaran; Banupriya, Loganathan; Harinee, Somasundharam; Sivaranjani, Sivagurunathan; Sharmila, Govindasamy; Rajasekar, Vinayagam; Kumar, Narasimhan Manoj

    2017-05-01

    Pectin derived from plant waste sources is currently focused as an economical and eco-friendly approach. Optimization of pectin extraction from muskmelon peel by response surface methodology (RSM) was investigated in this study. Box-Behnken Design (BBD) was used to identify the optimal level of the extraction variables such as time, pH and temperature. A second-order model equation for pectin extraction was obtained from multiple regression analysis of experimental data with the correlation coefficient (R 2 ) value of 0.92. ANOVA results showed that linear effect of temperature and combined effect of pH with temperature were found significant for pectin extraction from muskmelon peel. Validation results had good agreement with the predicted results. Pectin extracted from muskmelon peel was classed as high methoxy pectin with the equivalent weight of 384.5 g/mol. Non-newtonian pseudoplastic flow behaviour was observed for muskmelon pectin from the viscosity studies.

  18. Genetic Diversity of Spanish Melons (Cucumis melo L.) of the Madrid Provenance

    Science.gov (United States)

    The genetic diversity of five Group Inodorus landraces having a historic presence in the town of Villaconejos, Spain (near Madrid) and four reference accessions (one accession Group Flexuosus) (Lopez-Sese et al, 2002), was assessed using the allelic variation at 19 SSR loci. Seventy-two polymorphic...

  19. Reaction of melon ( Cucumis melo L.) cultivars to soil-borne plant ...

    African Journals Online (AJOL)

    None of the tested melon cultivars was immune to all the soil-borne plant pathogenic fungi. However, two cultivars, namely 'Sfidak khatdar' and 'Sfidak bekhat' were moderately resistant to all the three fungi. These melon cultivars are promising sources of resistance to M. phaseolina, M. cannonballus and R. solani, and ...

  20. High-quality total RNA isolation from melon (Cucumis melo L. fruits rich in polysaccharides

    Directory of Open Access Journals (Sweden)

    Gabrielle Silveira de Campos

    2017-08-01

    Full Text Available Melon, a member of the family Cucurbitaceae, is the fourth most important fruit in the world market and, on a volume basis, is Brazil’s main fresh fruit export. Many molecular techniques used to understand the maturation of these fruits require high concentrations of highly purified RNA. However, melons are rich in polyphenolic compounds and polysaccharides, which interfere with RNA extraction. This study aimed to determine the most appropriate method for total RNA extraction from melon fruits. Six extraction buffers were tested: T1 guanidine thiocyanate/phenol/chloroform; T2 sodium azide/?-mercaptoethanol; T3 phenol/guanidine thiocyanate; T4 CTAB/PVP/?-mercaptoethanol; T5 SDS/sodium perchlorate/PVP/?-mercaptoethanol, and T6 sarkosyl/PVP/guanidine thiocyanate, using the AxyPrepTM Multisource Total RNA Miniprep Kit. The best method for extracting RNA from both mature and green fruit was based on the SDS/PVP/?-mercaptoethanol buffer, because it rapidly generated a high quality and quantity of material. In general, higher amounts of RNA were obtained from green than mature fruits, probably due to the lower concentration of polysaccharides and water. The purified material can be used as a template in molecular techniques, such as microarrays, RT-PCR, and in the construction of cDNA and RNA-seq data.

  1. Diversity in expression of phosphorus (P responsive genes in Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Ana Fita

    Full Text Available BACKGROUND: Phosphorus (P is a major limiting nutrient for plant growth in many soils. Studies in model species have identified genes involved in plant adaptations to low soil P availability. However, little information is available on the genetic bases of these adaptations in vegetable crops. In this respect, sequence data for melon now makes it possible to identify melon orthologues of candidate P responsive genes, and the expression of these genes can be used to explain the diversity in the root system adaptation to low P availability, recently observed in this species. METHODOLOGY AND FINDINGS: Transcriptional responses to P starvation were studied in nine diverse melon accessions by comparing the expression of eight candidate genes (Cm-PAP10.1, Cm-PAP10.2, Cm-RNS1, Cm-PPCK1, Cm-transferase, Cm-SQD1, Cm-DGD1 and Cm-SPX2 under P replete and P starved conditions. Differences among melon accessions were observed in response to P starvation, including differences in plant morphology, P uptake, P use efficiency (PUE and gene expression. All studied genes were up regulated under P starvation conditions. Differences in the expression of genes involved in P mobilization and remobilization (Cm-PAP10.1, Cm-PAP10.2 and Cm-RNS1 under P starvation conditions explained part of the differences in P uptake and PUE among melon accessions. The levels of expression of the other studied genes were diverse among melon accessions, but contributed less to the phenotypical response of the accessions. CONCLUSIONS: This is the first time that these genes have been described in the context of P starvation responses in melon. There exists significant diversity in gene expression levels and P use efficiency among melon accessions as well as significant correlations between gene expression levels and phenotypical measurements.

  2. Correlated response of in vitro regeneration capacity from different source of explants inCucumis melo.

    Science.gov (United States)

    Molina, R V; Nuez, F

    1995-01-01

    The variation among and within different populations of the regeneration ability from leaf, cotyledon and hypocotyl explants has been studied. A control population and two lines selected by their regeneration capacity from leaf explants were used. Significant differences among the plants of the control population,for the organogenic response, were detected. The regeneration capacity varies depending on the type of explant. Selection in order to improve the regeneration frequency from leaf explants also raises the organogenic response in the other explant types. This result suggests the presence of a partial common genetic system controlling the regeneration frequency of the diverse types of explants.

  3. Diversity in expression of phosphorus (P) responsive genes in Cucumis melo L.

    Science.gov (United States)

    Fita, Ana; Bowen, Helen C; Hayden, Rory M; Nuez, Fernando; Picó, Belén; Hammond, John P

    2012-01-01

    Phosphorus (P) is a major limiting nutrient for plant growth in many soils. Studies in model species have identified genes involved in plant adaptations to low soil P availability. However, little information is available on the genetic bases of these adaptations in vegetable crops. In this respect, sequence data for melon now makes it possible to identify melon orthologues of candidate P responsive genes, and the expression of these genes can be used to explain the diversity in the root system adaptation to low P availability, recently observed in this species. Transcriptional responses to P starvation were studied in nine diverse melon accessions by comparing the expression of eight candidate genes (Cm-PAP10.1, Cm-PAP10.2, Cm-RNS1, Cm-PPCK1, Cm-transferase, Cm-SQD1, Cm-DGD1 and Cm-SPX2) under P replete and P starved conditions. Differences among melon accessions were observed in response to P starvation, including differences in plant morphology, P uptake, P use efficiency (PUE) and gene expression. All studied genes were up regulated under P starvation conditions. Differences in the expression of genes involved in P mobilization and remobilization (Cm-PAP10.1, Cm-PAP10.2 and Cm-RNS1) under P starvation conditions explained part of the differences in P uptake and PUE among melon accessions. The levels of expression of the other studied genes were diverse among melon accessions, but contributed less to the phenotypical response of the accessions. This is the first time that these genes have been described in the context of P starvation responses in melon. There exists significant diversity in gene expression levels and P use efficiency among melon accessions as well as significant correlations between gene expression levels and phenotypical measurements.

  4. Bin mapping of genomic and EST-derived SSRs in melon (Cucumis melo L.).

    Science.gov (United States)

    Fernandez-Silva, I; Eduardo, I; Blanca, J; Esteras, C; Picó, B; Nuez, F; Arús, P; Garcia-Mas, J; Monforte, Antonio José

    2008-12-01

    We report the development of 158 primer pairs flanking SSR motifs in genomic (gSSR) and EST (EST-SSR) melon sequences, all yielding polymorphic bands in melon germplasm, except one that was polymorphic only in Cucurbita species. A similar polymorphism level was found among EST-SSRs and gSSRs, between dimeric and trimeric EST-SSRs, and between EST-SSRs placed in the open reading frame or any of the 5'- or 3'-untranslated regions. Correlation between SSR length and polymorphism was only found for dinucleotide EST-SSRs located within the untranslated regions, but not for trinucleotide EST-SSRs. Transferability of EST-SSRs to Cucurbita species was assayed and 12.7% of the primer pairs amplified at least in one species, although only 5.4% were polymorphic. A set of 14 double haploid lines from the cross between the cultivar "Piel de Sapo" and the accession PI161375 were selected for the bin mapping approach in melon. One hundred and twenty-one SSR markers were newly mapped. The position of 46 SSR loci was also verified by genotyping the complete population. A final bin-map was constructed including 80 RFLPs, 212 SSRs, 3 SNPs and the Nsv locus, distributed in 122 bins with an average bin length of 10.2 cM and a maximum bin length of 33 cM. Map density was 4.2 cM/marker or 5.9 cM/SSR.

  5. miRNA-mediated auxin signalling repression during Vat-mediated aphid resistance in Cucumis melo.

    Science.gov (United States)

    Sattar, Sampurna; Addo-Quaye, Charles; Thompson, Gary A

    2016-06-01

    Resistance to Aphis gossypii in melon is attributed to the presence of the single dominant R gene virus aphid transmission (Vat), which is biologically expressed as antibiosis, antixenosis and tolerance. However, the mechanism of resistance is poorly understood at the molecular level. Aphid-induced transcriptional changes, including differentially expressed miRNA profiles that correspond to resistance interaction have been reported in melon. The potential regulatory roles of miRNAs in Vat-mediated aphid resistance were further revealed by identifying the specific miRNA degradation targets. A total of 70 miRNA:target pairs, including 28 novel miRNA:target pairs, for the differentially expressed miRNAs were identified: 11 were associated with phytohormone regulation, including six miRNAs that potentially regulate auxin interactions. A model for a redundant regulatory system of miRNA-mediated auxin insensitivity is proposed that incorporates auxin perception, auxin modification and auxin-regulated transcription. Chemically inhibiting the transport inhibitor response-1 (TIR-1) auxin receptor in susceptible melon tissues provides in vivo support for the model of auxin-mediated impacts on A. gossypii resistance. © 2016 John Wiley & Sons Ltd.

  6. The Alcohol Dehydrogenase Gene Family in Melon (Cucumis melo L.: Bioinformatic Analysis and Expression Patterns

    Directory of Open Access Journals (Sweden)

    Yazhong eJin

    2016-05-01

    Full Text Available Alcohol dehydrogenases (ADH, encoded by multigene family in plants, play a critical role in plant growth, development, adaptation, fruit ripening and aroma production. Thirteen ADH genes were identified in melon genome, including 12 ADHs and one formaldehyde dehydrogenease (FDH, designated CmADH1-12 and CmFDH1, in which CmADH1 and CmADH2 have been isolated in Cantaloupe. ADH genes shared a lower identity with each other at the protein level and had different intron-exon structure at nucleotide level. No typical signal peptides were found in all CmADHs, and CmADH proteins might locate in the cytoplasm. The phylogenetic tree revealed that 13 ADH genes were divided into 3 groups respectively, namely long-, medium- and short-chain ADH subfamily, and CmADH1,3-11, which belongs to the medium-chain ADH subfamily, fell into 6 medium-chain ADH subgroups. CmADH12 may belong to the long-chain ADH subfamily, while CmFDH1 may be a Class III ADH and serve as an ancestral ADH in melon. Expression profiling revealed that CmADH1, CmADH2, CmADH10 and CmFDH1 were moderately or strongly expressed in different vegetative tissues and fruit at medium and late developmental stages, while CmADH8 and CmADH12 were highly expressed in fruit after 20 days. CmADH3 showed preferential expression in young tissues. CmADH4 only had slight expression in root. Promoter analysis revealed several motifs of CmADH genes involved in the gene expression modulated by various hormones, and the response pattern of CmADH genes to ABA, IAA and ethylene were different. These CmADHs were divided into ethylene-sensitive and –insensitive groups, and the functions of CmADHs were discussed.

  7. Morphogenetic response of cotyledon and leaf explants of melon (Cucumis melo L. cv. Amarillo Oro

    Directory of Open Access Journals (Sweden)

    Fernanda Vidigal Duarte Souza

    2006-01-01

    Full Text Available Callus cultures from cotyledon and leaf explants of a Spanish cultivar of melon (Amarillo Oro were tested for growth and morphogenic capacity on several culture media with different concentrations of IAA (indole-3-acetic acid in combination with 1.0 mg.L-1 BA (6-benzylaminopurine or 6.0 mg.L-1 KIN (kinetin. The best results were achieved with cotyledon explants. The leaf explants presented low bud formation capacity. Variability of organogenic response on cotyledons of different age (7, 5, 3 and 1-day-old was evaluated. The age of explant had a significant influence on bud induction. Cotyledon explants from 7-day-old seedlings showed higher organogenic index and development of shoots when cultured onto MS medium supplemented with 1.5 mg.L-1 of IAA and 1.0 mg.L-1 of BA. The effect of cut type of cotyledonary explants on organogenic response was also investigated. Explants cut transversally showed the best results. The addition of copper sulfate in the culture medium promoted a qualitative improvement of the regenerated shoots.Explantes de cotilédones e folhas do cultivar de melão Amarillo Oro foram cultivados para avaliação do potencial morfogenético em diferentes meios de cultura com diversas concentrações de ácido indolacético (AIA, em combinação com 1,0 mg.L-1 benziladenina (BA e 6,0 mg.L-1 de cinetina (CIN. Os melhores resultados foram obtidos com explantes de cotilédones, sendo que explantes de folhas mostraram uma capacidade baixa na indução de gemas. A variação na resposta organogênica em cotilédones de diferentes idades fisiológicas (1, 3, 5 e 7 dias após a germinação mostraram que os melhores resultados foram obtidos com cotilédones de sete dias cultivados no meio MS suplementado com 1,5 mg.L-1 de AIA e 1,0 mg.L-1 de BA. O efeito do tipo de corte na resposta organogênica de explantes cotiledonares foi também avaliado. Os melhores resultados foram obtidos com explantes cortados transversalmente. Adição suplementar de sulfato de cobre ao meio de cultura resultou em uma melhora na qualidade da dos brotos regenerados.

  8. EVALUATION OF FLORAL CHARACTERISTICS OF MELON HYBRIDS (Cucumis melo L. IN POLLINATOR ATTRACTIVENESS

    Directory of Open Access Journals (Sweden)

    LÚCIA HELENA PIEDADE KIILL

    2016-01-01

    Full Text Available ABSTRACT Floral morphology and biology are important characteristics for plant-pollinator interactions and may influence the behavior of these agents. This study aimed to determine which floral attributes of different melon hybrids influence this interaction and, consequently, their attractiveness in simultaneous crops. The study was conducted in the region of Petrolina, State of Pernambuco (PE/Juazeiro, State of Bahia (BA and Mossoró, State of Rio Grande do Norte (RN, in areas with the following melon hybrids: Yellow type, Piel de Sapo, Cantaloupe and Galia. For studies on floral morphology and biology, hermaphrodites and male flowers of each hybrid were analyzed for their size and nectar chamber size, pollen and nectar production, anthesis time and flower lifespan. Floral visitors were observed simultaneously in hybrids of three types of melon, from 5:00 a.m. to 6:00 p.m., in the two study sites. Evaluations of the corolla diameter and flower height indicated that the hermaphrodite flowers were larger in size than male flowers in all types of melon investigated, in both study sites. As for nectar chamber, male flowers are larger in width, but smaller in height, compared to hermaphrodite flowers. Regarding the volume of nectar, differences were found between floral types for the hybrids evaluated, in the two study sites; the hermaphrodite flowers produced 2-7 times more nectar than male flowers in all studied hybrids. Observations of visits of Apis mellifera to areas with simultaneous flowering of the three types of melon demonstrated differences in the frequency of visits between hybrids, floral type and foraged resource. Flowers of the hybrids Piel de Sapo and Cantaloupe exhibited larger corolla diameter, larger dimensions of the nectar chamber and greater supply of resources for foraging, which could explain the higher number of visits of bees to their flowers in the sites studied.

  9. Inheritance of Resistance to Papaya Ringspot Virus-Papaya Strain in Melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Budi Setiadi Daryono

    2006-07-01

    Full Text Available Papaya ringspot virus (PRSV is one of potyviruses causing severe damage to the production of cucurbit crops including melon, however resistant melons to PRSV have not yet commercially available. To find resistant genetic source of melons against PRSV, sixty three melons were manually inoculated with PRSV-papaya strain (PRSV-P isolated in Thailand. Levels of resistance to PRSV-P accumulation in melon leaf tissue were evaluated using a combination of visual symptom observation and RT-PCR analysis. Among melons tested, Yamatouri, Mawatauri, PI 414723, and PI 371795 showed to be resistance to PRSV-P To study the inheritance of resistance to PRSV-P, breeding experiments were conducted by crossing the resistant Yamatouri with susceptible Vakharman. The genetic analysis results revealed that a single dominant gene conferred resistance to PRSV-P in Yamatouri and its generation.

  10. BTH treatment caused physiological, biochemical and proteomic changes of muskmelon (Cucumis melo L.) fruit during ripening.

    Science.gov (United States)

    Li, Xin; Bi, Yang; Wang, Junjie; Dong, Boyu; Li, Haijie; Gong, Di; Zhao, Ying; Tang, Yamei; Yu, Xiaoyan; Shang, Qi

    2015-04-29

    Benzo-(1,2,3)-thiadiazole-7-carbothioic acid S-methyl ester (BTH) is a chemical plant elicitor capable of inducing disease resistance in many crops. In this study, the climacteric fruit muskmelon (cv. Yujinxiang) was treated with BTH at 0.1g/L for assaying the changes in physiology, biochemistry and protein profile during ripening. The results showed that BTH treatment enhanced respiration rate, while reduced titratable acid content and retarded the decline of fruit firmness and ascorbic acid content. Ethylene production increased after BTH treatment at early stages of ripening, but decreased after 6days of treatment. Of the detected protein spots separated by means of 2-DE, 69 spots changed in abundance significantly after BTH treatment. Fifty-two spots out of 69 were identified using MALDI-TOF/TOF by blasting against NCBInr database. Functional classification revealed that the protein species identified were related to defense and stress responses, protein synthesis, destination and storage, energy metabolism, primary metabolism, cell structure, secondary metabolism, signal transduction and transporters. This study demonstrates an overview of major physiological, biochemical and proteomic changes in muskmelon fruit during ripening after BTH treatment and provides potentially useful information for maintaining fruit quality and delaying the ripening and senescence process. The study offers new proteomic evidences for elucidating the regulatory mechanism of muskmelon fruit ripening by BTH treatment at proteomic level, and provides a valuable reference for further research on the relationship between fruit quality and induction disease resistance in BTH-treated fruits. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. The melanoma antigens MELOE-1 and MELOE-2 are translated from a bona fide polycistronic mRNA containing functional IRES sequences.

    Directory of Open Access Journals (Sweden)

    Delphine Carbonnelle

    Full Text Available Our previous studies on melanoma antigens identified two new polypeptides, named MELOE-1 and MELOE-2, that are involved in immunosurveillance. Intriguingly, these antigens are coded by distinct open reading frames (ORF of the meloe mRNA which is significantly expressed only in the melanocytic lineage. In addition, MELOE-1 and -2 specific T cell clones recognized melanoma cells but very poorly normal melanocytes suggesting differential translation of meloe in normal vs tumor cells. This prompted us to elucidate the mechanisms of translation of these antigens in melanoma cells. We first demonstrated that no splicing event or cryptic promoter could generate shorter meloe transcripts containing only one of the two ORFs. Triggering meloe RNA degradation with a siRNA close to the ORF coding for MELOE-2 abrogated expression of both MELOE-1 and MELOE-2, thus confirming that the two ORFs are always associated. Next we showed, in a bicistronic reporter system, that IRES activities could be detected upstream of MELOE-1 and MELOE-2 and finally confirmed their translation from full length meloe cDNA in melanoma cells with eGFP constructs. In conclusion, meloe is a polycistronic mRNA that generates both MELOE-1 and MELOE-2 antigens through IRES-dependent translation in melanoma cells and that may explain their tumor specificity.

  12. Medieval herbal iconography and lexicography of Cucumis (cucumber and melon, Cucurbitaceae) in the Occident, 1300–1458

    Science.gov (United States)

    Paris, Harry S.; Janick, Jules; Daunay, Marie-Christine

    2011-01-01

    Background The genus Cucumis contains two species of important vegetable crops, C. sativus, cucumber, and C. melo, melon. Melon has iconographical and textual records from lands of the Mediterranean Basin dating back to antiquity, but cucumber does not. The goal of this study was to obtain an improved understanding of the history of these crops in the Occident. Medieval images purportedly of Cucumis were examined, their specific identity was determined and they were compared for originality, accuracy and the lexicography of their captions. Findings The manuscripts having accurate, informative images are derived from Italy and France and were produced between 1300 and 1458. All have an illustration of cucumber but not all contain an image of melon. The cucumber fruits are green, unevenly cylindrical with an approx. 2:1 length-to-width ratio. Most of the images show the cucumbers marked by sparsely distributed, large dark dots, but images from northern France show them as having densely distributed, small black dots. The different size, colour and distribution reflect the different surface wartiness and spininess of modern American and French pickling cucumbers. The melon fruits are green, oval to serpentine, closely resembling the chate and snake vegetable melons, but not sweet melons. In nearly all manuscripts of Italian provenance, the cucumber image is labelled with the Latin caption citruli, or similar, plural diminuitive of citrus (citron, Citrus medica). However, in manuscripts of French provenance, the cucumber image is labelled cucumeres, which is derived from the classical Latin epithet cucumis for snake melon. The absence of melon in some manuscripts and the expropriation of the Latin cucumis/cucumer indicate replacement of vegetable melons by cucumbers during the medieval period in Europe. One image, from British Library ms. Sloane 4016, has a caption that allows tracing of the word ‘gherkin’ back to languages of the geographical nativity of C

  13. Medieval herbal iconography and lexicography of Cucumis (cucumber and melon, Cucurbitaceae) in the Occident, 1300-1458.

    Science.gov (United States)

    Paris, Harry S; Janick, Jules; Daunay, Marie-Christine

    2011-09-01

    The genus Cucumis contains two species of important vegetable crops, C. sativus, cucumber, and C. melo, melon. Melon has iconographical and textual records from lands of the Mediterranean Basin dating back to antiquity, but cucumber does not. The goal of this study was to obtain an improved understanding of the history of these crops in the Occident. Medieval images purportedly of Cucumis were examined, their specific identity was determined and they were compared for originality, accuracy and the lexicography of their captions. The manuscripts having accurate, informative images are derived from Italy and France and were produced between 1300 and 1458. All have an illustration of cucumber but not all contain an image of melon. The cucumber fruits are green, unevenly cylindrical with an approx. 2:1 length-to-width ratio. Most of the images show the cucumbers marked by sparsely distributed, large dark dots, but images from northern France show them as having densely distributed, small black dots. The different size, colour and distribution reflect the different surface wartiness and spininess of modern American and French pickling cucumbers. The melon fruits are green, oval to serpentine, closely resembling the chate and snake vegetable melons, but not sweet melons. In nearly all manuscripts of Italian provenance, the cucumber image is labelled with the Latin caption citruli, or similar, plural diminuitive of citrus (citron, Citrus medica). However, in manuscripts of French provenance, the cucumber image is labelled cucumeres, which is derived from the classical Latin epithet cucumis for snake melon. The absence of melon in some manuscripts and the expropriation of the Latin cucumis/cucumer indicate replacement of vegetable melons by cucumbers during the medieval period in Europe. One image, from British Library ms. Sloane 4016, has a caption that allows tracing of the word 'gherkin' back to languages of the geographical nativity of C. sativus, the Indian

  14. Temas de Historia: El golpe de Melo

    Directory of Open Access Journals (Sweden)

    Fernando Serpa Flórez

    1965-07-01

    Full Text Available El 16 de abril de 1854, en las horas de la noche, el general José María Melo, comandante general del ejército, se apoderó de los cuarteles de Bogotá. Al día siguiente, por la mañana, envió una comisión ante el Presidente de la República, José María Obando, a ofrecerle la dictadura. El presidente rechazó tal propuesta y convocó al Consejo de Gobierno, al vicepresidente José de Obaldía, al Procurador General de la Nación y al designado, general Tomás Herrera, para estudiar la situación.

  15. A conserved ethylene biosynthesis enzyme leads to andromonoecy in two cucumis species.

    Directory of Open Access Journals (Sweden)

    Adnane Boualem

    Cucumis sativus (cucumber and Cucumis melo (melon that have diverged over 40 My ago. The isolation of the genes for andromonoecy in Cucumis species provides a molecular basis for understanding how sexual systems arise and are maintained within and between species.

  16. Response of Cucumber (Cucumis sativus L

    African Journals Online (AJOL)

    user

    and this was attributed to lack of scientific basis for advising farmers on application rates. It is also observed that information is scarce on response of cucumber (Cucumis sativus L.) to different source of animal manure. Against this background, there is need to study the effect of different organic manure source and rates in ...

  17. The possible origin of Cucumis anguria L

    NARCIS (Netherlands)

    Meeuse, A.D.J.

    1958-01-01

    Cucumis anguria L., the “West India Gherkin” or “Bur Gherkin”, is a cultigen known to have occurred in the West Indies in a cultivated or more or less adventitious state since before 1650 when the first accounts of this plant were published (1, 2). The occurrence of a single species of this old

  18. Marques de Melo: Su pensamiento periodístico

    Directory of Open Access Journals (Sweden)

    Jorge Pedro Sousa

    2008-12-01

    Full Text Available Marques de Melo el periodista investigador, cuyo trabajo es relevante para todo el universo de las Ciencias de la Comunicación, fue el primero en reconocer la existencia de una escuela de pensamiento comunicacional latinoamericano. El texto hace una breve incursión por los caminos seguidos por el teórico del periodismo.

  19. Producción y exportación de melón (Cucumis melo en Costa Rica

    Directory of Open Access Journals (Sweden)

    José Eladio Monge-Pérez

    2014-02-01

    Full Text Available Se estudió la producción y exportación de melón en Costa Rica. Se recopiló y analizó información obtenida a través de diferentes fuentes (FAO, BCCR, PROCOMER, MAG, CANAPEMS. Se estableció comunicación personal con gerentes de empresas exportadoras de melón y se revisaron diversas publicaciones sobre el tema. En este artículo se presentan datos sobre el área de siembra, el número de empresas exportadoras, la distribución geográfica del cultivo, el valor de las exportaciones, las exportaciones por país de destino y por tipo de melón a lo largo de varios años. Finalmente, se analizan los desafíos a nivel agronómico, económico, ambiental y logístico para el futuro de la producción de melón en Costa Rica.

  20. Identifikasi berat, diameter, dan tebal daging buah melon (Cucumis melo L. kultivar action 434 tetraploid akibat perlakuan kolkisin

    Directory of Open Access Journals (Sweden)

    Y. Ulung Anggraito

    2012-02-01

    Full Text Available Indonesian farmers are very dependence on certificated seed from another countries. In the other side the natural resources andmen powers very abundance. For these reason it is properly developed the research in agriculture sector, especially on plants breeding.It can be hoped that in the future the dependence on certificated seed from another countries can be minimized. The objective of thisresearch were: (1 to find out the concentration and dipping period which is effective to induce polyploid in musk melon plant, (2identify the weight, diameter, dan flesh thickness of tetraploid musk melon as result of colchicines treatment. The sample of this researchwas Action 434 musk melon cultivar, product of Chia-Thai Seed, Thailand. The number of sample was 480 plants, which plants on fieldrandomly. There were four colchicines concentration as an independent variable: 0.0%, 0.05%, 0.10% and 0.2%. The dipping periodwere 12, 16, 20, and 24 hours for each concentration respectively. Completely Random Design was used in three replications. Datameasurement were analyzed with Two Way ANOVA, DMRT, and LSD. From this research can be concluded that: (1 0.2 % colchicinesis the most effective concentration to induce polyploid on musk melon, with dipping period effective varied from 16–24 hours, (2 thereare changes in weight, diameter, and flesh thickness characters, with the increased tendency of each character in definite norm.

  1. Differential metabolism of L-phenylalanine in the formation of aromatic volatiles in melon (Cucumis melo L.) fruit.

    Science.gov (United States)

    Gonda, Itay; Davidovich-Rikanati, Rachel; Bar, Einat; Lev, Shery; Jhirad, Pliaa; Meshulam, Yuval; Wissotsky, Guy; Portnoy, Vitaly; Burger, Joseph; Schaffer, Arthur A; Tadmor, Yaakov; Giovannoni, James J; Fei, Zhangjun; Fait, Aaron; Katzir, Nurit; Lewinsohn, Efraim

    2018-02-12

    Studies on the active pathways and the genes involved in the biosynthesis of L-phenylalanine-derived volatiles in fleshy fruits are sparse. Melon fruit rinds converted stable-isotope labeled L-phe into more than 20 volatiles. Phenylpropanes, phenylpropenes and benzenoids are apparently produced via the well-known phenylpropanoid pathway involving phenylalanine ammonia lyase (PAL) and being (E)-cinnamic acid a key intermediate. Phenethyl derivatives seemed to be derived from L-phe via a separate biosynthetic route not involving (E)-cinnamic acid and PAL. To explore for a biosynthetic route to (E)-cinnamaldehyde in melon rinds, soluble protein cell-free extracts were assayed with (E)-cinnamic acid, CoA, ATP, NADPH and MgSO 4 , producing (E)-cinnamaldehyde in vitro. In this context, we characterized CmCNL, a gene encoding for (E)-cinnamic acid:coenzyme A ligase, inferred to be involved in the biosynthesis of (E)-cinnamaldehyde. Additionally we describe CmBAMT, a SABATH gene family member encoding a benzoic acid:S-adenosyl-L-methionine carboxyl methyltransferase having a role in the accumulation of methyl benzoate. Our approach leads to a more comprehensive understanding of L-phe metabolism into aromatic volatiles in melon fruit. Copyright © 2018 Elsevier Ltd. All rights reserved.

  2. Evaluación agronómica de melón (cucumis melo l bajo condiciones de campo

    Directory of Open Access Journals (Sweden)

    Fernando Borrego

    2001-01-01

    Full Text Available Con el objetivo de determinar las variables más relacionadas con el rendimiento, así como los principales componentes de variación, se establecieron en campo, en Ramos Arizpe, Coahuila, 12 genotipos de melón, en un diseño de Bloques Completos al Azar, con cuatro repeticiones. La parcela experimental fue de dos surcos de cinco metros de largo sembrados a doble hilera. Los genotipos en estudio fueron: híbridos: Primo, Pronto, Challenger, Cheyenne, Hi-Line, Cruiser, Durango, Apache, Laguna, Caravelle y Main Pak, y la variedad Top Mark, testigo; las variables evaluadas fueron: rendimiento (11 variables: cuantitativas y cualitativas; fenológicas (tres variables; agroclimáticas (cinco Variables y fisiológicas (cuatro variables. Se encontraron correlaciones significativas (p<0,05 y negativas, entre rendimiento y precocidad, peso promedio de frutos y número de frutos, así como entre número de frutos y longitud de fruto. Las variables fisiológicas más relacionadas fueron fotosíntesis y uso eficiente del agua. En el análisis de componentes principales, se encontró que hasta el componente tres, se explica el 65% de la varianza. En el componente uno, se encuentra un alto valor en las características de rendimiento (producción, peso y tamaño, por lo que se llamaría “Características Cuantitativas del Rendimiento”. En el componente dos, la mayor variación es el de “Componente de Precocidad”. Los componentes tres al seis, explican en proporciones muy similares las otras variables, siendo en el seis donde se encuentra con mayor valor la fotosíntesis. El análisis de regresión lineal múltiple fue significativo (p<0,057 que, por las condiciones del estudio, se considera adecuado. El rendimiento en t/ha, se explica por una ecuación lineal múltiple (r2=0,99 de 10 variables

  3. Hexanoic Acid Treatment Prevents Systemic MNSV Movement in Cucumis melo Plants by Priming Callose Deposition Correlating SA and OPDA Accumulation

    Directory of Open Access Journals (Sweden)

    Emma Fernández-Crespo

    2017-10-01

    Full Text Available Unlike fungal and bacterial diseases, no direct method is available to control viral diseases. The use of resistance-inducing compounds can be an alternative strategy for plant viruses. Here we studied the basal response of melon to Melon necrotic spot virus (MNSV and demonstrated the efficacy of hexanoic acid (Hx priming, which prevents the virus from systemically spreading. We analysed callose deposition and the hormonal profile and gene expression at the whole plant level. This allowed us to determine hormonal homeostasis in the melon roots, cotyledons, hypocotyls, stems and leaves involved in basal and hexanoic acid-induced resistance (Hx-IR to MNSV. Our data indicate important roles of salicylic acid (SA, 12-oxo-phytodienoic acid (OPDA, jasmonic-isoleucine, and ferulic acid in both responses to MNSV. The hormonal and metabolites balance, depending on the time and location associated with basal and Hx-IR, demonstrated the reprogramming of plant metabolism in MNSV-inoculated plants. The treatment with both SA and OPDA prior to virus infection significantly reduced MNSV systemic movement by inducing callose deposition. This demonstrates their relevance in Hx-IR against MNSV and a high correlation with callose deposition. Our data also provide valuable evidence to unravel priming mechanisms by natural compounds.

  4. Plantas hospederas de Aphis gossypii (Aphididae, vector de virus del melón Cucumis melo (Cucurbitaceae en Costa Rica

    Directory of Open Access Journals (Sweden)

    M.V. Sánchez

    2001-03-01

    Full Text Available Se identificaron las especies hospederas naturales de Aphis gossypii Glover (Aphididae: Homoptera en plantaciones comerciales de melón para la exportación en Costa Rica. El estudio se realizó en dos fincas, ubicadas una en la provincia de Guanacaste y la otra en la provincia de Puntarenas, correspondientes a dos zonas de vida vegetal diferentes. Se identificaron como especies hospederas del áfido todas aquellas especies vegetales en las que se observó la presencia del áfido en su forma áptera. En ambas fincas el estudio se realizó en los alrededores y dentro del cultivo de melón. En la finca A en cinco diferentes comunidades vegetales (cultivo, canal de drenaje, charral, potrero mejorado y semi-bosque previamente seleccionadas y en la finca B en cuatro comunidades vegetales (cultivo, charral, pastizal natural y semi-bosque. Especímenes de las plantas colonizadas por áfidos y los áfidos colonizadores de cada especie fueron recolectadas para su identificación. Los áfidos se preservaron en alcohol al 70% v/v e identificaron utilizando las claves taxonómicas para áfidos, confirmándose como especie dominante a A. gossypii. La diversidad, cobertura y época de aparición de las especies de plantas hospederas fue monitoreada durante un año calendario en las diferentes comunidades vegetales presentes en ambas fincas, observándose diferencias entre las dos fincas estudiadas. En la finca A se observaron 86 diferentes especies vegetales, pertenecientes a 49 familias, asociadas al cultivo del melón, mientras que en la finca B se identificaron 72 especies de 40 familias. En conjunto para ambas fincas, un de 24 especies de plantas (16 familias estaban colonizadas por el áfido A. gossypii. De éstas, 16 especies de 10 familias, son reportes nuevos de plantas hospederas para este áfido: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia y Corchorus orinocensis.Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families and 72 plant species (40 families were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families were colonized by A. gossypii and 16 (10 families are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.

  5. Biochemical and color changes of fresh-cut melon (Cucumis melo L. cv. Galia treated with UV-C

    Directory of Open Access Journals (Sweden)

    Rezzan Kasim

    2014-09-01

    Full Text Available The importance of minimally processed commodities in the retail groceries of most developed countries has been rising continuously during the last decades. Cantaloupe melon is used more than any other fruit in fresh-cut processing. Ultraviolet (UV light has been extensively used to simulate biological stres in plants and for determining resistance mechanisms of plant tissues. In this study the effect of ultraviolet irradiation on some properties of fresh-cut cantalope melon was determined during storage. Freshly cut cantalope melons cubes treated with ultraviolet irradiation at the doses of 1, 2 or 3 min before storage, and then placed in a cold room at 5±1°C temperature and 85-90% RH. Hue angle values of control group is low compared to UV-C treated samples, whereas L values of is high. EL of UV treated samples higher than those of control group. Total soluble solids of fresh-cut melon samples in UC3 treatment increased during storage. The results indicate that UV-C treatments on fresh-cut cantaloupe melon cubes increased total soluble solids independently from water loss.

  6. Hexanoic Acid Treatment Prevents Systemic MNSV Movement in Cucumis melo Plants by Priming Callose Deposition Correlating SA and OPDA Accumulation

    OpenAIRE

    Emma Fernández-Crespo; Navarro, Jose A.; Marta Serra-Soriano; Iván Finiti; Pilar García-Agustín; Vicente Pallás; Carmen González-Bosch

    2017-01-01

    Unlike fungal and bacterial diseases, no direct method is available to control viral diseases. The use of resistance-inducing compounds can be an alternative strategy for plant viruses. Here we studied the basal response of melon to Melon necrotic spot virus (MNSV) and demonstrated the efficacy of hexanoic acid (Hx) priming, which prevents the virus from systemically spreading. We analysed callose deposition and the hormonal profile and gene expression at the whole plant level. This allowed u...

  7. A new strategy to protect Katsura-uri (Japan's heirloom pickling melon, Cucumis melo var. conomon from extinction

    Directory of Open Access Journals (Sweden)

    Azusa Sasaki

    2017-03-01

    Conclusion: This demonstrated a new strategy to protect this heirloom vegetable from extinction by adding a new function that could increase its demand as a low-calorie fruit in the present diet habit for human health.

  8. Electronic detection of Drechslera sp. fungi in charentais melon ( Cucumis melo Naudin) using carbon-nanostructure-based sensors.

    Science.gov (United States)

    Greenshields, Márcia W C C; Mamo, Messai A; Coville, Neil J; Spina, Andréa P; Rosso, Diogo Filipe; Latocheski, Elaine C; Destro, João Guilherme; Pimentel, Ida C; Hümmelgen, Ivo A

    2012-10-24

    The development of chemical sensor technology in recent years has stimulated an interest regarding the use of characteristic volatiles and odors as a rapid and early indication of deterioration in fruit quality. The fungal infestation by Drechslera sp. in melons is a severe problem, and we demonstrate that electronic sensors based on carbon nanostructures are able to detect the presence of these fungi in melon. The responses of sensor conductance G and capacitance C at 27 kHz were measured and used to calculate their ΔG and ΔC variation over the full melon ripening process under shelf conditions with proliferation of Drechslera sp. fungi. The sensor response showed that these fungi can be electronically identified in charentais melon, constituting an effective and cheap test procedure to differentiate between infected and uninfected melon.

  9. Comparative transcriptional profiling analysis of developing melon (Cucumis melo L.) fruit from climacteric and non-climacteric varieties.

    Science.gov (United States)

    Saladié, Montserrat; Cañizares, Joaquin; Phillips, Michael A; Rodriguez-Concepcion, Manuel; Larrigaudière, Christian; Gibon, Yves; Stitt, Mark; Lunn, John Edward; Garcia-Mas, Jordi

    2015-06-09

    In climacteric fruit-bearing species, the onset of fruit ripening is marked by a transient rise in respiration rate and autocatalytic ethylene production, followed by rapid deterioration in fruit quality. In non-climacteric species, there is no increase in respiration or ethylene production at the beginning or during fruit ripening. Melon is unusual in having climacteric and non-climacteric varieties, providing an interesting model system to compare both ripening types. Transcriptomic analysis of developing melon fruits from Védrantais and Dulce (climacteric) and Piel de sapo and PI 161375 (non-climacteric) varieties was performed to understand the molecular mechanisms that differentiate the two fruit ripening types. Fruits were harvested at 15, 25, 35 days after pollination and at fruit maturity. Transcript profiling was performed using an oligo-based microarray with 75 K probes. Genes linked to characteristic traits of fruit ripening were differentially expressed between climacteric and non-climacteric types, as well as several transcription factor genes and genes encoding enzymes involved in sucrose catabolism. The expression patterns of some genes in PI 161375 fruits were either intermediate between. Piel de sapo and the climacteric varieties, or more similar to the latter. PI 161375 fruits also accumulated some carotenoids, a characteristic trait of climacteric varieties. Simultaneous changes in transcript abundance indicate that there is coordinated reprogramming of gene expression during fruit development and at the onset of ripening in both climacteric and non-climacteric fruits. The expression patterns of genes related to ethylene metabolism, carotenoid accumulation, cell wall integrity and transcriptional regulation varied between genotypes and was consistent with the differences in their fruit ripening characteristics. There were differences between climacteric and non-climacteric varieties in the expression of genes related to sugar metabolism suggesting that they may be potential determinants of sucrose content and post-harvest stability of sucrose levels in fruit. Several transcription factor genes were also identified that were differentially expressed in both types, implicating them in regulation of ripening behaviour. The intermediate nature of PI 161375 suggested that classification of melon fruit ripening behaviour into just two distinct types is an over-simplification, and that in reality there is a continuous spectrum of fruit ripening behaviour.

  10. Comparative transcriptional profiling analysis of developing melon (Cucumis melo L.) fruit from climacteric and non-climacteric varieties

    OpenAIRE

    Saladié, Montserrat

    2015-01-01

    [EN] Background: In climacteric fruit-bearing species, the onset of fruit ripening is marked by a transient rise in respiration rate and autocatalytic ethylene production, followed by rapid deterioration in fruit quality. In non-climacteric species, there is no increase in respiration or ethylene production at the beginning or during fruit ripening. Melon is unusual in having climacteric and non-climacteric varieties, providing an interesting model system to compare both ripening ...

  11. Assembly of cucumber (Cucumis sativus L.) somaclones

    Science.gov (United States)

    Skarzyńska, Agnieszka; Kuśmirek, Wiktor; Pawełkowicz, Magdalena; PlÄ der, Wojciech; Nowak, Robert M.

    2017-08-01

    The development of next generation sequencing opens the possibility of using sequencing in various plant studies, such as finding structural changes and small polymorphisms between species and within them. Most analyzes rely on genomic sequences and it is crucial to use well-assembled genomes of high quality and completeness. Herein we compare commonly available programs for genomic assembling and newly developed software - dnaasm. Assemblies were tested on cucumber (Cucumis sativus L.) lines obtained by in vitro regeneration (somaclones), showing different phenotypes. Obtained results shows that dnaasm assembler is a good tool for short read assembly, which allows obtaining genomes of high quality and completeness.

  12. Preliminary phytochemical analysis and cytotoxic potential of Cucumis trigonus Roxb

    Directory of Open Access Journals (Sweden)

    Balakrishnan Arunachalam

    2012-02-01

    Conclusion: These results conclude that the ethanolic fruit extract of Cucumis trigonus possess a good phytochemical strength and also an effective cytotoxic potential. [J Intercult Ethnopharmacol 2012; 1(1.000: 13-18

  13. Protein (Viridiplantae): 831920 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available rane protein 4 Cucumis melo MNRHNDPNPFDEEEVNPFSKGGGAPGSKFRIPQMVSDTLGFGQKHDATVDIPL...DTMNDPKKKERELAAWEAELNRKEKEIKKREEAVSKAGVPADDRNWPPFFPIIHHDIANEIPVHAQKLQYLAFASWLGIVLCLFFNVIAITVCWIRGGGVKIFFLAVIYAILGIPL

  14. Mathematical modelling of cucumber (cucumis sativus) drying

    Science.gov (United States)

    Shahari, N.; Hussein, S. M.; Nursabrina, M.; Hibberd, S.

    2014-07-01

    This paper investigates the applicability of using an experiment based mathematical model (empirical model) and a single phase mathematical model with shrinkage to describe the drying curve of cucumis sativus (cucumber). Drying experiments were conducted using conventional air drying and data obtained from these experiments were fitted to seven empirical models using non-linear least square regression based on the Levenberg Marquardt algorithm. The empirical models were compared according to their root mean square error (RMSE), sum of square error (SSE) and coefficient of determination (R2). A logarithmic model was found to be the best empirical model to describe the drying curve of cucumber. The numerical result of a single phase mathematical model with shrinkage was also compared with experiment data for cucumber drying. A good agreement was obtained between the model predictions and the experimental data.

  15. in differentiation of selected species of Cucumis grown in Southern ...

    African Journals Online (AJOL)

    Jane

    2011-08-22

    Aug 22, 2011 ... melon dated back to 2000 BC in India, where various types of melons viz. var. momordica, var. acidulus and var. flexuosus (L.) Naudin are cultivated. C. melo var. acidulus Naudin is commonly known as 'Vellari' and is endemic to tropical humid Southern India (states of. Kerala, Tamil Nadu and Karnataka).

  16. The genome of the cucumber, Cucumis sativus L.

    NARCIS (Netherlands)

    Huang, S.W.; Li, R.Q.; Vossen, van der E.A.G.

    2009-01-01

    Cucumber is an economically important crop as well as a model system for sex determination studies and plant vascular biology. Here we report the draft genome sequence of Cucumis sativus var. sativus L., assembled using a novel combination of traditional Sanger and next-generation Illumina GA

  17. The Effect Of Cucumis Metuliferus E Meye (Cucurbitaceae) On Rat ...

    African Journals Online (AJOL)

    Extract of fruit pulp of Cucumis metuliferus was screened for its effects on gastric functions and mucosal intergrity in albino rats. The study revealed significant (P < 0.05) dose-dependent decrease in the number and type of gastro mucosal lesions as compared to ranitidine (a standard anti-gastric ulcer drug). Similarly, the ...

  18. Technology transfer for cucumber ( Cucumis sativus L.) production ...

    African Journals Online (AJOL)

    Technology transfer for cucumber ( Cucumis sativus L.) production under protected agriculture in uplands Balochistan, Pakistan. ... The cucumbers so harvested were of higher quality (no insect damage) and were sold at premium prices during the whole production cycle. Proper crop sequencing by considering the market ...

  19. A genetic linkage map of cucumber ( Cucumis sativus L) combining ...

    African Journals Online (AJOL)

    Sequence-related amplified polymorphism (SRAP) and Inter-simple sequence repeat (ISSR) markers are both simple and efficient maker systems adapted to many crops and for multiple purposes. In this study a genetic map based on SRAP and ISSR markers was constructed for cucumber (Cucumis sativus L.) based on ...

  20. Chromosome-specific painting in Cucumis species using bulked oligonucleotides

    Science.gov (United States)

    Chromosome-specific painting is a powerful technique in molecular cytogenetic and genome research. We developed an oligonucleotide (oligo)-based chromosome painting technique in cucumber (Cucumis sativus) that will be applicable in any plant species with a sequenced genome. Oligos specific to a sing...

  1. A single recessive gene controls fragrance in cucumber (Cucumis ...

    Indian Academy of Sciences (India)

    2013-04-10

    Apr 10, 2013 ... c Indian Academy of Sciences. RESEARCH NOTE. A single recessive gene controls fragrance ... bitaceae. Cucumber fruits are consumed as a vegetable fresh or cooked or in pickled form. Over 95% of the cucumber ... Keywords. fragrance; aroma; cucumber; Cucumis sativus. Journal of Genetics, Vol.

  2. Next-generation sequencing, FISH mapping and synteny-based modeling reveal mechanisms of decreasing dysploidy in Cucumis.

    Science.gov (United States)

    Yang, Luming; Koo, Dal-Hoe; Li, Dawei; Zhang, Tao; Jiang, Jiming; Luan, Feishi; Renner, Susanne S; Hénaff, Elizabeth; Sanseverino, Walter; Garcia-Mas, Jordi; Casacuberta, Josep; Senalik, Douglas A; Simon, Philipp W; Chen, Jinfeng; Weng, Yiqun

    2014-01-01

    In the large Cucurbitaceae genus Cucumis, cucumber (C. sativus) is the only species with 2n = 2x = 14 chromosomes. The majority of the remaining species, including melon (C. melo) and the sister species of cucumber, C. hystrix, have 2n = 2x = 24 chromosomes, implying a reduction from n = 12 to n = 7. To understand the underlying mechanisms, we investigated chromosome synteny among cucumber, C. hystrix and melon using integrated and complementary approaches. We identified 14 inversions and a C. hystrix lineage-specific reciprocal inversion between C. hystrix and melon. The results reveal the location and orientation of 53 C. hystrix syntenic blocks on the seven cucumber chromosomes, and allow us to infer at least 59 chromosome rearrangement events that led to the seven cucumber chromosomes, including five fusions, four translocations, and 50 inversions. The 12 inferred chromosomes (AK1-AK12) of an ancestor similar to melon and C. hystrix had strikingly different evolutionary fates, with cucumber chromosome C1 apparently resulting from insertion of chromosome AK12 into the centromeric region of translocated AK2/AK8, cucumber chromosome C3 originating from a Robertsonian-like translocation between AK4 and AK6, and cucumber chromosome C5 originating from fusion of AK9 and AK10. Chromosomes C2, C4 and C6 were the result of complex reshuffling of syntenic blocks from three (AK3, AK5 and AK11), three (AK5, AK7 and AK8) and five (AK2, AK3, AK5, AK8 and AK11) ancestral chromosomes, respectively, through 33 fusion, translocation and inversion events. Previous results (Huang, S., Li, R., Zhang, Z. et al., , Nat. Genet. 41, 1275-1281; Li, D., Cuevas, H.E., Yang, L., Li, Y., Garcia-Mas, J., Zalapa, J., Staub, J.E., Luan, F., Reddy, U., He, X., Gong, Z., Weng, Y. 2011a, BMC Genomics, 12, 396) showing that cucumber C7 stayed largely intact during the entire evolution of Cucumis are supported. Results from this study allow a fine-scale understanding of the

  3. Backcross introgression of the Cucumis hystrix chakr. genome increases genetic diveristy in U.S. processing cucumber (Cucumis sativus L.)

    Science.gov (United States)

    The genetic base of commercial cucumber (Cucumis sativus L.) is extremely narrow (about 3 to 8% polymorphism). Wide-based crosses within C. sativus [i.e., var. sativus x var. hardwickii (R.) Alef.] and interspecific hybridization attempts prior to 1995 have not substantially increased genetic diver...

  4. Backcross introgression of the Cucumis hystrix chakr. genome increases genetic diversity in U.S. processing cucumber (Cucumis sativus L.)

    Science.gov (United States)

    The genetic base of commercial cucumber (Cucumis sativus L.) is extremely narrow (about 3 to 8% polymorphism). Wide-based crosses within C. sativus [i.e., var. sativus x var. hardwickii (R.) Alef.] and interspecific hybridization attempts prior to 1995 have not substantially increased genetic diver...

  5. João Cabral de Melo Neto

    Directory of Open Access Journals (Sweden)

    Sergio Ernesto Ríos

    2014-06-01

    Full Text Available A la pregunta sobre los primeros poetas brasileños, y más aun sobre aquellos que han apuntalado, nutrido y vivificado el idioma portugués, y escrito esas epopeyas particulares de un país, acudirá el nombre de João Cabral de Melo Neto (Recife, 1920-Río de Janeiro, 1999, quizá más conocido por sus libros Morte e vida Severina, O engenheiro y O cão sem plumas. Es vasta la bibliografía y traducción de esos temas y libros. De ahí mi interés en presentar estos poemas de su libro Pedra do sono, un libro de juventud —escrito antes de sus veinte años—, libre, telúrico y estelar, sin pretensiones ni esquemas, asombrado por el mundo y sus objetos, a los que deforma en un sinuoso ‘surrealismo’, mitad lúdico, mitad misterio.

  6. On the orthodox church melos: A contribution to the typology of church chant

    Directory of Open Access Journals (Sweden)

    Peno Vesna M.

    2003-01-01

    Full Text Available Many unresolved questions related to post-Byzantine church chanting present obstacles to understanding some aspects of church music since the 19th century. One of those problems concerns the need for strict definitions of criteria according to which a church melody is classified as "melos" (Serb. napev. In this article the actual classifications of new Greek and Serbian chants are given. The most important Greek theoretical sources (theoretikon are taken into consideration, as well as writings in which Serbian theoreticians and chanters explain the classification of hymns in Serbian church singing. The terminology related to "melos" in Greek and Serbian church chanting practice is critically examined. Attention is also drawn to elements common to new Greek (neumatic and Serbian (staff notation "melos". This article is an introduction to more detailed research whose aim will be to establish similarities and distinctions between the two church singing traditions that have the same origins in Byzantine church music.

  7. Comparative DFT Study of Phytochemical Constituents of the Fruits of Cucumis trigonus Roxb. and Cucumis sativus Linn.

    Directory of Open Access Journals (Sweden)

    Subarayan Bothi Gopalakrishnan

    2014-01-01

    Full Text Available The hepatoprotective active phytochemical constituents from the ethanolic extracts of the fruits of Cucumis trigonus Roxb. and Cucumis sativus Linn. were identified by GC-MS analysis. The density functional theory (DFT of these molecules was calculated by density functional B3LYP methods using B3LYP/6-311++G(d,p basis set. The optimized geometries of phytochemical constituents were evaluated. Physicochemical properties such as HOMO, LUMO, ionization potential, electron affinity, electronegativity, electrochemical potential, hardness, softness, electrophilicity, total energy, and dipole moment have also been recorded. These are very important parameters to understand the chemical reactivity and biological activity of the phytochemical constituents. Glycodeoxycholic acid and 2-(2-methylcyclohexylidene-hydrazinecarboxamide were found to be effective drugs selected on the basis of their HOMO and LUMO energy gap and softness. The effective properties of these compounds may be due to the presence of amino, carbonyl, and alcohol as a functional group.

  8. Pewarisan Karakter Fenotip Melon (Cucumis melo L. ‘Hikapel Aromatis’ Hasil Persilangan ♀ ‘Hikapel’ dengan ♂ ‘Hikadi Aromatik’

    Directory of Open Access Journals (Sweden)

    Budi Setiadi Daryono

    2018-01-01

    Full Text Available This research aims to develop cultivars with superior phenotypes of melon and high level of productivity. This research used the individual results of crossing between melon  ♀ ‘Hikapel' with ♂ 'Hikadi Aromatik'. The research included qualitative and quantitative phenotype characterization test. The research was conducted in Center of Agrotechnology Innovation University of Gadjah Mada (PIAT-UGM, Kalitirto, Berbah, Sleman, Yogyakarta and Laboratory of Genetics Faculty of Biology UGM on December 2016 until March 2017. Quantitative data analysis used ANOVA testing through PKBT-STAT 2.02 software with Random Complete Block Design (RCBD method at significance level of 1% and 5%. Melon 'Hikapel Aromatik' has several advantages including oval shape, without net, without lobes, crispy texture, skin-collored yellow RHS (6A, has a 7-14 brix, has volatile aromatic compound and transposon influenced. Based on the results of recapitulation of variance, the characters of 'Hikapel Aromatik' was not uniform.

  9. Comparison of Different Methods for Separation of Haploid Embryo Induced through Irradiated Pollen and Their Economic Analysis in Melon (Cucumis melo var. inodorus

    Directory of Open Access Journals (Sweden)

    Gökhan Baktemur

    2013-01-01

    Full Text Available Irradiated pollen technique is the most successful haploidization technique within Cucurbitaceae. After harvesting of fruits pollinated with irradiated pollen, classical method called as “inspecting the seeds one by one” is used to find haploid embryos in the seeds. In this study, different methods were used to extract the embryos more easily, quickly, economically, and effectively. “Inspecting the seeds one by one” was used as control treatment. Other four methods tested were “sowing seeds direct nutrient media,” “inspecting seeds in the light source,” “floating seeds on liquid media,” and “floating seeds on liquid media after surface sterilization.” Y2 and Y3 melon genotypes selected from the third backcross population of Yuva were used as plant material. Results of this study show that there is no statistically significant difference among methods “inspecting the seeds one by one,” “sowing seeds direct CP nutrient media,” and “inspecting seeds in the light source,” although the average number of embryos per fruit is slightly different. No embryo production was obtained from liquid culture because of infection. When considered together with labor costs and time required for embryo rescue, the best methods were “sowing seeds directly in the CP nutrient media“ and ”inspecting seeds in the light source.”

  10. Mapping and introgression of QTL involved in fruit shape transgressive segregation into ‘piel de sapo’ melon (cucumis melo l.) [corrected].

    Science.gov (United States)

    Díaz, Aurora; Zarouri, Belkacem; Fergany, Mohamed; Eduardo, Iban; Alvarez, José M; Picó, Belén; Monforte, Antonio J

    2014-01-01

    A mapping F2 population from the cross 'Piel de Sapo' × PI124112 was selectively genotyped to study the genetic control of morphological fruit traits by QTL (Quantitative Trait Loci) analysis. Ten QTL were identified, five for FL (Fruit Length), two for FD (Fruit Diameter) and three for FS (Fruit Shape). At least one robust QTL per character was found, flqs8.1 (LOD = 16.85, R2 = 34%), fdqs12.1 (LOD = 3.47, R2 = 11%) and fsqs8.1 (LOD = 14.85, R2 = 41%). flqs2.1 and fsqs2.1 cosegregate with gene a (andromonoecious), responsible for flower sex determination and with pleiotropic effects on FS. They display a positive additive effect (a) value, so the PI124112 allele causes an increase in FL and FS, producing more elongated fruits. Conversely, the negative a value for flqs8.1 and fsqs8.1 indicates a decrease in FL and FS, what results in rounder fruits, even if PI124112 produces very elongated melons. This is explained by a significant epistatic interaction between fsqs2.1 and fsqs8.1, where the effects of the alleles at locus a are attenuated by the additive PI124112 allele at fsqs8.1. Roundest fruits are produced by homozygous for PI124112 at fsqs8.1 that do not carry any dominant A allele at locus a (PiPiaa). A significant interaction between fsqs8.1 and fsqs12.1 was also detected, with the alleles at fsqs12.1 producing more elongated fruits. fsqs8.1 seems to be allelic to QTL discovered in other populations where the exotic alleles produce elongated fruits. This model has been validated in assays with backcross lines along 3 years and ultimately obtaining a fsqs8.1-NIL (Near Isogenic Line) in 'Piel de Sapo' background which yields round melons.

  11. Effect of ultrasonic processing on the changes in activity, aggregation and the secondary and tertiary structure of polyphenol oxidase in oriental sweet melon (Cucumis melo var. makuwa Makino).

    Science.gov (United States)

    Liu, Siyu; Liu, Yan; Huang, Xingjian; Yang, Wenjin; Hu, Wanfeng; Pan, Siyi

    2017-03-01

    Polyphenol oxidase (PPO) mainly contributes to the browning reaction of fruits and vegetables and causes serious damage to the quality of sweet melon products. However, traditional methods to inactivate browning may induce more unexpected risks than ultrasonic processing. Meanwhile, there are no reports on the effect of ultrasound on PPO directly purified from sweet melon. The PPO in the original juice was less inactivated than the purified form when treated with ultrasound. As for purified PPO, superior to thermal treatment, less heat was needed to inactivate the PPO with ultrasonic treatment. At intensity lower than 200 W, ultrasound did not significantly affect the structure and activity of PPO (P > 0.05), and latent PPO was activated. At intensity higher than 200 W, ultrasound inactivated PPO, induced aggregation and dissociation of PPO particles and significantly decreased the α-helix structure content. Low-frequency high-intensity ultrasound caused an inactivation effect and conformational changes of purified PPO from oriental sweet melons. Changes in the PPO structure induced by ultrasound eventually inactivated the enzyme. Ultrasound may be a potential method to inactivate PPO in oriental sweet melons. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  12. O estado da arte das sementes crioulas no Rio Grande do Sul com ênfase em sementes crioulas de melão (Cucumis melo L.)

    OpenAIRE

    Andréa Becker Delwing

    2006-01-01

    Este estudo objetivou avaliar o ‘estado da arte’ das sementes ‘crioulas’ no Rio Grande do Sul, possibilitando uma discussão sobre a biodiversidade de plantas cultivadas mantidas por agricultores que ainda utilizam sementes próprias, o diagnóstico sobre as causas da preferência por tais sementes, as dificuldades para sua manutenção e as estratégias desenvolvidas nas diferentes realidades locais para promoção do uso de tais recursos. Para levantar subsídios sobre tecnologia de sementes usadas p...

  13. Calidad de melón cantaloupe ( Cucumis melo cubierto con una película comestible de alginato - hpmc - parafina

    Directory of Open Access Journals (Sweden)

    Ma Concepción Reyes-Avalos

    2017-01-01

    Full Text Available Introducción : El melón es un fruto que tiene un corto periodo de almacenamiento. Una alternativa para extender este periodo es el uso de películas comestibles. En el presente estudio se evaluó el efecto de la aplicación de una película comestible de alginato de sodio - hidroxipropilmetilcelulosa - parafina (ALG - HPMC - PAR, sobre la calidad de melón Cantaloupe durante dos tipos de almacenamiento. Método : Frutos de melón Cantaloupe se cubrieron con una película comestible de alginato - hidroxipropilmetil celulosa - parafina (ALG - HPMC - PAR, y no cubiertos (CONTROL. Los melones se almacenaron por 21 días a 5ºC y 95% de humedad relativa (Hr. Cada siete días, los frutos se sometieron a análisis de índice de daños por frío, pérdida de peso, textura, y concentración de CO 2 y etileno d e la atmósfera interna del fruto. Además, para simular manejo comercial, al término de cada periodo de siete días en refrigeración, una muestra de melones era extraída del frigorífico y expuesta a condiciones ambientales de temperatura y humedad relativa ( 25ºC y 21 - 25% respectivamente durante tres días (almacenamiento combinado, y medidos los parámetros anteriormente mencionados. Resultados : La aplicación de la película comestible provocó que los frutos cubiertos tuvieran una mayor concentración de CO 2 y menor concentración de etileno en la atmósfera interna del fruto, contribuyendo a que los melones cubiertos mantuvieron su calidad por un mayor tiempo de almacenamiento, manteniéndose más firmes, con menor pérdida de peso y sufrir menor índice de daños por frío con respecto los frutos control. Discusión : Los resultados demuestran la factibilidad de la aplicación de películas comestibles para mantener la calidad del melón Cantaloupe almacenado en refrigeración y en almacenamiento combinado.

  14. Microbiological stability and quality of pulsed light treated cantaloupe (Cucumis melo L. reticulatus cv. Glamour) based on cut type and light fluence.

    Science.gov (United States)

    Koh, Pei Chen; Noranizan, Mohd Adzahan; Karim, Roselina; Nur Hanani, Zainal Abedin

    2016-04-01

    The aim of this study was to investigate the effect of cut type and pulsed light (PL) fluence on microbiological stability and quality of fresh-cut cantaloupes. Fresh-cut cantaloupes with various cut types (cuboid, triangular prism and sphere) were treated with PL technology at 6 J/cm(2). Samples were exposed to PL treatment at fluences of 2.7, 7.8, 11.7 and 15.6 J/cm(2) followed by storage at 4 ± 1 °C for 28 days. Microbiological quality, headspace composition, firmness, colour, pH, titratable acidity, total soluble solids, total phenolic content and ascorbic acid content of fresh-cut cantaloupes were determined. Spherical shape was found to be the most suitable shape for PL treatment of fresh-cut cantaloupes due to its significantly lowest (p ≤ 0.05) microbial counts before and after the PL treatment. No significant (p > 0.05) effect was observed for firmness, colour, total soluble solids and total phenolic content of fresh-cut cantaloupes throughout the storage study. Pulsed light treatment using 7.8 J/cm(2) was the best for extending shelf life of fresh-cut cantaloupes with extension of 8 days longer at 4 ± 1 °C compared to the control while maintaining the ascorbic acid content. In conclusion, PL treatment is a potential technique for extending the shelf life of fresh-cut cantaloupes by inactivating microorganisms without compromising the nutritional value.

  15. Evaluación de fungicidas convencionales e inductores de resistencia para el combate de mildiú velloso (Pseudoperonospora cubensis en melón (Cucumis melo

    Directory of Open Access Journals (Sweden)

    William Méndez Leiva

    2010-01-01

    Full Text Available El mildiú velloso, causado por el oomicete Pseudoperonospora cubensis (Berck & Curtis Rostovtsev, es una de las enfermedades más importantes en el cultivo de melón en Costa Rica. En la presente investigación se estudió el efecto de la aplicación de 2 fungicidas sistémicos convencionales, mefenoxam (1,96 kg i.a.ha-1 y dimethomorph (0,45 kg i.a.ha-1 y una secuencia de 2 fungicidas protectores, clorotalonil/mancozeb (2,01/1,20 kg i.a.ha-1, en combinación con 3 inductores de resistencia, fosfito (1,01 kg i.a.ha-1, menadiona bisulfito sodio (MBS (0,14 kg i.a.ha-1, acibenzolar-S-metil (ASM (0,02 kg i.a.ha-1, más un testigo sin fungicida y otro sin inductor, sobre la severidad de la enfermedad en el melón cv 'Ruidera'. Se encontraron diferencias significativas (p<0,05 en el área bajo la curva de progreso de la enfermedad entre los tratamientos fungicidas. La menor severidad se observó con los tratamientos clorotalonil/mancozeb y dimethomorph, en comparación con el mefenoxam. El fosfito fue el único inductor que resultó en diferencias significativas con respecto a los otros inductores y al testigo sin aplicación de inductores. No se determinaron interacciones estadísticamente significativas entre los fungicidas y los inductores de resistencia. El tratamiento que mostró la mayor eficiencia en el combate de la enfermedad fue clorotalonil/mancozeb+fosfito, con 4 aplicaciones de fungicidas y 2 del inductor de resistencia. Este tratamiento tuvo un costo económico menor que otros menos eficientes en el combate de la enfermedad.

  16. Evaluación de fungicidas convencionales e inductores de resistencia para el combate de mildiú velloso (Pseudoperonospora cubensis) en melón (Cucumis melo)

    OpenAIRE

    William Méndez Leiva; Luis Felipe Arauz; Rodrigo Ríos

    2010-01-01

    El mildiú velloso, causado por el oomicete Pseudoperonospora cubensis (Berck y Curtis) Rostovtsev, es una de las enfermedades más importantes en el cultivo de melón en Costa Rica. En la presente investigación se estudió el efecto de la aplicación de 2 fungicidas sistémicos convencionales, mefenoxam (1,96 kg i.a.ha-1) y dimethomorph (0,45 kg i.a.ha-1) y una secuencia de 2 fungicidas protectores, clorotalonil/mancozeb (2,01/1,20 kg i.a.ha-1), en combinación con 3 inductores de resistencia, fosf...

  17. Controlling the Sex of Flowers in Different Stages of Growth and Development of Melon (Cucumis melo var. reticualus L. with Ethephon Application

    Directory of Open Access Journals (Sweden)

    K. Arabsalmani

    2013-06-01

    Full Text Available To investigate the effect of ethephon on control of male flowers in melon, a split plot experiment, with randomized complete blocks design and three replications, was conducted in Agricultural and Natural Resources Research Center of Varamin, Iran, during 2005-2006. The main factor included three levels of plant growth stage (3-leaf, 6-leaf and early reproductive stage and sub-plots included four ethephon levels (0, 100, 200 and 300 mg/L. The appearance time of female flowers, number of male and female flowers (7 and 14 days after application of ethephon, total yield and female/male flowers ratio were evaluated. Results showed that plant response to increasing concentration of ethephon depends on plant growth stage. By using the ethephon concentrations of 100, 200 and 300 mg/L, the emergence of female flowers was delayed 6, 13 and 15 days, respectively, in comparison to control. The highest yield (26430 kg/ha was obtained with spraying of 200 mg/L ethephon in trifoliate plants. In this case, the ratio of female to male flowers was highest (81.5%. A high dose of ethephon (over 200 mg/L was associated with reduced yield and ratio of female to male flowers, at all stages of plant growth, especially in reproductive growth stage. The results this research showed that the beneficial effects of ethephon application is possible only if the right time is chosen with respect to plant growth.

  18. Grupos ganglionares superficiales

    OpenAIRE

    Cebrià Iranzo, M. Àngels

    2010-01-01

    Los grupos ganglionares son los puntos hacia los cuales se debe dirigir la linfa, y por lo tanto la dirección y el sentido de las manipulaciones del drenaje linfático manual. Estos se distribuyen por todo el cuerpo: cara y cuello, pecho, miembro superior, abdomen y miembro inferior.

  19. Grupo de trabajo: Unherpetos

    Directory of Open Access Journals (Sweden)

    Grupo de Trabajo Herpetología

    2000-12-01

    Full Text Available

    El grupo de Herpetología (Unherpetos surgió como una iniciativa de algunos estudiantes de Biología de la Universidad Nacional de Colombia como respuesta a la carencia de esfuerzos conjuntos en el estudio de los reptiles y de los anfibios. Hasta el momento, la información, así como los proyectos de investigación, han estado dispersos. Es evidente la necesidad de fomentar el trabajo interdisciplinario y el apoyo que los investigadores y personas interesadas puedan brindarse entre sí. También es cierto que al ser reconocidos formalmente como grupo de trabajo se facilitara la elaboración de proyectos vinculados a la Universidad Nacional de Colombia así como a otras instituciones.

  20. O "desenho de arquiteto" de João Cabral de Melo Neto

    Directory of Open Access Journals (Sweden)

    Rafaela Cardeal

    2015-12-01

    Full Text Available Tomando como ponto de partida a metáfora “desenho de arquiteto”, este ensaio aborda os aspectos arquitetônicos da poesia de João Cabral de Melo Neto. Para tal, propõe uma leitura retrospectiva da obra até o livro A educação pela pedra (1966, considerado pela crítica o mais arquitetônico da produção cabralina.

  1. Physiological maturity in gherkin (Cucumis anguria L.) seeds

    OpenAIRE

    Medeiros, Maria Aparecida de

    2009-01-01

    O objetivo do trabalho foi avaliar as modificações físicas e fisiológicas das sementes de maxixe (Cucumis anguria L.) durante o processo de maturação, as quais são aspectos importantes no que diz respeito à obtenção de sementes de alta qualidade e minimização de sua deterioração no campo. O experimento foi conduzido na Horta Didática e as análises realizadas no Laboratório de Análise de Sementes, Departamento de Ciências Vegetais, Universidade Federal Rural do Semi-Árido (UFERSA). As sementes...

  2. PHYSIOLOGY OF SEED MATURATION DE Maxixe (Cucumis L. anguria)

    OpenAIRE

    Medeiros, Maria Aparecida de

    2009-01-01

    O objetivo do trabalho foi avaliar as modificações físicas e fisiológicas das sementes de maxixe (Cucumis anguria L. durante o processo de maturação, as quais são aspectos importantes no que diz respeito à obtenção de sementes de alta qualidade e minimização de sua deterioração no campo. O experimento foi conduzido na Horta Didática e as análises realizadas no Laboratório de Análise de Sementes, Departamento de Ciências Vegetais, Universidade Federal Rural do Semi-Árido (UFERSA). As sementes ...

  3. Arsenic speciation in xylem sap of cucumber (Cucumis sativus L.).

    Science.gov (United States)

    Mihucz, Victor G; Tatár, Eniko; Virág, István; Cseh, Edit; Fodor, Ferenc; Záray, Gyula

    2005-10-01

    Flow injection analysis (FIA) and high-performance liquid chromatography double-focusing sector field inductively coupled plasma mass spectrometry (HPLC-DF-ICP-MS) were used for total arsenic determination and arsenic speciation of xylem sap of cucumber plants (Cucumis sativus L.) grown in hydroponics containing 2 micromol dm(-3) arsenate or arsenite, respectively. Arsenite [As(III)], arsenate [As(V)] and dimethylarsinic acid (DMA) were identified in the sap of the plants. Arsenite was the predominant arsenic species in the xylem saps regardless of the type of arsenic treatment, and the following concentration order was determined: As(III) > As(V) > DMA. The amount of total As, calculated taking into consideration the mass of xylem sap collected, was almost equal for both treatments. Arsenite was taken up more easily by cucumber than arsenate. Partial oxidation of arsenite to arsenate (nutrient solutions, which may explain the detection of arsenate in the saps of plants treated with arsenite.

  4. Efeito do tipo de corte nas características físico-químicas e microbiológicas do melão 'cantaloupe' (Cucumis melo L. Híbrido hy-Mark minimamente processado Effect of type of cutting on the physical chemical and microbiological characteristics of 'Cantaloupe' melon (Cucumis melo L. Hybrid hy-Mark minimally processed

    Directory of Open Access Journals (Sweden)

    Ariane Cordeiro de Oliveira

    2007-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito de dois tipos de cortes (manual e mecânico nas características físico-químicas e microbiológicas do melão 'Cantaloupe' minimamente processado e refrigerado. Frutos com grau de maturação adequado foram selecionados, lavados, sanificados (200 ppm de cloro ativo/2 minutos e processados de acordo com o tipo de corte. Os frutos utilizados para o corte mecânico foram descascados em máquina descascadora e após a retirada das sementes, submetidos ao corte com auxílio de máquina de corte. Os destinados ao corte manual foram descascados e cortados com auxílio facas, colocados em imersão em solução de hipoclorito de sódio (20 ppm de cloro ativo por 30 segundos e acondicionados em embalagens flexíveis PET, armazenados a 4°C ± 1°C e avaliados a cada três dias por um período de 15 dias. Ao final dos experimentos, concluiu-se que para o processamento mínimo de melão 'Cantaloupe', o corte manual foi o mais indicado, por apresentar melhor estabilidade das características de cor, textura, pH, umidade e contagens microbiológicas durante o armazenamento.The purpose of this work was to evaluate the effect of two types of cutting (manual and mechanic on the physical-chemical and microbiological characteristics of processed and refrigerated 'Cantaloupe' melon. The fruits in the appropriate stage of ripening were selected, washed, sanitized (200ppm of active chlorine/2 minutes and processed in agreement with types of cutting. The fruits used for the mechanical cutting were cutting in peeling machine and after at retreat of the seeds, submitted to the cutting with aid of cutting machine. The fruits destined at manual cutting were peeled and cut with aid of knives, immerged in chlorinated water (20 mg.L-1 of active chlorine for 30 seconds and conditioned in PET flexible packing, stored at 4°C ± 1°C and were carried out each three days during 15 days. At the end of the experiments it was concluded that for the minimally processed of 'Cantaloupe' melon, the manually cutting was the more indicated method, since it presented the best stability of characteristics concerning to color, firmness, pH, moisture and microbiological counting during storage.

  5. Conditional Clemency after the Golpe de Melo of 1854: Constitutionalism and Tradition in Early Republican Colombia

    Directory of Open Access Journals (Sweden)

    Joshua M. Rosenthal

    2017-01-01

    Full Text Available This article examines indultos after the Golpe de Melo of 1854. While the government hoped that these acts of clemency would erase all traces of the rebellion, a flood of appeals for indultos ensured that the post-war reckoning went on longer than the war itself. Drawing on archival and published material documenting this phenomenon, the article documents post-war politics in New Granada. The tension between popular ideals concerning pardonable behavior and the dispassionate constitutionalism promoted by the government documents the limits of the early republican project.

  6. Early Ukrainian-Belarusian-Polish traditional melo-massif: Interethnic wedding macro-areas

    Directory of Open Access Journals (Sweden)

    Klymenko Iryna

    2015-01-01

    Full Text Available Through rhythm-typological analysis and cartography the author has detected a similarity in the typological structure of early traditional musical forms belonging to agricultural and wedding genres on the territory which unites Ukraine, Belarus (within its ethnic area at the beginning of the 20th century, Eastern Poland (the Vistula river basin, and Lithuania (Dzūkija and Aukštaitija. This concerns several dozen song types, composed of items from a common grammatical base, forming the Ukrainian- Belarusian-Polish early-traditional melo-massif ‒ UBPEM. These types share interethnic (2-4-lingual areals, which do not correlate with linguistic ones.

  7. Single-crystal silicon beams formed by merged epitaxial lateral overgrowth (MELO) for optical reflectors

    Science.gov (United States)

    Neudeck, Gerold W.; Kabir, Abul E.

    1995-05-01

    Single crystalline silicon has very well known and predictable mechanical, optical, and electrical properties and is easily manufactured with consistent results. It is also integrated circuit compatible and leads to incorporation of circuits and high quality piezoresistors which are available to monitor motion for self-testing. We present for the first time a novel surface micro-machining process using merged epitaxial lateral overgrowth (MELO) silicon to demonstrate the fabrication of single crystal silicon, free standing cantilever beams 1 mm long and 5 micrometers X 10 micrometers in cross section. These beams had no evidence of stress related bending and were free from the substrate, returning to its original position after numerous electrostatic deflections. MELO has also shown great potential for advanced BJT and MOSFET device applications, hence active devices can be incorporated into the deflecting beam arrays. Diodes fabricated in the beams show excellent characteristics with average ideality factors of 1.01. Note that the technology permits adding of single crystal silicon to selected areas, hence it is an additive process as compared to traditional subtractive methods that deposit films over the entire wafer.

  8. Arsenic speciation in xylem sap of cucumber (Cucumis sativus L.)

    Energy Technology Data Exchange (ETDEWEB)

    Mihucz, Victor G. [Joint Research Group of Environmental Chemistry of the Hungarian Academy of Sciences and L. Eoetvoes University, Budapest (Hungary); Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); Tatar, Eniko [Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary); Virag, Istvan [L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary); Cseh, Edit; Fodor, Ferenc [L. Eoetvoes University, Department of Plant Physiology, Budapest (Hungary); Zaray, Gyula [Joint Research Group of Environmental Chemistry of the Hungarian Academy of Sciences and L. Eoetvoes University, Budapest (Hungary); Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary)

    2005-10-01

    Flow injection analysis (FIA) and high-performance liquid chromatography double-focusing sector field inductively coupled plasma mass spectrometry (HPLC-DF-ICP-MS) were used for total arsenic determination and arsenic speciation of xylem sap of cucumber plants (Cucumis sativus L.) grown in hydroponics containing 2 {mu}mol dm{sup -3} arsenate or arsenite, respectively. Arsenite [As(III)], arsenate [As(V)] and dimethylarsinic acid (DMA) were identified in the sap of the plants. Arsenite was the predominant arsenic species in the xylem saps regardless of the type of arsenic treatment, and the following concentration order was determined: As(III) > As(V) > DMA. The amount of total As, calculated taking into consideration the mass of xylem sap collected, was almost equal for both treatments. Arsenite was taken up more easily by cucumber than arsenate. Partial oxidation of arsenite to arsenate (<10% in 48 h) was observed in the case of arsenite-containing nutrient solutions, which may explain the detection of arsenate in the saps of plants treated with arsenite. (orig.)

  9. Grupo Focal em Pesquisas Sociais

    OpenAIRE

    Maria Lúcia Silva Servo; Pricila Oliveira Araújo

    2012-01-01

    Este artigo tem como objetivo discutir a técnica de grupo focal em pesquisas sociais. Apresenta-se as concepções sobre grupo focal. Traz-se os postulados de Pichon-Rivière sobre grupo operativo, os instrumentos de planificação, os vetores do campo grupal para nortear a dinâmica e a observação do campo grupal, bem como a organização, a operacionalização e a análise dos dados das sessões de grupo focal. Através desta técnica de coleta de dados em pesquisas sociais, é possível a construção do EC...

  10. El grupo y sus conflictos

    OpenAIRE

    Morales, J. Francisco; Yubero, Santiago

    1999-01-01

    La dinámica de las relaciones entre los grupos es la esencia de la vida social e, incluso, hay quienes piensan que no son las relaciones entre los grupos, sino los conflictos que se producen en ei marco de las relaciones grupaies los que nos dan las claves de la propia dinámica social. En este sentido, no es descabellado pensar que los conflictos grupaies aportan la energía necesaria para que tanto las organizaciones, como la propia sociedad muestren su actividad en...

  11. El conflicto entre grupos profesionales

    OpenAIRE

    Yubero, Santiago

    1999-01-01

    La dinámica de las relaciones entre los grupos es la esencia de la vida social e, incluso, hay quienes piensan que no son las relaciones entre los grupos, sino los conflictos que se producen en ei marco de las relaciones grupaies los que nos dan las claves de la propia dinámica social. En este sentido, no es descabellado pensar que los conflictos grupaies aportan la energía necesaria para que tanto las organizaciones, como la propia sociedad muestren su actividad en...

  12. Functional characterization of cucumber (Cucumis sativus L.) Clade V MLO genes

    NARCIS (Netherlands)

    Berg, Jeroen A.; Appiano, Michela; Bijsterbosch, Gerard; Visser, Richard G.F.; Schouten, Henk J.; Bai, Yuling

    2017-01-01

    Background: Powdery mildew (PM) causing fungi are well-known pathogens, infecting over 10.000 plant species, including the economically important crop cucumber (Cucumis sativus L.). Loss-of-function mutations in clade V MLO genes have previously been shown to lead to recessively inherited

  13. Asynchronous meiosis in Cucumis hystrix-cucumber synthetic tetraploids resulting in low male fertility

    Science.gov (United States)

    Wide hybridization is an important tool for crop improvement. Recently, we successfully developed a synthetic allotetraploid from interspecific cross between cucumber and its relative Cucumis hystrix-(2n = 2x =24) followed by chemical induction of chromosome doubling. The resulting allotetraploid wa...

  14. Pusaudžu melošana vecāku-pusaudžu mijiedarbības kontekstā

    OpenAIRE

    Lučkina, Jeļena

    2014-01-01

    Maģistra darba pētījuma mērķis bija apskatīt pusaudžu melošanu (dzimumatšķirības melošanas biežumā un tēmās), un noskaidrot kādas pastāv saistības starp pusaudžu melošanu un vecāku-pusaudžu attiecību aspektiem. Balstoties uz analizēto literatūru, tika izvirzīti četri pētījuma jautājumi: Vai pastāv dzimumatšķirības pusaudžu pašnovērtētajā melošanas biežumā un tēmās?; Kādas tēmas prevalē pusaudžu melošanā vecākiem?; Kādas sakarības pastāv starp pusaudžu melošanas biežumu un attiecību aspektiem ...

  15. The Effect of Different Cucurbit Rootstocks on Some Morphological and Physiological Traits of Cucumber (Cucumis sativus cv. Super Dominus

    Directory of Open Access Journals (Sweden)

    reihane Mesgari

    2017-02-01

    Full Text Available Introduction: Cucumber is one of the most important vegetable crops for the local consumption and exportation. The use of grafted vegetable seedlings has been popular in many countries during recent years. Growing fruit-bearing vegetables, chiefly tomato, cucumber and watermelon through grafted seedlings become a widespread practice worldwide. Grafting is a valuable technique to avoid soil-borne diseases, provide biotic and abiotic stress tolerance, enhance nutrient uptake, optimize water use, and increase fruit yield and quality. Vegetable grafting is a new topic in Iran and there are a limited number of studies on grafted vegetable production. However, attention to grafting by researchers has recently increased. Suitable rootstocks should be identified and characterized for the effective utilization of grafting. The rootstock's vigorous root system increases the efficiency of water and nutrient absorption, and may also serve as a source of endogenous plant hormones, thus leading to increased growth and yield in addition to disease control. In the present study, we investigated the response of two Cucurbita sp. and an Iranian melon as rootstocks for cucumber. Materials and methods: In order to study the effect of cucurbit rootstocks and grafting method on growth, yield and fruit quality of cucumber (Cucumis sativus cv. Super Dominus, an experiment was conducted as a factorial design in the base of RCBD with three replications in the greenhouse and research farm, University of Zanjan. Treatments were included three rootstocks (Cucurbita moschata L., Lagenaria siceraria and Cucumis melo L. and ungrafted plants (control and two grafting method (hole insertion and splice grafting. Seeds were sown simultaneously in plastic pots. For obtaining the same stem diameter of scion and rootstocks, cucumber seeds were planted four days earlier than rootstocks seeds. The seedlings were grown in an environment-controlled greenhouse with 25/20 day

  16. Trabalho em grupo com enlutados

    Directory of Open Access Journals (Sweden)

    Melissa Pascoal

    2012-12-01

    Full Text Available A cada dia temos mais famílias vivenciando o luto gerado por homicídios, acidentes e violência, e isso tem causado alguns problemas psicológicos para as pessoas que estão nesta situação. Este artigo é um relato da experiência profissional vivida no Hospital e Maternidade Mauá com um grupo de autoajuda para pacientes em processo de luto, e seu objetivo é compartilhar a experiência e difundir este trabalho. Em 15 encontros pré-estruturados de acordo com a demanda apresentada pelo próprio grupo, foi possível trabalhar diversos temas relacionados à perda que influenciaram as participantes e ao mesmo tempo proporcionaram, além de conforto, uma possibilidade de identificação e troca, e consequentemente o ressurgimento da autoconfiança. Por meio da articulação da teoria com a prática, é evidenciado que o atendimento em grupo para enlutados é uma alternativa viável que trouxe resultados positivos e inspiradores e sua divulgação é importante para ampliar horizontes e criar novas possibilidades.

  17. Taxonomía y distribución de Meloe (Eurymeloe saharensis Chobaut, 1898 (Coleoptera, Meloidae, con nuevas sinonimias y primeros registros para Europa y la Macaronesia

    Directory of Open Access Journals (Sweden)

    García-París, M.

    2010-06-01

    Full Text Available A small group of species of the genus Meloe related to M. saharensis Chobaut, 1898 stands out amongst the rarest species of the family Meloidae in the Mediterranean Basin. The taxonomic study of nine specimens (including type material of M. saharensis, M. otini Peyerimhoff, 1949 and M. vignai Bologna, 1990, allows us to conclude that previously reported specific differences between M. saharensis, M. otini and M. marianii Kaszab, 1983, particularly the appearance of the metanotum, fall within the variability of a single species. The study of a broader set of characters, including male genitalia, does not contribute to the separation of taxa except for M. vignai. Consequently, we propose the formal synonymy of M. marianii (syn. nov. and M. otini (syn. nov. with M. saharensis, and therefore this species complex is reduced to two taxa: M. saharensis and M. vignai. Specimens examined allow us to assign a broad geographic range to M. saharensis, which extends from Israel and Saudi Arabia to the Canary Islands (Tenerife, with presence in southeastern Spain and most of the northern African countries (Egypt, Tunisia, Algeria and Morocco. Despite its antiquity, dating back more than 80 years, the record of M. saharensis in Murcia represents the first known data about its presence in Europe.Entre las especies más raras de la familia Meloidae en la cuenca mediterránea destaca un pequeño grupo de especies del género Meloe relacionadas con M. saharensis Chobaut, 1898. El estudio taxonómico de nueve ejemplares (incluido el material tipo de M. saharensis, M. otini Peyerimhoff, 1949 y M. vignai Bologna, 1990, permite concluir que las diferencias específicas señaladas previamente entre M. saharensis, M. otini y M. marianii Kaszab, 1983, en especial la visibilidad del metanoto, entran dentro de la variabilidad de una única especie. El estudio de un conjunto más amplio de caracteres (incluida la genitalia masculina tampoco permite la separación de taxones

  18. Descripción de una especie nueva de Meloe Linnaeus, 1758 del subgénero Eurymeloe Reitter, 1911 (Coleoptera, Meloidae del norte de Marruecos

    Directory of Open Access Journals (Sweden)

    García-París, M.

    2009-12-01

    Full Text Available We describe a new species of Meloe (Coleoptera: Meloidae, subgenus Eurymeloe, included in the M. rugosus species group, related to species of the M. murinus subgroup. The specimens of the new species studied were found along the western Rif mountain chain (Talassemtane National Park in northwestern Morocco, and were located in hiperhumid montane forest habitats. The new species is characterized by having: a dull black coloration with greyish hue; a very short, curved, and not dense, yellow-whitish pilosity, which does not form tufts; a subrectangular transverse pronotum with a marked median grove and two longitudinal lateral depressions; head and pronotum punctures well impressed and subconfluent; elytra sligtly rugose; tarsomeres with slightly developed ventral pads; aedeagus with curved parameres, laterally depressed, apically pointed, with the distal ventral hook of median lobe close to apex. The new taxon es phenetically similar to M. nanus, M. baudueri and M. flavicomus, but distinguished from all of them by the mentioned morphological external and male genitalia characters. The distribution of the new species, only known from its type locality, overlaps those of M. murinus, M. nanus and possibly M. baudueri, but so far it has not been found in strict sympatry with any of them. The habitat type inhabited by the new species, mountain areas with mixed forests of Pinus pinaster hamiltonii var. maghrebiana, P. nigra mauritanica and Abies maroccana (endemic taxa of the limestone northwestern Rif mountain chain, contrasts with other habitat types recorded for species of the M. (E. murinus species subgroup of the subgenus Eurymeloe.Se describe una especie nueva de Meloe (Coleoptera: Meloidae del subgénero Eurymeloe, del grupo de M. rugosus, relacionada con especies del subgrupo de M. murinus. Los ejemplares estudiados de la especie nueva proceden del Rif occidental (Parque Nacional de Talassemtane, dorsal caliza rifeña, en el noroeste de

  19. O Sol Laranja e Negro de João Cabral de Melo Neto

    Directory of Open Access Journals (Sweden)

    Luciana Tiscoski

    2011-12-01

    Full Text Available O poeta pernambucano João Cabral de Melo Neto publica Sevilha andando em 1990, já aposentado da carreira diplomática que lhe possibilitou o contato com a cidade e o povo sevilhano, desde 1956, quando trabalha em pesquisas históricas no Arquivo das Índias de Sevilha. Após ter morado em cidades como Londres, Marselha e Barcelona, é transferido para a andaluza Cadiz, e novamente reside em Sevilha em 1962. Tendo ainda passado no decorrer de sua carreira diplomática por Berna, Senegal e Honduras, é a Andaluzia que se estabelece como lugar da linguagem poética e concreta, eleita Sevilha a cidade onde os elementos de sua poesia se realizam em lâmina, pedra, o sol laranja e negro, a mulher que anda. Sevilha andando e Andando Sevilha finalizam sua produção poética e reproduzem em serena e bruta semelhança o homem da terra que lhe remete ao sertanejo, a Pernambuco, a Recife.

  20. Screening of Furanone in Cucurbita melo and Evaluation of its Bioactive Potential Using In Silico Studies.

    Science.gov (United States)

    Singh, Nidhi; Sudandiradoss, C; Abraham, Jayanthi

    2016-12-01

    The work presented here attempts to screen for the presence of 4-Hydroxy-2,5-dimethyl-3(2H)-furanone in fruits and also any bioactive potential present in the fruit extracts. Curcurbita melo was selected for the study, and the fruit was crushed, filtered and extracted with ethyl acetate as the solvent. The resulting extract was subjected to disk diffusion test using Kirby Bauer method for checking its antimicrobial potential. Melon extract showed promising results against different clinical pathogens, 19-mm zone being the largest against Klebsiella pneumoniae and 17 mm against Shigella dysenteriae. GC-MS data of the melon extract confirmed the existence of furanone derivative in the extract. To evaluate the antimicrobial activity, in silico studies were performed using AutoDock 4.0 software, and topoisomerase was used as the target protein molecule for the isolated compound and 3-methyl-2-(2-oxopropyl)furan as the ligand. Further, the results were interpreted using PyMol and Ligplot plus softwares. The results confirmed the presence of molecular interactions between the protein molecule and the ligand. It can be envisaged that these interactions are responsible for the inhibitory effects of the extract .

  1. Grupos wallpaper e sua relação com cohomologia de grupos

    OpenAIRE

    Martins, Rafaella de Souza [UNESP

    2014-01-01

    O objetivo principal deste trabalho e estudar a relação entre cohomologia de grupos e o problema de classificar grupos wallpaper, que são grupos de simetrias de certas figuras do plano chamadas padrões wallpaper. Há, a menos de equivalência, exatamente 17 grupos wallpaper, que classificamos usando teoria dos grupos e algebra linear. Dado um grupo wallpaper G, temos associado inicialmente a G um subgrupo abeliano normal T (subgrupo das translações) chamado reticulado, um grupo G0 = G=T chamado...

  2. Spray dried melon seed milk powder: physical, rheological and sensory properties

    National Research Council Canada - National Science Library

    Zungur Bastıoğlu, Aslı; Tomruk, Dilara; Koç, Mehmet; Ertekin, Figen Kaymak

    2016-01-01

    Melon seed milk (MSM) powder was produced by aiming to get alternative vegetable milk from crushed Kırkağaç (Cucumis melo subsp. melo cv. Kırkağaç) and Çeşme (C. melo subsp. melo cv. Çeşme) type melon seeds...

  3. grupos virtuales de aprendizaje colaborativo

    Directory of Open Access Journals (Sweden)

    Ángel Torres Velandia

    2002-01-01

    Full Text Available Diversas experiencias de educación superior, virtual y a distancia, en las que hemos participado demuestran que la revolución tecnológica, en el contexto de la sociedad de la información, propicia cambios comunicacionales y educativos que favorecen la preparación profesional de cientos de jóvenes y adultos que, de otra manera, difícilmente llegarían a desarrollar autonomía e iniciativa propias para emprender y autodirigir procesos de aprendizaje personales, así como para trabajar en entornos virtuales colaborativos, mediante el uso racional y crítico de una variedad de herramientas y recursos técnicos y pedagógicos. Por lo que pretendemos: a analizar la naturaleza y aspectos básicos de las comunidades virtuales de aprendizaje (CVA y los grupos virtuales de aprendizaje colaborativo (GVAC, y b registrar los avances y las limitaciones de tres proyectos de investigación y desarrollo de la UAM-Xochimilco: 1 Red electrónica de la UAM para la formación virtual de tutores e investigadores de los sistemas de educación superior a distancia (SESAD. 2 Formación de docentes-tutores para la enseñanza y el aprendizaje en ambientes presenciales, virtuales y a distancia. 3 La experiencia de interacción y cooperación de dos tipos diferentes de grupos de aprendizaje: los del sistema modular de la UAM-Xochimilco y los de la Universitat Oberta de Catalunya, UOC.

  4. Chemical signature of two Permian volcanic ash deposits within a bentonite bed from Melo, Uruguay

    Directory of Open Access Journals (Sweden)

    Liane M. Calarge

    2006-09-01

    Full Text Available A Permian bentonite deposit at Melo, Uruguay is composed of a calcite-cemented sandstone containing clay pseudomorphs of glass shards (0-0.50 m overlying a pink massive clay deposit (0.50-2.10m. The massive bed is composed of two layers containing quartz and smectite or pure smectite respectively. The smectite is remarkably homogeneous throughout the profile: it is a complex mixed layer composed of three layer types whose expandability with ethylene glycol (2EG 1EG or 0EG sheets in the interlayer zone which correspond to low-, medium- and high-charge layers respectively varies with the cation saturating the interlayer zone. The smectite homogeneity through the profile is the signature of an early alteration process in a lagoonal water which was over saturated with respect to calcite. Compaction during burial has made the bentonite bed a K-depleted closed system in which diagenetic illitization was inhibited. Variations in major, REE and minor element abundances throughout the massive clay deposit suggest that it originated from two successive ash falls. The incompatible element abundances are consistent with that of a volcanic glass fractionated from a rhyolite magma formed in a subduction/collision geological context.Um depósito Permiano de bentonita em Melo, Uruguai,é composto por um arenito com cimento calcítico contendo pseudomorfos de argila sobre detritos vítreos(0-0.50 m superpostos a um deposito maciço de argila rosado (0.50-2.10 m. A camada maciça é composta por dois níveis contendo quartzo e esmectita ou esmectita pura, respectivamente. A homogeneidade de esmectita ao longo do perfil é notável: trata-se de um interestratificado composto de três tipos de camadas, cuja expansibilidade com etileno-glicol (folhas 2EG, 1EG ou 0EG na zona interfoliar correspondentes a camadas com baixa, média e alta carga, respectivamente variam com o tipo de cátion que satura a zona interfoliar. A homogeneidade da esmectita ao longo do perfil

  5. Efecto de la aplicación de bioactivadores y del raleo manual de frutos sobre el rendimiento y la calidad de melón (Cucumis melo L. bajo cultivo protegido en Costa Rica

    Directory of Open Access Journals (Sweden)

    Tania Alvarado-Sánchez

    2015-12-01

    Full Text Available Se evaluó el efecto del raleo manual de frutos y de la aplicación de los bioactivadores Algamix y Engordone sobre el rendimiento y la calidad del melón amarillo var. JMX-902. No se encontraron diferencias significativas con respecto a la firmeza del fruto, concentración de sólidos solubles totales, peso del fruto, rendimiento total, peso del fruto comercializable, rendimiento comercializable, y rendimiento por planta. Se encontraron diferencias significativas entre los tratamientos para el número de frutos por planta; las plantas tratadas con solo Engordone y solo Algamix presentaron mayor número de frutos por planta con respecto a otros tratamientos, pero estos resultados no fueron distintos de los del Testigo. Se encontraron diferencias significativas al distribuir la producción según distintas categorías de peso; el rendimiento de frutos de melón con un peso de entre 601-800 gramos fue superior en plantas tratadas con solo Algamix respecto a los demás tratamientos; el rendimiento de frutos de melón con un peso de entre 801-1000 gramos fue superior en plantas tratadas con solo Engordone respecto a los demás tratamientos.

  6. Protein (Viridiplantae): 854567 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 39:250 3650:250 ... 1003877:250 ... 3655:250 ... 3656:1543 ... PREDICTED: valencene synthase-like Cucumis melo MEVALASSGYELLSTISFVCMGDIATKEVFDWLFDCPKILKASTTISRLMDDVVSYKVVEESWTMVSIKFIYVSI

  7. A long peptide from MELOE-1 contains multiple HLA class II T cell epitopes in addition to the HLA-A*0201 epitope: an attractive candidate for melanoma vaccination.

    Science.gov (United States)

    Rogel, Anne; Vignard, Virginie; Bobinet, Mathilde; Labarriere, Nathalie; Lang, François

    2011-03-01

    CD4(+) T cells contribute importantly to the antitumor T cell response, and thus, long peptides comprising CD4 and CD8 epitopes may be efficient cancer vaccines. We have previously identified an overexpressed antigen in melanoma, MELOE-1, presenting a CD8(+) T cell epitope, MELOE-1(36-44), in the HLA-A*0201 context. A T cell repertoire against this epitope is present in HLA-A*0201+ healthy subjects and melanoma patients and the adjuvant injection of TIL containing MELOE-1 specific CD8(+) T cells to melanoma patients was shown to be beneficial. In this study, we looked for CD4(+) T cell epitopes in the vicinity of the HLA-A*0201 epitope. Stimulation of PBMC from healthy subjects with MELOE-1(26-46) revealed CD4 responses in multiple HLA contexts and by cloning responsive CD4(+) T cells, we identified one HLA-DRβ1*1101-restricted and one HLA-DQβ1*0603-restricted epitope. We showed that the two epitopes could be efficiently presented to CD4(+) T cells by MELOE-1-loaded dendritic cells but not by MELOE-1+ melanoma cell-lines. Finally, we showed that the long peptide MELOE-1(22-46), containing the two optimal class II epitopes and the HLA-A*0201 epitope, was efficiently processed by DC to stimulate CD4(+) and CD8(+) T cell responses in vitro, making it a potential candidate for melanoma vaccination.

  8. Functional characterization of cucumber (Cucumis sativus L.) Clade V MLO genes

    OpenAIRE

    Berg, Jeroen A.; Appiano, Michela; Bijsterbosch, Gerard; Visser, Richard G.F.; Schouten, Henk J.; Bai, Yuling

    2017-01-01

    Background Powdery mildew (PM) causing fungi are well-known pathogens, infecting over 10.000 plant species, including the economically important crop cucumber (Cucumis sativus L.). Loss-of-function mutations in clade V MLO genes have previously been shown to lead to recessively inherited broad-spectrum resistance to PM in several species. In cucumber, one clade V MLO homolog (CsaMLO8) was previously identified as being a susceptibility factor to PM. Two other closely related homologs (CsaMLO1...

  9. Safety Assessment of Cucumis sativus (Cucumber)-Derived Ingredients as Used in Cosmetics.

    Science.gov (United States)

    Fiume, Monice M; Bergfeld, Wilma F; Belsito, Donald V; Hill, Ronald A; Klaassen, Curtis D; Liebler, Daniel C; Marks, James G; Shank, Ronald C; Slaga, Thomas J; Snyder, Paul W; Andersen, F Alan

    2014-05-26

    The CIR Expert Panel assessed the safety of 6 Cucumis sativus (cucumber)-derived ingredients and found them safe in cosmetic formulations in the present practices of use and concentration. These ingredients are reported to function in cosmetics as skin-conditioning agents. Cucumber is a commonly consumed food with no history of significant adverse effects, suggesting that its ingredients should not pose any major safety issues following oral exposure. This assessment focused on the dermal exposure to the low concentrations of these ingredients as used in cosmetics. Some of the constituents of cucumbers have been assessed previously for safe use as cosmetic ingredients. © The Author(s) 2014.

  10. Presentación grupo AUROVA

    OpenAIRE

    Automática, Robótica y Visión Artificial

    2010-01-01

    Presentación del Grupo de Automática Robótica y Visión Artificial y descripción de algunos de sus proyectos para la industria. Vídeo realizado para presentar algunas actividades del grupo AUROVA relacionadas con la industria. Más información en http://aurova.ua.es/

  11. Investigation of the Use of "Cucumis Sativus" for Remediation of Chromium from Contaminated Environmental Matrices: An Interdisciplinary Instrumental Analysis Project

    Science.gov (United States)

    Butler, Lynsey R.; Edwards, Michael R.; Farmer, Russell; Greenly, Kathryn J.; Hensler, Sherri; Jenkins, Scott E.; Joyce, J. Michael; Mann, Jason A.; Prentice, Boone M.; Puckette, Andrew E.; Shuford, Christopher M.; Porter, Sarah E. G.; Rhoten, Melissa C.

    2009-01-01

    An interdisciplinary, semester-long project is presented in which students grow Cucumis sativus (cucumber) plants from seeds and study the ability of the plants to remediate a heavy metal from contaminated soil or water or both. Phytoremediation strategies for environmental cleanup are presented as possible alternatives to chemical based clean-up…

  12. Use of molecular markers aids in the development of diverse inbred backcross lines in Beit Alpha cucumber (Cucumis sativus L.)

    Science.gov (United States)

    Beit Alpha cucumber (Cucumis sativus L.) is a Mediterranean fresh-market type with a relatively narrow genetic base. To broaden its base for plant improvement, 42 diverse accessions were compared employing a previously defined standard marker array to choose wide-based parental lines for use in bac...

  13. Screening of Cucumis sativus as a new arsenic-accumulating plant and its arsenic accumulation in hydroponic culture.

    Science.gov (United States)

    Hong, Sun Hwa; Choi, Sun Ah; Yoon, Hyeon; Cho, Kyung-Suk

    2011-01-01

    Phytoextraction is a remediation technology with a promising application for removing arsenic (As) from soils and waters. Several plant species were evaluated for their As accumulation capacity in hydroponic culture amended with As. Cucumis sativus (cucumber) displayed the highest tolerance against As among 4 plants tested in this study (corn, wheat, sorghum and cucumber). The germination ratio of Cucumis sativus was more than 50% at the high concentration of 5,000 mg-As/l. In Cucumis sativus grown in a solution contaminated with 25 mg-As/l, the accumulated As concentrations in the shoot and root were 675.5 ± 11.5 and 312.0 ± 163.4 mg/kg, respectively, and the corresponding values of the translocation and bioaccumulation factors for As were 1.9 ± 0.9 and 21.1 ± 8.4, respectively. These results indicate Cucumis sativus is to be a candidate plant for phytoextraction of As from soils and water.

  14. Desenvolvimento larval de Macrobrachium birai Lobão, Melo & Fernandes (Crustacea, Decapoda, Caridea, Palaemonidae em laboratório Larval development of Macrobrachium birai Lobão, Melo & Fernandes (Decapoda, Caridea, Palaemonidae, under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Sonia Graça Melo

    2005-03-01

    Full Text Available Macrobrachium birai Lobão, Melo & Fernandes, 1986, espécie de camarão de água doce do Brasil, foi capturada no Rio Branco, Cananéia, Estado de São Paulo, Brasil. No início do desenvolvimento embrionário os ovos têm cor verde oliva e tamanho médio de 0,60 x 0,43 mm. As larvas foram criadas, individualmente, a temperatura média de 25ºC. O desenvolvimento larval de Macrobrachium birai é do tipo prolongado, constituído de 15 estágios morfológicos de zoea e o decapodito. A metamorfose foi atingida em 144 dias de cultivo, através de 44 ecdises. As mudas ocorreram em intervalos de dois a oito dias e em média com 3,3 dias. As larvas de M. birai possuem algumas características morfológicas que podem diferenciá-las das larvas de M. olfersii (Wiegmann, 1836.Macrobrachium birai Lobão, Melo & Fernandes, 1986, a native Brazilian species of freshwater shrimp, was captured along the coast of Rio Branco, Cananéia, state of São Paulo, Brazil. The eggs in early development were green and the average size was 0.60 x 0.43 mm. The larvae were reared in laboratory at average temperature of 25ºC. Macrobrachium birai has a prolonged larval development, with 15 morphological zoeal stages and the decapodito. The metamorphose was obtained in 144 days, through about 44 ecdysis. The molts occurred from two to eight days, in average of 3.3 days. The larvae of the M. birai present some morphological characteristics distinct from that of M. olfersii (Wiegmann, 1836.

  15. Cucumber volatile blend, a promising female‐biased lure for Bactrocera cucumis (French 1907) (Diptera: Tephritidae: Dacinae), a pest fruit fly that does not respond to male attractants

    National Research Council Canada - National Science Library

    Royer, Jane E; De Faveri, Stefano G; Lowe, Gail E; Wright, Carole L

    2014-01-01

    Bactrocera cucumis ( F rench 1907), the ‘cucumber fruit fly’, is a horticultural pest in A ustralia that primarily infests cucurbits and has also been recorded from tomatoes, papaw and several other hosts...

  16. Photosensitivity of Cucumber (Cucumis sativus L. Seedlings Exposed to Ultraviolet-B Radiation Fotosensibilidad de Plantines de Pepino de Ensalada (Cucumis sativus L. Expuestos a Radiación Ultravioleta del tipo B.

    Directory of Open Access Journals (Sweden)

    María Luisa Tapia F

    2010-03-01

    Full Text Available The intensity of ultraviolet-B radiation (UV-B has increased on the Earth´s surface due to the stratospheric ozone depletion, causing an adverse effect on a wide range of species, such as morphological, physiological, and biochemical alterations. This research studied the intraspecific photosensitivity of cucumber (Cucumis sativus L. seedlings exposed to UV-B. Six commercial cultivars were evaluated: Laura, Sprint 440, Dasher II, Exocet, Poinsett 76, and Marketmore 76 under greenhouse-controlled environmental conditions with a hydroponic sandwich-type system with a Hoagland II nutrient solution. Seedlings were irradiated from expanded cotyledons to the third true leaf with three intensities of UV-B radiation (30, 40, and 50 μW cm-2 for 18 d between 11:40-15:40 h. Seedling growth, morphology, accumulation of photosynthetic pigments, and absorbing UV-B pigments were evaluated. ‘Laura’ was the least affected by chlorosis and had a total absence of leaf curl, whereas ‘Poinsett 76’ was the most affected in the 40 and 50 μW cm-2 intensities. Both leaf area and seedling height of ‘Marketmore 76’ and ‘Poinsett 76’ had the lowest values. ‘Laura’ obtained the highest value in both fresh weight and dry weight. ‘Poinsett 76’ had the least amount of pigments absorbing UV-B and was 53% lower than that obtained by ‘Laura’. ‘Poinsett 76’ had lower chlorophyll and carotenoids. Parameters used were indicators of the seedling response to UV-B radiation, but could not be used for cucumber seedling sensitivity to UV-B radiation.La radiación ultravioleta tipo B (UV-B ha ido aumentando su intensidad a nivel de la superficie terrestre producto de la disminución del ozono estratosférico, provocando efectos negativos en una amplia gama de especies, observándose alteraciones morfológicas, fisiológicas y bioquímicas. En este trabajo se estudió la fotosensibilidad intraespecífica de plantines de pepino de ensalada (Cucumis sativus

  17. GRUPOS DE INVESTIGACIÓN FACULTAD DE CIENCIAS

    Directory of Open Access Journals (Sweden)

    VICTOR IGNACIO LÓPEZ RÍOS

    2016-07-01

    de investigacion de la Escuela de Fsica con la informacion de los ultimos dos a~nos (nombre del grupo de investigacion, lder del grupo, integrantes, proyectos vigentes y publicaciones recientes asociadas al grupo, entre otros aspectos.

  18. Antimicrobial Activity of Sphingolipids Isolated from the Stems of Cucumber (Cucumis sativus L.

    Directory of Open Access Journals (Sweden)

    Zhu Yu

    2010-12-01

    Full Text Available Three antimicrobial sphingolipids were separated by bioassay-guided isolation from the chloroform fraction of the crude methanol extract of cucumber (Cucumis sativus L. stems and identified as (2S,3S,4R,10E-2-[(2'R-2-hydroxytetra-cosanoylamino]-1,3,4-octadecanetriol-10-ene (1, 1-O-β-D-glucopyranosyl(2S,3S,4R,10E-2-[(2'R-2-hydroxy-tetracosanoylamino]-1,3,4-octadecanetriol-10-ene (2 and soya-cerebroside I (3 by their physicochemical properties and spectroscopic analysis. They were evaluated to show antifungal and antibacterial activity on test microorganisms including four fungal and three bacterial species. Among them, compound 1, a relatively low polarity aglycone,  exhibited stronger antimicrobial activity than its corresponding glycoside 2. The results indicated that sphingolipids could be the main antimicrobial compounds in the crude methanol extract of cucumber stems.

  19. Optical properties of the iridescent organ of the comb-jellyfish Beroë cucumis (Ctenophora)

    Science.gov (United States)

    Welch, Victoria; Vigneron, Jean Pol; Lousse, Virginie; Parker, Andrew

    2006-04-01

    Using transmission electron microscopy, analytical modeling, and detailed numerical simulations, the iridescence observed from the comb rows of the ctenophore Beroë cucumis was investigated. It is shown that the changing coloration which accompanies the beating of comb rows as the animal swims can be explained by the weakly-contrasted structure of the refractive index induced by the very coherent packing of locomotory cilia. The colors arising from the narrow band-gap reflection are shown to be highly saturated and, as a function of the incidence angle, cover a wide range of the visible and ultraviolet spectrum. The high transparency of the structure at the maximal bioluminescence wavelength is also explained.

  20. Histopathology combined with transcriptome analyses reveals the mechanism of resistance to Meloidogyne incognita in Cucumis metuliferus.

    Science.gov (United States)

    Ye, De-You; Qi, Yong-Hong; Cao, Su-Fang; Wei, Bing-Qiang; Zhang, Hua-Sheng

    2017-05-01

    Root-knot nematodes (Meloidogyne spp.) cause serious threat to cucumber production. Cucumis metuliferus, a relative of cucumber, is reported to be resistant to Meloidogyne incognita, yet the underlying resistance mechanism remains unclear. In this study, the response of resistant C. metuliferus accession PI482443 following nematode infection was studied in comparison with susceptible C. sativus cv. Jinlv No.3. Roots of selected Cucumis seedings were analysed using histological and biochemical techniques. Transcriptome changes of the resistance reaction were investigated by RNA-seq. The results showed that penetration and development of the nematode in resistant plants were reduced when compared to susceptible plants. Infection of a resistant genotype with M. incognita resulted in a hypersensitive reaction. The induction of phenylalanine ammonia lyase and peroxidase activities after infection was greater in resistant than susceptible roots. Several of the most relevant genes for phenylpropanoid biosynthesis, plant hormone signal transduction, and the plant-pathogen interaction pathway that are involved in resistance to the nematode were significantly altered. The resistance in C. metuliferus PI482443 to M. incognita was associated with reduced nematode penetration, retardation of nematode development, and hypersensitive necrosis. The expression of genes resulting in the deposition of lignin, toxic compounds synthesis, cell wall reinforcement, suppression of nematode feeding and resistance protein accumulation, and activation of several transcription factors might all contribute to the resistance response to the pest. These results may lead to a better understanding of the resistance mechanism and aid in the identification of potential targets resistant to pests for cucumber improvement. Copyright © 2017 Elsevier GmbH. All rights reserved.

  1. DOBRAS ESTRUTURAIS: RUPTURA GENERATIVA EM GRUPOS SOBREPOSTOS

    Directory of Open Access Journals (Sweden)

    David Stark

    2010-04-01

    Full Text Available Os grupos empresariais enfrentam um desafio duplo: reconhecer e implementar novas ideias. O presente artigo sugere que oempreendedorismo está mais relacionado com a geração de novos conhecimentos, por meio da recombinação de recursos, doque com a importação de ideias. Em contraste com a perspectiva “intermediação mais fechamento”, enfocamos a sobreposiçãode estruturas coesas de grupos. Ao analisar processos de intercoesão de redes, identificamos uma topologia de rede distinta:a dobra estrutural. Os atores de uma dobra estrutural são membros de múltiplos grupos, o que facilita o acesso familiar a diversosrecursos. Nosso conjunto de dados permite observar laços pessoais entre as 1.696 maiores empresas húngaras de 1987a 2001. Primeiro, testamos se dobras estruturais contribuem para o desempenho de grupos. Segundo, como o empreendedorismoé um processo de ruptura generativa, testamos a contribuição das dobras estruturais para a instabilidade do grupo.Terceiro, passamos de métodos dinâmicos à análise histórica de redes, e demonstramos que a coerência é uma propriedadede genealogias entrelaçadas de coesão, construídas por meio de repetidas separações e reunificações.

  2. El conflicto en los grupos de trabajo

    OpenAIRE

    Munduate, Lourdes; Dorado, Miguel Ángel

    1999-01-01

    La dinámica de las relaciones entre los grupos es la esencia de la vida social e, incluso, hay quienes piensan que no son las relaciones entre los grupos, sino los conflictos que se producen en ei marco de las relaciones grupaies los que nos dan las claves de la propia dinámica social. En este sentido, no es descabellado pensar que los conflictos grupaies aportan la energía necesaria para que tanto las organizaciones, como la propia sociedad muestren su actividad en...

  3. O papel de coordenador de grupos

    Directory of Open Access Journals (Sweden)

    Andaló Carmen Silvia de Arruda

    2001-01-01

    Full Text Available Os trabalhos com grupos, instrumental valioso nos espaços institucionais, vêm sofrendo um processo de banalização de cunho tecnicista. Este artigo pretende ser uma contribuição à reflexão sobre a coordenação de grupos. Afasta-se dos estudos sobre a personalidade dos coordenadores, propondo seu entendimento como o de mediadores entre o nível vivencial e a compreensão crítica. Isso aponta seu caráter constitutivo nos processos grupais.

  4. Grupos vivenciais sob uma perspectiva junguiana

    OpenAIRE

    Laura Villares de Freitas

    2005-01-01

    Este artigo tece considerações quanto à possibilidade e ao alcance de grupos vivenciais, sob a perspectiva da Psicologia Analítica de Carl G. Jung, em nosso contexto socio-econômico atual. Há uma proposta prática de grupos de construção de máscaras e personagens, e a apresentação e comentários das contribuições de diferentes autores que trazem conceitos junguianos clássicos para a dimensão grupal, consideram de maneira criativa o ritual, do ponto de vista psicológico, e questionam a viabilida...

  5. Comparative Efficacy of Insecticides on Bactrocera tryoni and Zeugodacus cucumis (Diptera: Tephritidae) in Laboratory and Semifield Trials in Fruiting Vegetables.

    Science.gov (United States)

    Senior, L J; Missenden, B P; Wright, C

    2017-08-01

    In-field management of Bactrocera tryoni (Froggatt) and Zeugodacus cucumis (French) (Diptera: Tephritidae) in fruiting vegetable crops has relied almost exclusively on organophosphate cover sprays. Laboratory and semifield trials were performed to compare a number of alternative insecticides for efficacy against these species. A novel semifield method was used whereby the insecticides were applied to crops as cover sprays under field conditions, and treated plants bearing fruit were transferred to large cages and exposed to fruit flies. Efficacy was assessed in terms of numbers of pupae developing from treated fruit. A laboratory cage method was also used to assess effects on adult mortality and comparative effects of 1- and 3-d-aged residues. The neonicotinoids clothianidin and thiacloprid were very effective against B. tryoni and Z. cucumis. Clothianidin was the only insecticide other than dimethoate to affect adult mortality. The synthetic pyrethroid alpha-cypermethrin was also very effective, particularly in semifield trials, although higher incidence of aphid and whitefly infestation was observed in this treatment compared to others. Cyantraniliprole was effective against B. tryoni, but less effective against Z. cucumis. Imidacloprid, bifenthrin, spinetoram, and abamectin were all relatively less effective, although all demonstrated a suppressive effect. © Commonwealth of Australia, Department of Agriculture and Fisheries, 2017.

  6. Os sentidos da festa: Mário Melo e as escolas de samba no carnaval recifense (1955-1956 = The senses of the feast: Mario Melo and the samba schools in Recife carnival (1955-1956

    Directory of Open Access Journals (Sweden)

    Silva, Augusto Neves

    2016-01-01

    Full Text Available O presente trabalho tem por objetivo analisar quais os motivos que levaram o jornalista Mário Melo, importante membro da intelectualidade pernambucana, e alguns de seus congêneres, a criticar a presença das escolas de samba no Carnaval do Recife. Por que para o referido intelectual o samba não poderia coexistir em meio a outras práticas culturais da folia recifense? Qual o sentido de tradição que estava defendendo para o festejo? O que estava em jogo para que o samba fosse condenado? Ao se procurar responder a essas perguntas, evidenciou-se uma cidade que se colocava em disputa pelo formato de festa desejado. E dar visibilidade a estes conflitos é compreender, naqueles "alegres" dias de Momo, não um campo de consenso harmônico, mas um meio de efetivação de embates entre diferentes práticas e tradições a serem legitimadas

  7. Grupos vivenciais sob uma perspectiva junguiana

    Directory of Open Access Journals (Sweden)

    Laura Villares de Freitas

    2005-09-01

    Full Text Available Este artigo tece considerações quanto à possibilidade e ao alcance de grupos vivenciais, sob a perspectiva da Psicologia Analítica de Carl G. Jung, em nosso contexto socio-econômico atual. Há uma proposta prática de grupos de construção de máscaras e personagens, e a apresentação e comentários das contribuições de diferentes autores que trazem conceitos junguianos clássicos para a dimensão grupal, consideram de maneira criativa o ritual, do ponto de vista psicológico, e questionam a viabilidade de trabalhos grupais. Numa abordagem mitológica, são considerados Górgona, Dioniso, Ártemis, Eco e Narciso, com destaque à deusa grega Héstia, cujas características são relacionadas a aspectos necessariamente presentes nos grupos vivenciais e à possibilidade de ocorrer uma experiência psicológica. Os grupos vivenciais são considerados favorecedores da perspectiva de alteridade, na medida em que cada participante tem neles a oportunidade de se afirmar e de ser confirmado, isto é, de se expressar e de refletir, num campo interacional fértil.

  8. An integrated molecular cytogenetic map of Cucumis sativus L. chromosome 2

    Directory of Open Access Journals (Sweden)

    Huang Sanwen

    2011-01-01

    Full Text Available Abstract Background Integration of molecular, genetic and cytological maps is still a challenge for most plant species. Recent progress in molecular and cytogenetic studies created a basis for developing integrated maps in cucumber (Cucumis sativus L.. Results In this study, eleven fosmid clones and three plasmids containing 45S rDNA, the centromeric satellite repeat Type III and the pericentriomeric repeat CsRP1 sequences respectively were hybridized to cucumber metaphase chromosomes to assign their cytological location on chromosome 2. Moreover, an integrated molecular cytogenetic map of cucumber chromosomes 2 was constructed by fluorescence in situ hybridization (FISH mapping of 11 fosmid clones together with the cucumber centromere-specific Type III sequence on meiotic pachytene chromosomes. The cytogenetic map was fully integrated with genetic linkage map since each fosmid clone was anchored by a genetically mapped simple sequence repeat marker (SSR. The relationship between the genetic and physical distances along chromosome was analyzed. Conclusions Recombination was not evenly distributed along the physical length of chromosome 2. Suppression of recombination was found in centromeric and pericentromeric regions. Our results also indicated that the molecular markers composing the linkage map for chromosome 2 provided excellent coverage of the chromosome.

  9. [Role of phytochrome in organ formation processes in Cucumis sativus L].

    Science.gov (United States)

    Sysoeva, M I; Marovskaia, E F

    2013-01-01

    The role of phytochrome B in the organogenesis process in the apical and axillary shoot meristems during early ontogenesis stages in cucumber Cucumis sativus L. at photoperiods (day/night) 10/14, 16/8 h, and continuous light in comparison with wild type plants and phytochrome B-deficient mutant (lh-mutant) was investigated. In mutant phytochrome B, deficiency caused inhibition of initiation of leaves both in the leading shoot and off-shoots and increased the number of flower buds (IV stage of organogenesis). With continuous light, the number of off-shoots and flowers during stage IV of organogenesis in wild-type plants increased twofold in comparison with the mutant. Short-term temperature drops did not induce floral ontogenesis in mutants but increased the number of off-shoots in both experimental variants during a long photoperiod and continuous light situations. We propose that phytochrome B, by increasing the compactness of chromatin, may facilitate coordination of ontogenesis processes with changing environmental conditions.

  10. Herbivory differentially affects male and female reproductive traits of Cucumis sativus.

    Science.gov (United States)

    Thomson, V P; Nicotra, A B; Cunningham, S A

    2004-09-01

    Herbivory is an important selection pressure in the life history of plants. Most studies use seed or fruit production as an indication of plant fitness, but the impact of herbivory on male reproductive success is usually ignored. It is possible that plants compensate for resources lost to herbivory by shifting the allocation from seed production to pollen production and export, or vice versa. This study examined the impact of herbivory by Helix aspersa on both male and female reproductive traits of a monoecious plant, Cucumis sativus. The effects of herbivory on the relative allocation to male and female flowers were assessed through measurements of the number and size of flowers of both sexes, and the amount of pollinator visitation. We performed two glasshouse experiments; the first looked at the impact of three levels of pre-flowering herbivory, and the second looked at four levels of herbivory after the plants had started to flower. We found that herbivory during the flowering phase led to a significant increase in the number of plants without male flowers. As a consequence there was significantly less pollen export from this population, as estimated by movement of a pollen analog. The size of female flowers was reduced by severe herbivory, but there was no affect on pollen receipt by the female flowers of damaged plants. The decrease in allocation to male function after severe herbivory may be adaptive when male reproductive success is very unpredictable.

  11. INFLUENCIA DE LA DENSIDAD DE SIEMBRA Y LA PODA EN EL CULTIVO DEL PEPINO (Cucumis sativus

    Directory of Open Access Journals (Sweden)

    Paublo Javier Bravo Bravo

    2011-12-01

    Full Text Available El objetivo de la investigación fue determinar la influencia de la densidad de siembra y el número de poda de ejes en el cultivo de pepino (Cucumis sativus. Se estudiaron tres distancias de siembra 1.0x0.2, 1.0x0.4 y 1.0x 0.6 m y la poda de ejes productivos dejando 1, 2 y 3 ejes por planta. La poda se realizó a los 30 días después del trasplante. Se evaluaron las características del fruto de diámetro (cm, longitud (cm, peso (g, fruto por planta y rendimiento por hectárea. Los tratamientos se distribuyeron en un diseño de bloques al azar y los datos se analizaron mediante análisis de varianza. Se obtuvo diferencias para la variable rendimiento/hectárea con respecto al resto de las variables evaluadas.

  12. Genome-wide identification, characterization, and expression analysis of the MLO gene family in Cucumis sativus.

    Science.gov (United States)

    Zhou, S J; Jing, Z; Shi, J L

    2013-12-11

    Mildew resistance locus o (MLO) is a plant-specific seven-transmembrane (TM) gene family. Several studies have revealed that certain members of the MLO gene family mediate powdery mildew susceptibility in three plant species, namely, Arabidopsis, barley, and tomato. The sequenced cucumber genome provides an opportunity to conduct a comprehensive overview of the MLO gene family. Fourteen genes (designated CsMLO01 through CsMLO14) have been identified within the Cucumis sativus genome by using an in silico cloning method with the MLO amino acid sequences of Arabidopsis thaliana and rice as probes. Sequence alignment revealed that numerous features of the gene family, such as TMs, a calmodulin-binding domain, peptide domains I and II, and 30 important amino acid residues for MLO function, are well conserved. Phylogenetic analysis of the MLO genes from cucumber and other plant species reveals seven different clades (I through VII). Three of these clades comprised MLO genes from A. thaliana, rice, maize, and cucumber, suggesting that these genes may have evolved after the divergence of monocots and dicots. In silico mapping showed that these CsMLOs were located on chromosomes 1, 2, 3, 4, 5, and 6 without any obvious clustering, except CsMLO01. To our knowledge, this paper is the first comprehensive report on MLO genes in C. sativus. These findings will facilitate the functional characterization of the MLOs related to powdery mildew susceptibility and assist in the development of disease resistance in cucumber.

  13. Optimization of factors influencing in vitro flowering of gherkin (Cucumis anguria L.).

    Science.gov (United States)

    Thiruvengadam, M; Chung, I M

    2014-03-01

    This study investigated the factors influencing in vitro flowering of gherkin (Cucumis anguria L.). Multiple shoots were efficiently regenerated from cotyledonary node and axillary bud explants of C. anguria within 15 days on MSB5 medium containing 3% sucrose and supplemented with 1.5 mg l-1 6-benzyladinine (BA). The elongated shoots were excised and transferred to MSB5 medium containing 4% sucrose supplemented with 0.5 mg l(-1) gibberellic acid (GA(3)) and 1.0 mg l(-1) indole-3-butyric acid (IBA) induced maximum number of flowers (9.5 flowers/plant) and root induction (16.5 roots/plant). Factors that influence the in vitro flowering were optimizing pH, photoperiod and temperature. In vitro flowering was significantly early and higher number of flowers produced at pH (5.8), photoperiod (12/12 h) and room temperature (28 °C). In vitro developed flowers were less viable (80 ± 1.0%) compared to control plants (90 ± 2.0%). Our in vitro flower induction procedures provide an extremely effective method for further research on flowering regulation mechanisms in C. anguria. These plantlets were successfully transferred to the soil where they grew well for 3 to 5 weeks with 90% survivability. Plants grew normally and produced flowers with viable pollen and fertile seeds.

  14. EFFECTS OF SALICYLIC ACID ON SEEDLING GROWTH AND NITROGEN METABOLISM IN CUCUMBER (CUCUMIS SATIVUS L.

    Directory of Open Access Journals (Sweden)

    Singh Pramod Kumar

    2010-09-01

    Full Text Available Salicylic acid is involved in the regulation of metabolic activity and defense mechanism in plants under various stress conditions. Present study was conducted to determine the effects of salicylic acid (10 to 500 μM on seedling growth, development and nitrogen use efficiency in cucumber (Cucumis sativus L. plants with or without nitrogen nutrient. Salicylic acid increased contents of chlorophyll, total non-structural carbohydrate and total nitrogen, as well as nitrate assimilation through the induction of nitrate reductase (EC 1.6.6.1 activity in isolated cucumber cotyledons. Accumulation of salicylic acid was two-fold higher in cotyledons without nitrate supply in comparison to that with nitrate supply. Further 50 μM of SA induced enhancement in seed germination and growth characteristics. However higher salicylic acid concentrations inhibited above physiological characteristics. Results show that, field application of salicylic acid need optimum physiological concentration (e.g., 50 μM to increase nitrogen use efficiency particularly during germination and seedling growth.

  15. The preface by João Cabral de Melo Neto to Em Va Fer Joan Brossa: Theory and practice of realism in two poets from the post-war.

    Directory of Open Access Journals (Sweden)

    Melcion Mateu

    2009-12-01

    Full Text Available In 1951, the book Em va fer Joan Brossa [Joan Brossa  Made me] was published in Barcelona, with a preface by João Cabral de Melo Neto. It is a useful text to better understand Brossa as well as Cabral; it is a significant text in order to grasp the individual response of these poets to the problem of returning to realism for the early post-war period. A translation of João Cabral de Melo Neto's preface, previously unpublished in Portuguese, is presented here.

  16. O Melos e Harmonia Acústica (1988) de César Guerra-Peixe, Koellreutter e Hindemith: similaridades e princípios básicos

    OpenAIRE

    Hartmann,Ernesto

    2013-01-01

    O Melos e Harmonia Acústica de César GUERRA-PEIXE (1988) apresenta um compêndio da atividade didática deste compositor expresso em forma de apostila. O presente trabalho busca traçar as possíveis influências comparando-o ao Caderno de Estudos com Koellreutter do próprio GUERRA-PEIXE (1944) e ao The Craft of Musical Composition de Paul HINDEMITH (1937), visando compreender melhor os pressupostos técnicos e teóricos.

  17. Experiencia educativa con Grupos de Facebook

    OpenAIRE

    Gómez, María Florencia

    2016-01-01

    Para continuar con el tema de este mes sobre relatos de experiencias educativas innovadoras con tecnologías, en esta publicación presentaré algunos beneficios de trabajar con Grupos Facebook para el seguimiento de un trabajo práctico grupal en la asignatura de grado Seminario de Psicología Experimental (Fac. de Psicología, UNLP). Dicha actividad consiste en el armado progresivo de una propuesta de investigación conforme se introducen las temáticas metodológicas en cada una de las clases. Asim...

  18. Trabajo en grupos en el aula universitaria

    OpenAIRE

    Blotto, Bettina Graciela; Ramírez, Stella Maris

    2016-01-01

    Pensar hoy en equipos de trabajo para organizar las clases en el nivel universitario, no significa imaginar conjuntos de estudiantes que se reúnen con intención de leer una guía de estudio y completarla. Coincidiendo con López Noguero (2007), el docente universitario debe trabajar colaborativamente con los grupos de estudiantes, realizando un giro significativo desde diferentes puntos de vista (pedagógico, epistemológico y psicosocial), recurriendo a la búsqueda de nuevas estrategias que tome...

  19. Inmunidad de grupo. Significado e importancia

    OpenAIRE

    Vaqué Rafart, Josep

    2005-01-01

    En los últimos veinte años el concepto de “inmunidad de grupo” ha adquirido gran relevancia debido a su utilidad para definir los objetivos y estrategias de los programas de vacunación, pues permite determinar la intensidad de las actuaciones a aplicar para impedir brotes epidémicos y para controlar y eliminar enfermedades infecciosas. Su definición clásica, establecida por Fox en 1971, dice: "Es la resistencia de un grupo a una infección ante la que una amplia proporción de individuos posee ...

  20. Grupos de formação

    OpenAIRE

    Fernandes, Sonia Cristina Lima

    2000-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Educação. A proposta deste trabalho foi compreender os sentidos e significados formulados pelos professores da Educação Infantil da Rede Municipal de Florianópolis acerca de sua própria formação na experiência de formação em serviço por eles vivenciado nos Grupos de Formação, entre 1994 e 1996, no Governo da Frente Popular. Foram investigados os documentos gerados pela Secretaria Municipal de Educação re...

  1. Antidiabetic and antioxidant potency evaluation of different fractions obtained from Cucumis prophetarum fruit.

    Science.gov (United States)

    Gawli, Kavishankar; Lakshmidevi, N

    2015-05-01

    Cucumis prophetarum Linn. (Cucurbitaceae) fruit is used for inflammatory-related problems and is proved to be possessing anticancer and hepatoprotective effects. The present investigation was to study the effect of different fractions of C. prophetarum on antidiabetic and antioxidant activity. Aqueous crude extract (CE) of C. prophetarum fruits was fractionated into water soluble fraction 1 (F1), chloroform fraction 2 (F2), basic fraction 3 (F3), and neutral fraction 4 (F4) by acid-base extraction. CE and its fractions at different doses (0.02-0.1 mg/mL) were subjected to antidiabetic (α-amylase and α-glucosidase inhibition assays) and antioxidant (DPPH, superoxide radical scavenging (SO) and metal chelation) evaluation. F1 exhibited effective antidiabetic activity (p F4 > F3 > F2, according to α-amylase assay, which were the same, with the exception of the rank order of F4 and CE, as the α-glucosidase assay. Furthermore, F1 (IC50 = 73 µg/mL) showed better reducing ability than CE >F4 >F2 > F3 (IC50 = 78-272 µg/mL), according to the DPPH assay. In SO and metal chelation assays, F1 showed the highest activity (IC50 = 101 and 147 µg/mL), respectively; the activity decreased in the order of CE >F4 >F3 > F2 (IC50 = 126-469 µg/mL) for SO and 194-944 µg/mL for metal chelation assay. The results indicate that F1 possesses potent in vitro antidiabetic and antioxidant activities.

  2. Effects of ultraviolet-B radiation on fungal disease development in Cucumis sativus

    Energy Technology Data Exchange (ETDEWEB)

    Orth, A.B.; Teramura, A.H.; Sisler, H.D. (Univ. of Maryland, College Park (USA))

    1990-09-01

    Stratospheric ozone depletion due to increased atmospheric pollutants has received considerable attention because of the potential increase in ultraviolet-B (UV-B, 280-320 nm) radiation that will reach the earth's surface. Three cucumber (Cucumis sativus L.) cultivars were exposed to a daily dose of 11.6 kJ m{sup {minus}2} biologically effective ultraviolet-B (UV-B{sub BE}) radiation in an unshaded greenhouse before and/or after injection by Colletotrichum lagenarium (Pass.) Ell. and Halst. or Cladosporium cucumerinum Ell. and Arth. and analyzed for disease development. Two of these cultivars, Poinsette and Calypso Hybrid, were disease resistant, while the third cultivar, Straight-8, was disease susceptible. Preinfectional treatment of 1 to 7 days with UV-B{sub BE} in Straight-8 led to greater severity of both diseases. Postinfectional UV treatment did not lead to increased disease severity caused by C. lagenarium, while preinfectional UV treatment in both Straight-8 and Poinsette substantially increased disease severity. Although resistant cultivars Poinsette and Calypso Hybrid showed increased anthracnose disease severity when exposed to UV-B, this effect was apparent only on the cotyledons. Both higher spore concentration and exposure to UV-B radiation resulted in greater disease severity. Of the cucumber cultivars tested for UV-B sensitivity, growth in Poinsette was most sensitive and Calypso Hybrid was least sensitive. These preliminary results indicate that the effects of UV-B radiation on disease development in cucumber vary depending on cultivar, timing and duration of UV-B exposure, inoculation level, and plant age.

  3. Occidental diffusion of cucumber (Cucumis sativus) 500–1300 CE: two routes to Europe

    Science.gov (United States)

    Paris, Harry S.; Daunay, Marie-Christine; Janick, Jules

    2012-01-01

    Background The cucumber, Cucumis sativus, is one of the most widely consumed fruit vegetables the world over. The history of its dispersal to the Occident from its centre of origin, the Indian subcontinent, has been incorrectly understood for some time, due to the confusion of cucumbers with vegetable melons. Iconographic and literary evidence has shown that cucumber was absent in Roman times, up to 500 CE, but present in Europe by late medieval times, 1300. The objective of the present investigation was to determine more accurately when the cucumber arrived in Europe and by what route. Findings and Conclusions The evidence for the movement of C. sativus westward is entirely lexicographical until the 10th century. Syriac, Persian and Byzantine Greek sources suggest the presence of cucumbers, to the east and north-east of the Mediterranean Sea (modern Iran, Iraq and Turkey), by the 6th or 7th century. Arabic medical writings suggest the presence of cucumbers in Spain as early as the mid-9th century and in Tunisia by the early 10th century. Descriptive evidence in Arabic establishes the presence of cucumbers in Andalusia by the second half of the 10th century. Latin translations from Arabic sources indicate the presence of cucumbers in southern Italy by the second half of the 11th century. These writings, together with lexicographical discrepancies in names of cucurbits in late medieval Latin writings, suggest that cucumber was introduced to Europe by two independent diffusions. One diffusion appears to have been overland from Persia into eastern and northern Europe and preceded the Islamic conquests. The other, subsequent diffusion into western and southern Europe, was probably by a mostly maritime route from Persia or the Indian subcontinent into Andalusia. PMID:22104164

  4. Cloning and expression analysis of transketolase gene in Cucumis sativus L.

    Science.gov (United States)

    Bi, Huangai; Wang, Meiling; Dong, Xubing; Ai, Xizhen

    2013-09-01

    Transketolase (TK, EC 2.2.1.1) is a key enzyme in the photosynthetic carbon reduction cycle (Calvin cycle). A full-length cDNA encoding transketolase (TK, designated as CsTK) was isolated from cucumber leaves (Cucumis sativa L. cv 'Jinyou 3') by RT-PCR and RACE. The cDNA contained 2368 nucleotides with a complete open reading frame (ORF) of 2229 nucleotides, which was predicted to encode a peptide of 742 amino acids. Expression analysis by real-time PCR and western blot revealed that TK mRNA was abundant in cucumber leaves and detectable in stems, fruits and roots. TK activity and the gene expression at the mRNA and protein levels was higher in mid-position leaves (4th apical leaves) than in upper position leaves (1st) and base position leaves (12th). The diurnal variation of CsTK expression and TK activity in the optimal functional leaf (4th leaf) was a single-peak curve, and the peak appeared at 14:00 on a sunny day. Low temperature (5 °C) and low light (100 μmol m(-2) s(-1)) induced CsTK expression, but the expression level decreased after 24 h of chilling stress. Over-expression of CsTK increased the TK activity, mRNA abundance and activities of other main enzymes in Calvin cycle, and net photosynthetic rate (Pn) in transgenic cucumber leaves. Transgenic plants showed a higher ratio of female flower and yield relative to the wild type (WT) plants. The decreases in Pn and carboxylation efficiency (CE) were less in transgenic plants than that in WT during low temperature and low light intensity. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  5. Silicon improves salt tolerance by increasing root water uptake in Cucumis sativus L.

    Science.gov (United States)

    Zhu, Yong-Xing; Xu, Xuan-Bin; Hu, Yan-Hong; Han, Wei-Hua; Yin, Jun-Liang; Li, Huan-Li; Gong, Hai-Jun

    2015-09-01

    Silicon enhances root water uptake in salt-stressed cucumber plants through up-regulating aquaporin gene expression. Osmotic adjustment is a genotype-dependent mechanism for silicon-enhanced water uptake in plants. Silicon can alleviate salt stress in plants. However, the mechanism is still not fully understood, and the possible role of silicon in alleviating salt-induced osmotic stress and the underlying mechanism still remain to be investigated. In this study, the effects of silicon (0.3 mM) on Na accumulation, water uptake, and transport were investigated in two cucumber (Cucumis sativus L.) cultivars ('JinYou 1' and 'JinChun 5') under salt stress (75 mM NaCl). Salt stress inhibited the plant growth and photosynthesis and decreased leaf transpiration and water content, while added silicon ameliorated these negative effects. Silicon addition only slightly decreased the shoot Na levels per dry weight in 'JinYou 1' but not in 'JinChun 5' after 10 days of stress. Silicon addition reduced stress-induced decreases in root hydraulic conductivity and/or leaf-specific conductivity. Expressions of main plasma membrane aquaporin genes in roots were increased by added silicon, and the involvement of aquaporins in water uptake was supported by application of aquaporin inhibitor and restorative. Besides, silicon application decreased the root xylem osmotic potential and increased root soluble sugar levels in 'JinYou 1.' Our results suggest that silicon can improve salt tolerance of cucumber plants through enhancing root water uptake, and silicon-mediated up-regulation of aquaporin gene expression may in part contribute to the increase in water uptake. In addition, osmotic adjustment may be a genotype-dependent mechanism for silicon-enhanced water uptake in plants.

  6. Iron deficiency affects nitrogen metabolism in cucumber (Cucumis sativus L.) plants.

    Science.gov (United States)

    Borlotti, Andrea; Vigani, Gianpiero; Zocchi, Graziano

    2012-10-11

    Nitrogen is a principal limiting nutrient in plant growth and development. Among factors that may limit NO3- assimilation, Fe potentially plays a crucial role being a metal cofactor of enzymes of the reductive assimilatory pathway. Very few information is available about the changes of nitrogen metabolism occurring under Fe deficiency in Strategy I plants. The aim of this work was to study how cucumber (Cucumis sativus L.) plants modify their nitrogen metabolism when grown under iron deficiency. The activity of enzymes involved in the reductive assimilation of nitrate and the reactions that produce the substrates for the ammonium assimilation both at root and at leaf levels in Fe-deficient cucumber plants were investigated. Under Fe deficiency, only nitrate reductase (EC 1.7.1.1) activity decreased both at the root and leaf level, whilst for glutamine synthetase (EC 6.3.1.2) and glutamate synthase (EC 1.4.1.14) an increase was found. Accordingly, the transcript analysis for these enzymes showed the same behaviour except for root nitrate reductase which increased. Furthermore, it was found that amino acid concentration greatly decreased in Fe-deficient roots, whilst it increased in the corresponding leaves. Moreover, amino acids increased in the xylem sap of Fe-deficient plants. The data obtained in this work provided new insights on the responses of plants to Fe deficiency, suggesting that this nutritional disorder differentially affected N metabolism in root and in leaf. Indeed under Fe deficiency, roots respond more efficiently, sustaining the whole plant by furnishing metabolites (i.e. aa, organic acids) to the leaves.

  7. Iron deficiency affects nitrogen metabolism in cucumber (Cucumis sativus L. plants

    Directory of Open Access Journals (Sweden)

    Borlotti Andrea

    2012-10-01

    Full Text Available Abstract Background Nitrogen is a principal limiting nutrient in plant growth and development. Among factors that may limit NO3- assimilation, Fe potentially plays a crucial role being a metal cofactor of enzymes of the reductive assimilatory pathway. Very few information is available about the changes of nitrogen metabolism occurring under Fe deficiency in Strategy I plants. The aim of this work was to study how cucumber (Cucumis sativus L. plants modify their nitrogen metabolism when grown under iron deficiency. Results The activity of enzymes involved in the reductive assimilation of nitrate and the reactions that produce the substrates for the ammonium assimilation both at root and at leaf levels in Fe-deficient cucumber plants were investigated. Under Fe deficiency, only nitrate reductase (EC 1.7.1.1 activity decreased both at the root and leaf level, whilst for glutamine synthetase (EC 6.3.1.2 and glutamate synthase (EC 1.4.1.14 an increase was found. Accordingly, the transcript analysis for these enzymes showed the same behaviour except for root nitrate reductase which increased. Furthermore, it was found that amino acid concentration greatly decreased in Fe-deficient roots, whilst it increased in the corresponding leaves. Moreover, amino acids increased in the xylem sap of Fe-deficient plants. Conclusions The data obtained in this work provided new insights on the responses of plants to Fe deficiency, suggesting that this nutritional disorder differentially affected N metabolism in root and in leaf. Indeed under Fe deficiency, roots respond more efficiently, sustaining the whole plant by furnishing metabolites (i.e. aa, organic acids to the leaves.

  8. Boron toxicity is alleviated by hydrogen sulfide in cucumber (Cucumis sativus L.) seedlings.

    Science.gov (United States)

    Wang, Bao-Lan; Shi, Lei; Li, Yin-Xing; Zhang, Wen-Hao

    2010-05-01

    Boron (B) is an essential micronutrient for plants, which when occurs in excess in the growth medium, becomes toxic to plants. Rapid inhibition of root elongation is one of the most distinct symptoms of B toxicity. Hydrogen sulfide (H(2)S) is emerging as a potential messenger molecule involved in modulation of physiological processes in plants. In the present study, we investigated the role of H(2)S in B toxicity in cucumber (Cucumis sativus) seedlings. Root elongation was significantly inhibited by exposure of cucumber seedlings to solutions containing 5 mM B. The inhibitory effect of B on root elongation was substantially alleviated by treatment with H(2)S donor sodium hydrosulfide (NaHS). There was an increase in the activity of pectin methylesterase (PME) and up-regulated expression of genes encoding PME (CsPME) and expansin (CsExp) on exposure to high B concentration. The increase in PME activity and up-regulation of expression of CsPME and CsExp induced by high B concentration were markedly reduced in the presence of H(2)S donor. There was a rapid increase in soluble B concentrations in roots on exposure to high concentration B solutions. Treatment with H(2)S donor led to a transient reduction in soluble B concentration in roots such that no differences in soluble B concentrations in roots in the absence and presence of NaHS were found after 8 h exposure to the high concentration B solutions. These findings suggest that increases in activities of PME and expansin may underlie the inhibition of root elongation by toxic B, and that H(2)S plays an ameliorative role in protection of plants from B toxicity by counteracting B-induced up-regulation of cell wall-associated proteins of PME and expansins.

  9. Boron excess affects photosynthesis and antioxidant apparatus of greenhouse Cucurbita pepo and Cucumis sativus.

    Science.gov (United States)

    Landi, Marco; Remorini, Damiano; Pardossi, Alberto; Guidi, Lucia

    2013-11-01

    This study aimed to evaluate the behavior of zucchini (Cucurbita pepo L.) and cucumber (Cucumis sativus L.) under boron (B) excess. Plants were grown under greenhouse conditions in a sandy soil-peat mixture using a nutrient solution containing 0.2 (control), 10 and 20 mg L(-1) B. Visible symptoms were quantified and leaf B accumulation, gas exchanges, chlorophyll (Chl) a fluorescence, malondialdehyde by-products and antioxidants were investigated 20 days after the beginning of the treatments. Boron toxicity induced oxidative load and leaf necrotic burns coupled with the reduction of leaf growth and biomass accumulation in both species. Boron excess resulted in a decrease of Chl a/b ratio, potential (Fv/Fm) and actual (ΦPSII) PSII quantum efficiency, photosynthetic rate (Pn), stomatal conductance (gs), and transpiration (E) as well. A general stimulation of the antioxidant enzymes ascorbate peroxidase, catalase and superoxide dismutase was observed, and a significant increase in the oxidized form of ascorbate and glutathione was evidenced for treated plants of both species. A difference between the two species was observed: C. pepo appeared to be more sensitive to B stress being damaged at all B concentration. C. sativus grown at 10 mg L(-1) B in nutrient solution showed some down-regulated mechanisms, i.e. increase in Chl b content and a good photochemical PSII efficiency as well as a higher amount of constitutive antioxidant molecules, that, however, are not sufficient to contrast the negative effects of B.

  10. MENTIMUN(Cucumis Sativus L DI DESA TIRTA MULYA KECAMATAN MAKARTI JAYA KABUPATEN BANYUASIN II

    Directory of Open Access Journals (Sweden)

    Irham Falahudin

    2015-08-01

    Full Text Available Cucumber plants (Cucumis sativus L. that includes or creeping vines and is one type of vegetable-fruit of the gourd family labuan (Cucurbitaceae that has been popular throughout the world and favored from Asia. Cucumber cultivation in Indonesia, found almost in every region, ranging from lowland to highland hot climate (tropical and moderate. One animal that has an abundant amount in cucumber plants are insects. This study aims to know the different types of species that exist on the Order Coleoptera cucumber farm in the village of Tirta Mulya District of makarti Jaya Banyuasin II and determine the role of the Order Coleoptera insects on cucumber plantations in the village of Tirta Mulya District of makarti Jaya Banyuasin II. This is a qualitative study conducted in October-November 2014 held in Cucumber Plants in the village of Tirta Mulya District of makarti Jaya Banyuasin II. Catching insects done using transect method and pitfall traps such as sweeping the net, pit fall traps and light traps, results in identification in the laboratory penelitanya UIN Raden Fatah Palembang. The results of this study indicate that insects are caught in a cucumber plantation obtained as many as 113 individual 3 families and 7 species. Insects which dominates in the village of Tirta Mulya District of makarti Jaya Banyuasin II is Cocinella repanda, Curinus coeruleus, Coelophora inaequalis, and Aulacophora similis, and insects that have the fewest number is Micraspis discolor, Micraspis vincta and Oryctes rhinoceros. The role of the Order Coleoptera Insects in general predators of the family Coccinellidae to eradicate mites while the family Chrysomelidae Scarabacidae and are pests that attack on cucumber plants that can cause death.

  11. Fine genetic mapping of target leaf spot resistance gene cca-3 in cucumber, Cucumis sativus L.

    Science.gov (United States)

    Wen, Changlong; Mao, Aijun; Dong, Congjuan; Liu, Huyu; Yu, Shuancang; Guo, Yang-Dong; Weng, Yiqun; Xu, Yong

    2015-12-01

    The cucumber target leaf spot resistance gene cca - 3 was fine mapped in a 79-kb region harboring a CC-NB-ARC type R gene that may be responsible for the hypersensitive responses to infection of the target leaf spot pathogen in cucumber. The target leaf spot (TLS) is one of the most important foliar diseases in cucumber (Cucumis sativus L.). In this study, we conducted fine genetic mapping of a simply inherited recessive resistance gene, cca-3 against TLS with 193 F2:3 families and 890 F2 plants derived from the resistant cucumber inbred line D31 and the susceptible line D5. Initial mapping with microsatellite markers and bulked segregant analysis placed cca-3 in a 2.5-Mbp region of cucumber chromosome 6. The D5 and D31 lines were re-sequenced at 10× genome coverage to explore new markers in the target region. Genetic mapping in the large F2 population delimited the cca-3 locus in a 79-kb region with flanking markers Indel16874230 and Indel16953846. Additional fine mapping and gene annotation in this region revealed that a CC-NB-ARC type resistance gene analog, Csa6M375730, seems to be the candidate gene for cca-3. One single nucleotide polymorphism (SNP) was found in the NB-ARC domain of this candidate gene sequence between D31 and D5 that may lead to amino acid change, thus altering the function of the conserved NB-ARC motif. This SNP was validated in the segregating population as well as 24 independent cucumber lines. There was significantly higher level of cca-3 expression in the leaves of D5 (susceptible) than in D31 (resistant), and the expression level was positively correlated with the areas of necrotic spots on leaves after inoculation. It seems the cca-3 resistance gene was able to induce hypersensitive responses to the infection by TLS pathogen.

  12. Das categorias aos grupos sociais: representações sociais dos grupos urbano e rural

    Directory of Open Access Journals (Sweden)

    Mariana Bonomo

    Full Text Available As reflexões que conduziram o estudo focalizaram a referência entre a elaboração do campo representacional e o processo de identificação social referentes à ruralidade e à urbanidade. Esse propósito serviu-se de dois objetos que integram as categorias sociais de interesse e os grupos sociais vinculados, pessoas do meio rural e pessoas da cidade. Os corpora de dados, processados através do software EVOC- 2003, foram coletados por meio da técnica da associação livre a partir de entrevistas com 200 integrantes de quatro gerações de uma comunidade rural, com idades entre 07 e 81 anos. Os resultados indicaram que as representações sobre o endogrupo estão fundamentadas em estereótipos positivos, enquanto as representações sobre o exogrupo retratam a imagem dos citadinos como negativa, dinâmica que sugere um campo valorativo sustentado na ideologia, respectivamente, de um grupo com valores humanitários versus um grupo referenciado por valores capitalistas. Discute-se a função identitária do campo representacional para a manutenção da identidade social positiva do grupo rural.

  13. Grupos vulneráveis no Brasil

    Directory of Open Access Journals (Sweden)

    Luciana Gross Cunha

    2015-07-01

    Full Text Available Este artigo examina o grau de efetividade do Estado de direito no Brasil por meio de uma análise de como alguns grupos sociais vulneráveis, como mulheres e negros, lidam com as leis e as instituições da Justiça no Brasil. Criamos o Índice Brasileiro de Confiança na Justiça (IBCJ, a fim de validar o argumento para a nossa medida a confiança e o Índice Brasileiro de Per- cepção e Conformidade com a Lei (IBPCL que mede as percepções, atitudes e hábitos dos brasileiros re- lativos ao cumprimento da lei. Nós identificamos al- gumas razões que poderiam explicar as percepções desses grupos sociais específicos. Descobrimos que existe uma relação positiva e significativa entre a o IBCJ e o IBRCL. Este artigo inova ao apresentar al- guns padrões estatísticos de dois grupos sociais vul- neráveis analisados aqui: mulheres e negros, os quais teriam poucas razões para obedecerem às leis. Além disso, nós concluímos que mulheres têm um nível mais alto de percepção de confiança e respeito às leis em relação aos homens; e também concluímos que negros têm a pior percepção de confiança e respeito às leis em comparação aos brancos, já que eles en- tendem que, no Brasil, raramente as pessoas seguem as leis. Nós também encontramos uma relação positi- va entre o índice de percepção da confiança e respei- to às leis e as variáveis de idade e renda.

  14. PO.EX em EXPO (ou POesia EXperimental em EXPOsição: Ernesto Melo e Castro, António Barros e Silvestre Pestana na Casa da Escrita

    Directory of Open Access Journals (Sweden)

    Manaíra Aires Athayde

    2013-07-01

    Full Text Available Review of three exhibitions: Ernesto MELO E CASTRO, Do Leve à Luz (3 october - 2 november 2012; António BARROS, Progestos_Obgestos (30 november - 21 december 2012; Silvestre PESTANA, Povo Novo Virtual (8 february - 1 march 2013. Ciclo NAS ESCRITAS PO.EX, Casa da Escrita, Coimbra, Portugal.

  15. Variety Studying and Peculiarities of Seed Production of the Nizhyn Cucumber (Cucumis sativus L.) Population at Maiak Variety Testing Facility under IOB NAAN

    OpenAIRE

    Хареба, О. В.

    2011-01-01

    The article offers information on main vectors in scientific research of Nizhyn Mistsevyi cucumber (Cucumis sativus L.) at Maiak variety testing facility under IOB NAAN (National Agrarian Academy of Science) for the period of 1974 to 2010 (variety testing and seed production).

  16. Variety Studying and Peculiarities of Seed Production of the Nizhyn Cucumber (Cucumis sativus L. Population at Maiak Variety Testing Facility under IOB NAAN

    Directory of Open Access Journals (Sweden)

    О. В. Хареба

    2011-07-01

    Full Text Available The article offers information on main vectors in scientific research of Nizhyn Mistsevyi cucumber (Cucumis sativus L. at Maiak variety testing facility under IOB NAAN (National Agrarian Academy of Science for the period of 1974 to 2010 (variety testing and seed production.

  17. Evaluation of the Effects of Cucumis sativus Seed Extract on Serum Lipids in Adult Hyperlipidemic Patients: A Randomized Double-Blind Placebo-Controlled Clinical Trial.

    Science.gov (United States)

    Soltani, Rasool; Hashemi, Mohammad; Farazmand, Alimohammad; Asghari, Gholamreza; Heshmat-Ghahdarijani, Kiyan; Kharazmkia, Ali; Ghanadian, Syed Mustafa

    2017-01-01

    Hyperlipidemia is associated with increased risk of atherosclerosis; therefore, control of this risk factor is very important in preventing atherosclerosis. Cucumber (Cucumis sativus) seed is used traditionally as a lipid-lowering nutritional supplement. The aim of this study was to evaluate the effect of cucumber seed extract on serum lipid profile in adult patients with mild hyperlipidemia. In a randomized double-blind placebo-controlled clinical trial, hyperlipidemic patients with inclusion criteria were randomly and equally assigned to either Cucumis or placebo groups and used one medicinal or placebo capsule, respectively, once daily with food for 6 wk. Body mass index (BMI) as well as fasting serum levels of total cholesterol, triglycerides (TG), low-density lipoprotein (LDL-C), and high-density lipoprotein (HDL-C) were measured for all patients pre- and post-intervention and finally the changes were compared between the groups. Twenty-four patients in Cucumis group and 23 patients in placebo group completed the study. Cucumis seed extract resulted in significant reduction of total cholesterol (P = 0.016), LDL-C (P effects on serum lipid profile in adult hyperlipidemic patients. Therefore, cucumber seed could be considered as a food supplement for treatment of dyslipidemia. © 2016 Institute of Food Technologists®.

  18. Genome-wide identification and characterization of R2R3MYB family in Cucumis sativus.

    Directory of Open Access Journals (Sweden)

    Qiang Li

    Full Text Available BACKGROUND: The R2R3MYB proteins comprise one of the largest families of transcription factors in plants. Although genome-wide analysis of this family has been carried out in some species, little is known about R2R3MYB genes in cucumber (Cucumis sativus L.. PRINCIPAL FINDINGS: This study has identified 55 R2R3MYB genes in the latest cucumber genome and the CsR2R3MYB family contained the smallest number of identified genes compared to other species that have been studied due to the absence of recent gene duplication events. These results were also supported by genome distribution and gene duplication analysis. Phylogenetic analysis showed that they could be classified into 11 subgroups. The evolutionary relationships and the intron-exon organizations that showed similarities with Arabidopsis, Vitis and Glycine R2R3MYB proteins were also analyzed and suggested strong gene conservation but also the expansions of particular functional genes during the evolution of the plant species. In addition, we found that 8 out of 55 (∼14.54% cucumber R2R3MYB genes underwent alternative splicing events, producing a variety of transcripts from a single gene, which illustrated the extremely high complexity of transcriptome regulation. Tissue-specific expression profiles showed that 50 cucumber R2R3MYB genes were expressed in at least one of the tissues and the other 5 genes showed very low expression in all tissues tested, which suggested that cucumber R2R3MYB genes took part in many cellular processes. The transcript abundance level analysis during abiotic conditions (NaCl, ABA and low temperature treatments identified a group of R2R3MYB genes that responded to one or more treatments. CONCLUSIONS: This study has produced a comparative genomics analysis of the cucumber R2R3MYB gene family and has provided the first steps towards the selection of CsR2R3MYB genes for cloning and functional dissection that can be used in further studies to uncover their roles in

  19. Functional characterization of cucumber (Cucumis sativus L.) Clade V MLO genes.

    Science.gov (United States)

    Berg, Jeroen A; Appiano, Michela; Bijsterbosch, Gerard; Visser, Richard G F; Schouten, Henk J; Bai, Yuling

    2017-04-21

    Powdery mildew (PM) causing fungi are well-known pathogens, infecting over 10.000 plant species, including the economically important crop cucumber (Cucumis sativus L.). Loss-of-function mutations in clade V MLO genes have previously been shown to lead to recessively inherited broad-spectrum resistance to PM in several species. In cucumber, one clade V MLO homolog (CsaMLO8) was previously identified as being a susceptibility factor to PM. Two other closely related homologs (CsaMLO1 and CsaMLO11) were found, but their function was not yet unravelled. CsaMLO1 and CsaMLO11 were cloned from cucumber and overexpressed in a tomato mlo mutant. The transcript abundances of all three CsaMLO genes in different cucumber tissues were quantified using qRT-PCR and RNA-seq, with and without inoculation with the cucumber PM fungus Podosphaera xanthii. Allelic variation of CsaMLO1 and CsaMLO11 was screened in silico in sequenced cucumber germplasm. Heterologous overexpression of all three CsaMLO genes in the tomato mlo mutant restored susceptibility to PM caused by Oidium neolycopersici, albeit to a different extent: whereas overexpression of CsaMLO1 or CsaMLO8 completely restored susceptibility, overexpression of CsaMLO11 was only partially able to restore PM susceptibility. Furthermore, it was observed by qRT-PCR and RNA-seq that CsaMLO8 was significantly higher expressed in non-inoculated cucumber compared to the other two MLO genes. However, inoculation with P. xanthii led to upregulation of CsaMLO1, but not to upregulation of CsaMLO8 or CsaMLO11. Both CsaMLO1 and CsaMLO11 are functional susceptibility genes, although we conclude that based on the transcript abundance CsaMLO8 is probably the major clade V MLO gene in cucumber regarding providing susceptibility to PM. Potential loss-of-function mutations in CsaMLO1 and CsaMLO11 have not been identified. The generation and analysis of such mutants are interesting subjects for further investigation.

  20. Effects of deficit irrigation and straw mulching on gas exchange of cucumber plants (Cucumis sativus L.

    Directory of Open Access Journals (Sweden)

    František Hnilička

    2012-01-01

    Full Text Available Leaves gas exchange were studied in one cucumber (Cucumis sativus L. cultivar Harriet F1 grown under control conditions (C, deficit irrigation (S and straw mulch (M, as well as under control or deficit irrigation conditions and straw mulch in combination (CM or SM. Cucumber plants were grown in loose soil, foil tunnel. The photosynthesis rate (PN and transpiration rate (E were measured in the leaves in situ using the portable gas exchange system LCpro+. It follows from the results obtained that water deficit (PN was 11.88 μmol CO2.m−2.s−1 and E was 1.83 mmol H2O.m−2.s−1 provably decreases the gas exchange rate in cucumber plants in comparison with the irrigated control group (average value of PN - 15.03 μmol CO2.m−2.s−1 and E – 2.16 mmol H2O.m−2.s−1. The application of mulch in the control and stresses plants statistically insignificantly reduced the photosynthesis rates −14.91 μmol CO2.m−2.s−1 and 11.86 μmol CO2.m−2.s−1, respectively. However, after the application of the mulch to the plants growing in the variant of deficit irrigation and control conditions with mulch, the transpiration rate increased. The rate of transpiration (E by plants from control and deficit irrigation with mulch was 2.28 mmol H2O.m−2.s−1 and 2.24 mmol H2O.m−2.s−1, respectively. Photosynthesis and transpiration rate is also influenced by stomatal conductance (gs. The obtained values ​of the coefficient of determination (r2 is evident no stomatal inhibition of gas exchange for variants C (r2 = 0.1404 – PN; 0.2352 – E and CM (r2 = 0.2656 – PN; 0.2483 – E. No stomatal inhibition of photosynthesis was observed in SM variant (r2 = 0.2867, too. However, stomatal inhibition of photosynthesis and transpiration rate was based on the coefficient of determination found in plants with limited irrigation (PN – r2 = 0.5222 and E – r2 = 0.7191 and in SM variant (r2 = 0.8972.

  1. Grupo Escolar Solferino Colombes-Francia

    Directory of Open Access Journals (Sweden)

    Tessier, J.

    1978-11-01

    Full Text Available This school complex is divided into three different facilities, one for boys, one for girls and a kindergarten, all in a two-storey Steel structure building. The dining halls and kitchen are located in a separate building connected to the main one, the toilets and the medical department, being a part of the connecting area. The design of the entire complex is highly decorative and yet, very functional.

    Este Grupo Escolar está formado por tres escuelas destinadas, cada una de ellas, a niñas, niños y jardín de infancia. Se halla instalado en un edificio de dos plantas, realizado a base de estructura metálica. Los comedores y la cocina se han situado en un edificio anexo. En la zona de comunicación entre los dos edificios se encuentran los lavabos y el departamento médico. Todo el conjunto se ha desarrollado de una manera muy decorativa y, a la vez, cómoda.

  2. O Joana grupo de teatro e o teatro de rua

    OpenAIRE

    Bragança, Suzete

    2015-01-01

    A dissertação tem como objeto de investigação o Teatro de Rua e o Grupo de Teatro Joana. A primeira parte refere-se ao Teatro de Rua da segunda metade do século XX, nomeando Grupos como Living Theatre, Bread and Puppet e Odin Teatret, que se revelaram de grande importância para a história desta Companhia portuguesa. A segunda parte incide sobre o Teatro Joana e o seu projeto artístico, enquanto Grupo de Teatro para a Infância e Juventude e, essencialmente, como Grupo de Teatro de Rua. ...

  3. GRUPOS DE INVESTIGACIÓN DE LA FACULTAD DE CIENCIAS

    Directory of Open Access Journals (Sweden)

    VICTOR IGNACIO LÓPEZ RÍOS

    2013-07-01

    Full Text Available Esta sección, dedicada a dar a conocer los grupos de investigacion de la Facultad, presentará un reporte del grupo de investigación de la Escuela de Física: Láseres y Espectroscopía óptica. Por su relevancia se ha decidido dar un espacio para la descripción de este grupo de investigación, sus líneas de investigación, premios obtenidos y apreciaciones de los integrantes del grupo.

  4. De um porto a outro: um navegar histórico no multiverso da vida e obra de João Cabral de Melo Neto

    OpenAIRE

    Galve, Fernanda Rodrigues

    2012-01-01

    Esta tese é uma navegação no multiverso da vida e obra de João Cabral de Melo Neto, cujo ancoramento está na visibilidade do trabalho poético com a aproximação de seus significados e mediações no mar da história. Busca-se refletir como a capacidade da práxis artística comportar em si uma dimensão política e histórica. A tese apresenta a história de um homem que, ao experimentar os fascínios e os desafios da literatura, soma-as à reflexão em seu diálogo com várias sociedades e a...

  5. Aboio Livre: Representações Ecológicas na Poesia de José Inácio Vieira de Melo

    Directory of Open Access Journals (Sweden)

    Calila das Mercês Oliveira (UEFS

    2014-07-01

    Full Text Available O artigo aborda as representações ecológicas na poesia de José Inácio Vieira de Melo (1968, poeta alagoano radicado na Bahia. A partir de Pedra Só (2012, tendo como recorte o capítulo Aboio Livre, é realizada uma análise da poética que envolve de forma concomitante lírica e meio ambiente. Conhecido como Cavaleiro de Fogo, o poeta apresenta um sertão místico que vai além das mazelas sociais, trazendo à tona a reflexão universal do que é “ser humano”. Expondo considerações de outros escritores e formadores de opinião acerca de sua obra e as fazendo interagir com as teorias de Alfredo Bosi, Octávio Paz, Félix Guattari, Serge Moscovici, Roland Barthes, entre outros.

  6. The genome sequence of the North-European cucumber (Cucumis sativus L. unravels evolutionary adaptation mechanisms in plants.

    Directory of Open Access Journals (Sweden)

    Rafał Wóycicki

    Full Text Available Cucumber (Cucumis sativus L., a widely cultivated crop, has originated from Eastern Himalayas and secondary domestication regions includes highly divergent climate conditions e.g. temperate and subtropical. We wanted to uncover adaptive genome differences between the cucumber cultivars and what sort of evolutionary molecular mechanisms regulate genetic adaptation of plants to different ecosystems and organism biodiversity. Here we present the draft genome sequence of the Cucumis sativus genome of the North-European Borszczagowski cultivar (line B10 and comparative genomics studies with the known genomes of: C. sativus (Chinese cultivar--Chinese Long (line 9930, Arabidopsis thaliana, Populus trichocarpa and Oryza sativa. Cucumber genomes show extensive chromosomal rearrangements, distinct differences in quantity of the particular genes (e.g. involved in photosynthesis, respiration, sugar metabolism, chlorophyll degradation, regulation of gene expression, photooxidative stress tolerance, higher non-optimal temperatures tolerance and ammonium ion assimilation as well as in distributions of abscisic acid-, dehydration- and ethylene-responsive cis-regulatory elements (CREs in promoters of orthologous group of genes, which lead to the specific adaptation features. Abscisic acid treatment of non-acclimated Arabidopsis and C. sativus seedlings induced moderate freezing tolerance in Arabidopsis but not in C. sativus. This experiment together with analysis of abscisic acid-specific CRE distributions give a clue why C. sativus is much more susceptible to moderate freezing stresses than A. thaliana. Comparative analysis of all the five genomes showed that, each species and/or cultivars has a specific profile of CRE content in promoters of orthologous genes. Our results constitute the substantial and original resource for the basic and applied research on environmental adaptations of plants, which could facilitate creation of new crops with improved growth

  7. Comparative chromosomal localization of 45S and 5S rDNAs and implications for genome evolution in Cucumis.

    Science.gov (United States)

    Zhang, Zhen-Tao; Yang, Shu-Qiong; Li, Zi-Ang; Zhang, Yun-Xia; Wang, Yun-Zhu; Cheng, Chun-Yan; Li, Ji; Chen, Jin-Feng; Lou, Qun-Feng

    2016-07-01

    Ribosomal DNAs are useful cytogenetic markers for chromosome analysis. Studies investigating site numbers and distributions of rDNAs have provided important information for elucidating genome organization and chromosomal relationships of many species by fluorescence in situ hybridization. But relevant studies are scarce for species of the genus Cucumis, especially in wild species. In the present study, FISH was conducted to investigate the organization of 45S and 5S rDNA among 20 Cucumis accessions, including cultivars and wild accessions. Our results showed that the number of 45S rDNA sites varied from one to five pairs in different accessions, and most of these sites are located at the terminal regions of chromosomes. Interestingly, up to five pairs of 45S rDNA sites were observed in C. sativus var. sativus, the species which has the lowest chromosome number, i.e., 2n = 14. Only one pair of 5S rDNA sites was detected in all accessions, except for C. heptadactylus, C. sp, and C. spp that had two pairs of 5S rDNA sites. The distributions of 5S rDNA sites showed more variation than 45S rDNA sites. The phylogenetic analysis in this study showed that 45S and 5S rDNA have contrasting evolutionary patterns. We find that 5S rDNA has a polyploidization-related tendency towards the terminal location from an interstitial location but maintains a conserved site number, whereas the 45S rDNA showed a trend of increasing site number but a relatively conserved location.

  8. Trabalho em grupo com enlutados Trabajo en grupo con enlutados Work group with bereaved

    Directory of Open Access Journals (Sweden)

    Melissa Pascoal

    2012-12-01

    Full Text Available A cada dia temos mais famílias vivenciando o luto gerado por homicídios, acidentes e violência, e isso tem causado alguns problemas psicológicos para as pessoas que estão nesta situação. Este artigo é um relato da experiência profissional vivida no Hospital e Maternidade Mauá com um grupo de autoajuda para pacientes em processo de luto, e seu objetivo é compartilhar a experiência e difundir este trabalho. Em 15 encontros pré-estruturados de acordo com a demanda apresentada pelo próprio grupo, foi possível trabalhar diversos temas relacionados à perda que influenciaram as participantes e ao mesmo tempo proporcionaram, além de conforto, uma possibilidade de identificação e troca, e consequentemente o ressurgimento da autoconfiança. Por meio da articulação da teoria com a prática, é evidenciado que o atendimento em grupo para enlutados é uma alternativa viável que trouxe resultados positivos e inspiradores e sua divulgação é importante para ampliar horizontes e criar novas possibilidades.Cada día tenemos más familias que experimentan el luto generado por homicidios, accidentes y violencia, esto ha causado algunos problemas psicológicos para las personas que se encuentran en esta situación. Este artículo es un relato de la experiencia profesional vivida en el Hospital de Mauá con un grupo de autoayuda para pacientes en el proceso de luto, y su objetivo es compartir la experiencia y difundir este trabajo. A través de quince reuniones preestructuradas de acuerdo con la demanda presentada por el propio grupo, fue posible trabajar diversos temas relacionados a la pérdida que influyeron a las participantes y al mismo tiempo proporcionaron, además de confort, una posibilidad de identificación y cambio, y consecuentemente el resurgimiento de autoconfianza. A través de la articulación de la teoría con la práctica, es evidenciado que la atención en grupo para enlutados es una alternativa viable que trajo resultados

  9. Transferência e psicoterapia de grupo Transferencia y psicoterapia de grupo Transference and group psychotherapy

    Directory of Open Access Journals (Sweden)

    Luiz Paulo de C. Bechelli

    2006-02-01

    Full Text Available No presente estudo, examinamos o conceito de transferência, focalizando suas peculiaridades no contexto grupal. A natureza da situação terapêutica e a ampla liberdade proporcionada ao paciente para abordar o material inconsciente, de acordo com seu próprio ritmo e dentro de um ambiente seguro e sem censura, estimula o estabelecimento gradual da transferência. Devido ao mecanismo de deslocamento, o psicoterapeuta e os participantes do grupo são percebidos não como são, com seus atributos reais, mas como objetos que suscitam emoções oriundas do mundo infantil, mais precisamente do acervo de influências afetivas profundas. Uma peculiaridade da situação de grupo em comparação com a psicoterapia individual é que, naquela modalidade, coexistem múltiplas transferências que os membros do grupo estabelecem entre si, potencializando uma gama de possibilidades de sentimentos. Ambas as modalidades guardam em comum o pressuposto de que os conflitos psíquicos que impeliram o paciente à busca de ajuda podem ser reduzidos ou mesmo suprimidos mediante a interpretação e a elaboração da transferência, que funcionam como procedimentos para a mudança no decorrer do processo terapêutico.En este estudio investigamos el concepto de la transferencia, enfocando sus peculiaridades en el contexto grupal. La naturaleza de la situación terapéutica y la amplia libertad proporcionada al paciente para abordar el material inconciente según su propio ritmo y dentro de un ambiente seguro y sin censura estimula el establecimiento gradual de la transferencia. Debido al mecanismo de desplazamiento, el psicoterapeuta y los participantes del grupo son percibidos no como son, con sus atributos reales, pero como objetos que suscitan emociones oriundas del mundo infantil, más precisamente del acervo de influencias afectivas profundas. Una peculiaridad de la situación de grupo en comparación con la psicoterapia individual es que, en aquella modalidad

  10. O Melos e Harmonia Acústica (1988 de César Guerra-Peixe, Koellreutter e Hindemith: similaridades e princípios básicos The Melos e Harmonia Acústica (1988 of César Guerra-Peixe, Koellreutter and Hindemith: basic principles and similarities

    Directory of Open Access Journals (Sweden)

    Ernesto Hartmann

    2013-06-01

    Full Text Available O Melos e Harmonia Acústica de César GUERRA-PEIXE (1988 apresenta um compêndio da atividade didática deste compositor expresso em forma de apostila. O presente trabalho busca traçar as possíveis influências comparando-o ao Caderno de Estudos com Koellreutter do próprio GUERRA-PEIXE (1944 e ao The Craft of Musical Composition de Paul HINDEMITH (1937, visando compreender melhor os pressupostos técnicos e teóricos.The Melos e Harmonia Acústica by César GUERRA-PEIXE (1988, presented a survey of the didactical activity of this composer expressed in a textbook form. This research attempts to trace possible influences, comparing it to The Craft of Musical Composition by Paul HINDEMITH (1937 and Caderno de Estudos com Koellreutter by GUERRA-PEIXE (1944 in order to better understand the technical and theoretical approaches embodied in it.

  11. Factors influencing cucumber (Cucumis sativus L.) somatic embryogenesis. I. The crucial role of pH and nitrogen in suspension culture

    OpenAIRE

    Tadeusz Wróblewski; Marcin K. Filipecki; Stefan Malepszy

    2014-01-01

    A method of obtaining and the characteristics of an embryogenic stabilised cucumber (Cucumis sativus L.) suspension culture which has many similarities to the carrot model are presented. The Specific Type I cells and proembryogenic mass were present in such a suspension. The maintenance of the proembryogenic stage took place in medium containing 2,4-D as the sole growth regulator, subsequent stages of embryogenesis occurred in hormone-free medium. Embryonic structures were also observed in me...

  12. Sobre ébrios, lascivos e coléricos: os corpos enfermos na obra de Francisco de Melo Franco (1794 = About drunkards, lecherous and choleric: the ill bodies in Francisco de Mello Franco work (1794

    Directory of Open Access Journals (Sweden)

    Stein, Tarcila Nienow

    2014-01-01

    Full Text Available Este trabalho analisa a obra do médico brasileiro Francisco de Melo Franco, intitulada “Medicina Teológica ou súplica humilde feita a todos os Senhores Confessores, e Diretores, sobre o modo de proceder com seus Penitentes na emenda dos pecados, principalmente da Lascivia, Colera e Bebedice”, de 1794. Inserida em um contexto marcado pelas transformações promovidas pela Ilustração em Portugal, a polêmica obra de Melo Franco foi dirigida aos confessores da Igreja Católica e propunha uma medicina que deveria conciliar o conhecimento do corpo com o da alma. Para doenças como a lascívia, a cólera e a bebedice, tidas como os três males sociais do período, Melo Franco recomendava tratamentos à base de medicamentos e de exercícios, enfatizando que somente os médicos possuíam a competência necessária para descobrir as causas desses males e curá-los

  13. Comparative physico-chemical and proximate analysis of oils of ...

    African Journals Online (AJOL)

    shyn

    2015-08-05

    Faso. Received 14 April, 2015; Accepted 2 July, 2015. In rural areas of developing countries like Burkina Faso, nutritive elements are mainly composed of vegetable source. Shea nut, seeds of Sesamum indicum, Cucumis melo ...

  14. Macronutrient composition of three cucurbit species cultivated for ...

    African Journals Online (AJOL)

    .) Matsum. & Nakai., Cucumeropsis mannii Naudin, and Cucumis melo var. agrestis L.] largely cultivated in Côte d'Ivoire and consumed as sauce thickeners were analyzed for their proximate composition and compared to a local landrace of ...

  15. Pepino japonês (Cucumis sativus L. submetido ao tratamento com fécula de mandioca Japonese cucumber (Cucumis sativus L. submitted of the treatment with cassava starch film

    Directory of Open Access Journals (Sweden)

    Kelen Cristina dos Reis

    2006-06-01

    Full Text Available Com o presente trabalho objetivou-se avaliar a qualidade e a vida útil do pepino (Cucumis sativus L., utilizando recobrimento com película de fécula de mandioca. Após seleção, amostras de pepino japonês foram mergulhadas em suspensões de fécula de mandioca a 0, 2, 3 e 4%, secos ao ar e armazenados em câmara fria a 5ºC e 95% de UR por 8 dias. As análises realizadas foram perda de massa, pH, sólidos solúveis (SS , acidez titulável (AT, Cor L*a*b e firmeza. O delineamento utilizado foi o DIC com 3 repetições, com os tratamentos dispostos em esquema fatorial 4 x 5. O valor encontrado para firmeza nas amostras tratadas com película a 4% foram menores em comparação aos outros tratamentos, isto, provavelmente se deve à plasticidade do tecido que estas amostras apresentaram. A película reduziu significativamente a perda de massa das amostras mantidas sob refrigeração. A aplicação de película de fécula de mandioca na concentração mais elevada (4%, proporcionou ao pepino um aspecto melhor de conservação, tornando o produto mais atraente.This work was made to evaluate the properties and postharvest life of cucumber (Cucumis sativus L. coated with cassava starch film. After the selection the fruits were dipped in suspensions 0, 2, 3 and 4% starch, dried naturally and stored in chamber cold (5ºC ± 1ºC and 90% ± 5% HR during 8 days and the analyses were done in the time zero and in intervals of 2 days. The analyses done were loss mass, titratable acidity (TA, pH, soluble solids (SS, color L*a*b and firmness. The test was conducted in completely randomized design, with three repetitions, with the treatments disposed in factory layout 4x5. The value found for firmness in the samples treated with biofilm at 4% was smaller in comparison to the other treatments, this, is probably due to the plasticity of the tissue that these samples presented. The film reduced the loss of mass of the samples maintained under refrigeration

  16. O enfermeiro como coordenador de grupos: contribuições da Dinâmica de Grupo

    OpenAIRE

    Carla Natalina da Silva Fernandes

    2008-01-01

    Na enfermagem a utilização do recurso grupal tem sido utilizada para trabalhar com pessoas o que exige dos profissionais um conhecimento específico, para atender aos objetivos do grupo sem causar danos aos envolvidos. O objetivo desta pesquisa foi discutir à luz do referencial teórico da Dinâmica de Grupo os atributos desejáveis para o enfermeiro como coordenador de grupos, suas possibilidades e limitações. Trata-se de uma investigação teórica, de natureza descritiva e analítica desenvolvida ...

  17. Colombia: crece el control de grupos financieros en los medios

    Directory of Open Access Journals (Sweden)

    Humberto López López

    2015-01-01

    Full Text Available Señala que parece inevitable el que en las economías de libre mercado, los medios tiendan a pertenecer a los grandes grupos financieros. La polémica sobre si los grandes grupos financieros deben controlar los medios o si es tan riesgoso un monopolio controlado por periodistas como un medio controlado por monopolios es un estadio más en la búsqueda de un periodismo objetivo, independiente y confiable

  18. O grupo operativo intervindo na Síndrome de Burnout

    Directory of Open Access Journals (Sweden)

    Vivien Rose Böck

    Full Text Available O presente estudo teve como objetivo verificar a alteração do nível de Burnout em professores por intermédio da intervenção da técnica de grupos operativos. A amostra foi composta por professores de 5ª a 8ª série de uma escola particular de Porto Alegre, subdividindo-se em dois grupos, o de controle e o experimental, com 12 professores em cada grupo. Para medir a Síndrome de Burnout foi utilizado o MBI (Maslach Burnout Inventory. Após a primeira aplicação do teste em todos os professores, realizaram-se 9 encontros sob a técnica de grupos operativos com o grupo experimental e posteriormente, todos responderam novamente ao teste. Os resultados demonstraram aumento do nível de Burnout, bem como nas suas dimensões: esgotamento emocional, realização profissional e despersonalização para o grupo experimental. Na análise da intervenção constatou-se a importância tanto da sensibilização profissional do trabalho docente como do apoio social entre os professores como estratégias para a prevenção e o enfrentamento da Síndrome de Burnout.

  19. Aspectos técnicos da psicoterapia de grupo

    Directory of Open Access Journals (Sweden)

    Bernardo Blay Neto

    1959-09-01

    Full Text Available São estudados os mecanismos psíquicos que se desenvolvem em agrupamentos humanos e a sua utilização para fins terapêuticos, sendo focalizado o fenômeno da interação como o dinamismo básico dessas reações. O autor compara a forma pela qual encara o grupo com as idéias de Bion, Moreno e Sullivan, encarando a hipótese de que os sentimentos de amor e hostilidade se manifestem em função do bom ou do mau funcionamento dos contactos primários que caracterizam a dependência. O autor comenta resultados que obteve usando o psicodrama, mediante o qual estudou reações emocionais de inveja, ódio, agressividade e amor. O autor analisa as técnicas de Slavson e Pratt baseando-se nos dinamismos inerentes ao grupo e refere os estudos de Beukemkamp para a compreensão do fenômeno transferenciai que, no grupo, tem características próprias. As diferenças entre a terapia de grupo e a individual são apontadas, sendo a contra-transferência considerada como elemento construtivo. Pensa o autor que o aspecto dramático vivenciado pelo grupo ou por um dos seus componentes tem alto valor, pois engloba a verbalização, os componentes emocionais e os componentes posturais. O tono emocional vivenciado pelo grupo é mais intenso e opressivo que o que é despertado na terapêutica individual, o que é explicável pela somação de efeitos provocada pela reação circular. Segundo o autor, a Psicoterapia de Grupo e a Psicoterapia Individual não se opõem, mas se completam.

  20. JOÃO CABRAL DE MELO NETO: LA IMAGEN DEL RÍO EN LA POÉTICA DE LOS DESVALIDOS

    Directory of Open Access Journals (Sweden)

    GLORIA VERGARA

    2013-11-01

    Full Text Available In this article we review the cosmic image of water, from the theory of Gaston Bachelard, in two long poems of João Cabral de Melo Neto: O Rio ("The River" and O cão sem plumas ("The dog without feathers". I will see the river as cosmic image of the helpless in "The River" and the first part of "The dog without feathers", Paisagem do Capibaribe, understanding that poetry is not a complaint, but these texts denouncing misery. This poems project the worldview of those who resist the rigor, not only hunger and social spoils, but the river. The creatures that inhabit this world are as far away, the neglected, ignored what society. In the river, these beings are confused with the lama, not just your bank or depth, but the margin between liquid and solid, between the filth and survival. The gift of the destitute is his strength. Thus, the different shades reaching cosmic water image helps us to perceive the existence deployments in the "helpless" than lyrical subjects are depicted in Brazilian poetry.

  1. A “Valsa da Dor”: dominação masculina e descontrole em “Valsa Negra”, de Patrícia Melo

    Directory of Open Access Journals (Sweden)

    Érica Schlude Wels

    2016-12-01

    Full Text Available “Valsa Negra” (MELO, 2003 é a base das reflexões acerca da ruína do modelo masculino dominador, em tensões permanentes com um feminino jovial e sedutor, mas em flagrante mudança. A leitura da psique descontrolada do Maestro apóia-se nos conceitos freudianos de “Pulsão de Morte” (Tanatos e “Psicose”, além da posse erótica total e malograda do corpo do outro (JEUDY; 2002. O arcabouço teórico procura descortinar as relações de gênero e os papéis sociais imbricados nas teias do discurso do poder (FOUCAULT, 2014; BOURDIEU, 2002, denunciando uma matriz antropológica e psicanalítica primordialmente heterossexual (BUTLER, 2003 em choque com uma possível essência biológica feminina/masculina (LIPOVETSKY, .2000; BAUDRILLARD, 1991.

  2. Three-Dimensional Reconstruction, by TEM Tomography, of the Ultrastructural Modifications Occurring in Cucumis sativus L. Mitochondria under Fe Deficiency.

    Directory of Open Access Journals (Sweden)

    Gianpiero Vigani

    Full Text Available Mitochondria, as recently suggested, might be involved in iron sensing and signalling pathways in plant cells. For a better understanding of the role of these organelles in mediating the Fe deficiency responses in plant cells, it is crucial to provide a full overview of their modifications occurring under Fe-limited conditions. The aim of this work is to characterize the ultrastructural as well as the biochemical changes occurring in leaf mitochondria of cucumber (Cucumis sativus L. plants grown under Fe deficiency.Mitochondrial ultrastructure was investigated by transmission electron microscopy (TEM and electron tomography techniques, which allowed a three-dimensional (3D reconstruction of cellular structures. These analyses reveal that mitochondria isolated from cucumber leaves appear in the cristae junction model conformation and that Fe deficiency strongly alters both the number and the volume of cristae. The ultrastructural changes observed in mitochondria isolated from Fe-deficient leaves reflect a metabolic status characterized by a respiratory chain operating at a lower rate (orthodox-like conformation with respect to mitochondria from control leaves.To our knowledge, this is the first report showing a 3D reconstruction of plant mitochondria. Furthermore, these results suggest that a detailed characterization of the link between changes in the ultrastructure and functionality of mitochondria during different nutritional conditions, can provide a successful approach to understand the role of these organelles in the plant response to Fe deficiency.

  3. Atmospheric Humidity Influences Oviposition Rate of Tetranychus urticae (Acari: Tetranychidae) Through Morphological Responses of Host Cucumis sativus Leaves.

    Science.gov (United States)

    Shibuya, T; Itagaki, K; Ueyama, S; Hirai, N; Endo, R

    2016-02-01

    We investigated the effects of morphology of host cucumber, Cucumis sativus L., leaves acclimatized to different atmospheric humidity levels on oviposition by adult females of the twospotted spider mite, Tetranychus urticae Koch. Cucumber seedlings were grown at a vapor pressure deficit (VPD) of 0.4, 1.9, or 3.0 kPa at 28°C (90%, 50%, or 20% relative humidity, respectively) in growth chambers until the second true leaves had expanded. Adult females of T. urticae were released on the adaxial surfaces of leaf squares cut from first and second true leaves in each treatment group, and held in the same humidity condition. Eggs were counted 2 d after release. The lower acclimatization humidity (higher VPD) increased trichome (leaf hair) density of the host leaves and oviposition rate, but the relationship between the trichome and oviposition differed between leaf positions. The leaf mass per area (LMA) was greater in first true leaves than in second true leaves, but was not influenced by VPD. A linear regression model with oviposition rate as the dependent variable and trichome density and LMA as independent variables showed that both variables influenced the oviposition rate approximately equally. We conclude that oviposition was accelerated under low humidity (high VPD) conditions indirectly probably through an increase in the trichome density of host leaves. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  4. Impact of a snail pellet on the phytoavailability of different metals to cucumber plants (Cucumis sativus L.).

    Science.gov (United States)

    Freitag, Sabine; Krupp, Eva M; Raab, Andrea; Feldmann, Jörg

    2013-02-01

    FePO4 based molluscicides (snail pellets) also contain a chelating agent. The influence of the chelating agent, which is intrinsically present in the molluscicide, on the phytoavailability of other metals present in the growth medium was investigated in the present study. Cucumber plants (Cucumis sativus) were grown in a hydroponic nutrient solution and exposed for one week to different metals in combination with a chelating agent containing molluscicide. Oven dried roots and shoots of plants were HNO 3/H2O2 microwave digested and analysed regarding total Fe, stable isotopic (54)Fe, Cd, Pb, and Bi concentrations using ICP-MS. The results showed that the addition of a chelating agent enhances the Fe phytoavailability to the plant, whether as an intrinsic part of the molluscicide or added individually. Additionally, the chelating agent present in the pesticide mobilises externally added metals and thus increases their phytoavailability. In particular the significantly higher Cd concentration in shoots from plants exposed to chelating agents indicates a potentially detrimental environmental effect.

  5. Ethylene is involved in brassinosteroids induced alternative respiratory pathway in cucumber (Cucumis sativus L. seedlings response to abiotic stress

    Directory of Open Access Journals (Sweden)

    Lijie eWei

    2015-11-01

    Full Text Available Effects of brassinosteroids (BRs on cucumber (Cucumis sativus L. abiotic stresses resistance to salt, polyethylene glycol (PEG, cold and the potential mechanisms were investigated in this work. Previous reports have indicated that BRs can induce ethylene production and enhance alternative oxidase (AOX pathway. The mechanisms whether ethylene is involved as a signal molecule which connected BR with AOX in regulating stress tolerance are still unknown. Here, we found that pretreatment with 1 µM brassinolide (BL, the most active BRs relieved stress-caused oxidative damage in cucumber seedlings and clearly enhanced the capacity of AOX and the ethylene biosynthesis. Furthermore, transcription level of ethylene signaling biosynthesis genes including ripening-related ACC synthase1 (CSACS1, ripening-related ACC synthase2 (CSACS2, ripening-related ACC synthase3 (CSACS3, 1-aminocyclopropane-1-carboxylate oxidase1 (CSACO1, 1-aminocyclopropane-1-carboxylate oxidase2 (CSACO2 and CSAOX were increased after BL treatment. Importantly, the application of the salicylhydroxamic acid (SHAM, AOX inhibitor and ethylene biosynthesis inhibitor aminooxyacetic acid (AOA decreased plant resistance to environmental stress by blocking BRs-induced alternative respiration. Taken together, our results demonstrated that ethylene was involved in BRs-induced AOX activity which played important roles in abiotic stresses tolerance in cucumber seedlings.

  6. Silencing of the gibberellin receptor homolog, CsGID1a, affects locule formation in cucumber (Cucumis sativus) fruit.

    Science.gov (United States)

    Liu, Bin; Liu, Xingwang; Yang, Sen; Chen, Chunhua; Xue, Shudan; Cai, Yanling; Wang, Dandan; Yin, Shuai; Gai, Xinshuang; Ren, Huazhong

    2016-04-01

    Gibberellins are phytohormones with many roles, including the regulation of fruit development. However, little is known about the relationship between GA perception and fleshy fruit ontogeny, and particularly locule formation. We characterized the expression of cucumber (Cucumis sativus) GA receptor gene (CsGID1a) using quantitative real-time PCR, in situ hybridization and a promoter::β-glucuronidase (GUS) assay. CsGID1a-RNAi cucumber fruits were observed by dissecting microscope, scanning electron microscopy and transmission electron microscopy. Finally, genome-wide gene expression in young fruits from a control and the RNAi line was compared using a digital gene expression (DGE) analysis approach. The expression pattern of CsGID1a was found to be closely correlated with fruit locule formation, and silencing CsGID1a in cucumber resulted in fruits with abnormal carpels and locules. Overexpression of CsGID1a in the Arabidopsis thaliana double mutant (gid1a gid1c) resulted in 'cucumber locule-like' fruits. The DGE analysis suggested that expression of genes related to auxin synthesis and transport, as well as the cell cycle, was altered in CsGID1a-RNAi fruits, a result that was supported by comparing the auxin content and cellular structures of the control and transgenic fruits. This study demonstrates a previously uncharacterized GA signaling pathway that is essential for cucumber fruit locule formation. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

  7. ACCIONES DE GRUPOS SOBRE EL ESPACIO DE RIEMANN-ROCH

    OpenAIRE

    VASQUEZ LATORRE, DANIELA

    2013-01-01

    Sea G un grupo finito de automorfismos de una curva proyectiva suave X, sobre el cuerpo de los números complejos, y D un divisor no especial de X invariante bajo la acción de G. En este trabajo estudiaremos el problema de descomposición de la representación natural del grupo G en el espacio de Riemann-Roch L(D), asociado al divisor D. Presentaremos fórmulas explícitas para la multiplicidad de cada factor irreducible, en términos de la multiplicidad de estos factores en la descompo...

  8. Fuentes de financiamiento legales e ilegales de grupos terroristas hoy

    Directory of Open Access Journals (Sweden)

    Gema Sánchez Medero

    2011-06-01

    Full Text Available En el artículo se analizan como se financian en el mundo actual los grupos terroristas, como logran transferir ese dinero y que medidas se han adoptado para prevenir y bloquear estas fuentes de financiación legales e ilegales. Tal vez, este punto sea uno de los menos estudiados por los especialistas en la materia, pero resulta de vital importancia, porque las organizaciones terroristas, como las demás organizaciones, necesitan de una serie de recursos para mantenerse y desarrollar sus actividades, de ahí que sea fundamental conocer como se financian estos grupos para poder combatirles y ponerles coto.

  9. Grupos cristalográficos e orbifolds euclidianos bidimensionais

    OpenAIRE

    Lopes, Isabel Cristina da Silva

    2004-01-01

    O tema central deste trabalho é a construção de modelos que permitam a visualizaçãodos padrões de simetria que estão associados aos 17 orbifolds euclidianos de dimensão 2.Um orbifold é visto aqui como o quociente de uma variedade por um grupo que age deforma propriamente descontínua, na verdade, um grupo cristalográfico, constituindo umageneralização do conceito de variedade, devido a permitir singularidades, tais como picos,espelhos ou esquinas provenientes de revestimentos ramificados.Os mo...

  10. Allelopathic effects of Juglone and decomposed walnut leaf juice on ...

    African Journals Online (AJOL)

    In this study, effects of juglone and decomposed walnut leaf juice on muskmelon (Cucumis melo cv. Galia) and cucumber (Cucumis sativus cv. Beith Alpha) seed germination percentage and postgermination seedling growth were investigated. Decomposition was carried out by keeping the leaves in distilled water.

  11. Influence of gamma irradiation on pollen viability, germination ability ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-12-15

    Dec 15, 2009 ... Effects of gamma radiation on vitality and competitive ability of Cucumis pollen. Euphytica, 32: 677-684. Yanmaz R, Ellialtıoglu S, Taner KY (1999). The effects of gamma irradiation on pollen viability and haploid plant formation in snake cucumber (Cucumis melo L. var. flexuosus Naud.). Acta Hort. 492:.

  12. Las personas en grupos: psicología social

    OpenAIRE

    Gutiérrez González, Macarena

    2013-01-01

    En este trabajo se analizarán los comportamientos y las actitudes de los individuos cuando se encuentran en grupo. El fin de este proyecto es analizar en qué medida la sociedad influye en las acciones de una persona.

  13. TTI Phase 2 Institutional Support: Grupo FARO | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The program aims to enhance their ability to provide sound research that informs and influences policy. This second TTI phase ... -establish a body of research anchored in participatory research methodologies -strengthen research ... -raise Grupo FARO's visibility in the media and in policy-making circles -build public ...

  14. de grupos minoritarios y mayoritarios en costa rica

    Directory of Open Access Journals (Sweden)

    Vanessa Smith Castro

    2005-01-01

    Full Text Available Utilizando las técnicas de los Modelos de Ecuaciones Estructurales, el presente estudio examina un modelo teórico sobre el efecto de la discriminación percibida, el contacto interétnico, la identificación étnica y las actitudes interétnicas en la autoestima de jóvenes costarricenses de diferentes grupos étnicos. En la investigación participaron 407 jóvenes afrocostarricenses (M=16.27 años, DE=1.58; 58% mujeres y 768 jóvenes del grupo mayoritario costarricense blancos/mestizo (M=15.93 años, DE=1.48; 60% mujeres provenientes de dos ciudades de diferente composición étnica. Los resultados son altamente consistentes con el modelo propuesto indicando que la autoestima se ve directamente afectada por la identificación étnica y las actitudes interétnicas en ambos grupos étnicos. Estas, a su vez, están directamente influenciadas por la percepción de la discriminación y el contacto interétnico. Diferencias y similitudes entre los grupos étnicos son analizadas y discutidas

  15. Identification and mapping of ts (tender spines), a gene involved in soft spine development in Cucumis sativus.

    Science.gov (United States)

    Guo, Chunli; Yang, Xuqin; Wang, Yunli; Nie, Jingtao; Yang, Yi; Sun, Jingxian; Du, Hui; Zhu, Wenying; Pan, Jian; Chen, Yue; Lv, Duo; He, Huanle; Lian, Hongli; Pan, Junsong; Cai, Run

    2018-01-01

    Using map-based cloning of ts gene, we identified a new sort of gene involved in the initiation of multicellular tender spine in cucumber. The cucumber (Cucumis sativus L.) fruit contains spines on the surface, which is an extremely valuable quality trait affecting the selection of customers. In this study, we elaborated cucumber line NC072 with wild type (WT) hard fruit spines and its spontaneous mutant NC073, possessing tender and soft spines on fruits. The mutant trait was named as tender spines (ts), which is controlled by a single recessive nuclear gene. We identified the gene ts by map-based cloning with an F 2 segregating population of 721 individuals generated from NC073 and WT line SA419-2. It was located between two markers Indel6239679 and Indel6349344, 109.7 kb physical distance on chromosome 1 containing fifteen putative genes. With sequencing and quantitative reverse transcription-polymerase chain reaction analysis, the Csa1G056960 gene was considered as the most possible candidate gene of ts. In the mutant, Csa1G056960 has a nucleotide change in the 5' splicing site of the second intron, which causes different splicing to delete the second exon, resulting in a N-terminal deletion in the predicted amino acid sequence. The gene encodes a C-type lectin receptor-like tyrosine-protein kinase which would play an important role in the formation of cucumber fruit. This is firstly reported of a receptor kinase gene regulating the development of multicellular spines/trichomes in plants. The ts allele could accelerate the molecular breeding of cucumber soft spines.

  16. TRANSMISSÃO DO CONHECIMENTO DE ALGUMAS ZOONOSES PARA ALUNOS DE ESCOLAS PÚBLICAS NOS MUNICÍPIOS DE APODI, FELIPE GUERRA E SEVERIANO MELO

    Directory of Open Access Journals (Sweden)

    Faviano Ricelli da Costa Moreira

    2013-05-01

    Full Text Available O presente trabalho objetivou avaliar o conhecimento de alunos da rede pública de ensino sobre algumas Zoonoses, através de palestras ministradas por alunos do curso de Técnico em Zootecnia. Foram aplicados 677 questionários para alunos de escolas públicas de Apodi, Felipe Guerra e Severiano Melo. Os questionários foram aplicados antes e após as palestras. Os dados foram discutidos através de uma análise descritiva. Os principais resultados demonstraram que os conteúdos relativos à transmissão e prevenção de algumas zoonoses foram fixados. Antes das palestras 20,8% dos alunos conheciam o conceito de Zoonoses e após, esse percentual passou para 88,3%. Houve um aumento no conhecimento da forma de transmissão da Larva migrans, Toxoplasmose e Leptospirose, onde antes das palestras o percentual era de 91,8, 1,9 e 29,4% e após as apresentações foi de 100,0, 57,8 e 72,4%, respectivamente. Para a forma de transmissão das Verminoses, o percentual de fixação do conhecimento não foi alterado, de maneira significativa, antes (86,5% e após (87,9% as palestras. Como conclusão, tem-se que a metodologia de palestras para alunos da rede pública de ensino é uma ferramenta que pode ser utilizada como forma de educação e prevenção de doenças.

  17. VALORACIÓN DE ATRIBUTOS DE CALIDAD EN PEPINO (Cucumis sativus L. FORTIFICADO CON VITAMINA E VALORAÇÃO DE ATRIBUTOS DE QUALIDADE EM PEPINO (Cucumis sativus L. FORTIFICADO COM VITAMINA E VALUATION OF QUALITY ATTRIBUTES IN CUCUMBER (Cucumis sativus L. FORTIFIED WITH VITAMIN E

    Directory of Open Access Journals (Sweden)

    MISAEL CORTÉS

    2011-06-01

    Full Text Available El objetivo de este trabajo fue desarrollar un producto mínimamente procesado fortificado con vitamina E, a partir de pepino (Cucumis sativus L, utilizando la ingeniería de matrices. Rodajas impregnadas al vacío (IV con DL-α-tocoferol acetato emulsificado en una fase acuosa isotónica al pepino (NaCl al 1%, son evaluadas en cuanto a propiedades fisicoquímicas, color, textura, estabilidad de la vitamina E y sensorialmente, por influencia del proceso, tiempo de almacenamiento y envasado (con y sin vacío. La vitamina E se cuantifica por HPLC (% del valor diario recomendado (VDR/100 g de pepino fresco, según la norma Colombiana. La respuesta IV alcanza niveles de 6.05±1.49%, correspondiente a 33.3±5.8 mg vitamina E y 110.5±19.1% VDR en 100 g de pepino fresco. Durante el almacenamiento en 9 días se presenta una pérdida aproximadamente del 50%, debido a la poca retención de la emulsión en el interior de la matriz. Los parámetros fisicoquímicos, el color y la textura son afectados por la IV, el tiempo y el envasado, siendo durante el almacenamiento más oscuras y más resistentes que el producto fresco. La ingeniería de matrices representa una metodología efectiva para fortificar el pepino con vitamina E.O objetivo deste estudo foi desenvolver um produto mínimamente processado fortificado com vitamina E, a partir de pepino (Cucumis sativus L, utilizando a engenharia de matrizes. Fatias de pepino foram impregnadas a vácuo (IV com DL-α- acetato de tocoferol emulsificado numa fase aquosa isotónica (NaCl a 1%, e foram avaliadas quanto às propiedades fisico-químicas, cor, textura, estabilidade da vitamina E e sensorialmente, tendo em consideração os factores: processo, tempo de armazenamento e envasado (com e sem vácuo. A vitamina E quantificou-se por HPLC (% do Valor Diario Recomendado (VDR/100 g de pepino fresco, de acordo com a norma Colombiana. A resposta à IV alcanzou niveis de 6.05±1.49%, correspondente a 33.3±5.8 mg

  18. La influencia de la Bauhaus en el grupo Memphis

    OpenAIRE

    Fernández Rodríguez, Salinas

    2017-01-01

    La Bauhaus hizo una de las mayores aportaciones al diseño moderno en el siglo XX. El objetivo de este trabajo es analizar los principios estéticos de la Bauhaus para ver cómo han influido en el Grupo Memphis: grupo de diseñadores y arquitectos que surgió en Italia en los años 80 de la mano de Ettore Sottsass. Este trabajo es una aproximación a la influencia estética de la Bauhaus en el colectivo de diseñadores Memphis, que dio un giro a los productos de la época transformándolos en objetos tota...

  19. La violencia femenina de grupo en el mito griego.

    OpenAIRE

    Villagra, Nereida

    2014-01-01

    En algunos relatos un grupo de mujeres asesina conjuntamente. El objetivo de este artículo es explorar si la violencia homicida colectiva tiene que ser femenina y hasta qué punto estos relatos obedecen a la idea de que la estirpe de las mujeres es mala contribuyendo a perfilar su naturaleza negativa, tan presente en la tradición arcaica, especialmente en Hesíodo. info:eu-repo/semantics/acceptedVersion

  20. Grupos sanguíneos de los indios guajiros

    OpenAIRE

    Martínez Silva, Ramiro; Soriano Lleras, Andrés

    2011-01-01

    Se estudian 230 muestras procedentes de indios de la Guajira para determinar sus grupos sanguíneos. Se encuentran las siguientes distribuciones: O 72.19 por ciento, A 8.26 por ciento, B 13.47 por ciento y AB 6.08 por ciento. Se estudia la posibilidad de inmunización con el factor Rh en 130 mujeres adultas y que habían estado embarazadas. No se encuentran anticuerpos contra el factor Rh.

  1. O uso do grupo focal em pesquisa qualitativa

    Directory of Open Access Journals (Sweden)

    Lúcia Beatriz Ressel

    2008-01-01

    Full Text Available Este estudio tuvo como objetivo presentar el uso del grupo focal como técnica de recolección de datos en una tesis de doctorado, resultado de una investigación cualitativa. El grupo focal utiliza sesiones grupales de discusión, teniendo como foco central un tópico específico a ser debatido por los participantes. La investigación focalizó la temática de la sexualidad en la asistencia de enfermería, bajo una perspectiva cultural, siendo desarrollada con dos grupos de enfermeras: docentes y asistenciales. Comprendió ocho encuentros, y cada uno fue planeado por separado. La evaluación del proceso se realizó por medio de entrevistas con las enfermeras, destacando como puntos positivos la conducción hacia el pensamiento crítico y al proceso de desalineación; y la posibilidad de que esta técnica revele significados singulares y a que ellos se relacionen desde el punto de vista de los sujetos investigados. Esa técnica facilitó el abordaje de la sexualidad, desconstruyendo y reconstruyendo conceptos y buscando respuestas para las inquietudes del tema.

  2. viver de um grupo de mulheres de classes populares

    Directory of Open Access Journals (Sweden)

    Kleyde Ventura de Souza

    2007-01-01

    Full Text Available Para la realización del presente estudio hicimos una encuesta a través de la cual conformamos un tipo especial de grupo llamado “Círculo de Ciudadanía”, con el objetivo de presentar los hechos & actos que han influenciado en la conquista de los derechos sexuales y reproductores de un grupo formado por 16 mujeres de clases populares. La encuesta fue desarrollada en 15 encuentros, en el período de diciembre de 2003 hasta julio de 2004. Los temas generadores fueron discutidos a la luz de los conceptos de Paulo Freire: “el cuerpo” y “derecho a tener derechos”. Las discusiones hechas en estos encuentros, originaron unidades temáticas que evidenciaron las desigualdades sociales, económicas y culturales, reforzando con ello, la condición de subordinación de las mujeres de clases populares, así como los dilemas y desafíos originados de la condición de ser mujer en el (difícil ejercicio de los derechos sexuales y reproductores, como integrantes del proceso de vivir del grupo estudiado.

  3. Por amar a liberdade: grupo Dóris

    Directory of Open Access Journals (Sweden)

    Cláudio Alberto dos Santos

    2007-10-01

    Full Text Available Este artigo discute o espetáculo Zumbi encenado pelo Grupo Teatral Dóris Cunha Melgaço (também conhecido como “Grupo do SESC?, em 1970-1, na cidade de Uberlândia. Tal montagem é presença fundamental quando se fala da história do teatro local. Até hoje este é um legado de incrível atualidade. O Grupo Dóris foi um núcleo seminal, instigante, vivo e bastante admirado pelo público de sua época. Apresentou muitas inovações formais e abriu caminhos. Trouxe inúmeras contribuições estéticas, mas, sobretudo, influenciou por sua postura política transformadora. O trabalho cênico em foco tem a marca da utopia que nasce do sentimento e da idéia do possível. Para o estabelecimento da identidade coletiva, tão importante quanto viver uma mesma situação social é ter as mesmas aspirações. Nessa perspectiva, a utopia defendida nessa encenação é uma possibilidade resiliente de experiência libertária.

  4. Compensation effect of bacterium containing biofertilizer on the growth of Cucumis sativus L. under Al-stress conditions.

    Science.gov (United States)

    Tóth, Brigitta; Lévai, L; Kovács, B; Varga, Mária Borbélyné; Veres, Szilvia

    2013-03-01

    Biofertilizers are used to improve soil fertility and plant production in sustainable agriculture. However, their applicability depends on several environmental parameters. The aim of our study was to evaluate the effect of free-living bacteria containing fertilizer on the growth of cucumber (Cucumis sativus L. cvs. Delicates) under aluminium (Al) stress. Different responses to Al stress of cucumber growth parameters were examined in terms of root elongation and physiological traits, such as Spad index (relative chlorophyll value), biomass accumulation of root and shoot, Al uptake and selected element contents (Fe, Mn, Zn, Mg) of leaves and root. The applied bacteria containing biofertilizer contains Azotobacter chroococcum and Bacillus megaterium. The dry weights of cucumber shoots and roots decreased in line with the increasing Al concentration. Due to different Al treatments (10-3 M, 10-4 M) higher Al concentration was observed in the leaves, while the amounts of other elements (Fe, Mn, Zn, Mg) decreased. This high Al content of the leaves decreased below the control value when biofertilizer was applied. In the case of the roots the additional biofertilizer treatments compensated the effect of Al. The relative chlorophyll content was reduced during Al-stress in older plants and the biofertilizer moderated this effect. The root/shoot ratio was decreased in all the Al-treatments in comparison to the control. The living bacteria containing fertilizer also had a modifying effect. The root/shoot ratio increased at the 10-4 M Al2(SO4)2 + biofertilizer and 10-4 M Al(NO3)3 + biofertilizer treatments compared to the control and Al-treatments. According to our results the biofertilizer is an alternative nutrient supply for replacing chemical fertilizers because it enhances dry matter production. Biofertilizer usage is also offered under Al polluted environmental conditions. Although, the nutrient solution is a clean system where we can examine the main processes without

  5. O terapeuta na psicoterapia de grupo El terapeuta en la psicoterapia de grupo The therapist in group psychotherapy

    Directory of Open Access Journals (Sweden)

    Luiz Paulo de C. Bechelli

    2005-04-01

    Full Text Available Psicoterapia de grupo designa, atualmente, um amplo espectro de procedimentos fundamentados nos mais variados referenciais teóricos, aplicados em diferentes contextos. O objetivo do presente estudo é abordar o papel do terapeuta de grupo, delineando algumas estratégias e habilidades necessárias para o exercício da grupoterapia. Os autores enfatizam o nível técnico-científico em que o trabalho com grupos é desenvolvido e a influência da personalidade do terapeuta nos participantes. Concluem que, para que o terapeuta possa preservar seu papel, sem perder a especificidade de sua função por envolvimento com as múltiplas situações vividas com os pacientes, é fundamental a estabilidade de sua identidade profissional. Nesse sentido, o preparo do terapeuta, a partir de seu processo de formação continuada, é condição necessária para habilitá-lo a enfrentar as situações peculiares do contexto grupal, de modo a conferir à psicoterapia de grupo seu singular potencial terapêutico.Psicoterapia de grupo designa, actualmente, un amplio espectro de procedimientos basados en los más variados referenciales teóricos, aplicados en diferentes contextos. El objetivo de este estudio es comprender el papel del terapeuta de grupo, delineando algunas estrategias y habilidades necesarias para el ejercicio de la grupoterapia. Los autores enfatizaron el nivel técnico-científico en que el trabajo con grupos es desarrollado y la influencia de la personalidad del terapeuta en los participantes. Los autores concluyen que, para que el terapeuta mantenga su rol, sin perder la especificidad de su función por su involucramiento con las varias situaciones vividas con los pacientes, es fundamental la estabilidad de su identidad profesional. En ese sentido, la preparación del terapeuta, a partir de su proceso de formación continuada, es condición necesaria para el enfrentamiento de las situaciones peculiares del contexto grupal, de manera a conferir a

  6. Grupo “Tres Colonias”, compartir para crecer

    Directory of Open Access Journals (Sweden)

    G. P. Fraire

    2014-01-01

    Full Text Available La cuenca lechera central argentina alberga pequeños y medianos productores, dedicados al tambo (establecimiento para la producción lechera, complementando con agricultura y ganadería; estas actividades demandan gran cantidad de maquinarias, imposibles de poseerlas en forma individual; por ello, se formaron los grupos de herramientas compartidas como “Tres Colonias”, creado luego de un año de diagramación. En 1991, 17 productores de diferentes tamaños se unieron para compartir un equipo de labranza de gran capacidad, cuya inversión y costo operativo fueron más convenientes que hacerlo en forma individual. Se organizaron a través de un circuito de trabajo de acuerdo a la cercanía de los campos y de un cupo de hectáreas, para que todos utilizaran el equipo en tiempo y forma. Un tractorista conduce, repara, mantiene el equipo, ordena y administra los turnos de trabajo. El nombre “Tres Colonias” proviene de los pueblos donde moran sus integrantes (Ramona, Marini y Coronel Fraga. A medida que el grupo se afianzó, se realizaron compras y trabajo de campos cooperativamente, adquiriendo con esto más herramientas y sumando personal. En 1993, el grupo ingresó al programa oficial Cambio Rural; ello permitió apuntalarlo y mejorarlo, técnica y humanamente. Esta práctica grupal generó la formación de otras congregaciones similares. La experiencia fue presentada en diversos simposios, congresos, eventos, dentro y fuera del país. Lo esencial de este trabajo fue cambiar, en muchos aspectos, la mentalidad de sus integrantes: trabajando agrupados sin perder su identidad, sobreviviendo a la etapa neoliberal, permitiendo su permanencia; pero, lo más importante, mejorando su crecimiento como seres humanos.

  7. Fuentes de financiamiento legales e ilegales de grupos terroristas hoy

    OpenAIRE

    Gema Sánchez Medero

    2011-01-01

    En el artículo se analizan como se financian en el mundo actual los grupos terroristas, como logran transferir ese dinero y que medidas se han adoptado para prevenir y bloquear estas fuentes de financiación legales e ilegales. Tal vez, este punto sea uno de los menos estudiados por los especialistas en la materia, pero resulta de vital importancia, porque las organizaciones terroristas, como las demás organizaciones, necesitan de una serie de recursos para mantenerse y desarrollar sus activid...

  8. Organizaciones para el siglo XXI: grupos de trabajo autogestionados.

    Directory of Open Access Journals (Sweden)

    Luis Avendaño Fernández

    2013-11-01

    Full Text Available En la actualidad, muchas empresas exitosas están dejando atrás los esquemas rígidos y autoritarios de organización y orientan sus esfuerzos hacia la formación de equipos autogestionados que integran el logro de los objetivos de eficiencia, rentabilidad y crecimiento que requiere la empresa, con el logro de los objetivos individuales y grupales de desarrollo humano. En Colombia las OTAS (Organizaciones de Trabajo Asociado poseen características de grupos autodirigidos que la empresa debe conocer y adoptar con el fin de conservar su participación en el mercado.

  9. Estrategia corporativa y responsabilidad social corporativa de Grupo Correos

    OpenAIRE

    García Prieto, Sergio

    2016-01-01

    RESUMEN: Este Trabajo Fin de Máster analiza la estrategia corporativa de una de las más antiguas y grandes compañías postales de Europa: Grupo Correos, para adaptarse a un nuevo entorno liberalizado mediante la diversificación, una mayor efectividad comercial, la optimización operativa y el desarrollo de una renovada estructura organizativa. Una estrategia basada en la apertura a nuevos negocios, donde los cambios del modo de comunicación en la sociedad y los nuevos hábitos de consumo de clie...

  10. Proceso de Internacionalización: Grupo Bimbo

    OpenAIRE

    Hostos Pradilla, Karla Juliana; Salgado Sanchez, Gloria Lorena

    2012-01-01

    Grupo Bimbo es uno de los mayores fabricantes a nivel mundial de panadería y dulces, es considerada como la segunda empresa panificadora más importante del mundo, estando presente en más de 17 países, en los cuales cuenta con gran participación y posicionamiento de sus productos. Esto ha contribuido a que se convierta en la empresa líder de la industria panadera en Latinoamérica, siendo así, un modelo a seguir para otras compañías que quieren seguir sus pasos. Por esta razón, fue preciso hac...

  11. Prueba de grupo. Una eficiente alternativa para estimar prevalencia animal

    OpenAIRE

    Osval Antonio Montesinos López; Abelardo Montesinos López; Ignacio Luna Espinoza; Laura Sanely Gaytán Lugo; Teodoro Espinosa Solares

    2012-01-01

    La estimación de prevalencia animal o detección de agentes infecciosos, es de vital importancia para una nación o estado para proteger su seguridad alimentaria y garantizar el comercio local y exterior. Sin embargo, realizar estas dos tareas (estimación y detección) eficientemente requiere de significativos recursos materiales y humanos. Por ello, el presente artículo presenta una revisión del proceso de estimación y detección usando la técnica estadística conocida como prueba de grupo (group...

  12. Comunidades de aprendizaje: las ayudas entre iguales en grupos interactivos

    OpenAIRE

    Rois Donsión, Carmen

    2013-01-01

    Dentro el modelo de Comunidades de Aprendizaje existen diferentes líneas de actuación entre las que se encuentra el foco central de este trabajo: los grupos interactivos. A través de esta medida se pone énfasis en la potenciación de las interacciones entre iguales, tanto en calidad como en cantidad. Por ello vamos a examinar de forma más detallada cómo son estas ayudas entre el alumnado y las mejoras que producen en la convivencia y en el aprendizaje. Grado en Educación Prim...

  13. Allelopathic influence of aqueous extracts from the leaves of Morus alba L. on seed germination and seedling growth of Cucumis sativus L. and Sinapsis alba L.

    Directory of Open Access Journals (Sweden)

    Katarzyna Możdżeń

    2014-04-01

    Full Text Available The aim of the present study was to elucidate impact of the aqueous extracts from leaves of Morus alba L. on germination, growth and photosynthetic activity of Cucumis sativus L. and Sinapis alba L. Plants were grown for 21 days at the temperature 25°C (day and 18°C (night, within 12/12 hours photoperiod, light intensity 150 μmol·m-2·s-1 and relative humidity 60-70% (day/night. Our experiments proved that allelopathic compounds in aqueous extracts of the leaves M. alba at high concentrations, reduce power and energy of germination. Biometric analysis of seedlings and adult plants grown showed that allelopathic substances have stimulating or inhibiting function depending on the stage of treatment. Moreover, they cause changes in chlorophyll contents and activity of photosystem II (PS II.

  14. Depletion of soil mineral N by roots of ¤Cucumis sativus¤ L. colonized or not by arbuscular mycorrhizal fungi

    DEFF Research Database (Denmark)

    Johansen, A.

    1999-01-01

    Two experiments were conducted where Cucumis sativus were grown in uncompartmented pots either alone or in symbiosis with Glomus intraradices Schenck and Smith (Experiment 1) or Glomus sp. (Experiment 2) in order to investigate if root colonization by arbuscular mycorrhizal (AM) fungi has an effect....... Dry weight of plant parts, total root length, mycorrhizal colonization rate and soil concentration of NH4+ and NO3- were recorded at five sequential harvest events: 21, 24, 30, 35 and 42 days (Experiment 1) and 22, 25, 28, 31 and 35 days (Experiment 2) after planting. In Experiment 1, plants were also...... analysed for total content of N and N-15. The mycorrhizal colonization rate increased during time: from 25 to 40% in Experiment 1 and from 50 to 60% in Experiment 2. Plant dry matter accumulation was unaffected by mycorrhizal colonization, except in Experiment 1 where shoot dry weights were slightly...

  15. El desempeño de grupos con responsabilidad personal

    Directory of Open Access Journals (Sweden)

    Alberto Alexander S.

    1982-01-01

    Full Text Available En este ensayo he identificado varias bases para poder interaccionar entre los miembros de un grupo. En particular he sugerido que una manera que he denominado el grupo de responsabilidad personal, permite a los participantes la posibilidad de experimentar libertad y responsabilidad, dos características valiosísimas en el potencial humano. He sugerido también un número de conceptos y técnicas que podrían usar un conjunto de personas, que deseen funcionar bajo la base de responsabilidad personal . REFERENCIAS Berne, E. Transactional analysis in psychotherapy. Nueva York: Grove Press, 1961. Deutsch, M., y Krauss, R. M. Studies of interpersonal bargaining. [ournal 01 Conilict Resoluiion, 1962, 6, 52-76. Di Marco, N. Life style, work group structure, compatibility, and job satisfaction. Academy 01 Management [ournal, 1975, 18, !l1!l-!l22. Gibb, J. R. Defensive communication. ]ournal 01 Comrmmication, 1961, 11, 141-148. Gordon, T. Parent eitectioeness training. Nueva York: New American Library, 1970. Freud, S. The interpretation 01 dreams. Traducido del alemán. Nueva York: Avon Books, 1965. Heider, J. Catharsis in encounter. [oumal 01 Humanistic Psychology, 1974, U, 27-48.

  16. Peril Motivacional de un grupo de estudiantes universitarios

    Directory of Open Access Journals (Sweden)

    María del Carmen Aguilar-Rivera

    2016-01-01

    Full Text Available El objetivo de este trabajo es presentar un peril motivacional de un grupo de 562 estudiantes universitarios argentinos. Se estudiaron las metas académicas de aprendizaje y rendimiento, junto a otras variables y factores intervinientes en la motivación, como ser la atribución causal interna y externa y la satisfacción académica en sus tres dimensiones, la proveniente de la actuación de los profesores, la social y la institucional. Por medio de un análisis clúster se encontraron tres grupos diferenciados, el clúster 1, (337 sujetos, co n metas de aprendizaje y de rendimiento altas; el clúster 2, (212 sujetos, con metas de aprendizaje altas y de rendimiento medias y el clúster 3, (13 sujetos, con metas de aprendizaje y de rendimiento medias. Los integrantes del clúster 1 con metas elevadas también presentaron medias más altas en las atribuciones causales y en la satisfacción académica. Prevalecen en los tres clústeres las metas de aprendizaje, pero en la mayoría de los sujetos se conirma la presencia de múltiples metas, hecho favorable para aprender en el ámbito académico.

  17. Grupo Poéticas Digitais: projetos desluz e amoreiras

    Directory of Open Access Journals (Sweden)

    Gilbertto Prado

    2010-01-01

    Full Text Available O Grupo Poéticas Digitais foi criado em 2002, no Departamento de Artes Plásticas da ECA-USP, com a intenção de gerar um núcleo multidisciplinar, promovendo o desenvolvimento de projetos experimentais e a reflexão sobre o impacto das novas tecnologias no campo das artes. O Grupo é um desdobramento do projeto wAwRwT, iniciado em 1995 por Gilbertto Prado e tem como participantes professores, artistas, pesquisadores e estudantes. O objetivo deste texto é apresentar algumas experimentações recentes de projetos poéticos como Desluz, de 2009/2010, e Amoreiras, de 2010.Poéticas Digitais Group was created in 2002 in the Visual Arts Department at ECA-USP to create a multidisciplinary center, promoting the development of experimental projects and reflection on the impact of new technologies in the field of arts. The Group is an unfolding of the wAwRwT project started in 1995 by Gilbertto Prado and has as participants lecturers, artists, researchers and students. The aim of this article is to present some recent experiments such as "desluz", (2009/2010 and "amoreiras".

  18. SISTEMA DE CONTROL INTELIGENTE PARA UN GRUPO DE ELEVADORES

    Directory of Open Access Journals (Sweden)

    Andrés Enrique Rosso Mateus

    2008-01-01

    Full Text Available En este artículo se trata el problema del tráfico vertical en edificios de gran altura y se describe el análisis, diseño y evaluación de un sistema de control para un grupo elevadores que busca mejorar el desempeño respecto a un sistema de control tradicional. El controlador propuesto busca asignar de una forma inteligente las llamadas que se generan a los ascensores que hacen parte del grupo, el desempeño del sistema se traduce en una reducción de los tiempos de servicio y de la energía que invierte el sistema. El controlador propuesto está basado en lógica difusa y las reglas de inferencia expresan el conocimiento de un experto orientado hacia la obtención de los objetivos mencionados. El controlador inteligente se evalúa en un simulador gráfico desarrollado para este fin, este simulador permite ingresar parámetros de configuración para que se adapte y represente una edificación real. Se corrieron dos simulaciones, una usando un controlador convencional y otra usando el controlador inteligente, esto con el fin de comparar su desempeño y cuantificar valores como tiempo de esperar de los usuarios y energía consumida por el sistema.

  19. REPRESENTACIONES DEL GRUPO SIMÉTRICO CON MATRICES ENTERAS

    Directory of Open Access Journals (Sweden)

    Fernando Novoa

    2002-12-01

    Full Text Available La representación de grupos de simetría es uno de los ternas en álgebra abstracta con más aplicaciones en la actualidad. El análisis espectral en diseño de experimentos, el diseño de redes de comunicación, la teoría de códigos, son algunos de los campos en donde esta teoría encuentra aplicación. A pesar de su utilidad, no siempre se encuentra a disposición del profesor y del estudiante una herramienta didáctica que le permita hacer ejemplos, cómputos y comprobaciones de los enunciados teóricos y se tiene que conformar con los ejemplos triviales que no le permiten ver realmente el grado de profundidad del concepto ni la complejidad del cálculo. El propósito de la siguiente nota es presentar un programa computacional para el sistema computacional CoCoA y en particular, ciertas rutinas que permiten calcular las representaciones irreducibles de los grupos de simetría en forma matricial, cuyas matrices tienen sus entradas enteras.

  20. Nivel de autotrascendencia en un grupo de adultos mayores mexicanos

    Directory of Open Access Journals (Sweden)

    Raúl Fernando Guerrero Castañeda

    2017-01-01

    Full Text Available Introducción: La autotrascendencia es una expansión multidimensional personal, una conexión con los demás, el entorno y/o una entidad superior, está relacionada con el bienestar personal del adulto mayor. Objetivo: Determinar el nivel de autotrascendencia de un grupo de adultos mayores mexicanos. Materiales y Métodos: Estudio descriptivo de corte transversal; realizado en tres centros gerontológicos de Celaya, Guanajuato, México, muestra probabilística aleatoria n=118. Se incluyeron adultos mayores que acudían a los centros gerontológicos, hombres y mujeres, ≥ 60 años. Se utilizó la Escala de Autotrascendencia en español con valor resultante entre 15 y 60 (mayor puntaje = mayor autotrascendencia. Se realizó prueba piloto con 40 adultos mayores con Alpha de Cronbach de 0.80. Análisis estadístico descriptivo para variables categóricas (frecuencias y porcentajes, para variables numéricas: medidas de tendencia central y dispersión. Resultados: Media de Autotrascendencia fue 51.36. Se identificaron con “Encontrando significado en mis creencias espirituales” (85.6% y “Disfrutando mi ritmo de vida” (81.4%; hubo diferencia estadísticamente significativa en la media de Autotrascendencia (p˂0.05 por sexo, siendo mayor el nivel en las mujeres. No hubo diferencia entre grupos de edad. Discusión y Conclusiones: La media de autotrascendencia refleja un nivel alto, en comparación con otros estudios y se reportó entre 75-84 años una media mayor. Los adultos mayores se identifican con características como la religión y el disfrute de la vida. La Escala de Autotrascendencia se puede usar en adultos mayores mexicanos ya que demostró un buen nivel de consistencia interna. Cómo citar este artículo: Guerrero RF, Lara R. Nivel de autotrascendencia en un grupo de adultos mayores mexicanos. Rev Cuid. 2017; 8(1: 1476-87. http://dx.doi.org/10.15649/cuidarte.v8i1.354

  1. Homicidas juveniles en Bogotá, estudio de grupos focales

    Directory of Open Access Journals (Sweden)

    Franklin Escobar Córdoba

    2015-07-01

    Materiales y Métodos. Estudio cualitativo mediante técnica de grupos focales. Resultados. Se encontró como el factor de riesgo más implicado la disponibilidad y uso de armas. Otros  factores de riesgo determinantes de la conducta delincuencial afectan la disposición del joven homicida para tener un comportamiento criminal y las estrategias de control que son elegidas por el individuo, dichos factores son apreciados de maneras distintas por los jóvenes homicidas y los no homicidas Conclusión. Este estudio arroja información clave que puede ser utilizada en el diseño e implementación de estrategias para enfrentar el homicidio juvenil como problema de salud pública.

  2. Perfis da província e máscaras da modernidade: uma leitura da correspondência de Gilberto Freyre com Manuel Bandeira, José Lins do Rego e Rodrigo Melo Franco de Andrade = Provincial sketches and masks of modernity: an interpretation of the Gilberto Freyre’s correspondence with Manuel Bandeira, José Lins do Rego and Rodrigo Melo Franco de Andrade

    Directory of Open Access Journals (Sweden)

    Dias, Silvana Moreli Vicente

    2014-01-01

    Full Text Available O objetivo deste artigo é interpretar a epistolografia de Gilberto Freyre com base no conceito de persona ou máscara. Dialogando com escrita mais grave, que beira o paroxismo e a tragédia pessoal e coletiva, de José Lins do Rego, bem como com as formas literárias aparentemente descomprometidas presentes nas cartas trocadas com Manuel Bandeira e Rodrigo Melo Franco de Andrade, articulam-se distintas personae na correspondência do ensaísta. Serão colocadas em pauta facetas ambíguas do escritor Gilberto Freyre, ao lado da tentativa de se refletir sobre aspectos da modernidade alternativa ou provinciana que lhes são subjacentes. Portanto, será possível perceber como os paradoxos presentes no ensaio social de Freyre ligam-se também às imagens contraditórias inscritas no tecido epistolar

  3. OS GRUPOS INDÍGENAS E OS DOCES BRASILEIROS

    Directory of Open Access Journals (Sweden)

    MÁRTIN CÉSAR TEMPASS

    2008-12-01

    Full Text Available ABSTRACT: In the books of Gilberto Freyre and Câmara Cascudo, that influencied so much the literature about brazilian alimentation, the participation of indigenous groups in the national sweets formation process is negligencied. However, is possible to find in book´s“interlineations” of these two authors valuables informations about indigenous contributions to this process. Starting from these two authors and based in the culinary system notion, this paper quests to situate the role of indigenous groups in the brazilian sweets formation and numbers the possibles causes to invisibility of sweets by indigenous at the culinary formation process.RESUMO: Nas obras de Gilberto Freyre e Câmara Cascudo, que tanto influenciaram a literatura sobre a alimentação brasileira, a participação dos grupos indígenas no processo de formação da doçaria nacional é negligenciada. Contudo, é possível encontrar nas“entrelinhas” das obras destes dois autores valiosas informações sobre as contribuições indígenas a este processo. A partir destes dois autores e baseado na noção de sistemas culinários, o presente artigo busca situar o papel dos grupos indígenas na formação da doçaria brasileira e elencar as possíveis razões para a invisibilidade da doçaria de origem indígena no processo de formação da culinária nacional.

  4. RESPONSABILIDAD INTERNACIONAL DEL ESTADO COLOMBIANO POR ACCIONES DE GRUPOS PARAMILITARES

    Directory of Open Access Journals (Sweden)

    Nataly Vargas Ossa

    2008-12-01

    Full Text Available El Sistema Interamericano constituye un espacio que permite observar la situación de los Derechos Humanos en América Latina, los mecanismos de protección a que acuden las víctimas y la actitud de los Estados frente a la promoción, protección y defensa de los Derechos Humanos. Bajo esta premisa es que el proyecto “Alcance y Descripción de los Derechos Humanos en el Sistema Interamericano de Protección de los Derechos Humanos”, utilizando el método dogmático documental, pretendió recopilar aquellas providencias que permiten recoger el concepto y el alcance que La Corte Interamericana ha desarrollado entorno a algunos Derechos Humanos, es así como el presente escrito hace parte de los resultados de dicho proyecto, el cual recopila las sentencias proferidas por la Corte Interamericana en contra del Estado Colombiano, por acciones de grupos paramilitares.El estado Colombiano en reiteradas oportunidades ha sido declarado internacionalmente responsable por violaciones a Derechos Humanos, debido a la conformación y apoyo de grupos “paramilitares“. En el presente escrito se busca retomar aquellas providencias emanadas de la Corte Interamericana, en lo que tiene que ver con la descripción y alcance de derechos por los cuales el Estado Colombiano ha sido condenado. En es orden de ideas son cuatro providencias objeto análisis del presente escrito: El Caso de los 19 Comerciantes, el Caso de la Masacre de Mapiripán, el Caso de las Masacres de Pueblo Bello, y el Caso de las Masacres de Ituango.

  5. Criminalidade, etnicidade e desigualdades análise comparativa entre os grupos nacionais dos PALOP e Leste Europeu e o grupo étnico cigano

    OpenAIRE

    Gomes, Sílvia Andreia da Mota

    2013-01-01

    Tese de doutoramento em Sociologia (área de especialização em Sociologia e Metodologia Fundamentais) Esta dissertação procura entender a problemática da criminalidade quando associada a grupos estrangeiros e étnicos em Portugal, designadamente os estrangeiros dos PALOP e Leste europeu e o grupo étnico cigano. A análise desta questão fez-se sob um triplo ponto de vista: pela recolha das representações sociais em torno das práticas criminais destes grupos sociais construídas e...

  6. Diferencias conductuales y cognitivas en dos grupos de escolares con TDAH intervenidos con Arteterapia -vsMetilfenidato y un grupo control

    Directory of Open Access Journals (Sweden)

    M. Aurora G. Gallardo Saavedra

    2018-01-01

    el WISC-IV. Resultados. Se encontraron diferencias conductuales al inicio inter grupos en 4 subescalas y después del tratamiento en 5, en “hiperactividad” para el grupo “A” y funciones ejecutivas en el “B”, los cambios cognitivos en el índice de comprensión verbal entre “B” y ”C” e Índice de velocidad de procesamiento para el grupo “A”. Discusión y conclusiones los resultados sugieren que el arteterapia podría mejorar la conducta pero no la cognición.

  7. El control entre las sociedades y la constitución del grupo la protección de los socios externos en los grupos de sociedades

    OpenAIRE

    Martínez-Gijón Machuca, Pablo

    1998-01-01

    Se estudian los grupos de sociedades desde un punto de vista jurídico, en cuanto que el desarrollo de los grupos implican un cambio notable en el funcionamiento de las sociedades que los integran, lo que debe ser tenido en cuenta por los legisladores para establecer las correspondientes consecuencias jurídicas. El trabajo se divide en tres partes bien diferenciadas. La primera de ellas tiene por objeto el régimen jurídico aplicable a los grupos de sociedades, y se desarrolla en los capítulos...

  8. Crisis empresarial al interior de un grupo de sociedades – Responsabilidad-

    Directory of Open Access Journals (Sweden)

    Camilo Enrique Cubillos Garzón

    2005-01-01

    Full Text Available En el presente artículo describiremos: Qué es un Grupo de Sociedades; Cuál es la relación entre el Grupo Empresarial con el Derecho de Sociedades, el Mercado y la Economía; y finalmente, Cuál es la responsabilidad dentro de un Grupo Empresarial en situación de crisis llevada a cabo por un gestor oculto.

  9. Grupos avicaptores del Tardiglaciar : las aves de Berroberria

    Directory of Open Access Journals (Sweden)

    C. Diez Fernandez-Lomana

    1995-01-01

    Full Text Available En este artículo presentamos un estudio sobre marcas de cortes en aves de Berroberria. Los restos proceden de un nivel Magdaleniense superior final datable mediante C14 y con la ayuda de estudios palinológicos y arqueológicos. Los restos avianos pertenecen a la especie Lagopus mutus (perdiz nival y evidencian la caza de esta especie por grupos humanos. El estudio realizado plantea la existencia de poblaciones que recurrían a la caza de aves en épocas del año concretas, las cuales desarrollaron una estrategia de descuartizamiento primario en el lugar de caza y de descarnación en la cavidad. La ausencia de restos avianos quemados, y la minuciosidad en el desmembramiento y deshuesado, implican una búsqueda de carne aviar para un consumo no inmediato. Se postula un acopio de carne, con técnicas de secado y ahumado, para ulteriores necesidades alimenticias, ligadas al encarecimiento de los recursos durante el invierno. Las especies avianas presentes aportan algunas notas sobre las consiciones climáticas que imperaban en la zona.

  10. El desarrollo de la identidad de grupo andaluza

    Directory of Open Access Journals (Sweden)

    Marina Apaydin

    2014-07-01

    Full Text Available A lo largo de sus 700 años de historia, Al-Andalus tuvo de forma consistente la imagen de “Paraíso terrenal” a pesar de sus continuos problemas económicos, sociales y políticos y amenazas externas. Este estudio intenta explicar cómo se creó la Identidad Andaluza, cuáles fueron sus principales características, porqué se consideraron un grupo que desarrollaba admiración y cómo esta información ha sido mantenida y transmitida a lo largo del tiempo. Esta investigación tuvo lugar en 2005 en el Sur de España, zona antaño llamada Al-Andalus. Una combinación de fuentes primarias y secundarias, junto a artefactos visuales de naturaleza histórica sirven de base para este análisis. La base teórica para este trabajo fue desarollada utilizando diferentes teorías sociales de los autores Bourdieu, Ringrose, Piaget, Cavalli-Sforza y Maslow.

  11. Inseguridad alimentaria en latinos de California: observaciones de grupos focales

    Directory of Open Access Journals (Sweden)

    Melgar-Quiñonez Hugo

    2003-01-01

    Full Text Available OBJETIVO: Estudiar la percepción y la experiencia sobre inseguridad alimentaria entre latinoamericanos de California, así como su interpretación de los insumos incluidos en la Escala de Seguridad Alimentaria. MATERIAL Y MÉTODOS: Entre noviembre y diciembre de 2000, en los condados californianos de Solano y San Joaquín, se efectuaron cuatro grupos focales, con 30 adultos de origen latinoamericano residentes allí. Los comentarios de los participantes fueron codificados por dos investigadores para determinar los temas principales, y fueron confrontados para verificar su convergencia. RESULTADOS: Las preguntas fueron bien comprendidas, no percibiéndose como ofensivas. El marco conceptual se confirmó como "proceso manejado" con diferentes niveles de severidad. Las causas de inseguridad alimentaria identificadas fueron: desempleo, alto costo de algunos alimentos y falta de información nutricional. La necesidad de educación nutricional fue una constante. CONCLUSIONES: Para interpretar datos nacionales de inseguridad alimentaria en latinoamericanos es esencial considerar su percepción particular de ese fenómeno.

  12. COMPETENCIAS EN ESCRITURA DE UN GRUPO DE ESTUDIANTES DE LA

    Directory of Open Access Journals (Sweden)

    Myriam Pastora Arias Agudelo

    2012-12-01

    Full Text Available Se presentan los resultados del análisis de las habilidades en escritura de un grupo de estudiantes de la Facultad de Odontología de la Universidad Nacional de Colombia. Se evaluaron las características gramaticales de coherencia y cohesión en textos académicos escritos en la asignatura Ortodoncia, Crecimiento y Desarrollo. Se utilizó un formato en programa Word®, que fue diligenciado por los estudiantes. Se empleó una plantilla para revisión de textos académicos y los datos obtenidos se incluyeron en Excel®. Se realizó el análisis estadístico con el paquete SPSS Versión 19® y con el fin de corroborar la relación entre algunas de las variables cuantitativas e identificar patrones de asociación entre pares de variables cualitativas, se realizaron seis cruces bivariados y cinco multivariados. Los resultados reflejan competencias gramaticales bajas (0-35% que limitan las capacidades de los estudiantes para expresar ideas de forma adecuada a través de textos académicos.

  13. Homicidas juveniles en Bogotá, estudio de grupos focales

    Directory of Open Access Journals (Sweden)

    Franklin Escobar-Córdoba

    2015-07-01

    Full Text Available Antecedentes. La violencia ha sido declarada un problema de salud pública mundial. En los últimos años, se ha visto un incremento alarmante de la violencia causada por adolescentes, reflejado en indicadores como el número de homicidios. Los adolescentes son victimarios y víctimas de muchos de estos actos violentos. Colombia no escapa a este fenómeno -donde el homicidio es la principal manera de muerte violenta- y se cuenta con pocos estudios en población homicida juvenil. Objetivo. Explorar comportamientos asociados a cometer homicidio en jóvenes escolarizados y población no escolarizada. Materiales y métodos. Estudio cualitativo mediante técnica de grupos focales. Resultados. Se encontró como el factor de riesgo más implicado la disponibilidad y uso de armas. Otros factores de riesgo afectan la disposición del joven homicida para tener un comportamiento criminal y las estrategias de control que son elegidas por el individuo. Dichos factores son apreciados de maneras distintas por los jóvenes homicidas y los no homicidas. Conclusión. Este estudio arroja información clave que puede ser utilizada en el diseño e implementación de estrategias para enfrentar el homicidio juvenil como problema de salud pública.

  14. Una separación artificial: Grupos yumanos de México y Estados Unidos

    OpenAIRE

    Miguel Wilken Robertson

    1993-01-01

    Los grupos indígenas sobrevivientes de Baja California están vinculados estrechamente por lazos de lengua, cultura e historia con los grupos indígenas del sur de California y Arizona; todos estos grupos integran la región yumana- Este artículo examina la importancia de cada uno de los grupos yumanos bajaca1ifornianos dentro del contexto de la región como una totalidad, en lugar de separarlos arbitrariamente en yumanos mexicanos y estadounidenses. Se analizan algunos de los elementos paralelos...

  15. Estereótipos sociais do idoso para diferentes grupos etários

    OpenAIRE

    Tatiana de Lucena Torres; Brigido Vizeu Camargo; Bousfield,Andréa Barbará S.

    2016-01-01

    RESUMO O objetivo deste estudo foi identificar estereótipos de idosos para diferentes grupos etários. Foram realizados oito grupos focais com cinco integrantes cada. Foram utilizadas 12 fotografias de pessoas e 70 cartões com adjetivos atribuídos ao idoso. Os participantes (40) foram divididos por sexo e grupo etário. Destes, 30 relataram contato diário com idosos. Para os idosos, idade foi o principal critério de categorização, seguido de etnia. Para os outros grupos, o principal critério fo...

  16. CONVERSANDO SOBRE SEXUALIDADE COM FILHOS ADOLESCENTES: O OLHAR DE MÃES DE GRUPOS POPULARES

    OpenAIRE

    Sabrina Dal Ongaro Savegnago

    2014-01-01

    O presente estudo teve como objetivo conhecer a percepção de mães de grupos populares acerca do diálogo sobre sexualidade com seus filhos adolescentes. Com este intuito, realizou-se um estudo qualitativo, do qual participaram mães de adolescentes usuárias de um Centro de Referência de Assistência Social (CRAS) de uma cidade do interior do Rio Grande do Sul. Foram realizadas nove entrevistas e dois grupos focais, com a presença de três a cinco participantes por grupo. Os grupos e as entrevista...

  17. El carácter híbrido de las dinámicas grupales online: del grupo de discusión al grupo focal

    Directory of Open Access Journals (Sweden)

    Francisco Javier Parada Dueñas

    2013-07-01

    Full Text Available Este artículo reflexiona sobre formas de acceder a la realidad social a través del uso de metodologías de investigación online que tienen características híbridas. Primero se dan algunas claves para la construcción y ejecución de grupos de discusión en un contexto online. Una de las características centrales de esta técnica es su composición híbrida, moviéndose entre lo que sería un grupo de discusión y un grupo focal. El paso de la mediación a la conducción marca fuertemente la transición de una fase de grupos de discusión a una fase de grupo focal. Segundo, se reflexiona sobre Facebook y algunos posibles usos que se le puede dar a esta red social digital con la finalidad de llevar a cabo de mejor manera técnicas de investigación aplicadas al contexto online. En este sentido, se reflexiona sobre el avatar o perfil de Facebook en dos direcciones: para efectos de la composición muestral de un grupo de discusión online y como material que ayuda al análisis de las posiciones discursivas que tienen los sujetos estudiados.

  18. Prueba de grupo. Una eficiente alternativa para estimar prevalencia animal

    Directory of Open Access Journals (Sweden)

    Osval Antonio Montesinos López

    2012-01-01

    Full Text Available La estimación de prevalencia animal o detección de agentes infecciosos, es de vital importancia para una nación o estado para proteger su seguridad alimentaria y garantizar el comercio local y exterior. Sin embargo, realizar estas dos tareas (estimación y detección eficientemente requiere de significativos recursos materiales y humanos. Por ello, el presente artículo presenta una revisión del proceso de estimación y detección usando la técnica estadística conocida como prueba de grupo (group testing que puede contribuir al ahorro de recursos cuantiosos para la estimación y detección de enfermedades infecciosas en ciencia animal cuando la prevalencia es menor o igual al 10%. Group testing es una ingeniosa técnica estadística propuesta por Dorfman (1943. Esta técnica consiste en juntar el material de k individuos, mezclarlos perfectamente y en lugar de realizar una prueba de laboratorio para cada individuo, se realiza una sola prueba con la mezcla de los k individuos. De esta forma se logran ahorros significativos. Por ello, se muestra el funcionamiento de algunos métodos para clasificar individuos; se expone el proceso de estimación puntual y por intervalo de prevalencia animal; y se ilustra el cálculo del tamaño de muestra bajo este modelo, con la finalidad de que los investigadores en ciencia animal la utilicen y ahorren recursos significativos.

  19. In vitro culture of Cucumis sativus L. VI. Histological analysis of leaf explants cultured on media with 2, 4-D or 2, 4, 5-T

    Directory of Open Access Journals (Sweden)

    Anna Nadolska-Orczyk

    2014-01-01

    Full Text Available The developmental sequence of callus initiation and somatic embryogenesis in leaf explants of Cucumis sativus cv. Borszczagowski was analysed and compared on media containing two different auxin phenoxy-derivatives (2,4-D and 2,4,5-T and cytokinin (BAP or 2iP. During the first 20 days of culture on media with 2,4,5-T proliferation of parenchymatic tissue occurred mainly and only small meristematic centers were observed. There was an intensive detachment of parenchymatic cells and dissociation of their cell walls near vessels and in the lower part of the explant adjacent to the medium. These cells were strongly plasmolysed. On the 2,4-D containing medium mostly meristematic tissue developed, proliferating around vascular bundles and forming meristematic centers or promeristem-like structures. After 35-50 days of culture, secondary callus was formed by separation of meristematic cells from the meristem surface in explants cultured on the 2,4-D containing medium. On medium supplemented with 2, 4, 5-T the detachment of parenchymatic and meristematic cells occurred, along with formation of a gel-like substance. The gel-like callus contained multi-cellular aggregates, proembryoids and embryoids. This type of callus tissue was initiated more intensively on medium with 2, 4, 5-T, but the frequency of somatic embryogenesis was much lower. The periferial cells of aggregates, proembryoids and embryoids showed the tendency to separate from the surface of the tissue. Many embryoids formed adventitious embryos.

  20. Grafting of Cucumis sativus onto Cucurbita ficifolia leads to improved plant growth, increased light utilization and reduced accumulation of reactive oxygen species in chilled plants.

    Science.gov (United States)

    Zhou, Yanhong; Zhou, Jie; Huang, Lifeng; Ding, Xiaotao; Shi, Kai; Yu, Jingquan

    2009-09-01

    The effects of chilling at 14 and 7 degrees C on plant growth, CO(2) assimilation, light allocation, photosynthetic electron flux and antioxidant metabolism were examined in cucumber (Cucumis sativus L. cv. Jinyan No. 4, CS) plants with figleaf gourd (Cucurbita ficifolia Bouché, CF) and cucumber as rootstocks, respectively. Growth inhibition by chilling at 7 degrees C was characterized by irreversible inhibition of CO(2) assimilation in grafted plants with cucumber as rootstock and scion (CS/CS) but this effect was significantly alleviated by grafting onto CF roots (CS/CF). Chilled CS/CF plants exhibited a higher photosynthetic activity and lower proportion of energy dissipation than chilled CS/CS plants. Chilling resulted in a greater decrease in the electron flux in photosystem (PS) II (J (PSII)) than the rate of energy dissipation either via light-dependent (J (NPQ)) or via constitutive thermal dissipation and fluorescence (J (f,D)) in CS/CS plants. In parallel with the reduction in J (PSII), electron flux to oxygenation (J (o)) and carboxylation by Rubisco (J (c)) all decreased significantly whilst alternative electron flux in PS II (J (a)) increased, especially in CS/CS plants. Moreover, CS/CF plants exhibited higher activity of antioxidant enzymes, lower antioxidant content and less membrane peroxidation relative to CS/CS plants after chilling.

  1. Synchrotron micro-XRF and micro-XANES confirmation of the uptake and translocation of TiO₂ nanoparticles in cucumber (Cucumis sativus) plants.

    Science.gov (United States)

    Servin, Alia D; Castillo-Michel, Hiram; Hernandez-Viezcas, Jose A; Diaz, Baltazar Corral; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L

    2012-07-17

    Advances in nanotechnology have raised concerns about possible effects of engineered nanomaterials (ENMs) in the environment, especially in terrestrial plants. In this research, the impacts of TiO(2) nanoparticles (NPs) were evaluated in hydroponically grown cucumber (Cucumis sativus) plants. Seven day old seedlings were treated with TiO(2) NPs at concentrations varying from 0 to 4000 mg L(-1). At harvest, the size of roots and shoots were measured. In addition, micro X- ray fluorescence (micro-XRF) and micro X-ray absorption spectroscopy (micro-XAS), respectively, were used to track the presence and chemical speciation of Ti within plant tissues. Results showed that at all concentrations, TiO(2) significantly increased root length (average >300%). By using micro-XRF it was found that Ti was transported from the roots to the leaf trichomes, suggesting that trichomes are possible sink or excretory system for the Ti. The micro-XANES spectra showed that the absorbed Ti was present as TiO(2) within the cucumber tissues, demonstrating that the TiO(2) NPs were not biotransformed.

  2. La perspectiva de la minoría: estereotipos y emociones entre grupos inmigrantes

    Directory of Open Access Journals (Sweden)

    Isabel Cuadrado

    Full Text Available Este trabajo se centra en la perspectiva de la minoría, y analiza las evaluaciones que los tres grupos inmigrantes más representativos en España mantienen entre sí a partir de las variables contempladas en el modelo del contenido de los estereotipos (MCE. Participaron 409 inmigrantes, que evaluaron a los otros dos grupos: los inmigrantes marroquíes fueron evaluados por ecuatorianos (grupo EM, N = 66 y rumanos (RM, N = 76; los inmigrantes rumanos por ecuatorianos (ER, N = 65 y marroquíes (MR, N = 62; y los inmigrantes ecuatorianos por rumanos (RE, N = 80 y marroquíes (ME, N = 60. Todos ellos indicaron cómo percibían al grupo correspondiente en moralidad, sociabilidad y competencia, en qué grado experimentaban las emociones de admiración, desprecio, envidia y compasión, así como su percepción de estatus y competición exogrupal. Los resultados con grupos minoritarios apoyan, en general, las predicciones del MCE ya confirmadas con miembros de grupos mayoritarios. El grupo más valorado en estatus y estereotipos fue el ecuatoriano (coincidiendo con las valoraciones de la mayoría, el cual también despertaba más admiración. Los resultados se discuten abordando la aplicabilidad del MCE para analizar las relaciones entre grupos minoritarios.

  3. La geometría de Minkowski a partir del grupo de Lorentz

    OpenAIRE

    Medina, Jael Inés; Luque, Carlos Julio

    2008-01-01

    Se hace una presentación de los fundamentos de la geometr´ıa de Minkowski tomando como base el grupo de transformaciones de Lorentz, siguiendo las directrices del programa de Erlangen propuesto por Felix Klein, estudiando las formas invariantes del grupo de transformaciones.

  4. Actores no estatales: grupos armados, milicias, señores de la guerra, grupos criminales organizados y paramilitares. ¿Pueden acaso estos grupos cometer crímenes internacionales conforme al Derecho penal internacional?

    Directory of Open Access Journals (Sweden)

    Mónica Rocha Herrera

    2016-03-01

    Full Text Available El legado de los tribunales penales internacionales de la ONU, el ICTY y el ICTR han sido claros y consistentes en una jurisprudencia conducente a responder de manera afirmativa que aquéllos grupos de individuos conformados por actores ‘No Estatales’ como grupos armados, milicias, señores de la guerra, paramilitares e incluso grupos criminales organizados son susceptibles de cometer crímenes internacionales conforme al derecho penal internacional, a saber, genocidio, crímenes de lesa humanidad y crímenes de guerra. La Corte Penal Internacional ha asumido este legado y hoy sabemos que, con o sin la complicidad de las autoridades del Estado, y a partir de la escasa jurisprudencia de la Corte Penal Internacional, estos grupos cometen crímenes de guerra como bien se estableció en la sentencia de Lubanga del 2012 y en Katanga del 2014 respectivamente. Crímenes de lesa humanidad a partir concretamente de la Decisión de Apertura de una Investigación para Kenia en 2010 donde la Sala a pesar de discrepancias adoptó la posición de que estos grupos organizados, con algún tipo de jerarquía y capaces de infringir los derechos humanos pueden ser considerados ‘organización’ en el sentido del artículo 7 del Estatuto de Roma. La comisión de genocidio por estos grupos en la CPI no la encontramos aún, pero el legado dejado por el ICTR y el ICTY es poderoso y elocuente.

  5. Grupos económicos y productividad en Colombia, una mirada a la encuesta anual manufacturera

    Directory of Open Access Journals (Sweden)

    María Fernanda Murcia-Sandoval

    2011-06-01

    Full Text Available Este trabajo muestra las diferencias en la productividad entre los establecimientos industriales que pertenecen a empresas de grupos económicos colombianos y los establecimientos de empresas independientes para el periodo 1995-2006. Si bien la productividad es más alta para los establecimientos de grupos que para los individuales, esto se debe a que las empresas de los grupos se encuentran en sectores con mayor productividad y no al efecto de pertenencia a grupo que, de hecho, resulta negativo en un análisis de datos panel. De otro lado, los establecimientos de grupos tienden a invertir más en activos fijos que los independientes.

  6. Psicoterapia de grupo em hospital-dia psiquiátrico

    Directory of Open Access Journals (Sweden)

    Ana Celina Pires de Campos Guimarães

    2009-12-01

    Full Text Available Este estudo objetivou estudar a psicoterapia de grupo em um hospital-dia psiquiátrico, caracterizando os pacientes dos grupos, os temas discutidos, a frequência das verbalizações e o manejo terapêutico das sessões. O método foi quanti-qualitativo, categorial temático. Os pacientes eram heterogêneos e os grupos abertos, com duração de uma hora. Emergiram dos grupos seis categorias temáticas. Os pacientes verbalizaram 56% do total das 2.459 falas. No manejo técnico das sessões predominou o apoio, a ênfase no aqui-e-agora e a estrutura na condução dos grupos. Concluiu-se que, nas sessões analisadas, houve espaço para a fala dos pacientes, sendo estas manejadas terapeuticamente.

  7. Grupo escolar en Irurzun - Navarra - España

    Directory of Open Access Journals (Sweden)

    Guibert Tabar, J.

    1978-10-01

    Full Text Available The formal characteristics of this school complex are determined by the large roofs and the angled shape of the floorplans. The first is as a consequence of the interest in achieving a unity of concept and volume, at the same time maintaining the architectural tradition of the area. Insofar as the angular shape, this is the response to the idea of obtaining ideal conditions of light in each of the classrooms. The building consists of three upper levels, ground floor and semi-basement. In the last of these are found: the gymnasium, the dressing rooms for students and the technical premises serving the school. The ground floor, where the main access is found, includes a small administrative area, the dining room and kitchen, one classroom for girls, three for pre-school children, four for boys and one multifunctional room. The rest of the floors, with the same arrangement, house eight classrooms for girls and five for boys, along with a series of auxiliary premises, such as teachers' rooms, libraries, classrooms for various uses, archives, rooms for crafts, etc. . The construction is completed with an ample sports area and recreation zone.

    Las características formales de este grupo escolar —proyectado en 1969— vienen determinadas por las grandes cubiertas y la forma dentada de las plantas. La primera de ellas es consecuencia del interés por lograr una unidad de concepto y de volumen, manteniendo, al mismo tiempo, la tradición arquitectónica de la zona. En cuanto a la forma dentada, es la respuesta a la idea de obtener unas óptimas condiciones de iluminación en cada una de las aulas. El edificio se compone de tres niveles superiores, planta baja y semisótano. En este último se hallan: el gimnasio, los vestuarios de alumnos y los locales técnicos que sirven a la escuela. La planta baja, en la que se encuentra el acceso principal, comprende una pequeña zona administrativa, el comedor con su cocina, una clase de niñas, tres

  8. Triyodotironina, tiroxina y comportamiento reproductivo en diferentes grupos raciales bovinos

    Directory of Open Access Journals (Sweden)

    Campos Gaona Rómulo

    1995-12-01

    Full Text Available

    The thyroid gland were reported in adaptation to climate variations, specially to dairy cows. The objetive of present paper is study thyroid function in the diversus breeds under tropical environmental conditions. The breeds were: Holstein Friesian, BON (White Ear-Black, native breed of Colombia, Gucerat, Holstein X Gucerat, BON x Gucerat, Brown Swiss x Gucerat. The Serie levels of T and T4 were analized for RIA Technique; the interval partum-partum (IPP is evaluated for individual breed. The relationships of the thyroids hormones levels with IPP showed statistical difference for BON and Holstein breeds. It is a adaptative conditions for native BON's breed.

    Se estudiaron los valores de T3 y T4  en seis grupos raciales, 5 de origen Bos taurus y uno Bos indicus, en simulares Condiciones de ecohabitat, nutrición y manejo con el fin de dilucidar los valores hormonales y su posible relación con el comportamiento reproductivo, medido como intervalo entre partos (lEP. Los valores séricos de T3  (1.39 ± 0.31 nmol/L y T4 (41.84 ± 8.89 nmol/L, en 85 vacas multíparas se encuentran dentro de los valores de referencia reportados. El análisis estadístico mostró diferencias significativas (P<0.05 entre BON puro (1.250 ± 0.161 T Y 50.079 ± 7.274 T4 y  Holstein Friesian (1.628 ± 0.453 T3  y 43.353 ± 10.461 T4 lo cual permite plantear que la adaptación de animales productivos en condiciones tropicales se puede estudiar mediante la valoración endocrina de la actividad tiroidea. El intervalo entre partos (416.15 días, se puede considerar como aceptable para las condiciones del estudio.

  9. TAREA Y COMPETENCIA COMUNICATIVAS: REFLEXIONES DESDE UN GRUPO FOCAL*

    Directory of Open Access Journals (Sweden)

    Mercedes Vallejo Gómez

    2011-08-01

    Full Text Available El objetivo de este artículo es describir una propuesta de gestión del aprendizaje de lenguas extranjeras, concebida a partir de la identificación y la estructuración de la tarea comunicativa como eje articulador para el desarrollo de la competencia comunicativa. Para ello se realizó un trabajo investigativo fundamentado en la investigación-acción, bajo el acompañamiento de profesores participantes, con la intención de generar un trabajo colaborativo de reflexión, diálogo crítico y transformación (Burns, 1999. Se configuró un grupo focal, se realizaron diarios de campo, se aplicó una encuesta diagnóstica, entrevistas semiestructuradas a docentes y se construyó colaborativamente una guía de gestión del aprendizaje y enseñanza de la lengua extranjera. Como resultado, se obtuvo la configuración de un documento guía (como uno de los hallazgos parciales de la investigación en curso, que contempla la competencia comunicativa como parte de una concepción integral de lengua que pone en juego agentes sociales en situaciones específicas de comunicación intercultural y que tiene en cuenta la definición de una tarea comunicativa; la planeación de tareas previas conducentes al logro de la tarea comunicativa; la evaluación de la tarea por medio de estrategias formativas; la activación de estrategias de aprendizaje; el desarrollo de tareas en ambientes presencial y virtual, y la reflexión del profesor una vez se ha terminado el ciclo. La resignificación de las actividades propuestas por los profesores, en relación con el proceso de aprendizaje de una lengua extranjera, se constituye en un factor integrador para el desarrollo de una tarea comunicativa que cuenta con inputs y outputs que se configuran en una serie de instrumentos diversos, los cuales involucran condiciones de comprensión, interacción y producción.

  10. Os grupos-nome: efeitos da substituição do imaginário pelo virtual na constituição dos grupos sociais

    OpenAIRE

    Carvalho,João Eduardo Coin de

    2002-01-01

    Os grupos sociais categoriais são alvo, desde o pós-guerra, de uma intenso esforço de compreensão e demarcação conceitual, principalmente por parte dos psicólogos sociais europeus. A ampliação desta importância na pauta dos pesquisadores se deve ao aumento da presença relativa deste tipo de grupo no cenário das relações sociais e de suas conseqüências na produção das identidades sociais. Neste trabalho indicamos como o crescimento da importância dada aos grupos categoriais acompanha o esvazia...

  11. MOTRICIDAD EN UN GRUPO DE PERSONAS CON NECESIDADES EDUCATIVAS ESPECIALES

    Directory of Open Access Journals (Sweden)

    P. Linares

    2010-09-01

    Full Text Available

    RESUMEN

    Aunque va incrementándose la literatura sobre una materia tan incipiente como la “Actividad Motriz Adaptada”, aún son escasos en nuestro país los estudios que abordan científicamente este tema. Así pues, en este artículo se presenta un trabajo de investigación basado en la actividad motriz, y que fue llevado a cabo con un alumnado que tiene necesidades educativas especiales.
    Siendo el propósito del presente estudio, el valorar los niveles motor y cognitivo-motriz alcanzados por un grupo de alumnos/as con discapacidad psicofísica, tras intervenir con un programa de actividad motriz adaptada.
    La programación estuvo enmarcada dentro de la reforma del Sistema educativo, y basada en las directrices que establece el MEC (1995 para el alumnado escolarizado en Centros de Educación Especial.
    El diseño experimental utilizado fue de tipo “intrasujeto” con medidas pretest y postest. Las variables dependientes estudiadas fueron la edad motriz y el nivel cognitivo-motor, y la independiente el propio Programa de Actividad Motriz Adaptada.
    Los resultados obtenidos fueron significativos en favor de un incremento de los aspectos motores y cognitivomotrices de todos los sujetos. Lo que nos permite concluir la importancia que tiene la Motricidad para este alumnado con necesidades educativas especiales permanentes.
    PALABRAS CLAVE: Necesidades educativas especiales, niños/as, aspectos cognitivo-motrices, adaptación curricular significativa, actividad motriz adaptada

     

    ABSTRACT

    Although literature about an incipient subject like “Adapted Motor Activity” increases day by day, the studies which approach in a scientific way this subject are not many in our country. So, in this article a research based on motor activity is

  12. Proceso de psicoterapia puntual en grupo y exploración comparativa de funcionamiento psíquico en dos grupos de adolescentes institucionalizados

    OpenAIRE

    Trevisi Fuentes, Hugo Andrés

    2012-01-01

    En este estudio de intervención-investigación, se exploraron cinco dimensiones de la metapsicología psicoanalítica y el funcionamiento grupal (n=6) de dos grupos de adolescentes institucionalizados con vivencias de maltrato infantil, bajo la guía teórica y técnica de Freud-Klein-Bion-Meltzer-Kaës. El análisis comparativo de los dos grupos y sus individuos de adolescentes fue hecho usado la terapia puntual y se exploraron la diferencias psíquicas entre adolescentes que habían sido abandonados ...

  13. Abordagem do enfermeiro no grupo educativo com gestantes candidatas à laqueadura

    Directory of Open Access Journals (Sweden)

    Arlete de Souza Barros

    1993-06-01

    Full Text Available Enfocamos neste trabalho a abordagem do enfermeiro enquanto coordenador de grupo educativo com gestantes candidatas à laqueadura. Enfatizamos a necessidade de um referencial teórico específico para trabalharmos com grupos de pacientes. Queremos evidenciar também o papel de educador inerente ao enfermeiro e a importância da sua atuação na equipe multiprofissional da área de saúde. A metodologia do grupo educativo é suscintamente descrita, na forma de um protocolo, que apresentamos como sugestão para o desenvolvimento de atividades semelhantes.

  14. Brassinosteroids-Induced Systemic Stress Tolerance was Associated with Increased Transcripts of Several Defence-Related Genes in the Phloem in Cucumis sativus.

    Directory of Open Access Journals (Sweden)

    Pingfang Li

    Full Text Available Brassinosteroids (BRs, a group of naturally occurring plant steroidal compounds, are essential for plant growth, development and stress tolerance. Recent studies showed that BRs could induce systemic tolerance to biotic and abiotic stresses; however, the molecular mechanisms by which BRs signals lead to responses in the whole plant are largely unknown. In this study, 24-epibrassinosteroid (EBR-induced systemic tolerance in Cucumis sativus L. cv. Jinyan No. 4 was analyzed through the assessment of symptoms of photooxidative stress by chlorophyll fluorescence imaging pulse amplitude modulation. Expression of defense/stress related genes were induced in both treated local leaves and untreated systemic leaves by local EBR application. With the suppressive subtractive hybridization (SSH library using cDNA from the phloem sap of EBR-treated plants as the tester and distilled water (DW-treated plants as the driver, 14 transcripts out of 260 clones were identified. Quantitative Real Time-Polymerase Chain Reaction (RT-qPCR validated the specific up-regulation of these transcripts. Of the differentially expressed transcripts with known functions, transcripts for the selected four cDNAs, which encode an auxin-responsive protein (IAA14, a putative ankyrin-repeat protein, an F-box protein (PP2, and a major latex, pathogenesis-related (MLP-like protein, were induced in local leaves, systemic leaves and roots after foliar application of EBR onto mature leaves. Our results demonstrated that EBR-induced systemic tolerance is accompanied with increased transcript of genes in the defense response in other organs. The potential role of phloem mRNAs as signaling components in mediating BR-regulated systemic resistance is discussed.

  15. Factors influencing cucumber (Cucumis sativus L. somatic embryogenesis. I. The crucial role of pH and nitrogen in suspension culture

    Directory of Open Access Journals (Sweden)

    Tadeusz Wróblewski

    2014-01-01

    Full Text Available A method of obtaining and the characteristics of an embryogenic stabilised cucumber (Cucumis sativus L. suspension culture which has many similarities to the carrot model are presented. The Specific Type I cells and proembryogenic mass were present in such a suspension. The maintenance of the proembryogenic stage took place in medium containing 2,4-D as the sole growth regulator, subsequent stages of embryogenesis occurred in hormone-free medium. Embryonic structures were also observed in medium with auxin in the late stages of growth, probably due to the depletion of 2,4-D in the medium during subculture. The choice of the proper inorganic nitrogen sources and the maintenance of correct proportions between them had a significant effect on the formation of these structures. We have shown that the pH of the medium with an embryogenic culture became stabilized regardless of the initial pH value and depended on the medium composition. The inoculum used for the initiation of subsequent subcultures of the stable suspension culture was 1 part tissue to 300 parts medium and was small in comparison to the systems described for the cucumber so far. From 1 ml of basic suspension 7 embryos were obtained on medium without growth regulators 10 days after inoculation, and this amount increased to 21 after 3 weeks. From 3.2% of the somatic embryos it was posible to regenerate plants. The high yield and synchronisation of the process and the development of embryos without passing through callus tissue create the possibility of using this system for molecular investigations and in the technology of somatic seed production.

  16. Una separación artificial: Grupos yumanos de México y Estados Unidos

    Directory of Open Access Journals (Sweden)

    Miguel Wilken Robertson

    1993-05-01

    Full Text Available Los grupos indígenas sobrevivientes de Baja California están vinculados estrechamente por lazos de lengua, cultura e historia con los grupos indígenas del sur de California y Arizona; todos estos grupos integran la región yumana- Este artículo examina la importancia de cada uno de los grupos yumanos bajaca1ifornianos dentro del contexto de la región como una totalidad, en lugar de separarlos arbitrariamente en yumanos mexicanos y estadounidenses. Se analizan algunos de los elementos paralelos de la tradición oral de los kumiai, paipai, kiliwa, cucapá, yavapai y hualapai, mostrando que un acercamiento comparativo transregional puede arrojar nuevas luces en el campo de la investigación de la historia antigua de los yumanos.

  17. Percepciones y practicas corporales esteticas de un grupo de jovenes universitarias Afrodescendientes de Cali

    National Research Council Canada - National Science Library

    Ortiz Piedrahita, Vanessa

    2013-01-01

    Este articulo presenta los principales resultados de un estudio cualitativo sobre los sentidos y practicas corporales elaboradas por un grupo de estudiantes Afrodescendientes a proposito de su propio cuerpo y apariencia...

  18. Percepciones y practicas corporales esteticas de un grupo de jovenes universitarias Afrodescendientes de Cali

    National Research Council Canada - National Science Library

    Ortiz Piedrahita, Vanessa

    2013-01-01

    .... Se discute como este grupo de jovenes estudiantes reproduce parcialmente ideales hegemonicos de belleza transmitidos socio-culturalmente, y en esta medida recrea un modelo estetico hibrido que valora...

  19. A pesquisa sobre envelhecimento humano no Brasil: grupos e linhas de pesquisa

    Directory of Open Access Journals (Sweden)

    Shirley Donizete Prado

    2004-01-01

    Full Text Available Descrevemos a pesquisa científica sobre envelhecimento humano no Brasil a partir da versão 4.1 do Diretório dos Grupos de Pesquisa no Brasil (2000 do Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq. O critério para a identificação dos grupos estudados foi o desenvolvimento de, pelo menos, uma linha de pesquisa referente ao envelhecimento humano, e a busca na base de dados foi realizada a partir de palavras-chave associadas ao envelhecimento humano. Foram identificados 144 grupos, 209 linhas de pesquisa e 511 pesquisadores. Discutimos as áreas de conhecimento em que se inserem estes grupos, o período de seu surgimento e sua distribuição geográfica e institucional.

  20. Fotometría de grupos compactos de galaxias: Shakhbazian 37, 45, 166, 331 y 362

    Science.gov (United States)

    Campos, J. M.; Calderón, J. H.; Gimeno, N. G.; Díaz, R. J.

    Continuando con la fotometría CCD de Grupos de Galaxias Compactos de Shakhbazyan (SCGG) en este trabajo se presentan nuevos resultados preliminares sobre los grupos Shakbazyan 37, 45, 166, 331 y 362. EL objeto del proyecto es contribuir al estudio de las propiedades físicas de tales grupos y contribuir a las bases de datos para mejora de las estadísticas. Los datos fueron adquiridos con el Telescopio JKT del Observatorio Norte Europeo. El análisis de las imágenes en las bandas I y B como del índice de color B-I permitió reidentificar las galaxias catalogadas, resultando las mismas muy enrojecidas y verificando que predominan las galaxias tempranas, resultados consistentes con los obtenidos para otros grupos y por otros autores.

  1. Introducción a la teoría geométrica de grupos

    Directory of Open Access Journals (Sweden)

    Olga Salazar-Díaz

    2011-06-01

    Full Text Available En este artículo haremos una introducción a la teoría geométrica de grupos. Veremos cómo a partir de una presentación finita de un grupo, se puede dotar a dicho grupo de una estructura de espacio métrico; se discute la acción del grupo sobre dicho espacio y se estudian propiedades geométricas que se preservan bajo cuasi isometría. Abstract. In this article we will give an introduction to geometric group theory. We will see how from a finite presentation of a group, we can give this group a metric space structure. We discuss the action of the group on this space and we study geometric properties preserved under quasiisometry.

  2. Distorsiones cognitivas: diferencias entre abusadores sexuales, delincuentes violentos y un grupo control

    National Research Council Canada - National Science Library

    José Ignacio Ruiz Pérez; Zulma Yadira Cepeda Rodríguez

    2016-01-01

    ... y comparación de la variable distorsiones cognitivas en tres grupos diferentes: hombres condenados por delitos sexuales a menores de edad, delincuentes violentos no sexuales y personas sin historia...

  3. Significados e interacciones de paz de jovenes integrantes del grupo "Juventud Activa" de Soacha, Colombia

    National Research Council Canada - National Science Library

    Sacipa, Stella; Tovar Guerra, Claudia Constanza

    2011-01-01

    ... en el municipio de Soacha. Se estudiaron las similitudes y diferencias entre sus interacciones narradas acerca de su hacer cotidiano en el grupo, en la familia y en el barrio, en contraste con las formas en que significan la paz...

  4. Una alternativa para el diseño de experimentos con grupos intactos

    Directory of Open Access Journals (Sweden)

    Raúl Hernández-Heredia

    2017-11-01

    Full Text Available Se ofrece una variante de la proyección del trabajo experimental con grupos docentes intactos. Sobre la base de seis grupos intactos no equivalentes, se conforma un grupo experimental y otro de control, a partir de la técnica de pareamiento grupal. El pareamiento se desarrolló tomando como punto de partida un diagnóstico inicial de tres capacidades físicas básicas de trascendencia para el entrenamiento deportivo. Como resultado se obtuvieron dos grupos equivalentes (experimental y control y se garantizó el control de variables ajenas, imprescindible para minimizar el nivel de incertidumbre en el trabajo experimental.

  5. Intervencion psicomotriz en el area personal/social de un grupo de educacion preescolar

    National Research Council Canada - National Science Library

    Rubio Ponce, Rocio; Garcia Fernandez, David Arnoldo; Cervantes Hernandez, Natanael

    2011-01-01

    En el presente estudio se realiza el analisis de un grupo de ninos y ninas de tercer grado de educacion preescolar, en cuanto a la posible mejoria en su area personal/social que abarca la interaccion...

  6. El cambio creativo en la estrategia propagandística de los grupos terroristas

    OpenAIRE

    Herrero Grande, Francisco Javier

    2016-01-01

    En este trabajo se intenta demostrar cómo han evolucionado los métodos de comunicarse y de conseguir los objetivos que los grupos terroristas han tratado de conseguir en las últimas décadas. Cómo la propaganda ha sido una de las bases para ese desarrollo y de cómo estos grupos se han adaptado a una nueva era tecnológica. Grado en Publicidad y Relaciones Públicas

  7. Fraccionamiento y estudio de subpoblaciones linfocitarias en distintos grupos de am??gdalas palatinas

    OpenAIRE

    S??nchez Rozas, Jos?? Antonio

    1989-01-01

    Se ha estudiado en linfocitos de am??gdala de distintos grupos cl??nicos de amigdalitis la expresi??n de una amplia bacteria de anticuerpos monoclonales y otros marcadores con la finalidad de investigar la existencia o no en am??gdalas de c??lulas inmaduras previrgenes y determinar la secuencia madurativa de diferenciaci??n en distintos grupos cl??nicos de am??gdala.

  8. Soutien organisationnel de la phase 2 de l'ITT : Grupo de Análisis ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Soutien organisationnel de la phase 2 de l'ITT : Grupo de Análisis para el Desarrollo. Ce financement contribuera à renforcer le rôle du Grupo de Análisis para el Desarrollo (GRADE) en tant qu'organisme crédible de recherche sur les politiques au Pérou en accroissant sa capacité à fournir des recherches de qualité ...

  9. Soutien organisationnel de la phase 2 de l'ITT : Grupo FARO | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Soutien organisationnel de la phase 2 de l'ITT : Grupo FARO. Ce financement contribuera à renforcer le rôle du Grupo FARO en tant qu'organisme crédible de recherche sur les politiques publiques en Équateur en renforçant sa capacité à fournir des recherches de qualité supérieure, influentes et utiles en matière de ...

  10. Grupo de iguales e iniciación sexual adolescente: diferencias de género

    Directory of Open Access Journals (Sweden)

    Esperanza Navarro-Pertusa

    2006-01-01

    Full Text Available El presente estudio explora las diferencias de género en la relación entre grupo de iguales e iniciación sexual, a través de una investigación transversal descriptiva. Se entrevistó a una muestra de 505 adolescentes de ambos sexos acerca de su nivel de experiencia sexual y otras variables relativas a su vida con el grupo de amigos. La muestra fue clasificada en cinco estadios de iniciación sexual, de no iniciadas a personas que han experimentado relaciones coitales. Los resultados confirman parcialmente la hipótesis de la confluencia de género en el papel del grupo de iguales en la iniciación sexual. Los resultados revelan que en los varones de esta muestra la mayor experiencia sexual se acompaña de una mayor vida en grupo, mayor número de amigos y mayor liderazgo dentro del grupo, no así en las chicas. Para los varones, la iniciación sexual es un elemento de socialización con el grupo de iguales, positivamente connotado, mientras que para las mujeres la iniciación sexual es un elemento más de la experiencia amorosa.

  11. Frecuencia de grupos sanguíneos y factor Rh en donantes de sangre, Colombia ,1996

    Directory of Open Access Journals (Sweden)

    Mauricio Beltrán

    1999-03-01

    Full Text Available El establecer un patrón nacional de distribución de los grupos sanguíneos por seccionales de salud con base en los datos de donantes de banco de sangre, permite la localización e intercambio de sangre y componentes con fines de transfusión de una manera oportuna, mejora la disponibilidad de sangre y ofrece, además, información útil para áreas como las de genética para identificación personal y pruebas de paternidad, y en el campo antropológico para hallar diferencias raciales según su distribución. Con el fin de estimar la frecuencia y distribución de los grupos A, 8, AB y O y factor Rh por seccionales de salud en donantes de sangre, se analizó la información enviada durante 1996 por todos los bancos del país a la Coordinación Nacional de Bancos de Sangre con sede en el lnstituto Nacional de Salud. Se realizó un estudio descriptivo de la información, diferenciando por grupos sanguíneos y la presencia o ausencia del factor Rhesus. Durante 1996, los 180 bancos de sangre del país recolectaron 393.063 unidades de sangre; éstos reportaron los datos de pruebas de grupos sanguíneos A, B, AB , O y factor Rhesus de 338.063 (86% unidades; no se obtuvo información de las unidades restantes. Del total de unidades hemoclasificadas, 91,16% correspondió al factor Rhesus positivo; para este factor, la distribución por grupos sanguíneos fue de 56,2% para el grupo 0; 26,0% para el grupo A; 7,3% para el grupo B, y 1,4% para el grupo sanguíneo AB. El 8,83% de las unidades de sangre restantes correspondió al factor Rhesusne-a ativo. con una distribución por grupos sanguíneos de 5,1%'para el grupo 0; 2,7% para el grupo A; 0,7% para el grupo B, y para el grupo AB 0,31%. Los bancos de sangre de las seccionales de Antioquia, Caldas y San Andrés, reportaron la mayor proporción de unidades de sangre hemoclasificadas como factor Rhesus negativo. Esta información debe ser utilizada por todos los bancos de sangre, para ubicar e

  12. O impacto da doença de Parkinson na qualidade de vida de dois grupos de doentes

    OpenAIRE

    Alves, Daniela; Santos, Fátima

    2010-01-01

    O objectivo do estudo foi medir o impacto da Doença de Parkinson na qualidade de vida (QV) de 30 participantes divididos em dois grupos (Grupo1- não faziam Fisioterapia, n=15; Grupo 2 -realizavam Fisioterapia, n=15), através da administração da Parkinson Disease Quality of Life Questionnaire (PDQL). Não se verificaram diferenças entre os resultados dos grupos, excepto no item “sensação de cansaço extremo”, em que os indivíduos do Grupo 2 apresentaram melhores resultados relativ...

  13. Aplicações da teoria de bass-serre : endomorfismos injetivos de grupos de baumslag-solitar

    OpenAIRE

    Eliana Vieira Norte

    2006-01-01

    Resumo: Nessa dissertação estudamos a teoria de Bass-Serre que liga grupos que agem sobre árvores em grupos fundamentais de grafos de grupos. Para desenvolver essa teoria primeiramente estudamos conceitos básicos como: grupos livres, produto livre amalgamado, extensão HNN. Na parte final a teria de Bass-Serre é aplicada para endomorfismos injetivos de grupos de Baumslag-Solitar. ;;Abstract:ln this master thesis we study Bass-Serre theory that links groups acting on trees and fundamental grou...

  14. Poetry in transitional space (reflections about the Cacaso's grupo escolar A poesia passada a limbo (reflexões sobre grupo escolar de Cacaso

    Directory of Open Access Journals (Sweden)

    Debora Racy Soares

    2009-10-01

    Full Text Available The main purpose of this work is to think about two poems of the book Grupo Escolar (1974 by Antônio Carlos de Brito (1944-1987, known inside the Brazilian cultural universe as Cacaso. Despite being the second book by Cacaso, Grupo Escolar was the fi rst to be published independently, in the traditional editorial system, through Frenesi, a poetry collection pro Rio de Janeiro. It is interesting to realize that this book demands from the author a new poetical lettering, in agreement with the “alchemist days”. By the analysis of the poems chosen – “O futuro já chegou” and “Aquarela” – it’s possible to see how they dialogue with the production moment, in different ways. Both can be read as symptoms of a traumatic reality. Although, if in the fi rst poem we face a reference poetry based on extreme literality and on “reality excess”, in the second we face the sense mixtures modulations of allegory. Keywords: Cacaso. Grupo Escolar. 1974. O futuro já chegou. Aquarela. Dictatorship. O objetivo deste trabalho é refl etir sobre dois poemas do livro Grupo Escolar (1974, de Antônio Carlos de Brito (1944-1987, mais conhecido pelo pseudônimo Cacaso no universo cultural brasileiro. Apesar de ter sido o segundo livro de Cacaso, Grupo Escolar foi o primeiro a ser publicado de forma independente, à margem do sistema editorial tradicional, através da Frenesi, uma coleção carioca de poesia. É interessante perceber que este livro exige do autor uma nova alfabetização poética, mais condizente com os “tempos de alquimia”. Demonstraremos, por meio da análise dos poemas escolhidos – “O futuro já chegou” e “Aquarela” – como dialogam com o momento de produção, de diferentes formas. Ambos podem ser lidos como sintomas de uma realidade traumática. No entanto, se no primeiro poema estamos diante de uma poesia referencial, ancorada na literalidade extrema e no “excesso de realidade”, no segundo nos deparamos com

  15. Um olhar para a dinâmica do Coordenador de Grupos

    Directory of Open Access Journals (Sweden)

    Kátya Alexandrina Matos Barreto Mota

    2006-04-01

    Full Text Available No mundo contemporâneo a utilização de grupos enquanto estratégia na atenção em saúde e em atividades do ensino é cada vez mais utilizado, considerando inclusive as propostas oficiais do Ministério da Saúde e da Educação. Assim, o domínio dessa tecnologia pelos profissionais como fundamento para guiar suas ações assistenciais e gerenciais, torna-se, a cada dia de maior importância. Neste artigo de atualização propomos desenvolver alguns aspectos sobre os pressupostos teóricos e dilemas do coordenador de grupos, assim como apontar elementos que possam ajudar os profissionais que têm no grupo seu campo de trabalho. O texto aborda também a organização do setting grupal, o manejo das situações previsíveis, a administração do tempo, manejo de conflitos do grupo e o poder do contrato grupal. A essência do texto é ancorada no principal dilema do coordenador de grupo, que é encontrar a medida adequada, ou seja, equilíbrio para fazer intervenções sobre os conteúdos que emergem na dinâmica grupal, centradas no contexto científico e no emocional que surgem do contato com o grupo. Neste intervalo entre a prática e a teoria, entre o profissional e o pessoal é que acreditamos encontrar o equilíbrio. Nesse sentido, é fundamental ao coordenador a noção da complexidade grupal, para que diante de sua singularidade possa viver o grupo e tudo o que dele emana.

  16. ENFERMAGEM E TECNOLOGIA: ANÁLISE DOS GRUPOS DE PESQUISA CADASTRADOS NA PLATAFORMA LATTES DO CNPq

    Directory of Open Access Journals (Sweden)

    Sayonara de Fátima Faria Barbosa

    2009-01-01

    Full Text Available Estudio descriptivo cuyo objetivo es analizar los grupos de investigación del área de enfermería que están registrados en la plataforma Lattes de la página web del Consejo Nacional para el Desarrollo Científico y Tecnológico, y que tienen entre sus líneas de investigación la producción del conocimiento en tecnología. A través de los datos obtenidos por medio de encuesta a todos los grupos de investigación de enfermería en el Brasil, que están registrados en el Directorio de los Grupos de Investigación del Consejo Nacional para el Desarrollo Científico y Tecnológico, se identificaron 66 grupos, distribuidos en 29 instituciones de todo el país. El análisis estadístico descriptivo permitió observar una mayor concentración de grupos en las instituciones de la región sudeste del país. La mayoría de los grupos se acerca a la tecnología en sus diversas formas, destacándose siete grupos de investigación que incluyen la línea de Tecnologías de la Información y Comunicación como centro de su producción.

  17. The Infection of Cucumber (Cucumis sativus L.) Roots by Meloidogyne incognita Alters the Expression of Actin-Depolymerizing Factor (ADF) Genes, Particularly in Association with Giant Cell Formation.

    Science.gov (United States)

    Liu, Bin; Liu, Xingwang; Liu, Ying; Xue, Shudan; Cai, Yanling; Yang, Sen; Dong, Mingming; Zhang, Yaqi; Liu, Huiling; Zhao, Binyu; Qi, Changhong; Zhu, Ning; Ren, Huazhong

    2016-01-01

    Cucumber (Cucumis sativus L.) is threatened by substantial yield losses due to the south root-knot nematode (Meloidogyne incognita). However, understanding of the molecular mechanisms underlying the process of nematode infection is still limited. In this study, we found that M. incognita infection affected the structure of cells in cucumber roots and treatment of the cytoskeleton inhibitor (cytochalasin D) reduced root-knot nematode (RKN) parasitism. It is known that Actin-Depolymerizing Factor (ADF) affects cell structure, as well as the organization of the cytoskeleton. To address the hypothesis that nematode-induced abnormal cell structures and cytoskeletal rearrangements might be mediated by the ADF genes, we identified and characterized eight cucumber ADF (CsADF) genes. Phylogenetic analysis showed that the cucumber ADF gene family is grouped into four ancient subclasses. Expression analysis revealed that CsADF1, CsADF2-1, CsADF2-2, CsADF2-3 (Subclass I), and CsADF6 (Subclass III) have higher transcript levels than CsADF7-1, CsADF7-2 (Subclass II genes), and CsADF5 (Subclass IV) in roots. Members of subclass I genes (CsADF1, CsADF2-1, CsADF2-2, and CsADF2-3), with the exception of CsADF2-1, exhibited a induction of expression in roots 14 days after their inoculation (DAI) with nematodes. However, the expression of subclass II genes (CsADF7-1 and CsADF7-2) showed no significant change after inoculation. The transcript levels of CsADF6 (Subclass III) showed a specific induction at 21 DAI, while CsADF5 (Subclass IV) was weakly expressed in roots, but was strongly up-regulated as early as 7 DAI. In addition, treatment of roots with cytochalasin D caused an approximately 2-fold down-regulation of the CsADF genes in the treated plants. These results suggest that CsADF gene mediated actin dynamics are associated with structural changes in roots as a consequence of M. incognita infection.

  18. Identification and characterization of potential NBS-encoding resistance genes and induction kinetics of a putative candidate gene associated with downy mildew resistance in Cucumis

    Directory of Open Access Journals (Sweden)

    Wan Hongjian

    2010-08-01

    Full Text Available Abstract Background Due to the variation and mutation of the races of Pseudoperonospora cubensis, downy mildew has in recent years become the most devastating leaf disease of cucumber worldwide. Novel resistance to downy mildew has been identified in the wild Cucumis species, C. hystrix Chakr. After the successful hybridization between C. hystrix and cultivated cucumber (C. sativus L., an introgression line (IL5211S was identified as highly resistant to downy mildew. Nucleotide-binding site and leucine-rich repeat (NBS-LRR genes are the largest class of disease resistance genes cloned from plant with highly conserved domains, which can be used to facilitate the isolation of candidate genes associated with downy mildew resistance in IL5211S. Results Degenerate primers that were designed based on the conserved motifs in the NBS domain of resistance (R proteins were used to isolate NBS-type sequences from IL5211S. A total of 28 sequences were identified and named as cucumber (C. sativus = CS resistance gene analogs as CSRGAs. Polygenetic analyses separated these sequences into four different classes. Quantitative real-time polymerase chain reaction (qRT-PCR analysis showed that these CSRGAs expressed at different levels in leaves, roots, and stems. In addition, introgression from C. hystrix induced expression of the partial CSRGAs in cultivated cucumber, especially CSRGA23, increased four-fold when compared to the backcross parent CC3. Furthermore, the expression of CSRGA23 under P. cubensis infection and abiotic stresses was also analyzed at different time points. Results showed that the P. cubensis treatment and four tested abiotic stimuli, MeJA, SA, ABA, and H2O2, triggered a significant induction of CSRGA23 within 72 h of inoculation. The results indicate that CSRGA23 may play a critical role in protecting cucumber against P. cubensis through a signaling the pathway triggered by these molecules. Conclusions Four classes of NBS-type RGAs were

  19. The Infection of Cucumber (Cucumis sativus L. Roots by Meloidogyne incognita Alters the Expression of Actin-Depolymerizing Factor (ADF Genes, Particularly in Association with Giant Cell Formation

    Directory of Open Access Journals (Sweden)

    Bin Liu

    2016-09-01

    Full Text Available Cucumber (Cucumis sativus L. is threatened by substantial yield losses due to the south root-knot nematode (Meloidogyne incognita. However, understanding of the molecular mechanisms underlying the process of nematode infection is still limited. In this study, we found that M. incognita infection affected the structure of cells in cucumber roots and treatment of the cytoskeleton inhibitor (cytochalasin D reduced root-knot nematode (RKN parasitism. It is known that Actin-Depolymerizing Factor (ADF affects cell structure, as well as the organization of the cytoskeleton. To address the hypothesis that nematode-induced abnormal cell structures and cytoskeletal rearrangements might be mediated by the ADF genes, we identified and characterized eight cucumber ADF (CsADF genes. Phylogenetic analysis showed that the cucumber ADF gene family is grouped into four ancient subclasses. Expression analysis revealed that CsADF1, CsADF2-1, CsADF2-2, CsADF2-3 (Subclass I and CsADF6 (Subclass III have higher transcript levels than CsADF7-1, CsADF7-2 (Subclass II genes and CsADF5 (Subclass IV in roots. Members of subclass I genes (CsADF1, CsADF2-1, CsADF2-2 and CsADF2-3, with the exception of CsADF2-1, exhibited a induction of expression in roots 14 days after their inoculation (DAI with nematodes. However, the expression of subclass II genes (CsADF7-1 and CsADF7-2 showed no significant change after inoculation. The transcript levels of CsADF6 (Subclass III showed a specific induction at 21 DAI, while CsADF5 (Subclass IV was weakly expressed in roots, but was strongly up-regulated as early as 7 DAI. In addition, treatment of roots with cytochalasin D caused an approximately two-fold down-regulation of the CsADF genes in the treated plants. These results suggest that CsADF gene mediated actin dynamics are associated with structural changes in roots as a consequence of M. incognita infection.

  20. Grupos na enfermagem: classificação, terminologias e formas de abordagem Grupos en enfermería: classificación, terminología y formas de enfoque Workgroups in nursing: classification, terminologies and approaches

    Directory of Open Access Journals (Sweden)

    Fabiana Verdan Simões

    2006-04-01

    Full Text Available Este artigo retrata as diversas terminologias utilizadas para os trabalhos de grupos realizados por enfermeiros e contextualiza as formas de abordagens utilizadas em estudos de enfermeiros sobre as atividades grupais. Aborda as seguintes terminologias: grupos operativos e seus campos de atuação, grupos com pacientes somáticos, grupos interdisciplinares homogêneos, grupos de convivência, grupos focais e grupos de convergência. As terminologias existentes são pautadas de acordo com objetivos mais definidos de atuação do grupo, onde, na verdade, todas se encaixam no conceito de grupo operativo, como uma classificação dessas atividades grupais. Sobre as formas de abordagem relacionadas a essas atividades, são descritas: grupos como processo educativo em saúde, grupos como tecnologia e como estratégia. Entre as citadas, a visão do grupo como estratégia, segundo os autores, permite ampliar o significado de atuação do trabalho de grupo e sua importância como ferramenta de trabalho para o profissional enfermeiro.Este artículo trata de las variadas terminologías utilizadas para los trabajos de grupos realizados por enfermeros y contextualiza las formas de enfoques empleadas en estudos de enfermeros sobre las actividades grupales. Enfoca las siguientes terminologías: grupos operativos y sus campos de actuación, grupos con pacientes somáticos, grupos interdisciplinarios homogéneos, grupos de convivir, grupos focales y grupos de convergencia. Las terminologías que hay son pautadas de acuerdo con objetivos más definidos de actuación del grupo, donde, en verdad, todas se encajan en el concepto de grupo operativo, como una clasificación de actividades grupales. Sobre las formas de abordaje que tienen relación con esas actividades, son descriptas: grupos como proceso educativo en salud, grupos como tecnología y como estrategía. A lo mejor, la visión del grupo como estrategía, de acuerdo con los autores, puede crecer su

  1. Portadores de Neisseria meningitidis y Neisseria lactamica en tres grupos de edades diferentes

    Directory of Open Access Journals (Sweden)

    Niury Núñez

    2007-08-01

    Full Text Available Se determinó la prevalencia de N. meningitidis y N. lactamica, así como su relación con las variables edad y sexo en individuos de tres grupos de riesgo diferentes (círculo infantil, escuela primaria y escuela universitaria, a los que se les realizó exudado de la nasofaringe posterior. Se identificaron los marcadores epidemiológicos de las cepas de N. meningitidis aisladas y se analizó la presencia de otros microorganismos de la familia Neisseriaceae. La identificación de las cepas obtenidas se realizó por el sistema APINH (bioMérieux, el seroagrupamiento de N. meningitidis se determinó por aglutinación en lámina portaobjetos con antisueros específicos y los sero/subtipos e inmunotipos se identificaron por un ensayo inmunoenzimático de células enteras con anticuerpos monoclonales. El 10,9% de los sujetos investigados fue portador de N. meningitidis, cifra que aumentó con la edad. La prevalencia de portadores tuvo el siguiente comportamiento: Grupo 1: niños de 0-6 años (4,3%; Grupo 2: niños de 5-12 años (6,9% y Grupo 3: adultos jóvenes de 17-22 años (25,1%. No hubo diferencias significativas respecto al sexo (p > 0,05. En el Grupo 1 predominó el fenotipo NA:NT:P1.6:L3,7,9 (71,5%, mientras que, en los Grupos 2 y 3, prevaleció la asociación NA:NT:P1.NST:L3,7,9 (36,4 y 25%, respectivamente. El predominio de cepas no epidemiogénicas avalan el impacto de la inmunización en Cuba con VA-MENGOC-BCÒ. El aislamiento de cepas de N. lactamica disminuyó a medida que aumentó la edad: Grupo 1 (47,5%, Grupo 2 (29,8% y Grupo 3 (3%.

  2. EVALUACIÓN DEL CAMBIO EN PACIENTES UNIVERSITARIOS NO-HOSPITALIZADOS BAJO PSICOTERAPIA DE GRUPO

    Directory of Open Access Journals (Sweden)

    Juan A. Mejías

    2015-06-01

    Full Text Available Objetivo: evaluar los cambios de la psicoterapia grupal interpersonal tipo yalomen pacientes universitarios no-hospitalizados. Método: estudio longitudinal con tres grupos (dos en psicoterapia grupal y uno comparativo de pacientes universitarios. Los indicadores de mejoría fueron los síntomas depresivos y ansiosos, el autoconcepto y el funcionamiento social. Resultados: se observó mejoría por tiempo en las puntuaciones de depresión, autoconcepto y funcionamiento social (efps; áreas: social, económica, sexual y total. Las comparación por grupo mostró cambios significativos en todas las escalas excepto en el aspecto sexual de la efps y la ansiedad medida por la escala de shehan; sin embargo, los grupos bajo psicoterapia con y sin tratamiento farmacológico no mostraron diferencias significativas. Con respecto a la percepción de mejoría, la mayoría de los pacientes manifestaron tenerla en algún grado. Conclusión: la psicoterapia de grupo es efectiva para la intervención de pacientes universitarios no-hospitalizados. Palabras Clave: psicoterapia de grupo, estudiantes universitarios, pacientes no hospitalizados

  3. Projeto de vida de um grupo de adolescentes à luz de Paulo Freire

    Directory of Open Access Journals (Sweden)

    Cardoso Cristina Peres

    2003-01-01

    Full Text Available O estudo se propõe a conhecer o projeto de vida de um grupo de adolescentes de uma Unidade Básica de Saúde em Marília, São Paulo, utilizando pesquisa qualitativa, por meio de entrevistas individuais semi-estruturadas e de reuniões em grupo, empregando a técnica de grupo educativo, com observação participante, sob o enfoque de Paulo Freire. Nas discussões em grupo, foram apresentadas três questões: o que é ser adolescente; o que é ter saúde e qual o projeto de vida do adolescente, e as temáticas foram analisadas sob o enfoque de Minayo. A análise indicou que os adolescentes têm um projeto de vida, apesar das dificuldades próprias das condições socioeconômicas a que pertencem, fato por eles percebido. A prática dos ideais de Freire envolveu o pesquisador com o grupo, indicando ser este o caminho para a verdadeira reflexão crítica dos problemas levantados, propiciando um meio para a conscientização e luta pelo seu projeto de vida.

  4. Projeto de vida de um grupo de adolescentes à luz de Paulo Freire

    Directory of Open Access Journals (Sweden)

    Cristina Peres Cardoso

    Full Text Available O estudo se propõe a conhecer o projeto de vida de um grupo de adolescentes de uma Unidade Básica de Saúde em Marília, São Paulo, utilizando pesquisa qualitativa, por meio de entrevistas individuais semi-estruturadas e de reuniões em grupo, empregando a técnica de grupo educativo, com observação participante, sob o enfoque de Paulo Freire. Nas discussões em grupo, foram apresentadas três questões: o que é ser adolescente; o que é ter saúde e qual o projeto de vida do adolescente, e as temáticas foram analisadas sob o enfoque de Minayo. A análise indicou que os adolescentes têm um projeto de vida, apesar das dificuldades próprias das condições socioeconômicas a que pertencem, fato por eles percebido. A prática dos ideais de Freire envolveu o pesquisador com o grupo, indicando ser este o caminho para a verdadeira reflexão crítica dos problemas levantados, propiciando um meio para a conscientização e luta pelo seu projeto de vida.

  5. Estrategias de crecimiento implementadas por los grupos económicos del Ecuador (2007-2016

    Directory of Open Access Journals (Sweden)

    Giuseppe Vanoni Martínez

    2017-07-01

    Full Text Available El presente trabajo tiene como objetivo identificar las estrategias de crecimiento que fueron implementadas por los grupos económicos del Ecuador, durante el periodo 2007-2016. Para su comprensión, se realizaron aproximaciones teóricas sobre los constructos grupo económico y estrategias de crecimiento, mientras que para el desarrollo de la investigación se empleó el muestreo aleatorio simple como herramienta metodológica, lo que arrojó una muestra recomendada de análisis de 132 grupos. Como resultado, se pudo determinar que dentro de las estrategias que estos grupos aplicaron existe una orientación hacia la concentración de sus negocios, siendo la especialización la estrategia más implementada. Esto permite concluir que fue la estrategia más aplicada, dadas las condiciones económicas de estabilidad que vivió el país y que, al contrario de lo que expresan los teóricos del capitalismo desorganizado, los grupos económicos siguen vigentes en Ecuador y sin que las familias que lo conforman hayan perdido su hegemonía.

  6. Acercamiento al Concepto de Grupos Empresariales: Concurrencia de Elementos para su Existencia

    Directory of Open Access Journals (Sweden)

    Carlos Mario Montiel Fuentes

    2009-07-01

    Full Text Available El grupo empresarial es el conjunto de una o más sociedades independientes jurídicamente entre sí, pero que se encuentran bajo un control o subordinación ejercido por una matriz o controlante y sometidas a una dirección unitaria que determina los lineamientos de cada una de ellas. Conformándose el grupo empresarial únicamente cuando concurran los dos elementos de su esencia; 1. El control o subordinación y 2. La unidad de propósito y dirección; sin que signifique esto, que se esté dando nacimiento a un nuevo ente autónomo e independiente, pues se mantiene intacta la personalidad jurídica de cada una de las sociedades vinculadas al grupo.

  7. Acercamiento al Concepto de Grupos Empresariales: Concurrencia de Elementos para su Existencia

    Directory of Open Access Journals (Sweden)

    Carlos Mario Montiel Fuentes

    2009-06-01

    Full Text Available El grupo empresarial es el conjunto de una o más sociedades independientes jurídicamente entre sí, pero que se encuentran bajo un control o subordinación ejercido por una matriz o controlante y sometidas a una dirección unitaria que determina los lineamientos de cada una de ellas. Conformándose el grupo empresarial únicamente cuando concurran los dos elementos de su esencia; 1. El control o subordinación y 2. La unidad de propósito y dirección; sin que signifique esto, que se esté dando nacimiento a un nuevo ente autónomo e independiente, pues se mantiene intacta la personalidad jurídica de cada una de las sociedades vinculadas al grupo.

  8. O conceito de resistência na Psicoterapia Grupo-Analítica: repensando um caminho

    Directory of Open Access Journals (Sweden)

    Jorge Ponciano Ribeiro

    Full Text Available O autor faz um estudo da resistência em grupo baseado na obra de Siegmund Heinrich Foulkes, fundador da Psicoterapia Grupo Analítica. Foulkes utilizava os conceitos da Psicologia da Gestalt e da Teoria do Campo para fazer compreender o processo de mudança nos seus grupos, embora essas referências passassem desapercebidas, talvez pela dificuldade epistemológica que ele encontrava em combinar Psicanálise e essas teorias. O autor retoma os rastros de Foulkes e desenvolve, a partir dos conceitos de figura e fundo e aqui e agora, uma visão diferente na perspectiva foulkesiana, acenada por ele, mas não desenvolvida. Foulkes tem também uma linguagem fenomenológica que o autor procura explorar.

  9. Identidad cultural en grupos sociales de la zona fronteriza de Baja California

    Directory of Open Access Journals (Sweden)

    Ma. Luisa Rodríguez Sala

    1985-05-01

    Full Text Available En este trabajo se presenta un resumen comparativo de los resultados que se obtuvieron en el grupo de estudiantes y en el grupo de científicos y profesionistas en torno a la identidad cultural en la zona fronteriza. Tanto las conclusiones particulares como las generales comprueban las hipótesis que se sustentan en el marco teórico general de esta investigación, las que además se refuerzan con los subsecuentes resultados provenientes de un profundo análisis de los grupos sociales y del subgrupo de los adolescentes de conducta antisocial que complementan la investigación. El objetivo fundamental de esta primera etapa es lograr el primer acercamiento de carácter semiológico al entendimiento de la identidad cultural en una zona fronteriza del norte de México.

  10. A arte de (sobreviver coletivamente: estudando a identidade do Grupo Galpão

    Directory of Open Access Journals (Sweden)

    Mariana Mayumi Pereira de Souza

    2013-03-01

    Full Text Available O objetivo neste artigo foi analisar o processo de construção da identidade coletiva do Grupo Galpão, um grupo de atores de teatro fundado em 1982 e sediado em Belo Horizonte. O tema da identidade foi abordado em relação ao contexto da indústria cultural. Para o estudo da identidade, partiu-se do nível individual para entender significados coletivamente partilhados, notadamente em relação aos objetivos e à estrutura do grupo. Sendo a identidade individual construída a partir das práticas discursivas e sendo essas últimas sempre relacionadas a estruturas sociolinguísticas e aos gêneros discursivos, a identidade individual é revelada em determinado contexto e em relação a outras identidades, individuais e coletivas. Entende-se, na pesquisa aqui apresentada, que os espaços de interação delimitados pelas identidades coletivas fornecem limites para a expressão das identidades individuais. Entretanto, ocasionalmente, o indivíduo lograria transformar-se e transformar ativamente os espaços que lhe impõem relações de dominação. Para penetrar na realidade cotidiana do Grupo Galpão, foram realizadas observações e entrevistas em profundidade, as quais foram tratadas pela análise do discurso. Ao final da pesquisa, foram evidenciados aspectos identitários do Grupo Galpão que comprovam a estabilidade do grupo, mas que revelam tensões entre a racionalidade do mercado de bens culturais e a racionalidade intrínseca à produção artística autêntica.

  11. Fatores terapêuticos em um grupo de apoio para pacientes psiquiátricos ambulatoriais

    Directory of Open Access Journals (Sweden)

    Guanaes Carla

    2001-01-01

    Full Text Available INTRODUÇÃO/OBJETIVOS: O emprego da psicoterapia de grupo no atendimento em saúde mental, sobretudo em contextos institucionais, tem se expandido aceleradamente, não havendo uma expansão correlata de pesquisas na área, conforme aponta a literatura especializada. Objetivou-se compreender algumas possibilidades e alguns limites de um grupo de apoio de curta duração (16 sessões para pacientes psiquiátricos ambulatoriais, investigando os fatores terapêuticos que operam nesse grupo, segundo a percepção de seus participantes. MÉTODOS: Questionários do Incidente Crítico (QIC, observação e registro do grupo, consultas aos prontuários dos pacientes e notas de campo constituíram as fontes de dados. A análise das respostas dos pacientes ao QIC foi realizada por procedimentos de avaliação categorial de conteúdo, tendo como base um sistema descritivo dos fatores terapêuticos proposto na literatura. As demais fontes foram tomadas como dados de contexto dos sentidos produzidos pelos pacientes em suas respostas ao QIC. RESULTADOS: Os resultados remetem a dez categorias derivadas da percepção dos pacientes, indicativas de vivências terapêuticas e não-terapêuticas no grupo. DISCUSSÃO/CONCLUSÃO: Este estudo possibilita uma compreensão sobre o modo como os pacientes vivenciaram o processo desse grupo, tendo em vista os sentidos que produziram a partir de sua participação neste, e, em conjunção com a compreensão de seus quadros clínicos, situa algumas possibilidades e alguns limites desse tipo de tratamento em saúde mental, considerando o contexto em que ocorre e a clientela que usualmente o integra.

  12. ¿Qué explica la supervivencia de los grupos terroristas? Alianzas y competencia

    OpenAIRE

    Phillips, Brian J.

    2016-01-01

    ¿Por qué algunos grupos terroristas perduran más que otros? ¿Qué nos revela esta longevidad sobre la eficacia de las organizaciones terroristas? Este artículo examina, en primer lugar, por qué la supervivencia organizativa puede considerarse un factor de eficacia organizativa. En segundo lugar, se revisa la literatura sobre la longevidad de los grupos terroristas –incluyendo el examen sistemático de diez estudios cuantitativos sobre este tema. El análisis muestra que unos pocos factore...

  13. Grupo reflexivo de professores da educação superior: Estudo sobre seus movimentos construtivos

    OpenAIRE

    Hedioneia Maria F. Pivetta; Silvia Maria de Aguiar Isaia

    2014-01-01

    El foco de ese estudio está concentrado en los movimientos constructivos del grupo de profesores reflexivos como dispositivos de aprendizaje docente de la educación superior. Tubo por objetivos identificar cuales los movimientos constructivos de este grupo, analizar la dinámica grupal y el aprendizaje de la docencia a partir de él. El camino recorrido envolvió el abordaje metodológica de cuño cualitativo narrativo con características de investigación-formación e investigación-acción (Maciel, ...

  14. Etnografia da leitura num grupo de estudos espírita

    OpenAIRE

    Bernardo Lewgoy

    2004-01-01

    O espiritismo kardecista é uma religião que confere fundamental importância ao estudo de uma literatura própria, entendida como complemento de uma revelação religiosa. Este artigo, realizado a partir de pesquisa etnográfica num tradicional centro espírita de classe média de Porto Alegre, examina e sistematiza alguns modos pelos quais os adeptos espíritas, estruturados em pequenos grupos, relacionam-se com essa tradição escrita.O grupo é fundamental na formação da identidade dos espíritas em d...

  15. Grupos económicos y bonanza minera en el Perú

    OpenAIRE

    Torres, Víctor

    2014-01-01

    El artículo analiza las estrategias organizacionales de los cinco grupos económicosnacionales de mayor importancia en la minería peruana –Buenaventura, Brescia,Volcan, Hochschild y Milpo– durante la primera década del presente siglo, periodocaracterizado por una sostenida bonanza minera –debida al alza del preciointernacional de los metales– y por acentuados conflictos socioambientales. Eneste inédito contexto, los grupos mineros fortalecieron sus espaldas financierasgracias a las ganancias e...

  16. Grupo Archigram, 1961-1974.Uma Fábula da técnica

    OpenAIRE

    Pianta Costa Cabral, Claudia

    2002-01-01

    El tema de esta tesis es la producción del grupo inglés Archigram, constituido por Peter Cook (1936), Warren Chalk (1927-1987), Ron Herron (1930-1994), Dennis Crompton (1935), Michael Webb (1937) y David Greene (1937), articulado alrededor a la revista homónima publicada en Londres entre 1961 y 1974 (diez números). Dicha producción por lo tanto no consiste en obras construidas, pero en el conjunto de los proyectos, dibujos y textos desarrollados en estos años por los miembros del grupo, indi...

  17. Un estado del arte sobre el conocimiento tácito de los grupos

    OpenAIRE

    Diez Gaviria, Ana Cecilia

    2016-01-01

    Desde la teoría de creación de conocimiento organizacional, se plantean diferentes tipos de conocimiento: el individual, el grupal y el organizacional, los cuales pueden ser tácitos o explícitos -- Teniendo en cuenta que todo conocimiento es socialmente construido, que es relacional y colectivo, los grupos en la organización ocupan un lugar importante para la creación y expansión del conocimiento -- El conocimiento tácito grupal, brinda posibilidades para que el grupo pueda desarrollar accion...

  18. Vinculación a grupos armados: un resultado del conflicto armado en Colombia

    Directory of Open Access Journals (Sweden)

    Olga Lucía Valencia

    2010-01-01

    Full Text Available El presente artículo inicia con un recuento histórico sobre el conflicto en Colombia, y las consecuencias de permanecer en un grupo armado, para luego describir los motivos de vinculación en adultos, en menores de edad y en mujeres. Al final se mencionan las motivaciones para pertenecer a las fuerzas armadas encontrando algunas semejanzas entre los motivos de vinculación a los grupos armados ilegales en comparación con las fuerzas estatales.

  19. Contaminación acústica por grupos electrógenos

    OpenAIRE

    Yanexy Cepero-Aguilera

    2009-01-01

    El trabajo tiene como tema el impacto ambiental por ruido de grupos electrógenos (GE). Se muestran diferentes definiciones y conceptos referidos a la explotación de los GE y las consecuencias que puede provocar a las personas que permanezcan cerca de ellos durante su funcionamiento. Los grupos electrógenos son además de generadores de energía, generadores de ruido y por tanto contribuyen a la contaminación acústica del lugar donde estén situados. En el documento se aborda la importancia del c...

  20. Grupo de trabalho de Gestão de documentos de arquivo - APBAD

    OpenAIRE

    Penteado, Pedro; Balinha, Hélio; Pereira, Isabel

    2012-01-01

    Grupo de trabalho de Gestão de documentos de arquivo - APBAD [Poster para o Congresso]  O Grupo de trabalho de Gestão de documentos de arquivo (GT-GDA) da Associação Portuguesa de Bibliotecários, Arquivistas e Documentalistas (APBAD), após uma paragem de alguns anos, reiniciou a sua atividade em Dezembro de 2011. Começou por alinhar um modelo conceptual, com base em referenciais nacionais e internacionais, que lhe permitisse assumir um posicionamento teórico sólido, diferenciando a Gestão de ...

  1. Programa de la asignatura psicología de los grupos y comportamiento colectivo

    OpenAIRE

    Espelt, Esteve; Aiger, Montserrat; Vicente, Raúl

    2014-01-01

    Se presenta el programa de la asignatura de Psicología de los Grupos y Comportamiento Colectivo del Grado de Psicología de la Universidad de Barcelona. Se distribuyen las temáticas en dos grandes bloques temáticos: Psicología de los Grupos y Comportaiento Colectivo. Esta distribución de mantiene en la distribución de dos tercios para el primero y un tercio para el segundo manteniendo esta proporción en la distribución de temáticas de estudio. prácticas y evaluación.

  2. Guion de prácticas. Psicología de los grupos y comportamiento colectivo

    OpenAIRE

    Aiger, Montserrat; Vicente, Raúl

    2014-01-01

    Se presenta el guion para la elaboración de las prácticas del bloque de Psicología de los Grupos de la asignatura de Psicología de los Grupos y Comportamiento Colectivo del Grado de Psicología de la Universidad de Barcelona. Se trata del análisis de un caso grupal. Los alumnos deben escoger una película de las propuestas en el guion y analizar los diferentes elementos estructurales y de proceso observados.

  3. Indicadores de aprendizaje organizacional en grupos de investigación universitaria

    Directory of Open Access Journals (Sweden)

    Yenni Angélica Conde C.

    2014-01-01

    Full Text Available Una preocupación de las instituciones universitarias que asignan recursos para la investigación es cómo medir su resultado, más allá de los productos académicos. El presente trabajo propone el aprendizaje organizacional como un resultado importante del proceso investigativo. A partir de los resultados de la investigación, se proponen indicadores e índices para medir el proceso de aprendizaje y las condiciones facilitadoras de grupos de investigación. El trabajo fue realizado con investigadores de los grupos adscritos al Sistema de Investigaciones de la Universidad del Cauca, en Colombia.

  4. Criminalidad, grupos armados y reinserción: perfiles y motivaciones

    OpenAIRE

    Ocampo, Melina; Gobernación de Antioquia

    2014-01-01

    Con el fin de determinar las causas por las cuales una persona ingresa a un grupo armado ilegal en Antioquia, se revisó la literatura existente tanto en el ámbito internacional como en el nacional. La misma se contrastó con la información cuantitativa existente de los victimarios y exvictimarios en los órdenes nacional y departamental, y la información cualitativa encontrada en entrevistas a miembros de bandas criminales y en grupos focales con expertos.  Un sujeto puede tener motivaciones pa...

  5. Criminalidad, grupos armados y reinserción: perfiles y motivaciones

    OpenAIRE

    Melina Ocampo

    2014-01-01

    Con el fin de determinar las causas por las cuales una persona ingresa a un grupo armado ilegal en Antioquia, se revisó la literatura existente tanto en el ámbito internacional como en el nacional. La misma se contrastó con la información cuantitativa existente de los victimarios y exvictimarios en los órdenes nacional y departamental, y la información cualitativa encontrada en entrevistas a miembros de bandas criminales y en grupos focales con expertos. Un sujeto puede tener motivaciones ...

  6. Metasíntesis en alfabetización para el empoderamiento de grupos vulnerables

    OpenAIRE

    Camilli Trujillo, Celia; Römer Pieretti, Max

    2017-01-01

    La vulnerabilidad se traduce en grupos humanos concretos que, si bien conocen lo que ocurre alrededor de ellos en materia digital, por su propia condición social y cultural están marginados y, en ese sentido, alejados del ejercicio del derecho a la información. El objetivo ha sido analizar la alfabetización crítica, mediática y digital para el empoderamiento de grupos vulnerables. La revisión sistemática de la literatura (meta-síntesis) abarca el período comprendido entre los años 1996-2016 y...

  7. As diversas aproximações à terapêutica de grupo

    Directory of Open Access Journals (Sweden)

    David Zimmermann

    1958-03-01

    Full Text Available Nesta revisão é salientado o desenvolvimento e a importância atual da psicoterapia de grupo. O autor, baseado em sua experiência em psicoterapia analítica de grupo, faz um estudo crítico dos principais métodos empregados, passando em revista as contribuições mais representativas dos métodos repressivo, didático, psicodramático e psicanalítico. Divide êste último em duas orientações fundamentais: uma em que as interpretações do psicoterapeuta visam os pacientes do grupo e a outra que focaliza primordialmente o grupo como um todo, como uma unidade dinâmica. A grande maioria dos autores menciona resultados terapêuticos favoráveis, pelo menos modificações ou desaparecimento de sintomas, mas não há ainda afirmações concludentes de modificações profundas e duradouras na personalidade dos pacientes. Quanto ao modo como atua o tratamento, nos métodos repressivo e didático, verifica-se facilmente como não são levados em conta os conflitos inconscientes, o que significa que não são tocadas as verdadeiras origens dos sintomas neuróticos. A ação terapêutica do método psicodramático, pelo menos nos têrmos em que se encontra atualmente conceituada, é difícil de ser apreciada devidamente, merecendo, entretanto, uma revisão à luz da experiência psicanalítica. No método psicanalítico, o instrumento técnico pelo qual se tenta obter as modificações desejadas, como na análise individual, são as interpretações transferenciais. Cita-se os inconvenientes da orientação em que as interpretações focalizam predominantemente os pacientes no grupo e conclui-se ser a orientação que visa o grupo como um todo a única que se apresenta adequada ao manejo técnico das situações clínicas e oferece mais possibilidades terapêuticas afetivas. Sugere-se ainda o motivo do terapeuta interpretar aos indivíduos do grupo: trata-se de uma defesa contra-transferencial contra as ansiedades despertadas pela ação envolvente

  8. Regiosseletividade na abertura do anel do 1,3 - benzodioxol substituido com grupos eletron-retiradores

    OpenAIRE

    Radetski, Claudemir Marcos

    1991-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciencias Fisicas e Matematicas O grupo do dioximetilênico (e.g., 1,3-benzodioxol) é encontrado em muitos produtos naturais, particularmente alcalóides. Esse grupo serve como um meio de proteção para os catecóis, pois como os arilalquiléteres, ele é inerte para uma grande variedade de reações químicas. No presente trabalho, estudou-se a regiosseletividade na abertura do anel dioximetilênico de 1,3-benzodioxól substit...

  9. Ictericia e incompatibilidad por grupo Kell: caso clínico.

    OpenAIRE

    Miguel Zúñiga; Jorge Varela; Miguel Valero; Victoria Novik; Cristian Peña

    2009-01-01

    Dentro de las patologías más frecuentes que afectan al recién nacido se encuentra la ictericia. Sus etiologías son diversas y conforman una larga lista que varía desde causas infecciosas, metabólicas, hematológicas, inmunológicas, entre otras. Sin embargo, cuando se presenta durante las primeras horas, las causas más frecuentes corresponden a incompatibilidades de grupo sanguíneo y de ellas, la incompatibilidad Rh y ABO suelen ser más frecuentes. La incompatibilidad por grupo Kell, en cambio...

  10. Hábitos vocais em dois grupos de idosos Vocal habits in two groups of aged

    Directory of Open Access Journals (Sweden)

    Elisângela Barros Soares

    2007-06-01

    Full Text Available OBJETIVO: comparar as diferenças quanto à presença dos hábitos inadequados, as formas de prevenção e os sintomas vocais, mais freqüentes, em dois grupos da terceira idade. MÉTODOS: foi aplicado um questionário com questões do tipo fechada, previamente elaboradas em 45 idosos de ambos os sexos, sendo que apenas um grupo recebeu orientações vocais durante o ano anterior à pesquisa por um profissional fonoaudiólogo. É um estudo descritivo, observacional, transversal. RESULTADOS: de acordo com os resultados, o grupo 2 que recebeu orientação vocal, possui menor freqüência de hábitos inadequados quando comparado ao grupo 1. Quanto às formas de prevenção de distúrbios da voz, a maioria do grupo 1, não possui nenhum cuidado. No grupo 2, já se constata, entre outras formas de prevenção, a referência de realização de treinamento vocal. Com relação à presença de sintomas, o grupo 1 apresentou maior freqüência quanto a cansaço ao falar (50%, dor na garganta (50%, sensação de corpo estranho (67%, do que o grupo 2. CONCLUSÃO: observa-se que houve diferenças quanto hábitos inadequados, formas de prevenção e sintomas nos dois grupos, sendo que o grupo 2 (que recebeu orientação quanto aos cuidados com a voz possui índices menores quanto aos hábitos inadequados e sintomas vocais, ou seja, de acordo com os resultados, orientações sobre saúde vocal em grupos de terceira idade é eficaz.PURPOSE: to compare the differences as for the presence of inadequate habits, forms of prevention and vocal symptoms, more frequent, in two groups of the third age. METHODS: a questionnaire was applied with questions of the closed type, previously elaborated in the 45 aged of both genders, being that only one group received vocal orientation during the previous year the research by a speech therapist professional. It is a study of the descriptive, observational, transversal. RESULTS: of accordance with the results, group 2 that

  11. O complexo holosericeus de Ommatius Wiedemann no Brasil: nova espécie e primeiro registro do grupo ampliatus para o País e novos registros para o grupo holosericeus (Diptera, Asilidae

    Directory of Open Access Journals (Sweden)

    Rodrigo Vieira

    2011-12-01

    Full Text Available O complexo holosericeus de Ommatius Wiedemann no Brasil: nova espécie e primeiro registro do grupo ampliatus para o país e novos registros para o grupo holosericeus (Diptera, Asilidae. Neste trabalho é descrita uma nova espécie de Ommatius Wiedemann, 1821 para o estado do Amazonas, pertencente ao grupo ampliatus. Além disso, são fornecidos novos registros, variações taxonômicas, ilustrações e descrição das estruturas das terminálias masculina e feminina para as espécies do grupo holosericeus.

  12. Efficient plant regeneration from cotyledonary node explants of ...

    African Journals Online (AJOL)

    An efficient regeneration system was developed using cotyledonary node of two inbred line of melon, Cucumis melo 'CM-15' and 'CM-23'. The induction of shoots was achieved on Murashige and Skoog (MS) solid medium supplemented with different combinations of 6-benzylaminopurine (BA) and indole- 3-acetic acid ...

  13. Pre-harvest muskmelon fruit cracking: causes and potential remedies

    Science.gov (United States)

    Fruit cracking is a serious disorder that causes a major loss of marketable yield and revenue in the muskmelon (Cucumis melo L.) fruit industry. The physiological and environmental factors causing cracking are poorly understood. Although generally considered a physiological disorder caused by fluctu...

  14. Optimization of somatic embryogenesis induction in Iranian melon ...

    African Journals Online (AJOL)

    In this study, regeneration of Cucumis melo cv. Khatooni: one specific Iranian melon- via somatic embryogenesis was investigated. Three different types of explant (cotyledon, hypocotyl and cotyledonary petiole) from six days old seedlings were used. Growth regulator treatments were two levels of 6-benzyl aminopurine (0 ...

  15. Comparative physico-chemical and proximate analysis of oils of ...

    African Journals Online (AJOL)

    In rural areas of developing countries like Burkina Faso, nutritive elements are mainly composed of vegetable source. Shea nut, seeds of Sesamum indicum, Cucumis melo and Cucurbita pepo, four species widely consumed were studied. The proximate parameters: moisture, proteins and fat were analysed. Saponification ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 4101 - 4150 of 11090 ... Vol 8, No 22 (2009), Effects of different combinations and concentrations of growth regulators and photoperiod on somatic embryogenesis of cucumis melo var. flexuosus, Abstract PDF. N Comlekcioglu, YY Mendi, S Eldogan, C Unek. Vol 12, No 16 (2013), Effects of different combinations of ...

  17. Effects of different combinations and concentrations of growth ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-11-16

    Nov 16, 2009 ... The present study describes the effects of medium, explant type and photoperiod on somatic embryogenesis of snake melon (Cucumis melo var. flexuosus). Two different types of explant. (cotyledon and hypocotyls) obtained from 3 days old snake melon seedlings and culture conditions were investigated ...

  18. Author Details - African Journals Online

    African Journals Online (AJOL)

    Effects of different combinations and concentrations of growth regulators and photoperiod on somatic embryogenesis of cucumis melo var. flexuosus. Abstract PDF · Vol 10, No 20 (2011) - Articles The effects of the regulated deficit irrigation on yield and some yield components of common bean (Phaseolus vulgaris L.) under ...

  19. Author Details - African Journals Online

    African Journals Online (AJOL)

    Effects of different combinations and concentrations of growth regulators and photoperiod on somatic embryogenesis of cucumis melo var. flexuosus. Abstract PDF. ISSN: 1684-5315. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners ...

  20. 7 CFR 319.56-26 - Melon and watermelon from certain countries in South America.

    Science.gov (United States)

    2010-01-01

    ...) Beginning in Guayaquil, the road north through Nobol, Palestina, and Balzar to Velasco-Ibarra (Empalme); (ii...) Cantaloupe and watermelon from Ecuador. Cantaloupe (Cucumis melo) and watermelon (fruit) (Citrullus lanatus) may be imported into the United States from Ecuador only in accordance with this paragraph and all...

  1. QTL list: fs2.1 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95598 Cucumis melo Cucurbitaceae fs2.1 fs Fruit shape, p (pentamerous flower gen...e) co-segregated with fs12.1 1,4 H33/M43_1 LG_02 ... 4.76 ... 10.1007/s00438-001-0612-y 11862487

  2. QTL list: beta-car2.3 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95721 Cucumis melo Cucurbitaceae beta-car2.3 Beta-car quantity of Beta-carotene ...in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_II ... 52.2 6.82 ... 10.1007/s00122-008-0868-2 18773190

  3. Effect of chromium toxicity on germination and early seedling growth ...

    African Journals Online (AJOL)

    This study was conducted to determine and compare the inhibitory effects of chromium on seed germination and early seedling growth of melon (Cucumis melo L.). Chromium applications were controls; 2.5, 5, 10, 25, 50, 75, 100, 200 and 300 mgl-1 Cr in germination stage, and controls; 2.5, 5, 10, 20, 30, 40, 50, 60 and 70 ...

  4. Soluble Nutrient Production During Fermentation of Three Melon ...

    African Journals Online (AJOL)

    The amount of soluble nutrient production (soluble sugars and free amino acids) in three varieties of melon seeds, Citrullus colocynthis (A), Cucumis melo (B) and Cucumeropsis mannii (C) during fermentation in Musa spp (M), Thaumatococcus danielli (D) and Carica papaya (P) leaves were investigated. Proximate ...

  5. USDA 846-1 fractal melon and derived recombinant inbred lines

    Science.gov (United States)

    The Agricultural Research Service, United States Department of Agriculture announces the release of a melon (Cucumis melo L.) breeding line with highly branched, fractal-type architectural growth habit and 81 derived recombinant inbred lines (RIL). The indeterminate, monoecious USDA 846-1 produces 2...

  6. QTL list: beta-car4.1_May-July [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95724 Cucumis melo Cucurbitaceae beta-car4.1_May-July Beta-car quantity of Beta-car...otene in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_IV ... 0 9.69 ... 10.1007/s00122-008-0868-2 18773190

  7. QTL list: beta-car4.1_May-August [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95722 Cucumis melo Cucurbitaceae beta-car4.1_May-August Beta-car quantity of Beta-car...otene in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_IV ... 0 6.33 ... 10.1007/s00122-008-0868-2 18773190

  8. QTL list: beta-car2.2 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95720 Cucumis melo Cucurbitaceae beta-car2.2 Beta-car quantity of Beta-carotene ...in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_II ... 43.1 8.18 ... 10.1007/s00122-008-0868-2 18773190

  9. QTL list: beta-car4.2 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95725 Cucumis melo Cucurbitaceae beta-car4.2 Beta-car quantity of Beta-carotene ...in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_IV ... 72 3.96 ... 10.1007/s00122-008-0868-2 18773190

  10. QTL list: beta-car6.1 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95726 Cucumis melo Cucurbitaceae beta-car6.1 Beta-car quantity of Beta-carotene ...in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_VI ... 66.7 4.71 ... 10.1007/s00122-008-0868-2 18773190

  11. QTL list: beta-car4.1_May-July [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95723 Cucumis melo Cucurbitaceae beta-car4.1_May-July Beta-car quantity of Beta-car...otene in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_IV ... 5.5 9.01 ... 10.1007/s00122-008-0868-2 18773190

  12. QTL list: beta-car6.2 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95727 Cucumis melo Cucurbitaceae beta-car6.2 Beta-car quantity of Beta-carotene ...in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_VI ... 142.5 4.62 ... 10.1007/s00122-008-0868-2 18773190

  13. QTL list: beta-car1.1 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95717 Cucumis melo Cucurbitaceae beta-car1.1 Beta-car quantity of Beta-carotene ...in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_I ... 52.5 9.24 ... 10.1007/s00122-008-0868-2 18773190

  14. QTL list: beta-car1.2 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95718 Cucumis melo Cucurbitaceae beta-car1.2 Beta-car quantity of Beta-carotene ...in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_I ... 77.8 6.06 ... 10.1007/s00122-008-0868-2 18773190

  15. QTL list: beta-car2.1 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT95719 Cucumis melo Cucurbitaceae beta-car2.1 Beta-car quantity of Beta-carotene ...in mature fruit, Csf-2 gene (Beta-car4.1) ... LG_II ... 20.6 6.4 ... 10.1007/s00122-008-0868-2 18773190

  16. Comparison of some local melon genotypes selected from Lake Van ...

    African Journals Online (AJOL)

    This study aimed to compare some local melon (Cucumis melo L.) genotypes selected from the Lake Van Basin (65 ER 02, 65 ER 04, and 13 TAT 05) with some commercial melon cultivars (Ananas, Makdimon F1, and Rambo F1) for some yield and quality related traits observed in field and high tunnel conditions for two ...

  17. Metabolomic and elemental profiling of melon fruit quality as affected by genotype and environment

    DEFF Research Database (Denmark)

    Bernillon, Stéphane; Biais, Benoit; Deborde, Catherine

    2013-01-01

    Melon (Cucumis melo L.) is a global crop in terms of economic importance and nutritional quality. The aim of this study was to explore the variability in metabolite and elemental composition of several commercial varieties of melon in various environmental conditions. Volatile and non-volatile me...

  18. Protection of melon plants against Cucumber mosaic virus infection ...

    African Journals Online (AJOL)

    Adhab

    This study was carried out to characterize a virus causing severe mosaic, yellowing, stunting and leaf deformation on melon (Cucumis melo L.), and evaluate the capacity of Pseudomonas fluorescens as biofertilizer to improve plant growth and restrict the accumulation of the virus in the plant. The virus was identified as an ...

  19. Optimization of ISSR marker for African edible-seeded ...

    African Journals Online (AJOL)

    We applied a molecular approach using inter-simple sequence repeat (ISSR) markers on three African edible-seeded cucurbits (Citrullus lanatus L. Matsumura and Nakai, Cucumeropsis mannii L. Naudin and Cucumis melo var. agrestis L. Naudin). To obtain clear and reproducible bands on 1.5% agarose gels, we ...

  20. 864-IJBCS-Article-Dr Gbogouri Crobi A

    African Journals Online (AJOL)

    DR GATSING

    Three indigenous cucurbit seeds from Ivory Coast namely Cucumeropsis mannii Naudin, Citrullus lanatus var. Citroides (Thrumb.) Matsum & Nakai and Cucumis melo var. Agrestis were investigated for the physicochemical properties. Thermal properties of their crude oils extracted by a cold solvent method were also tested.

  1. Comparative study of physicochemical and thermal properties of the ...

    African Journals Online (AJOL)

    Three indigenous cucurbit seeds from Ivory Coast namely Cucumeropsis mannii Naudin, Citrullus lanatus var. Citroides (Thrumb.) Matsum & Nakai and Cucumis melo var. Agrestis were investigated for the physicochemical properties. Thermal properties of their crude oils extracted by a cold solvent method were also tested.

  2. 716-IJBCS-Article-Kouame Kra

    African Journals Online (AJOL)

    DR GATSING

    Davet P, Roux F. 1997. Détection et Isolement des Champignons du Sol. INRA : Paris. Djè Y, Kouonon LC, Zoro Bi AI, Gnamien. GY, Baudoin JP. 2006. Etude des caractéristiques botaniques, agronomi- ques et de la biologie florale du melon africain (Cucumis melo L. var. agrestis. Naudin, Cucurbitaceae). Biotechnologie ...

  3. Antioxidative enzyme activities in the leaves and callus tissues of ...

    African Journals Online (AJOL)

    The response of the antioxidant system to salt stress was studied in the leaves and callus tissues of 4 Turkish melon varieties (Cucumis melo L.) Besni, Yuva, Midyat, and Semame and a melon cultivar Galia C8. The antioxidant capability of the plants was determined by measuring superoxide dismutase (SOD) and catalase ...

  4. Metabolomics in melon: A new opportunity for aroma analysis

    NARCIS (Netherlands)

    Allwood, J.W.; Cheung, W.W.L.; Xu, Y.; Mumm, R.; Vos, de C.H.; Deborde, C.; Biais, B.; Maucourt, M.; Berger, Y.; Schaffer, A.; Rolin, D.; Moing, A.; Hall, R.D.; Goodacre, R.

    2014-01-01

    Cucumis melo fruit is highly valued for its sweet and refreshing flesh, however the flavour and value are also highly influenced by aroma as dictated by volatile organic compounds (VOCs). A simple and robust method of sampling VOCs on polydimethylsiloxane (PDMS) has been developed. Contrasting

  5. LOS GRUPOS DE INTERÉS EN LAS ENTIDADES DE CRÉDITO ESPAÑOLAS

    Directory of Open Access Journals (Sweden)

    Seguí Alcaraz, Antoni

    2012-01-01

    Full Text Available Se plantean los orígenes, evolución y clasificación de los grupos de interés (stakeholders. Se pone de relieve la relación que se entabla entre la entidad de crédito como organización social y sus diferentes grupos de interés, analizándose la importancia que se asigna a estos. El trabajo de campo se realizó a través de una encuesta contestada por 57 entidades de crédito españolas. Los resultados del estudio muestran la sensibilidad de las entidades de crédito hacia la RSE (Responsabilidad Social de la Empresa, con referencia al conjunto del sector financiero español. Nuestro objetivo es analizar la importancia que tienen los diversos grupos de interés: accionistas, empleados, clientes, proveedores, la comunidad y la administración pública para las entidades de crédito españolas. Las entidades de crédito centran su interés básicamente en dos grupos de interés: empleados y clientes. La transparencia y el diálogo abierto sobre actuación, prioridades y planes futuros de sostenibilidad son actuaciones a llevar a la práctica para que se inspire confianza y futuro.

  6. Orientação de pais no processo de psicoterapia infantil de grupo

    Directory of Open Access Journals (Sweden)

    Helena Bazanelli Prebianchi

    2011-04-01

    Full Text Available Este trabalho descreve um grupo de orientação de pais diferente daqueles cujo foco é o ensino de habilidades específicas de criação de filhos. Embora tais habilidades também sejam modeladas no grupo, o objetivo do trabalho descrito é ajudar os pais a abandonarem certos comportamentos negativos na criação de seus filhos, condutas fortemente ligadas à sua imagem pessoal e ao modo pelo qual foram criados. A condução do grupo de pais ocorreu concomitantemente ao atendimento terapêutico dos filhos. Na primeira etapa, os participantes aprenderam a identificar seus sentimentos negativos, ao mesmo tempo em que elaboravam princípios comportamentais e de desenvolvimento, na criação dos filhos. A segunda etapa da condução do grupo utilizou-se da dramatização e outras intervenções cognitivo-comportamentais para ajudar os pais a discriminarem seus sentimentos negativos anteriormente aprendidos, reduzindo a intensidade da culpa, da raiva, da vergonha e da autopiedade, possibilitando que reestruturassem os comportamentos em relação aos filhos.

  7. El grupo de trabajo del agua subterránea: experiencias de participación

    OpenAIRE

    Cisneros de Britto, Julio Cesar de; LÓpez Vera, Fernando

    2008-01-01

    López Vera, F., & Cisneros Britto, J. C. (2008). El Grupo de trabajo del agua subterránea: Experiencia de participación. Ciudadanos y usuarios en la Gestión del Agua. XIII Jornadas de Derecho de Aguas. Editor. Antonio Embid Irujo. Universidad de Zaragoza.

  8. Análisis de grupos de pilotes sometidos a cargas de sismo

    Directory of Open Access Journals (Sweden)

    Carlos Javier Sainea Vargas

    2012-05-01

    Full Text Available Se presentan los análisis de los resultados obtenidos al emplear la metodología p-y en el análisis de un amplio número de modelos de grupos de pilotes, en los que se aplicaron modificaciones a las curvas p-y para la inclusión de los efectos de grupo y carga sísmica; dichos modelos han sido elaborados incluyendo diferentes configuraciones geométricas de los grupos, y varios tipos de suelos de cimentación. Para el análisis de los modelos se ha empleado el software especializado FB-Multipier, que, además de incluir la metodología elegida, permite la aplicación de cargas sísmicas reales, como las dadas por señales acelerográficas. A partir de los resultados de deflexiones y momentos obtenidos en el análisis de losmodelos, se presentan algunas observaciones sobre el comportamiento de los grupos de pilotes sometidos a carga sísmica y se incluyen consideraciones referentes a su diseño.

  9. Metacognição em Grupos de Problem-based Learning (PBL

    Directory of Open Access Journals (Sweden)

    Adriana Vargas

    2017-08-01

    Full Text Available Aprendizagem em grupo é um processo que envolve a mobilização de funções cognitivas e desenvolve competências necessárias no decorrer da vida. A Problem-based Learning (PBL, uma proposta de aprendizagem em grupo, enfatiza o desenvolvimento cognitivo e pode potencializar a metacognição. Objetivou-se responder as questões: 1 a PBL é uma metodologia que envolve o desenvolvimento da metacognição? 2 pode-se relacionar os estudos da metacognição no contexto grupal à PBL? Realizou-se o estado do conhecimento do tema, entre 2010 a 2015, contendo os termos metacognition e Problem-based Learning, no portal de periódicos da CAPES. Oito pesquisas foram selecionadas por descreverem evidências empíricas da metacognição em grupos de PBL. A PBL pode ser aplicada aos estudos de aprendizagem em grupo e metacognição, por mobilizar conhecimentos, a tomada de consciência e o autocontrole.

  10. Grupo de Trabajo de Gestión del Conocimiento y Propiedad Intelectual

    OpenAIRE

    Grupo de Trabajo de Gestión del Conocimiento y Propiedad Intelectual, Universidad de Castilla-La Mancha.

    2015-01-01

    Presentación del Grupo de Gestión del Conocimiento y Propiedad Intelectual de la Universidad de Castilla-La Mancha, en la Jornada Técnica destinadas a bibliotecarios del Consorcio G9 de universidades, celebrada en Ciudad Real el 22 de enero de 2015.

  11. Uso de TIC: posibles relaciones con habilidades cognitivas e interpersonales en un grupo de adolescentes

    National Research Council Canada - National Science Library

    Gabriela Raynaudo; Ana Borgobello

    2016-01-01

    ... de la Información. En este artículo se describen hábitos de uso de tecnologías y habilidades cognoscitivas e interpersonales en un grupo de adolescentes con la finalidad de encontrar posibles relaciones entre los temas estudiados...

  12. El Grupo Cerúleo: Collaboration to assess nonbreeding range of Cerulean Warbler in South America

    Science.gov (United States)

    Gabriel Colorado; Paul Hamel; Amanda Rodewals; Wayne Thogmartin

    2008-01-01

    Cerulean Warbler (Dendroica cerulea. Parulidae) has been listed as a vulnerable species by the International Union for the Conservation of Nature because of recent population declines. An international, proactive approach to Cerulean Warbler conservation, the Cerulean Warbler Technical Group, was founded in 2001. One of its subcommittees, El Grupo...

  13. Grupos de pesquisa em história da enfermagem: a realidade brasileira

    Directory of Open Access Journals (Sweden)

    Maria Itayra Padilha

    2012-02-01

    Full Text Available Este estudo tem por objetivo analisar as atividades dos grupos de pesquisa em história da enfermagem existentes no Brasil e sua articulação com os cursos de graduação e pós-graduação em enfermagem. É um estudo exploratório qualitativo descritivo documental, realizado no período de julho de 2008 a março de 2010. Foram identificados 34 grupos de pesquisa com pelo menos uma de suas linhas de pesquisa em história da enfermagem. Os resultados indicaram que os grupos têm produzido um vasto material bibliográfico, linhas de pesquisa e ampla participação de estudantes de graduação e pós-graduação. Verifica-se também que ainda não há uma rede de comunicação entre os grupos da mesma linha de pesquisa. Conclui-se que é necessário trabalhar na interdisciplinaridade e no fortalecimento de algumas linhas de pesquisa que sustentem o conhecimento em história da enfermagem brasileira.

  14. Análisis de grupos de pilotes sometidos a cargas de sismo

    Directory of Open Access Journals (Sweden)

    Carlos Javier Sainea Vargas

    2011-07-01

    Full Text Available Se presentan los análisis de los resultados obtenidos al emplear la metodología p-y en el análisis de un amplio número de modelos de grupos de pilotes, en los que se aplicaron modificaciones a las curvas p-y para la inclusión de los efectos de grupo y carga sísmica; dichos modelos han sido elaborados incluyendo diferentes configuraciones geométricas de los grupos, y varios tipos de suelos de cimentación. Para el análisis de los modelos se ha empleado el software especializado FB-Multipier, que, además de incluir la metodología elegida, permite la aplicación de cargas sísmicas reales, como las dadas por señales acelerográficas. A partir de los resultados de deflexiones y momentos obtenidos en el análisis de losmodelos, se presentan algunas observaciones sobre el comportamiento de los grupos de pilotes sometidos a carga sísmica y se incluyen consideraciones referentes a su diseño.

  15. TTI Phase 2 Institutional Support: Grupo de Análisis para el Desarrollo

    International Development Research Centre (IDRC) Digital Library (Canada)

    TTI Phase 2 Institutional Support: Grupo de Análisis para el Desarrollo ... Since 1980, GRADE has devoted itself to economic, educational, environmental, and social research in areas relevant to Peru and Latin America's ... Soutien organisationnel de la phase 2 de l'ITT : Asociación de Investigación y Estudios Sociales.

  16. O grupo como dispositivo das relações sociais do sujeito

    NARCIS (Netherlands)

    R. Quadros Rigoni (Rafaela); T.G. Santi (Thais); G.S. Campos (Gracielie)

    2007-01-01

    textabstractRESUMO: Pensar o grupo como um dispositivo de transformação nas relações dos sujeitos parece uma tarefa intensa; neste trabalho nos propomos a pensar questões grupais e as transformações subjetivas que ocorreram no desenrolar desse território que foi criado, dando ênfase ao processo de

  17. O uso dos grupos focais on-line síncronos em pesquisa qualitativa

    Directory of Open Access Journals (Sweden)

    Gabriela Sagebin Bordini

    2011-09-01

    Full Text Available No Brasil, ainda hoje são pouco comuns os trabalhos que utilizam o computador e a Internet para coletar dados na pesquisa qualitativa em psicologia. Poucos são os estudos, por exemplo, que trabalham com grupos focais realizados via Internet, ao invés de utilizarem o clássico formato presencial. A técnica dos grupos focais on-line síncronos, contudo, não consiste na mera transposição dos tradicionais grupos focais para o ambiente virtual. Essa nova ferramenta, ao ser introduzida no conjunto dos procedimentos de pesquisa, carrega consigo suas especificidades, modificando o método qualitativo. Cabe, então, divulgar o uso de tal técnica mostrando suas particularidades para, assim, contribuir para o avanço da pesquisa qualitativa em psicologia. Neste trabalho, descreve-se o uso que foi feito dos grupos focais on-line síncronos em uma pesquisa qualitativa, para recuperar as etapas realizadas e relatar as especificidades encontradas.

  18. PESQUISA COM GRUPO FOCAL: CONTRIBUIÇÕES AO ESTUDO DAS REPRESENTAÇÕES SOCIAIS

    Directory of Open Access Journals (Sweden)

    Danielle Oliveira Nóbrega

    Full Text Available RESUMO Este artigo é uma reflexão teórica, que objetiva discutir sobre o grupo focal enquanto aporte metodológico válido para pesquisas com a Teoria das Representações Sociais - TRS. Tem como argumento central a afirmação de que o grupo focal é uma técnica de produção de dados profícua em estudos que enfoquem o contexto grupal e os movimentos de constituição das representações sociais, uma vez que pode evidenciar tal processo e sua sociogênese. Para tanto, discute-se a TRS, enfatizando seu caráter psicossocial e sua base sociogenética e, em seguida, aborda-se a estratégia do grupo focal em pesquisas com a TRS. Conclui-se que o cenário de comunicações e interações proporcionado pelo grupo focal cria oportunidades de acesso às representações sociais e aos elementos e processos grupais que as constituem, favorecendo em especial investigações sobre suas características sociogenéticas.

  19. PASSE.psi - Dinâmicas de grupos : boas práticas

    OpenAIRE

    Tinoco, Rui; Cláudio, Débora; Pereira de Sousa, Nuno

    2014-01-01

    Programa Alimentação Saúdavel em Saúde Escolar (PASSE) Manual PASSE com listagem de boas práticas e opções a serem tomadas quando os dinamizadores estiverem a trabalhar com grupos de alunos ou de adultos em contexto do programa PASSE.

  20. Grupo multifamiliar no contexto dos Transtornos Alimentares: a experiência compartilhada

    Directory of Open Access Journals (Sweden)

    Manoel Antônio Santos

    2016-01-01

    Full Text Available Este estudio trata de explorar la experiencia compartida por los cuidadores que participaron en un grupo de apoyo para familiares de personas diagnosticadas con trastornos alimenticios (TA, buscando identificar los sentimientos experimentados y la posible reinterpretación de sus experiencias como cuidadores. Fueron analizadas cinco sesiones del Grupo de Apoyo Psicológico a Familiares, al que asistieron 23 familiares de pacientes registrados en una clínica especializada en TA en el estado de São Paulo, Brasil. Los datos fueron sometidos a análisis de contenido temático e interpretados a la luz de la teoría psicodinámica. Los resultados indican que los miembros de la familia tratan de comprender las causas del problema, perciben el miembro afectado por el trastorno como emocionalmente inmaduro, experimentan sentimientos de culpa y déficits de auto-cuidado, se benefician de la presencia del padre durante el tratamiento y de otros miembros de la familia que no sean las madres, y aprovechan el grupo para reforzar su papel como cuidadores familiares. Se hizo evidente que el grupo puede funcionar como una alternativa importante en la construcción de relaciones más sanas, induciendo cambios en la dinámica familiar.

  1. Los grupos armados ante el Derecho Internacional contemporáneo. : Obligaciones y responsabilidad

    NARCIS (Netherlands)

    Inigo Alvarez, L.|info:eu-repo/dai/nl/394241029

    2016-01-01

    Los grupos armados no estatales no son un fenómeno nuevo. Sin embargo, el incremento de los conflictos armados internos desde el final de la Guerra Fría así como el surgimiento del terrorismo internacional han abierto el debate sobre la eficacia del Derecho Internacional Humanitario (DIH)y del

  2. TTI Phase 2 Institutional Support: Grupo de Análisis para el Desarrollo

    International Development Research Centre (IDRC) Digital Library (Canada)

    This funding will advance Grupo de Análisis para el Desarrollo's (GRADE) role as a credible policy research institution in Peru by enhancing its ability to provide high-quality, influential, and policy-relevant research. About GRADE Located in Lima, Peru, GRADE is a private, non-profit, non-political research centre.

  3. Comportamento de poedeiras criadas a diferentes densidades e tamanhos de grupo em ambiente enriquecido

    Directory of Open Access Journals (Sweden)

    Danilo Florentino Pereira

    2013-06-01

    Full Text Available O objetivo deste trabalho foi determinar diferenças comportamentais entre poedeiras criadas sob diferentes densidades e tamanhos de grupo, em condições de ambiente enriquecido. Foram utilizadas poedeiras Isa Brown com idade entre 30 e 32 semanas alojadas em galpões de escala reduzida e distorcida. As aves foram criadas durante 28 dias, em baias com cama de maravalha, poleiro e ninho. Foram avaliados dois tamanhos de grupos (6 e 12 aves e duas densidades de criação (774 e 1.440 cm² por ave, em arranjo fatorial com três repetições. Em amostras de vídeo de 15 min, foram registrados as frequências e os tempos de expressão dos comportamentos: arrumar penas, banho de areia, bater asas, beber água, bicar, coçar a cabeça, ciscar, comer, empoleirar, esticar perna, perseguir, sentar e visitar o ninho. Foram observados efeitos significativos dos tratamentos e da interação entre eles. O grupo de seis aves manifestou aumento da frequência de comportamentos que indicam maior frustração das aves, independentemente da densidade. O tamanho de grupo é o fator mais importante para o bem-estar das aves.

  4. Os efeitos na formação de residentes de psiquiatria ao experimentarem grupos GAM

    Directory of Open Access Journals (Sweden)

    Thais Mikie de Carvalho Otanari

    Full Text Available Trata-se de uma dissertação de mestrado que propôs conhecer e descrever os efeitos desencadeados na formação de residentes de psiquiatria ao participarem de grupos constituídos por pessoas diagnosticadas com transtorno mental que utilizaram a intervenção GAM (Gestão Autônoma da Medicação como norteadora. A aposta foi que, ao participarem dos encontros, os residentes experienciariam uma nova situação em que a palavra do paciente passaria a ser ouvida de forma diferente da trabalhada no currículo da residência, construindo um dispositivo capaz de transformar suas práticas clínicas. Para verificar esses efeitos, utilizamos dois grupos focais, realizados antes e depois dos grupos de intervenção, além de entrevistas individuais conduzidas após o término dos grupos. A análise do material indicou efeitos principalmente quanto à escuta clínica desses profissionais, mostrando a necessidade de estudos mais aprofundados.

  5. Grupo com irmãos de pessoas com necessidades especiais

    Directory of Open Access Journals (Sweden)

    Karina Silva Molon

    2011-11-01

    Full Text Available O relacionamento entre irmãos favorece o desenvolvimento de ambos porque a relação que se estabelece é de reciprocidade e de complementaridade. Para algumas crianças, a experiência de ter um “irmão especial” pode ser intensamente positiva, mas para outras a vivência pode ser difícil. Esta pesquisa teve como objetivo proporcionar a troca de experiências entre os irmãos, assim como auxiliá-los no manejo com seus sentimentos relacionados ao irmão, aos pais, à família e consigo mesmo. O desenvolvimento desse projeto estava centrado num grupo de ajuda mútua, dentro de fundamentos teóricos que compreendem a linha psicanalítica, caracterizado por um grupo do tipo homogêneo e aberto, tendo como participantes seis adolescentes e pré-adolescentes, com idade variando entre 10 e 14 anos. As reuniões do grupo aconteciam no Núcleo de Práticas em Psicologia do Centro Universitário Franciscano – UNIFRA, e compreendiam dois encontros mensais, tendo duração de 1h30min cada e participação gratuita. Num período que compreendeu os meses de Março à Novembro de 2004. O espaço do grupo permitiu aos participantes a escuta de suas dificuldades do dia-a-dia e principalmente dos sentimentos provenientes do convívio com o irmão e auxiliou também no encontro de novas alternativas para lidar com as diferenças. Palavras-chave: Grupo de Irmãos. Interação.

  6. Considerações peircinanas sobre o gesto na peformance do Grupo UAKTI Percian considerations on gesture in the performance of the Grupo UAKTI

    Directory of Open Access Journals (Sweden)

    Patrícia Furst Santiago

    2009-01-01

    Full Text Available Este artigo lida com alguns conceitos e significados de gesto em música. A partir de uma definição de alguns dos aspectos que integram o gesto na performance musical e da perspectiva semiótica de Charles Sanders PEIRCE (2000, apresentamos, segundo nossa própria percepção, uma observação qualitativa da gestualidade na performance dos músicos do Grupo UAKTI, buscando compreender seus possíveis significados. Propomos reflexões sobre a função e importância do gesto na performance musical e suas implicações para a pedagogia dos instrumentos.This article deals with some concepts and meanings of gesture in music. Based on the definition of some aspects that integrate gesture in musical performance as well as on the semiotic perspective of Charles Sanders PEIRCE (2000, we offer, according to our own perceptions, a qualitative observation of the gestural performances of the musicians that form the Grupo UAKTI in order to understand their possible meanings. We reflect on the function and importance of gesture in musical performance and its implication for the pedagogy of the instruments.

  7. Evolucao dos precos relativos de grupos alimentares entre 1939 e 2010, em Sao Paulo, SP

    Directory of Open Access Journals (Sweden)

    Tania Yuka Yuba

    2013-06-01

    Full Text Available OBJETIVO: Analisar a evolução dos preços relativos dos grupos de produtos alimentares e sua influência nas políticas públicas para uma alimentação saudável. MÉTODOS: Foram analisados dados do município de São Paulo de 1939 a 2010, a partir da aplicação de métodos de cálculo de números-índices. Foram utilizados dados do banco de preços e estruturas de ponderação da Fundação Instituto de Pesquisas Econômicas (1939 a 1988 e do Instituto Brasileiro de Geografia e Estatística (1989 a 2010. O banco de preços foi organizado, sua consistência foi testada e os preços foram deflacionados pelo Índice de Preços ao Consumidor. Os dados relativos a preços deflacionados foram calculados e agregados por categorias e grupos alimentares da pirâmide alimentar adaptada. Os índices de preços de cada grupo foram construídos aplicando a fórmula de Laspeyres modificada. O índice geral de preços da alimentação foi comparado com índices de cada grupo alimentar e respectiva categoria: alimentos in natura; alimentos industrializados; bebidas; carnes, leguminosas, leite e ovos; cereais e tubérculos; e refeições fora do domicílio. RESULTADOS: Os grupos alimentares de gorduras, óleos, condimentos, açúcares e alimentos processados (alimentos industrializados apresentaram tendência de redução de preços em termos relativos. O índice dos alimentos in natura, como frutas e verduras, apresentaram tendência de elevação de preços. Outros grupos alimentares, como cereais, farinhas e massas, carnes, leite e ovos, apresentaram estabilidade de preços relativos ao longo do tempo. CONCLUSÕES: A evolução dos preços relativos dos alimentos no município de São Paulo mostra tendência desfavorável à manutenção da alimentação saudável em nível domiciliar em longo prazo.

  8. O processo decisório em grupo: uma análise temporal-ambiental

    Directory of Open Access Journals (Sweden)

    Fabiano Rodrigues

    2014-03-01

    Full Text Available Neste artigo, investiga-se a dinâmica do processo decisório conduzido por grupos de trabalho ao longo do tempo em ambientes com diferentes latitudes de ação (graus de liberdade para a atuação dos gestores distintos. O objetivo é verificar a influência do tempo e do ambiente nos processos decisórios em grupo. O tema é enfocado a partir de uma revisão teórica considerando três tópicos - o processo decisório conduzido por grupos, a influência do tempo nesses processos e a influência do ambiente nesses processos -, os quais dão origem às hipóteses a serem testadas. Na pesquisa de campo, de natureza quantitativa, utiliza-se o método survey e os dados foram coletados com 89 grupos da disciplina Jogos de Empresa, em um curso de graduação em Administração de Empresas. Para o tratamento dos dados, utilizou-se a modelagem por equações estruturais via partial least square para avaliação das relações entre os construtos. Como resultado, constatou-se influência temporal na associação entre qualidade do processo decisório e resultados organizacionais, reduzindo-se o efeito do perfil dos grupos. Já as relações interpessoais, independente do ambiente, influenciaram nos processos de planejamento e execução das decisões. Concluiu-se que diferentes relações entre perfil dos gestores, qualidade do processo e resultados são observadas pela incorporação simultânea das dimensões temporal e ambiental como contingências na análise do processo decisório em grupo.

  9. Diferencias, en el uso del tiempo, entre varones y mujeres y otros grupos sociales

    Directory of Open Access Journals (Sweden)

    MARIANO ÁLVARO PAGE

    1996-01-01

    Full Text Available En este artículo se presentan los resultados encontrados al estudiar como usa su tiempo la población española de 18 y más años. Las actividades de "usos del tiempo" se han clasificado en cinco diferentes grupos o áreas conductuales: necesidades personales, trabajo doméstico, educación, trabajo remunerado y tiempo libre. se comparan los resultados obtenidos por mujeres y varones, así como por otros grupos, confeccionados con las siguientes variables sociodemográficas: hábitat, edad, estudios terminados, ingresos mensuales recibidos en el hogar, número de personas que conviven juntas en el mismo hogar, estado civil y días de la semana. todos estos resultados se comparan de manera sistematica con los de estudios parecidos realizados con anterioridad.

  10. PESQUISA COM GRUPO FOCAL: CONTRIBUIÇÕES AO ESTUDO DAS REPRESENTAÇÕES SOCIAIS

    OpenAIRE

    Nóbrega,Danielle Oliveira; Andrade,Erika dos Reis Gusmão; Melo,Elda Silva do Nascimento

    2016-01-01

    RESUMO Este artigo é uma reflexão teórica, que objetiva discutir sobre o grupo focal enquanto aporte metodológico válido para pesquisas com a Teoria das Representações Sociais - TRS. Tem como argumento central a afirmação de que o grupo focal é uma técnica de produção de dados profícua em estudos que enfoquem o contexto grupal e os movimentos de constituição das representações sociais, uma vez que pode evidenciar tal processo e sua sociogênese. Para tanto, discute-se a TRS, enfatizando seu ca...

  11. Grupo de pacientes de cirurgia cardíaca: relato de experiência

    Directory of Open Access Journals (Sweden)

    Elisa Helena Kuhn

    1986-09-01

    Full Text Available Neste trabalho relata-se uma experiência de grupo com pacientes de cirurgia cardíaca. A atividade realiza-se no INSTITUTO DE CARDIOLOGIA DO RIO GRANDE DO SUL e tem por objetivo proporcionar aos pacientes a oportunidade de verbalizarem suas ansiedades e conversarem sobre suas experiências relacionadas com a cirurgia e anestesia. Os grupos reúnem-se duas vezes por semana sendo constituídos por pacientes adultos em pré e pós-operatório imediato. A equipe de saúde é composta por enfermeiros, psicólogo, anestesista, cardiologistas e fisioterapeutas e sua atuação é no sentido de auxiliar na compreensão dos procedimentos aos quais o paciente vai se submeter, desfazendo fantasias distorcidas da realidade.

  12. Grupos empresarios y entidad informativa: una visión global

    Directory of Open Access Journals (Sweden)

    Silvina Marcolini

    2012-11-01

    Full Text Available La concentración empresaria es un fenómeno creciente del que participa el mundo en las últimas décadas. La globalización llega acompañada de rápidos avances tecnológicos, competitividad, apertura de mercados y acercamiento a otras culturas. En ese contexto, la formación de un grupo de empresas puede responder a diferentes objetivos y estar condicionada por distintos factores. En cualquier caso, el grupo debe preparar información contable consolidada de acuerdo con el método de la consolidación total. El procesamiento estadístico de los resultados del relevamiento empírico realizado sobre las empresas matrices argentinas cuyos títulos de capital o de deuda tienen cotización pública, evidencia las cuestiones planteadas.

  13. Metodologia de avaliação e desenvolvimento de grupos de alto desempenho

    Directory of Open Access Journals (Sweden)

    Ana Cristina Carneiro

    2008-11-01

    Full Text Available Este artigo discute a fundamentação teórica do Projeto de Avaliação e Desenvolvimento de Grupos de Alto Desempenho, concebido com base na metodologia da Meta-aprendizagem, e no Modelo Evolutivo, estendido à luz da Teoria da Complexidade. Visa ao desenvolvimento e aplicação de uma metodologia de avaliação/constituição de grupos de alto desempenho no ambiente de pesquisa e pós-graduação. A metodologia proposta validada empiricamente teve base no aproveitamento das virtudes e potencialidades das teorias que lhe deram origem. É destinado aos docentes e pesquisadores de vários campos do conhecimento, bem como aos dirigentes de instituições de educação superior e de pesquisa.

  14. Grupos sangüíneos humanos nos livros didáticos de biologia

    OpenAIRE

    Pschisky, Alcionete

    2003-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Educação. Programa de Pós-Graduação em Educação. O trabalho apresenta a análise do tema Grupos Sangüíneos nos livros didáticos de Biologia dos últimos 40 anos. Foram identificados 24 assuntos que mostram como a temática Grupos Sangüíneos, está sendo veiculada ao longo dos anos, com especial atenção às questões de saúde humana. A presença e a profundidade de tais assuntos oscilam nas obras examinadas. O t...

  15. INFLUENCIA DE LOS GRUPOS ESTRATÉGICOS SOBRE EL RENDIMIENTO EMPRESARIAL: UN ENFOQUE MULTINIVEL

    Directory of Open Access Journals (Sweden)

    Pereira Moliner, J.

    2009-01-01

    Full Text Available Uno de los principales temas de investigación en el campo de la dirección estratégica es responder a la cuestión de por qué las empresas obtienen diferentes niveles de desempeño. Este estudio responde a esta cuestión desde el enfoque de los grupos estratégicos. Esta investigación analiza la relación de los grupos estratégicos con el desempeño empresarial ofreciendo un análisis multinivel sobre la importancia relativa de las diferencias de desempeño inter e intragrupo para explicar el desempeño empresarial empleando Modelos Jerárquicos Lineales (MJL. Los resultados muestran que las diferencias de desempeño intragrupo explican el desempeño empresarial en mayor medida que las intergrupo.

  16. POLÍTICAS PÚBLICAS Y DERECHOS HUMANOS EN LOS GRUPOS ÉTNICOS

    Directory of Open Access Journals (Sweden)

    Luz Marina Donato Molina

    2012-08-01

    Full Text Available Los derechos humanos de los grupos étnicos en Colombia requieren una aproximación específica, tanto filosófica como política y normativa. Estos sectores sociales de gran particularidad histórica y sociocultural tienen derechos específicos en cuanto a la protección de su cultura, su autonomía y sus territorios. Poblaciones indígenas y negras han sido brutalmente atacadas y perjudicadas por las bandas armadas de izquierda y derecha enfrentados en la guerra que se libra en Colombia. Las instituciones oficiales, y las universidades deben proponer e implementar políticas públicas hacia los grupos ètnicos basados en valores humanistas y en una comprensión informada de los Derechos Humanos colectivos de éstas poblaciones.

  17. COMUNIDADES ORIGINARIAS Y GRUPOS ÉTNICOS DE LA PROVINCIA DE JUJUY

    Directory of Open Access Journals (Sweden)

    Matilde García Moritán

    2012-01-01

    Full Text Available Esta Nota es un compendio de un texto más amplio y profundo escrito para contribuir al conocimiento de los pueblos originarios de la provincia de Jujuy (Argentina y fue pensado como una herramienta para el uso de las comunidades aborígenes. La versión que aquí se presenta resume información sobre la localización actual de los grupos étnicos y sus comunidades en el territorio jujeño. Caracteriza someramente a los diferentes grupos y repasa el establecimiento ancestral de las parcialidades indígenas en el pasado. En suma, intenta favorecer la visibilización de los pueblos originarios que habitaron y habitan hoy en Jujuy.

  18. Identidades sociales en jóvenes de sectores populares aproximaciones a un grupo de raperos

    Directory of Open Access Journals (Sweden)

    James Cuenca

    2008-01-01

    Full Text Available Este estudio se enfoca en la manera en que un grupo de jóvenes de sectores populares de Cali, Colombia, ha construido sus identidades sociales en relación con el rap. Los datos que se presentan como evidencia se apoyan en una investigación etnográfica hecha en 1998 y 2000 con grupos de raperos que tienen una fuerte ascendencia en esta ciudad. La discusión que se propone se centra, básicamente, en dos aspectos. Uno, caracterizar el tipo de identidad que los jóvenes construyen alrededor de esta oferta cultural y, dos, analizar estas identidades como un tipo de productividad simbólica que los jóvenes realizan para resistir y luchar contra las condiciones de pobreza y exclusión social en que viven.

  19. Atendimento fonoaudiológico em grupo Speech therapy group care

    Directory of Open Access Journals (Sweden)

    Manuela Luchesi Brazil Araújo

    2011-04-01

    Full Text Available Tema: atendimento fonoaudiológico em grupo na área da Fonoaudiologia. Para sua realização, visitou-se os textos publicados em revistas científicas da área, nos últimos 15 anos, e os capítulos de livros e dissertações que se detiveram em tematizar o atendimento fonoaudiológico em grupo. Objetivo: identificar, entender e discutir: 1 os princípios teóricos que justificam a indicação do atendimento em grupo, que o estruturam e o sustentam de maneira a explicitar como a dinâmica do grupo age sobre os sintomas ; 2 os critérios para a composição e formação dos grupos e, principalmente, 3 a intervenção do fonoaudiólogo e a possibilidade de eficácia de sua terapêutica. Conclusão: o levantamento bibliográfico identificou diferentes práticas fonoaudiológicas em grupo, atreladas a diversas perspectivas teóricas. No que diz respeito aos critérios de formação, à função do fonoaudiólogo no grupo, à prevalência do atendimento em grupo em relação ao individual, houve divergências de opiniões, dado que os textos visitados, não (corresponderam com a consistência teórica esperada. Tal resultado se deve ao fato de haver uma certa adoção irrefletida de conceitos de outras áreas, sem argumentação e sem a reestruturação que sua transposição para a clínica fonoaudiológica, exigiria. Sugere-se que estas incoerências ocorrem porque não se evidencia a preocupação em articular os estudos teóricos aos elementos que configuram a clínica fonoaudiológica, a saber: a semiologia, a etiologia, a diagnóstica e a terapêutica.Background: the theme of this literature review is the group therapy in the Speech Therapy area. To perform it, we studied the texts published in scientific journals of the field, in the last 15 years, in the form of articles, book chapters and dissertations, which were focused on the group therapy. Purpose: the goal is to identify, understand and discuss, the following themes: 1 the theoretical

  20. Análisis del riesgo preconcepcional en un grupo básico de trabajo

    Directory of Open Access Journals (Sweden)

    Miguel Lugones Botell

    1995-04-01

    Full Text Available Se realiza un estudio en 669 pacientes dispensarizados con riesgo PRECONCEPCIONAL, en el grupo básico de trabajo No.4 del Policlínico Docente "26 de Julio" en el municipio Playa, y se analiza el trabajo realizado con estas pacientes durante 1990 y 1991. Se valoran diferentes parámetros tales como: edad, principales factores de riesgo, tipos de anticonceptivos utilizados, así como los resultados referentes a la mortalidad infantil, la muerte fetal tardía y el bajo peso al nacer. Se concluye que las adolescentes con actividad sexual y el riesgo social fueron los grupos más numerosos en las pacientes dispensarizadas y que hubo un buen control de la natalidad en las pacientes de riesgo en cuanto a la prenaturidad y/o bajo peso, y la mortalidad infantil, que fueron íntimos.

  1. Actuación de los coordinadores de grupos de salud en la red docente asistencial

    OpenAIRE

    Santos, Luciane de Medeiros dos [UNIFESP; Oliveira, Eleonora Menicucci de [UNIFESP; Crepaldi, Maria Aparecida; Aurélio da Ros, Marco

    2010-01-01

    OBJETIVO: Analisar o modelo de atuação de coordenadores de grupos de promoção da saúde em unidades básicas de saúde vinculadas à formação de profissionais. PROCEDIMENTOS METODOLÓGICOS: Estudo qualitativo realizado no município de Florianópolis, SC, em 2001. Foram analisados quatro grupos, totalizando 24 sessões em unidades básicas de saúde. Procedeu-se à observação participante para iniciar o trabalho de campo. Os relatos foram analisados por meio da técnica de análise do discurso do tipo enu...

  2. A temática do envelhecimento humano nos grupos de pesquisa do Brasil

    Directory of Open Access Journals (Sweden)

    Maíra de Oliveira Valadares

    2013-12-01

    Full Text Available Trata-se de estudo quantitativo e descritivo que objetivou delinear uma fotografia dos grupos de pesquisa (GPs em Gerontologia no Brasil, utilizando na busca a base de dados online do Diretório de Grupos de Pesquisa no Brasil. Visualizou-se que somente 1,42% dos GPs registrados estudam o envelhecimento humano, com 36,91% deles localizados na região Sudeste e maior concentração na área de predominância da Saúde Coletiva (14,9%. Considera-se que o envelhecimento humano não está sendo pesquisado em suas múltiplas facetas, pois os GPs estão concentrados principalmente na área da saúde.

  3. Sentimentos advindos da maternidade: revelações de um grupo de gestantes

    Directory of Open Access Journals (Sweden)

    Mirlane Gondim Leite

    2014-03-01

    Full Text Available Este estudo objetivou identificar os sentimentos revelados por um grupo de gestantes em dois momentos - ao descobrir a gravidez e no instante atual da gestação -, bem como identificar dificuldades ao longo deste processo. Participaram nove gestantes com idade entre 20 e 40 anos, as quais em sua maior parte eram primíparas e conviviam com o companheiro. Depois de formado, o grupo foi levado a participar de três encontros: no primeiro se apresentou a proposta da pesquisa e as gestantes falaram dos sentimentos que as envolviam na atual gestação; o segundo encontro foi conduzido com base nos aspectos negativos relacionados à gestação identificados no primeiro encontro, encorajando as gestantes a falarem deste aspecto; e o terceiro encontro foi de encerramento do grupo e se sua avaliação pelas gestantes. Os resultados revelaram que o sentimento inicial era o de que as mulheres não desejavam a gravidez, por diversas razões, desencadeando sentimentos de tristeza, medo, culpa e ansiedade; mas estes sentimentos negativos se transformaram em sentimentos de alegria e satisfação, principalmente pelo resultado do exame de ultrassonografia e pela aceitação da gravidez pelo companheiro. Conclui-se que a formação do grupo das gestantes ofereceu acolhimento, interação das participantes e expressão significativa de suas emoções e foi uma oportunidade para revelar sentimentos e limitações/dificuldades, tanto individuais quanto coletivas.

  4. Internal Communication and Culture in Organizations: Case of Grupo FISA (Spain)

    OpenAIRE

    Jorge Moret; Carlos Arcila Calderón

    2009-01-01

    This study focuses on valuing the internal communication process (formal and informal) in organizations dedicated to Communications. For this goal, the researchers studied the case of a Spanish Communication Corporation (identified under the nickname of Grupo FISA), observing its internal communication structure, applying interviews and tests to members of this organization. The current article pretends to contrast the formal and institutionalized communication with the actual informal way. B...

  5. Grupos de idosos: atuação da psicogerontologia no enfoque preventivo

    Directory of Open Access Journals (Sweden)

    Olga Nazaré Pantoja de Morais

    Full Text Available Este artigo descreve estratégias de enfrentamento saudável do processo de envelhecimento através da intervenção grupal do setor de psicologia de um centro de referência à saúde do idoso. São discutidos os aspectos psicológicos envolvidos no envelhecimento, as limitações e dificuldades dessa fase bem como as possibilidades saudáveis de enfrentamento desse processo. A atuação com grupos é uma importante contribuição na formação de uma rede de suporte psicossocial. Os grupos desenvolvidos foram: Cuidando do Cuidador, que proporcionou momentos de reflexão sobre o “cuidar” a familiares e/ou idosos que exercem a função de cuidadores; o grupo Exercitando o Corpo e a Mente, que estimulou os idosos à descoberta de práticas corporais e estímulos mentais saudáveis em seu cotidiano, e Cuidando da Saúde com Alegria, que visou à conscientização do autocuidado nos idosos participantes, através da descoberta de atividades prazerosas em seu dia a dia. Os resultados alcançados mostraram que os idosos atendidos nesses grupos passaram a perceber a necessidade de responsabilizarem-se pela própria saúde como prioridade em suas vidas. A intervenção do psicólogo como agente facilitador do processo grupal mostrou relevante importância no atendimento com idosos, visto sua notável contribuição na aquisição e/ou manutenção de uma velhice saudável.

  6. Psicoterapia de grupo: como surgiu e evoluiu Psicoterapia de grupo: como surgió y evolucionó Group psychotherapy: how it emerged and evolved

    Directory of Open Access Journals (Sweden)

    Luiz Paulo de C. Bechelli

    2004-04-01

    Full Text Available Este estudo tem por objetivo oferecer um panorama histórico do surgimento e evolução da psicoterapia de grupo, delineando suas raízes, principais modelos e pressupostos teóricos. Sua origem remonta ao início do século passado (1905, estendendo-se por cerca de cinco décadas: período de configuração e desenvolvimento técnico. Posteriormente, a psicoterapia de grupo passou pela fase de expansão teórica nos anos 50 e 60, seguida da fase de consolidação na década de 70, e de amadurecimento nos anos 80 e 90. Finalmente, examina-se sua evolução recente, dando ênfase especial à construção de novos modelos. Nos últimos anos, diversas técnicas desta modalidade de tratamento têm sido desenvolvidas para atendimento de populações específicas de pacientes, com as mais diversas condições médicas e psicossociais, o que sugere uma tendência crescente rumo a uma maior especificidade de sua aplicação.Este estudio tiene por objetivo mostrar un panorama histórico del surgimiento y evolución de la psicoterapia de grupo, delineando sus raíces, modelos principales y presupuestos teóricos. Su origen se remonta al inicio del siglo pasado (1905, extendiéndose por cerca de cinco décadas: periodo de configuración y desarrollo técnico. Posteriormente la psicoterapia de grupo paso por la fase de expansión teórica en los años 50 y 60, seguida de la fase de consolidación en la década de 70 y llegando a su madurez en los años 80 y 90. Finalmente, se examina su reciente evolución, dando especial énfasis a la construcción de nuevos modelos. En los últimos años, diversas técnicas en esta modalidad de tratamiento han sido desarrolladas para atención de poblaciones específicas de pacientes, con las más diversas condiciones médicas y psicosociales, lo que sugiere una tendencia creciente en dirección a una mayor especificidad para su aplicación.This study aims to offer a historical overview of the emergence and evolution of

  7. Grupo de ajuda como suporte aos alcoolistas Grupo de Ayuda como Soporte a los Alcoholistas Help group as support to the alcoholics

    Directory of Open Access Journals (Sweden)

    Alice do Carmo Jahn

    2007-12-01

    Full Text Available Trata de estudo descritivo exploratório, que teve como objetivo conhecer a história de pessoas alcoolistas que freqüentam grupos de ajuda do Centro de Atendimento Psicossocial para Dependentes de Álcool e Drogas (CAPS-ad. A coleta dos dados foi realizada com dez pessoas alcoolistas no ano 2005 no Município de Santa Maria-RS. Foram utilizados um instrumento estruturado e uma técnica projetiva, o desenho-história com tema. Nos resultados, os relatos expressam como é a trajetória de suas vidas. Já o apoio que recebem através dos grupos foi demonstrado pela visão de que o local representaria uma casa, uma família, um lugar seguro, onde todos com o mesmo problema se ajudam para a reconstrução de suas vidas. Entende-se como necessário o trabalho do enfermeiro neste processo, para que o usuário consiga manter-se em abstinência.Se trata de un estudio descriptivo exploratorio que tuve como objetivo conocer la historia de personas alcoholistas, las cuales frecuentan grupos de ayuda del Centro de Atención Psicosocial para Dependientes del Alcohol y Drogas, (CAPS- ad. La colecta de los dados fue realizada con diez personas alcoholistas en el año 2005 en el Municipio de Santa Maria RS. Fueron utilizados un instrumento estructurado y una técnica proyectiva, el dibujo historia con tema. En los resultados, los relatos expresan como es la trayectoria de sus vidas. Ya el apoyo que reciben a través de los grupos fue mostrado por la visión de que el local representaba una casa, familia, un lugar seguro, donde todos con el mismo problema se ayudan para la reconstrucción de sus vidas. Es entendido que se hace necesario el trabajo del enfermero en este proceso, para que el usuario consiga mantenerse en abstinencia.It is about a descriptive exploratory study that had as objective to know the history of alcoholic people, who attends aid groups of the Center of Psychosocial Attendance for Alcohol Dependents and Drugs (CAPS-ad. The collection of

  8. Debates entre pais e mães divorciados: um trabalho com grupos

    Directory of Open Access Journals (Sweden)

    Leila Maria Torraca de Brito

    Full Text Available O artigo apresenta dados coletados em pesquisa participativa realizada por meio de grupos de reflexão com pais e mães separados. A investigação teve como objetivo avaliar dificuldades quanto ao exercício da parentalidade após a separação conjugal bem como a possibilidade do uso de grupos de reflexão em tais situações. Destacam-se, no artigo, vivências e queixas de pais e de mães que participaram de cada um dos dois grupos organizados no que diz respeito ao convívio com os filhos após a dissolução conjugal. Conclui-se que a divisão tradicional entre guardiães e visitantes acarreta dificuldades próprias a cada uma das categorias, o que pode ser bem compreendido quando os pais se reúnem para o debate sobre o tema.

  9. Ictericia e incompatibilidad por grupo Kell: caso clínico.

    Directory of Open Access Journals (Sweden)

    Miguel Zúñiga

    2009-01-01

    Full Text Available Dentro de las patologías más frecuentes que afectan al recién nacido se encuentra la ictericia. Sus etiologías son diversas y conforman una larga lista que varía desde causas infecciosas, metabólicas, hematológicas, inmunológicas, entre otras. Sin embargo, cuando se presenta durante las primeras horas, las causas más frecuentes corresponden a incompatibilidades de grupo sanguíneo y de ellas, la incompatibilidad Rh y ABO suelen ser más frecuentes. La incompatibilidad por grupo Kell, en cambio, es un trastorno mucho menos frecuente. Se presenta en un recién nacido con ictericia secundaria a una anemia hemolítica y que posee anticuerpos relacionados con el grupo sanguíneo Kell. Su evolución puede ser compleja y severa, requiriendo en algunos casos manejo en cuidados intensivos y apoyo importante de hemoderivados. Todo lo anterior hace importante conocer esta patología, de manera de poder identificarla y actuar a tiempo en su tratamiento.

  10. La construcción de los derechos del grupo social transgénero

    Directory of Open Access Journals (Sweden)

    Jimena Cardona-Cuervo

    2016-01-01

    Full Text Available El presente artículo aborda el tema de los derechos sociales del grupo social transgénero, tradicionalmente marginado y discriminado por una sociedad que le niega la existencia de una identidad propia, a una vida digna y, por lo tanto, el derecho a la felicidad. Se asume como punto de partida que en las sociedades modernas la aceptación del derecho de igualdad sin distinción de sexo ha suprimido la correlación entre género y exclusión, pero no ha conseguido eliminar los efectos de la exclusión de la que son objeto algunos grupos con el consiguiente atentado a su dignidad, particularmente los que componen el grupo de las personas transgénero. En este sentido, y para lograr la concreción de los derechos fundamentales y sociales de todas las personas, se plantea que es preciso abandonar la concepción de la sociedad que obliga al ser humano a identificarse exclusivamente como hombre o mujer e implantar un nuevo paradigma acorde con la existencia de una ciudadanía democrática e incluyente mediante una política pública integral, que contemple la construcción de identidades de género no normativas.

  11. La religiosidad en Aguascalientes: Comparación entre dos grupos de edad

    Directory of Open Access Journals (Sweden)

    María Estela Esquivel Reyna

    2015-01-01

    Full Text Available En este artículo se realiza una comparación de elementos propios de las creencias y las prácticas religiosas de dos grupos generacionales distintos: entre los grupos de edad de 18 a 24 años, y de 45 a 54 años. Los datos usados para este análisis fueron tomados de la Encuesta de Creencias y Prácticas Religiosas en Aguascalientes 2009. Deducimos que el paisaje de fondo de las diferencias encontradas entre los grupos está constituido por los cambios en Aguascalientes en los últimos 30 o 40 años: inmigración, industrialización, crecimiento urbano y de la población, abandono del campo, entre otros muchos que permiten hablar de que, literalmente, los aquí considerados “mayores”, crecieron en un mundo distinto del que lo hacen los individuos de 18 a 24 años.

  12. Ictericia e incompatibilidad por grupo Kell: caso clínico.

    Directory of Open Access Journals (Sweden)

    Miguel Zúñiga

    2010-08-01

    Full Text Available Dentro de las patologías más frecuentes que afectan al recién nacido se encuentra la ictericia. Sus etiologías son diversas y conforman una larga lista que varía desde causas infecciosas, metabólicas, hematológicas, inmunológicas, entre otras. Sin embargo, cuando se presenta durante las primeras horas, las causas más frecuentes corresponden a incompatibilidades de grupo sanguíneo y de ellas, la incompatibilidad Rh y ABO suelen ser más frecuentes. La incompatibilidad por grupo Kell, en cambio, es un trastorno mucho menos frecuente. Se presenta en un recién nacido con ictericia secundaria a una anemia hemolítica y que posee anticuerpos relacionados con el grupo sanguíneo Kell. Su evolución puede ser compleja y severa, requiriendo en algunos casos manejo en cuidados intensivos y apoyo importante de hemoderivados. Todo lo anterior hace importante conocer esta patología, de manera de poder identificarla y actuar a tiempo en su tratamiento.

  13. Grupo Drosophila asiri (Diptera, Drosophilidae, un nuevo grupo de especies andinas con la descripción de dos nuevas especies y la redescripción de Drosophila asiri

    Directory of Open Access Journals (Sweden)

    María Luna Figuero

    2012-03-01

    Full Text Available El nuevo grupo Drosophila asiri pertenece al subgénero Drosophila. Los ejemplares fueron capturados en los bosques andinos del Ecuador, desde los 3200 hasta los 4000 m de altitud. A este grupo pertenecen Drosophila (D. asiri Vela & Rafael, 2005 previamente ubicada dentro del grupo D. onychophora, y dos nuevas especies; Drosophila (D. yuragyacum sp. nov. y Drosophila (D. yanaurcus sp. nov. Las capturas se realizaron en el bosque protector Pasochoa, en la quebrada de Cruz Loma y en el páramo de Papallacta, utilizando cebo de banano y levadura. Los miembros del nuevo grupo por el momento son endémicos de los Andes ecuatorianos. Las tres especies del grupo D. asiri son moscas de tamaño grande (aproximadamente 6 mm. Los machos presentan el edeago quitinizado con dos proyecciones laterales en la cabeza a manera de cuernos muy quitinizados. Estas características diferencian a las especies del grupo D. asiri de otros grupos dentro de Drosophila.

  14. Acumulación de Grados-Día en un Cultivo de Pepino (Cucumis sativus L. en un Modelo de Producción Aeropónico Growing Degree Days Accumulation in a Cucumber (Cucumis sativus L. Crop Grown in an Aeroponic Production Model

    Directory of Open Access Journals (Sweden)

    Dubián Hoyos García

    2012-06-01

    Full Text Available Resumen. La temperatura tiene gran influencia sobre los cultivos y es clave en la determinación de la fecha de siembra, cosecha y las variables de producción. Los grados-día (GDD o unidades térmicas (HU son uno de los índices más comúnmente utilizados para estimar el desarrollo de las plantas y para predecir la fecha de cosecha. En el cultivo de pepino (Cucumis sativus L., el número de días desde la siembra hasta la cosecha depende del genotipo y su interacción con la temperatura ambiental. En este trabajo se estudiaron variables fenométricas que inciden sobre la eficiencia y producción de cultivos bajo un sistema aeropónico. Se determinó que se requirieron 726 y 660 grados-día, correspondientes a 73 y 64 días para los materiales comerciales Dasher II y Poinsset 76, respectivamente. Se analizó el efecto de dos periodos de riego 30 y 60 s, con un intervalo de aplicación de cuatro min durante el día, sobre las variables área foliar y peso seco de tallos y hojas en el híbrido Dasher II. No se encontraron diferencias significativas para los parámetros evaluados lo que indicó que el tiempo de 30 s representó una ventaja económica por el ahorro de energía. Se usaron tres soluciones nutritivas: Hoagland y Arnon, Aeropónicos 100% y Aeropónicos 50%, para determinar el efecto sobre el peso seco y el área foliar. Se encontró una reducción de las variables área foliar, materia seca acumulada en el tallo y las hojas, peso promedio de frutos (hasta 44,3% y número promedio de frutos, con la solución Aeropónicos al 50% de la concentración comercial. Los resultados permiten implementar variables de eficiencia en el cultivo aeropónico de pepino, las cuales inciden en el rendimiento, viabilidad económica y ambiental de la tecnología.Abstract. Plant growth and development is determined largely by weather which is composed by several factors. Temperature is one of such key factors which is very important for deciding sowing and

  15. El proceso evolutivo de los Conglomerados o Grupos Económicos en Colombia

    Directory of Open Access Journals (Sweden)

    Giovanna Wilches-Sánchez

    2016-03-01

    Full Text Available En función de la tesis de algunos teóricos del nuevo “capitalismo desorganizado”, que afirman que el tiempo de la Gran Sociedad, Grupos Económicos o Conglomerados, con sus estructuras de control y coordinación, cuidadosamente articuladas, ha finalizado y centrando la atención en la Ley 222 de 1995 y las consecuencias que su entrada en vigencia generó sobre este tipo particular de estructura industrial y empresarial en Colombia, este artículo busca responder al siguiente interrogante: si los grupos económicos o conglomerados deben desaparecer, ¿por qué en Colombia, con una economía abierta insertada en la Economía Global, este tipo de organizaciones, en lugar de disminuir, continúa aumentando? El trabajo parte del reconocimiento de los grupos económicos como objeto de trabajo del investigador en las Ciencias de Gestión y un análisis sobre las diferentes posturas, que ha generado su existencia y permanencia en las diferentes economías, entre ellas la de la preconización de su final como agente económico de primer nivel. Se presenta de igual manera la objetivación y el método empleado en el análisis de datos usados para la comprensión del fenómeno evolutivo de este tipo de organizaciones. Se realiza un análisis al concepto emergente, desde la estrategia corporativa, de diversificación, recogiendo elementos puntuales de la noción de grupo económico en diferentes culturas, resaltando elementos comunes encontrados en la literatura. Por ser un tema común a diversas economías, se ve necesario efectuar una somera revisión comparativa a las legislaciones que regulan la operación de las estructuras analizadas en algunos países, para finalizar centrándose en la evolución de la legislación colombiana en particular. Por último, recoge y analiza el proceso de registro de matrices y subsidiarias en Colombia, para dar cuenta del fenómeno de aparición y consolidación de los grupos económicos en una economía en

  16. Estructura y dinámica de los grupos de investigación

    Directory of Open Access Journals (Sweden)

    Sebastián, Jesús

    2008-08-01

    Full Text Available The importance of associability is being increasingly stated when the present ways of production of the knowledge are analyzed. Different organizational levels exist in the context of scientific research. Among them, research groups constitute one of the most generalized modalities of association. In this article we analyze conceptual and practical aspects which are considered when it comes to identify the nature and characteristics of research groups, as well as their differences with other modalities of scientific association, such as research teams. We emphasize the functional and dynamic character of research groups, which go through different stages in their evolution. We conclude that research groups must be considered as functional organizational units, instead than structural units. This has important consequences for the policies of promotion of research groups and for the consideration of groups on the part of research institutions.La importancia de la asociabilidad se está poniendo crecientemente de manifiesto cuando se analizan los actuales modos de producción del conocimiento. Existen diferentes niveles organizativos en el ámbito de la investigación científica, entre los que los grupos de investigación constituyen una de las modalidades de asociación más generalizadas. En este artículo se analizan los aspectos conceptuales y prácticos que se plantean cuando se trata de identificar la naturaleza y las características de los grupos de investigación, así como las diferencias con otras modalidades de asociación, como los equipos de investigación. Se enfatiza el carácter funcional y dinámico de los grupos de investigación, que transitan por diferentes etapas en su evolución. Se concluye que los grupos de investigación se deben considerar más como unidades organizativas funcionales que estructurales, lo que tiene importantes consecuencias en las políticas de fomento de los grupos e incluso en su consideración en las

  17. Estudio comparativo del melanismo en lagartijas del grupo Liolaemus fitzingerii (Liolaemini: Liolaemus

    Directory of Open Access Journals (Sweden)

    Frutos, Nicolás

    2012-08-01

    Full Text Available Los patrones de coloración y melanismo, han sido foco de estudios evolutivos en una amplia variedad de grupos taxonómicos, incluidas las lagartijas, y generalmente se los encuentra asociados a ciertos aspectos ecológicos. Sin embargo, dentro del género Liolaemus solo se han estudiado algunos aspectos particulares del melanismo en pocas especies del grupo fitzingerii. Las poblaciones de estas especies presentan diferentes grados de melanismo en cuanto a intensidad y a ubicación, y esto en algunos casos se ha utilizado como carácter diagnóstico en diferentes especies de este grupo. El objetivo de este estudio fue evaluar el grado de polimorfismo en el melanismo ventral corporal y dorsal de la cabeza en lagartijas patagónicas pertenecientes a los cinco haploclados del grupo fitzingerii (que incluyen todas las especies descriptas, determinar la variación geográfica de los mismos y evaluar su utilidad como carácter diagnóstico. Se observó un alto grado de polimorfismo en el melanismo ventral corporal y dorsal de la cabeza en los cinco haploclados y en las diferentes zonas geográficas analizadas. En este grupo, lo caracteres melánicos deberían ser utilizados con precaución y en conjunto con otros, como caracteres diagnósticos para diferenciar especies. Color patterns and melanism have been focus of evolutionary studies in a wide variety of taxa, including lizards, and are often associated with certain ecological attributes. However, within the genus Liolaemus, only some particular aspects of melanism have been studied in a few species of the L. fitzingerii group. Populations of these species show different degrees of melanism with respect to both the intensity and location of black pigment, that in some cases have been used as diagnostic characters in different species of this group. The aim of this study was to assess the degree of polymorphism in ventral body and dorsal head melanism in Patagonian lizards from the five haploclades

  18. Diversidad genética, entre y dentro de los mayores grupos humanos

    Directory of Open Access Journals (Sweden)

    Barbujani, G.

    2003-01-01

    Full Text Available Varios estudios están de acuerdo cuando reportan que cerca del 85% de la diversidad del ADN autosomal y de los loci de las proteínas se debe a diferencias entre individuos dentro de la misma población, mientras que las diferencias entre los grupos de diferentes continentes son responsables de solamente 10% de la variación genética total. Estos resultados están en conflicto con nociones populares de razas humanas claramente distintas y relativamente homogéneas, y nos hacen cuestionar la utilidad de clasificaciones étnicas en diagnósticos médicos, en el campo forense y en genética farmacológica. Nuevos datos obtenidos de inserciones polimórficas de Alu y del cromosoma Y confirman los resultados previos, aunque indican una diversidad mayor en algunos (pero no todos los loci del cromosoma Y. Estos datos nos permiten investigar dos preguntas: (1 si las diferencias continentales, aunque pequeñas, son suficientemente grandes como para asignar a individuos a sus continentes basados en sus genotipos; (2 si los genotipos observados se agrupan en grupos de población o continentales cuando el origen de la muestra se ignora. Usando varios métodos estadísticos, veremos que los errores de clasificación son por lo menos de un 30% para los polimorfismos autosomales bi-alélicos, y de un 27% para el cromosoma Y. Cuatro series de datos genéticos de todo el mundo sugieren la existencia de grupos de genotipos diferentes, pero que éstos cuatro grupos no coinciden el uno con el otro. Adicionalmente, estudios de bloques de ADN del genoma humano indican que la mayor parte de dichos bloques es compartida entre los continentes, con solamente un pequeño porcentaje siendo específico a ciertos continentes. Estos resultados no indican que haya una base clara para subdividir a los humanos en grupos biológicamente definidos. Este puede no ser un problema en áreas aplicadas de genéticas, dado que los métodos rápidos para obtener genotipos individuales

  19. Wiki como herramienta de aprendizaje en grupo y evaluación al alumno

    Directory of Open Access Journals (Sweden)

    María Jesús Miró Obradors

    2013-11-01

    Full Text Available “Estimular el aprendizaje autónomo, incentivar el estudio individual y colectivo y reducir las formas pasivas de enseñanza" es uno de los objetivos de los nuevos planes de estudios. Siendo una Wiki aquél espacio de trabajo en línea que posibilita la creación colectiva de documentos utilizando un navegador web, consideramos ésta, una buena herramienta para el desarrollo del trabajo en grupo de los alumnos, así como para realizar una evaluación continuada de los mismos. Metodología: 1 Establecer grupos de estudiantes, 2 Crear wikis en las asignaturas abiertas en Moodle del Campus Virtual UCM (CV, 2 Introducción por el profesor de las actividades, 3 Abrir un foro, 4 Envío de las tareas (CV, 5 Calificación. Resultados y conclusiones: Alumnos de asignaturas en el Área de Bioquímica y Biología Molecular y Celular del Grado en Farmacia (UCM, han trabajado en wikis: a Una tabla, en la cual cada grupo de estudiantes introduce dos palabras clave (sin repetir de cada tema impartido y a su vez, redacta el enunciado de dos preguntas relativas a palabras clave que han incluido previamente otro grupo de alumnos. La lista resultante y revisada de unas 75 cuestiones, se utilizó para elaborar exámenes, realizados en clase tras la finalización de cada bloque de contenidos. b Cuestiones relativas a seminarios y películas de cine proyectadas previamente. El módulo Wiki de Moodle ha permitido a cada estudiante trabajar en páginas web on line con sus compañeros, habiendo podido añadir, expandir o modificar su contenido en ellas. Las versiones antiguas nunca se eliminan y pueden restaurarse. Esto ha permitido, además de calificar el trabajo de grupo, hacer un seguimiento del trabajo individual de cada estudiante, para su mejor evaluación. PIMCD 2013 nº 3 (UCM.

  20. Grupo sanguíneo, alimentación y sobrepeso/obesidad: Una Miscelánea

    OpenAIRE

    Hernández Carranco, Roandy; Flores Peña,Yolanda; Ortiz Félix, Rosario Edith

    2014-01-01

    Antecedentes: La obesidad (OB) es un problema de salud pública. En el intento de encontrar otras variables que expliquen mejor esta problemática se ha señalado que el grupo sanguíneo de las personas juega un rol importante. Se dice que de acuerdo al grupo sanguíneo ABO, las personas tienen mayor probabilidad de desarrollar este padecimiento si los alimentos que consumen no son compatibles con dicho grupo sanguíneo. Objetivo: Revisar la literatura disponible para comprender ...

  1. A mediação emocional na constituição de um grupo comunitário

    OpenAIRE

    Baptista, Rogério Rodolfo

    2006-01-01

    O tema dessa pesquisa é o grupo, ela teve como objetivo investigar o processo grupal e sua mediação na configuração da consciência das pessoas participantes de uma ONG inserida em uma comunidade periférica de uma cidade do interior paulista, destacando seus aspectos afetivos, que ora são mobilizadores de ações, ora são paralizantes e fazem o grupo retroceder. Os aspectos afetivos estão presentes em todos os processos sociais de uma comunidade e nos grupos, pois é nele que ocorr...

  2. Grupos econômicos e capital financeiro : uma história recente do grande capital brasileiro

    OpenAIRE

    Marco Antonio Martins da Rocha

    2013-01-01

    Resumo: Através do estudo dos 20 maiores grupos econômicos ligados à atividade industrial no Brasil, o trabalho procura analisar a trajetória recente de recomposição do "grande capital brasileiro", isto é, as mudanças na estrutura de propriedade que compõem os maiores grupos econômicos nacionais após 1994. A análise é realizadas a partir dos relatórios contábeis e administrativos das holdings centrais dos grandes grupos econômicos e de bases de dados sobre estrutura acionária, indicadores fin...

  3. Enfoques do comprometimento dos membros dos grupos PET da USP: um estudo comparativo entre grupos da capital e do interior [doi: 10.5329/RECADM.20090802005

    Directory of Open Access Journals (Sweden)

    Marcus Felipe Brito Castro

    2009-11-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 RESUMO O Comprometimento pode ser interpretado como vínculos entre pessoas e organizações e a natureza desses vínculos pode afetar o desempenho e resultados de ambos. O presente estudo, exploratório, de caráter qualitativo, tem como objetivo investigar os enfoques de comprometimento dos integrantes dos grupos PET – Programa de Educação Tutorial da Universidade de São Paulo – USP, da Capital e do Interior, comparando esses grupos em relação à predominância desses enfoques. Para desenvolver a análise foi utilizado o modelo tridimensional de Meyer e Allen (1991 com seus três enfoques de comprometimento: normativo, afetivo e instrumental, lembrando que uma pessoa pode apresentar os três, em maior ou menor grau. Os resultados encontrados indicam uma grande semelhança entre os enfoques dos grupos PET, sendo que o afetivo e o normativo apresentaram maior destaque nas amostras e, por serem enfoques que geram maior desempenho, contribuem para a perenidade e evolução do Programa. Ainda, o afetivo esteve relacionado principalmente aos objetivos, valores e metas, enquanto o normativo surgiu da valorização de esforço e obrigação.   Palavras-Chave: Comprometimento Organizacional; Enfoques; Organização PET.     ABSTRACT The commitment can be interpreted as links between a person and the organization, and the nature of these links can affect the performance and results of both. The present exploratory and qualitative study has as objective to study the approaches of commitment of the integrants of groups PET (Tutorial Education Program of University of São Paulo (USP, comparing groups PET of the Capital with those of the Internal in relation with the predominant approaches. To develop the analysis, was used the three-dimensional model of Allen and Meyer (1991 that shows and analysis the existence of three approaches of commitment: normative, affective

  4. Spray dried melon seed milk powder: physical, rheological and sensory properties

    OpenAIRE

    Zungur Bastıoğlu, Aslı; Tomruk, Dilara; KOÇ, Mehmet; Ertekin, Figen Kaymak

    2016-01-01

    Melon seed milk (MSM) powder was produced by aiming to get alternative vegetable milk from crushed Kırkağaç (Cucumis melo subsp. melo cv. Kırkağaç) and Çeşme (C. melo subsp. melo cv. Çeşme) type melon seeds. MSM was converted to powder form via spray dryer at inlet air temperature of 150 °C, air flow rate of 473 l · h−1, aspiration ratio of 24 m3 · h−1and feed flow rate of 8 ml · min−1 in order to extend the shelf life and usage area. The moisture content and water activity of samples changed...

  5. Grupos de utilizacion de recursos en unidades de agudos y media estancia de servicios de geriatria

    Directory of Open Access Journals (Sweden)

    Solano Jaurrieta Juan José

    2001-01-01

    Full Text Available Fundamentos: En los últimos años se han implantado en nuestro país Sistemas de Clasificación de Pacientes (SCP con objeto de medir el «producto hospitalario». Sin embargo los sistemas más tradicionales resultan poco adecuados para la población anciana, en los que la incapacidad asociada a la enfermedad resulta determinante para explicar el consumo de recursos y los resultados asistenciales. Por ello, nos planteamos aplicar en servicios especializados de atención al anciano un sistema que contempla este parámetro, los Grupos de Utilización de Recursos (RUG, analizando las características y diferencias en la distribución en función de RUG en cuatro Servicios de Geriatría. Métodos: Se estudian transversalmente, mediante cortes sucesivos en períodos superiores a la estancia media en cada unidad, los pacientes ingresados en las unidades de agudos y media estancia de los Servicios de Geriatría del Hospital Monte Naranco (HMN (n=318, Hospital Central de la Cruz Roja (HCCR (n=384, Hospital General de Guadalajara (HG (n=272 y Hospital Virgen del Valle (HVV (n=390, en lo relativo a su distribución según la clasificación RUG-T18. Las posibles diferencias entre los centros se analizaron mediante el test estadístico chi-cuadrado (SPSS para windows Resultados: Para el conjunto de la muestra los pacientes se concentran en los grupos R, S y C de la clasificación, con muy escasa representación de los grupos P y B, detectándose diferencias entre los centros. Así, el HCCR es el que maneja una mayor proporción de pacientes del grupo R (47,64% vs. 23,66% en el HMN, 20,57% en el HG y 20,53% en el HVV y una menor proporción de pacientes del grupo S (3,12% vs 6,40% en el HMN, 9,92% en el HG y 9,76% en el HVV y C (48,94% vs 76,29% en el HMN, 66,89% en el HG y 68,36% en el HVV. Igualmente es posible detectar diferencias en el análisis individual para las unidades de agudos y media estancia. Conclusiones: Los grupos de utilización de recursos

  6. GRUPOS TRÓFICOS DE MACROINVERTEBRADOS ACUÁTICOS EN UN HUMEDAL URBANO ANDINO DE COLOMBIA

    Directory of Open Access Journals (Sweden)

    JOHN JADER RIVERA USME

    2013-01-01

    Full Text Available En el humedal Jaboque (Bogotá, Colombia se analizaron las condiciones físicas y químicas del agua y se estudió la comunidad de macroinvertebrados acuáticos por grupos dietarios entre abril de 2009 y enero de 2010. Las aguas del humedal presentaron un carácter ligeramente ácido con valores altos de nitratos, nitrógeno amoniacal y fósforo, por lo que este ecosistema se clasifica como eutrófico a hipereutrófico. La comunidad de macroinvertebrados acuáticos registró seis grupos alimenticios, los cuales estuvieron formados por 27 familias, 26 géneros confirmados y nueve géneros aún por confirmar, con un total de 6403 individuos recolectados en 28 muestras de macrófitas. La mayor abundancia correspondió a detritívoros (43,5 %, colectores-raspadores (31,5 % y colectores-fragmentadores (14,1 %, los cuales fueron más abundantes en los meses de menor precipitación. Los con- tenidos estomacales de algunos de los organismos evidenciaron que la mayoría de estos individuos consumieron más de un tipo de alimento, además de altas cantidades de materia orgánica. El análisis de correspondencia linealizado (ACL mostró una or- ganización espacial (estaciones y temporal (épocas climáticas en la que los gremios tróficos se agrupan de acuerdo a sus reque- rimientos de nicho, fluctuaciones ambientales o factores de intervención humana. Las variaciones en los grupos dietarios reflejaron cambios en la comunidad de macroinvertebrados desde una perspectiva funcional e indicaron que el humedal es un sistema muy alterado por las actividades urbanas.

  7. Grupo reflexivo de professores da educação superior: Estudo sobre seus movimentos construtivos

    Directory of Open Access Journals (Sweden)

    Hedioneia Maria F. Pivetta

    2014-01-01

    Full Text Available El foco de ese estudio está concentrado en los movimientos constructivos del grupo de profesores reflexivos como dispositivos de aprendizaje docente de la educación superior. Tubo por objetivos identificar cuales los movimientos constructivos de este grupo, analizar la dinámica grupal y el aprendizaje de la docencia a partir de él. El camino recorrido envolvió el abordaje metodológica de cuño cualitativo narrativo con características de investigación-formación e investigación-acción (Maciel, 2006. Se desarrolló a partir de quince encuentros con un grupo de dieciséis profesores de una institución confesional del Rio Grande do Sul, Brasil, teniendo como estrategia propulsora de la reflexión el diario de clase adoptado por los profesores y vivencias planeadas para los encuentros. La análisis textual discursiva (Moraes & Galiazzi, 2007 constituyó la escoja para la sistematización de los resultados. El trayecto hecho permitió identificar la dinámica grupal envolviendo tres movimientos constructivos: (1 articulación inicial; (2 aproximaciones y alejamientos; y (3 continuum reflexivo. El aprendizaje docente se constituyó en un proceso inter e intrapersonal e inter-relacional en el contexto grupal, establecido como un lugar motivacional y de compartir, agentes de la transformación en el sentir, en el pensar y en el actuar de los profesores.

  8. El trabajo a turnos como factor de riesgo para lumbago en un grupo de trabajadores peruanos.

    Directory of Open Access Journals (Sweden)

    Juan Carlos Palomino Baldeon

    2005-07-01

    Full Text Available Objetivo: Identificar la asociación entre trabajo a turnos y lumbago en un grupo de trabajadores mineros. Materiales y métodos: Estudio Caso Control realizado el año 2003 en un grupo de trabajadores mineros. Se revisaron las historias electrónicas de los trabajadores con lumbago, en quienes se obtuvo la edad, sexo, estado civil, grado de instrucción, tiempo de trabajo, índice masa corporal (IMC, trabajo a turnos (8 horas y puesto de trabajo, éste último, se dividió en "white collar" (trabajo de oficina y "blue collar"(trabajo no oficina. Se calculó el Odds Ratio para trabajo a turnos y puesto de trabajo versus lumbago. Resultados: De 1 240 trabajadores, 149 (72% tuvieron lumbago sin ciática y 56 (28% con ciática. No se encontró diferencias estadísticamente significativas para las variables demográficas descritas entre los grupos de estudio. Se encontró que los trabajadores de trabajo por turnos tuvieron un OR para lumbago sin ciática de 1,28 (IC de 0,89 - 1,82 y lumbago con ciática un OR de 2,12 (CI 1,4- 3,93. En relación al puesto de trabajo tipo blue collar se encontró que para lumbago sin ciática tuvo un OR de 1,63 (IC 1,05-2,51 y para lumbago con ciática se tiene OR de 1,48 (IC 0,76-2,9. Conclusión: Existe un riesgo mayor en trabajadores de turnos de trabajo para lumbago con ciática y mayor riesgo en trabajadores con puestos de trabajo tipo blue collar para lumbago sin ciática. (Rev Med Hered 2005;16:184-189.

  9. Metasíntesis en alfabetización para el empoderamiento de grupos vulnerables

    Directory of Open Access Journals (Sweden)

    2017-10-01

    Full Text Available La vulnerabilidad se traduce en grupos humanos concretos que, si bien conocen lo que ocurre alrededor de ellos en materia digital, por su propia condición social y cultural están marginados y, en ese sentido, alejados del ejercicio del derecho a la información. El objetivo ha sido analizar la alfabetización crítica, mediática y digital para el empoderamiento de grupos vulnerables. La revisión sistemática de la literatura (meta-síntesis abarca el período comprendido entre los años 1996-2016 y arrojó 202 documentos, de los cuales 117 cumplieron con los criterios de inclusión (105 investigaciones documentales y 12 estudios cualitativos. Los resultados indican que niños, adolescentes y adultos se han beneficiado y empoderado de esta alfabetización, incluso con niveles bajos de educación, con situación de desventaja económica, con altos niveles de exclusión social o cultural. Son los espacios informales los que prevalecen para esta formación mediática y digital y la reflexión sobre la necesaria alfabetización. Se analiza también en este estudio la influencia del empode¬ramiento en la esfera social y personal, y las implicaciones educativas y comunicacionales para quienes tienen la responsabilidad de empoderar. Se concluye que los grupos son vulnerables si solamente se mantienen con bajos niveles de formación y que alfabetizarlos otorga el empoderamiento requerido para la vida ciudadana.

  10. Posibilidades educativas de las redes sociales y el trabajo en grupo. Percepciones de los alumnos universitarios

    Directory of Open Access Journals (Sweden)

    Julio Cabero Almenara

    2014-01-01

    Full Text Available El cambio en las metodologías de aula viene de la mano, en muchos casos, de Internet y de las herramientas de la Web 2.0. Por otra parte, el desarrollo de una perspectiva de corte constructivista apoyado en el trabajo en grupo, suponen que la formación de los estudiantes puede ser alimentada a través de este tipo de recursos, dado que potencia, entre otros aspectos la socialización, la búsqueda de información, el logro de una meta común, etc. La investigación que aquí se presenta versa sobre la realidad de los procesos de aprendizaje universitario con TIC y las preferencias para trabajar dentro y fuera del aula de los estudiantes de las universidades de Córdoba, Huelva, Sevilla y País Vasco. Los objetivos se centran en conocer las percepciones que los alumnos tienen sobre el software social y el trabajo en grupo y colaborativo, cuáles son las herramientas de software social que emplean y si hay diferencias en función de la universidad de procedencia. Se empleó como instrumento de recogida de datos un cuestionario conformado por cuatro dimensiones. Se concluye que el alumnado está interesado en el empleo del trabajo en grupo como metodología de aula, así como su escaso conocimiento de las herramientas tecnológicas, salvo de las redes sociales. Al mismo tiempo, estos resultados aportan un instrumento fiable para el diagnóstico de las variables que lo conforman.

  11. Exploración de las emociones percibidas en cuatro grupos de edad

    Directory of Open Access Journals (Sweden)

    Claudia J. Arias

    2013-12-01

    Full Text Available En el presente artículo se presentan los resultados de un estudio empírico de comparación de grupos de edad sobre Emociones Percibidas. Los antecedentes sobre este tema son escasos –tanto a nivel internacional como local- y poco claros, por lo que se considera necesario explorar el constructo. Se utilizó la versión validada para población local  de las escalas de Lawton  (Intensidad del afecto; Moderación del afecto positivo; Búsqueda de sensaciones; Control cognitivo; Madurez emocional; Disimulación afectiva; Responsividad psicofisiológica; Variabilidad afectiva; Duración del afecto y Rapidez de la respuesta afectiva. Se seleccionó una muestra intencional de 480 sujetos de ambos sexos, 240 de la ciudad de Mar del Plata y 240 de la ciudad de Buenos Aires. Se encontraron puntajes significativamente más altos en los grupos de adultos mayores en las dimensiones Moderación del afecto positivo, el Control cognitivo, Disimulación afectiva y la Madurez emocional. No se encontraron diferencias significativas entre los distintos grupos de edad en las dimensiones Intensidad del afecto y Responsividad psicofisiológica. Los resultados son consistentes con los antecedentes de investigación que señalan que los adultos mayores presentan elevados niveles de habilidades de regulación emocional, lo que fortalece la mirada de la psicología positiva y del curso vital sobre el envejecimiento.  

  12. Funcionamiento familiar: Su percepción por diferentes grupos generacionales y signos de alarma

    Directory of Open Access Journals (Sweden)

    Anagalys Ortega Alvelay

    2003-08-01

    Full Text Available Se estudió un grupo de familias pertenecientes a un área de salud del municipio Cienfuegos, con el objetivo de valorar la percepción que tiene cada grupo generacional sobre el funcionamiento de sus respectivas familias, así como los signos de alarma presentes en ellas. Se utilizó el instrumento APGAR para diagnosticar el funcionamiento familiar. Predominaron las respuestas positivas para los componentes del APGAR familiar crecimiento espiritual, resolución y participación. Los adultos mayores consideraron con mayor frecuencia que sus familias eran funcionales, mientras que en el resto de los grupos etáreos, el mayor porcentaje de sus miembros, consideró lo contrario; no encontramos diferencias estadísticas significativas entre estas variables. En las familias disfuncionales se presentaron de manera marcada los signos de alarma. La ansiedad crónica con síntomas difusos y la migraña atípica fueron los más fecuentes.A group of families, which belong to the health care area of Cienfuegos municipality, were studied to assess the perception that each generation group has on the functioning of their own families as well as the alarm signals found in them. The APGAR instrument was used to diagnose the family functioning. Positive responses were predominant for APGAR components such as spiritual growth, resolution and participation. Older adults often stated that their families were functional whereas a higher percentage of the members of the rest of the age groups considered that their families were not functional; however, no significant statistical differences were found among the variables. Dysfunctional families showed remarkable alarm signals. Chronic anxiety with diffuse symptoms and atypical migraine were the most frequent signs.

  13. Telejornalismo e convergência: rumo a um telejornal de marca de grupo?

    Directory of Open Access Journals (Sweden)

    Alfredo Vizeu Pereira Junior

    2012-12-01

    Full Text Available O presente artigo pretende discutir o processo de convergência midiática na perspectiva das redações dos telejornais da região do Agreste pernambucano. Para tanto, são levantadas duas hipóteses: 1 os processos de integração das redações estariam abrindo caminho para a configuração de grupos que estariam provocando uma reconfiguração na produção e distribuição de conteúdos, 2 o processo de convergência, através das redações integradas, poderia gerar uma redução na autonomia dos telejornais, que acabariam se tornando telejornais de marca de grupo. O trabalho utilizou basicamente três instrumentos metodológicos: revisão de literatura, observação e monitoramento dos telejornais ABTV (2ª edição e TV Jornal Notícias e suas relações de convergência com os demais veículos regionais de cada um dos dois grupos (rádios e portais de internet e, por último, entrevistas com jornalistas e gestores sobre as tendências e perspectivas na produção de notícias e adoção das novas tecnologias de informação e comunicação (NTICs.

  14. Contaminación acústica por grupos electrógenos

    Directory of Open Access Journals (Sweden)

    Yanexy Cepero-Aguilera

    2009-05-01

    Full Text Available El trabajo tiene como tema el impacto ambiental por ruido de grupos electrógenos (GE. Se muestran diferentes definiciones y conceptos referidos a la explotación de los GE y las consecuencias que puede provocar a las personas que permanezcan cerca de ellos durante su funcionamiento. Los grupos electrógenos son además de generadores de energía, generadores de ruido y por tanto contribuyen a la contaminación acústica del lugar donde estén situados. En el documento se aborda la importancia del correcto uso y selección de los protectores auditivos para aquellas personas que trabajen directamente en las baterías de grupos electrógenos, así como algunas formas de atenuar el ruido. También se caracteriza la emisión sonora de estos a partir de estudios realizados.This paper concerns with the environmental damage due to noise emission introduced by Engine Generator Sets. Definitions and concepts about Engine Generator operation are shown as well as the consequences over the personnel who stand near the Engine Generators during their operation. Obviously, such kind of machines generates energy but they also generate noise which contaminates the environment around them. The paper states how important are the right selection and use of noise protection devices for those whose main job is to operate engine generator sets. Some methods for noise damping are also shown. Finally, some case studies are presented in order to describe the noise emission registered in the real world.

  15. Revisión taxonómica del grupo Haplothrips-Karnyothrips (Thysanoptera: Phlaeothripidae

    Directory of Open Access Journals (Sweden)

    Axel P Retana-Salazar

    2007-06-01

    Full Text Available Se revisa el estado taxonómico del grupo Haplothrips y al mismo tiempo del grupo Karnyothrips, separándose este en varios nuevos géneros por considerarse parafilético; se describen los nuevos géneros Vargasia, Willeia y Aguilaria separados del antiguo Karnyothrips. Se describe un nuevo género de Thysanoptera-Phlaeothripidae procedente del Pacífico Central de Costa Rica. Este género se distingue por los estiletes maxilares muy apartados entre sí, carece de puente maxilar, la forma de la pelta y la seta B1 que es 2/3 la longitud del tubo. Se presenta el análisis crítico de este género y los posibles táxones emparentados, estableciendo un nuevo grupo a partir de las condiciones presentadas por Jironiella gen. n.Taxonomic revision of the Haplothrips-Karnyothrips group (Thysanoptera: Phlaeothripidae. The generic group ("ensemble" Haplothrips-Karnyothrips is reviewed, following the most recently published criteria for distinguishing generic characters. We establish a new diagnosis for each genus. A review of a Central American collection is included and a new genus of Phlaeothripidae is described from the Central Pacific of Costa Rica from specimens collected on Cyperaceae flowers during the dry season. The genus can be distinguished by widely separated maxillary stylets, absent maxillary bridge, pelta shape and the setae B1, which measures two thirds of the tube length. We include a key based on characters of phylogenetic importance. Rev. Biol. Trop. 55 (2: 627-635. Epub 2007 Jun 29.

  16. MOTIVACIóN, GRUPO DE DEPORTE, NIVEL COMPETITIVO y EDAD DEPORTIVA EN DEPORTISTAS CALDENSES

    OpenAIRE

    Héctor Haney Aguirre–Loaiza; Santiago Ramos Bermúdez Ramos Bermúdez; Adriana María Agudelo Agudelo

    2015-01-01

    Se estudian las diferencias entre los factores de motivación en relación con el género, grupos de deportes, edad deportiva y nivel competitivo en 205 deportistas caldenses (M= 18,9, DE= 5,2), que diligenciaron la Escala de Motivación Deportiva. Los 139 hombres y 66 mujeres, practicantes de 20 modalidades deportivas, fueron seleccionados a través de una muestra no probabilística en un diseño no experimental. Los datos demuestran que los deportistas puntuaron valores superior medio en motivació...

  17. Grupos étnicos de Sonora: territorios y condiciones actuales de vida y rezago

    OpenAIRE

    José Luis Zárate Valdez

    2016-01-01

    En el presente artículo se ofrece una caracterización breve de los territorios y condiciones en que viven los gru - pos indígenas que habitan en el estado de Sonora, a partir de su historia. Además, se plasma su situación actual en indica - dores territoriales, demográficos, actividades económicas, educación, vivienda, salud y rezago social. En Sonora hay nueve grupos étnicos, integrados por alrededor de 138 mil personas, lo que representa 5.2 por ciento de la población total de la enti...

  18. Notas sobre el recorrido de los enfoques institucionales y sus grupos en las universidades argentinas

    OpenAIRE

    Fernández, Lidia

    2011-01-01

    Se presenta la alocución realizada en ocasión de la inauguración del Centro “Fernando Ulloa" en la Facultad de Ciencias Políticas de la Universidad Nacional de Cuyo. Incluye breves noticias del inicio y el desarrollo de los enfoques institucionales en Argentina, referencias al grupo de profesores que han creado el Centro y una semblanza de Fernando Ulloa, uno de los creadores de la psicología institucional argentina recientemente fallecido. The brief speech d...

  19. O representante eleito como intermediário entre o grupo e o poder

    OpenAIRE

    Galery, Augusto Dutra

    2017-01-01

    Resumo Este artigo investiga a hipótese de que o sistema democrático como modelo de organização de grupos instituídos tem a função intersubjetiva de manter o vínculo social, ao transferir para o representante eleito o mal-estar da convivência, mas sem permitir ao representante o poder absoluto. O representante ocupa, portanto, a posição de tabu, que mantém o desejo narcísico e onipotente rejeitado entre os membros. Do ponto de vista do representante, significa submeter seu ideal de Eu aos ide...

  20. El ecosistema multiplataforma de los grupos televisivos españoles: los formatos de entretenimiento

    OpenAIRE

    Guerrero, E. (Enrique)

    2011-01-01

    La revolución digital ha transformado de un modo decisivo la industria del entretenimiento audiovisual, especialmente la del sector televisivo. Los operadores españoles han pasado de gestionar una cadena de televisión a un grupo de canales y toda una serie de plataformas complementarias accesibles desde el móvil e Internet. Como consecuencia, toda la cadena de valor de la producción audiovisual necesita ser revisada, desde la ideación de los contenidos hasta su producción y comercializaci...

  1. Sistemática de especies de Lutzomyia del grupo verrucarum Theodor, 1965 (Diptera: Psychodiadae.

    Directory of Open Access Journals (Sweden)

    Eduar Elías Bejarano

    2003-03-01

    Full Text Available El grupo verrucarum comprende insectos vectores de Leishmania spp. y Bartonella bacilliformis, y se le considera uno de los grupos de flebotomíneos neotropicales más importantes en salud pública. Debido a la marcada semejanza morfológica entre las especies agrupadas, la identificación de algunos vectores se dificulta al utilizar caracteres taxonómicos convencionales, lo que ha hecho que sean objeto de estudio a través de quetotaxia, morfometría, sistema espiracular larval, estructura coriónica, morfología del atrio genital, citogenética, filogenética morfológica, isoenzimas, amplificación al azar de ADN polimórfico, hidrocarburos cuticulares, hibridación de ADN y secuencias nucleotídicas nucleares y mitocondriales. En la actualidad, el grupo se encuentra dividido en cuatro series de especies, verrucarum, serrana, townsendi y pia, con base en características de la terminalia masculina. Después de la revisión efectuada por Young y Duncan en 1994, se han descrito diez nuevos taxones, en su mayoría de origen andino, pertenecientes a las series verrucarum (Lutzomyia maranonensis, Lutzomyia cajamarcensis, Lutzomyia antioquiensis, Lutzomyia falcaorum, serrana (Lutzomyia robusta, Lutzomyia guilvardae y pia (Lutzomyia suapiensis, Lutzomyia tihuiliensis, Lutzomyia tocaniensis, Lutzomyia limafalcaoae, lo que eleva a 40 el número de especies agrupadas. Esta diversidad parece ser el resultado de distintos eventos climáticos y biogeográficos entre los que se destacan el aislamiento de poblaciones ancestrales durante el cuaternario, el elevamiento de los Andes como barrera geográfica y el surgimiento del istmo de Panamá, lo que facilitó la dispersión de especies entre Sur y Centroamérica. El presente artículo revisa los más recientes avances en el conocimiento de la sistemática, biogeografía y evolución del grupo verrucarum, con énfasis en los 19 taxones presentes en Colombia.

  2. Psicoterapia de grupo de apoio multifamiliar (PGA em hospital-dia (HD psiquiátrico

    Directory of Open Access Journals (Sweden)

    Contel José Onildo B.

    1999-01-01

    Full Text Available INTRODUÇÃO: O familiar é a ponte, entre o ambiente da casa do paciente e o ambiente terapêutico do hospital-dia (HD, onde o paciente permanece das 7h30 às 15h30, de segunda a sexta-feira. A complexidade para a integração do exercício dessa tarefa e suas conseqüências para o tratamento em HD, levou-nos a criar a Psicoterapia de Grupo de Apoio multifamiliar (PGA para facilitar o exame das vissicitudes desta via de duas mãos entre a residência e o HD. OBJETIVOS: As características, liderança e fatores terapêuticos de Yalom nessa PGA serão objetos do presente trabalho MÉTODO: A PGA é um grupo aberto com 1 h e 15 minutos de duração, de freqüência semanal e com coordenação, em coterapia, de um psicoterapeuta de grupo e de uma enfermeira psiquiátrica. RESULTADOS E DISCUSSÃO: Os resultados foram obtidos pelo exame de 20 grupos sucessivos, tanto após cada sessão, pelos coterapeutas e observador mudo, durante 20-30 min, como pela análise de conteúdo de 20 sessões transcritas. A presença sempre foi maior que 80% dos familiares esperados, com predomínio de mulheres, especialmente mães de pacientes. A estrutura oferecida pela liderança apressou a obtenção de resultados no curto prazo, entre 4 a 6 sessões. A Coesão Grupal de Yalom apareceu em situações comuns e criou um senso de união entre todos. CONCLUSÃO: A adesão de familiares à PGA facilita e abrevia a terapia em HD. Questiona-se quanto, no futuro, a família orientada assumirá na condução do tratamento dos seus pacientes.

  3. Aporte de vitaminas y minerales por grupo de alimentos en estudiantes universitarios chilenos

    OpenAIRE

    Samuel Durán Agüero; Susanne Reyes García; María Cristina Gaete

    2013-01-01

    Introducción: La etapa universitaria es un proceso en el cual las personas pasan por periodos prolongados de inactividad física y horarios irregulares de comidas, lo que conlleva al incremento en el consumo de alimentos procesados y de comida rápida. Objetivo: Fue determinar el aporte vitaminas y minerales por grupo de alimentos en la alimentación de estudiantes universitarios. Métodos: Se trabajó con una muestra de 654 estudiantes universitarios chilenos (18-24 años, 54% mujeres), a quienes ...

  4. Frecuencia de grupos sanguíneos y factor Rh en donantes de sangre, Colombia ,1996

    OpenAIRE

    Mauricio Beltrán; Maribel Ayala; Jorge Jara

    1999-01-01

    El establecer un patrón nacional de distribución de los grupos sanguíneos por seccionales de salud con base en los datos de donantes de banco de sangre, permite la localización e intercambio de sangre y componentes con fines de transfusión de una manera oportuna, mejora la disponibilidad de sangre y ofrece, además, información útil para áreas como las de genética para identificación personal y pruebas de paternidad, y en el campo antropológico para hallar diferencias raciales según su distrib...

  5. MAPEAMENTO DO SISTEMA DE GRUPOS SANGUÍNEOS ABO EM RONDONÓPOLIS – MT

    OpenAIRE

    Neves, Dannyara Rodrigues; Vieira, Elizete Cavalcante Souza; Carvalho, Eslany Moraes; Silva, Rodrigo Andrade da; Mendes, Simone de Oliveira; Medeiros, Mauro Osvaldo

    2014-01-01

    O conhecimento da frequência fenotípica dos vários grupos sanguíneos da nossa população é essencial para estimar a disponibilidade de sangue compatível para pacientes que apresentem anticorpos antieritrocitários. Dessa forma, o objetivo do trabalho foi mapear os tipos sanguíneos de doadores voluntários de sangue do Departamento de Hemoterapia do Hospital Regional de Rondonópolis "Irmã Elza Giovanella", para detectar a distribuição da frequência quanto ao sistema ABO, para a formação de um ban...

  6. Polímeros funcionalizados con grupos quirales derivados de aminoácidos

    OpenAIRE

    Salvador Tena, Rosa V.

    1998-01-01

    El objetivo general planteado en el presente trabajo ha sido la creación de pequeñas bibliotecas de compuestos poliméricos funcionalizados con grupos quirales derivados de aminoácidos naturales. El estudio de las posibilidades de estos compuestos para actuar como auxiliares quirales en distintas reacciones orgánicas, como son reducciones enantioselectivas o reacciones de Diels-Alder, representa una segunda etapa del trabajo planteado.Una de las mayores limitaciones que presenta el trabajo con...

  7. Geometría en espacios homogéneos de grupos unitarios

    OpenAIRE

    Chiumiento, Eduardo H.

    2009-01-01

    En este trabajo estamos interesados en propiedades geométricas de espacios homogéneos de grupos unitarios. Estos espacios homogéneos, construidos a partir de elementos de la teoría de operadores, son variedades de dimensión infinita donde definimos una métrica de Finsler natural. Principalmente, estudiaremos aspectos concernientes a la geometría métrica de estos espacios homogéneos, como la existencia y unicidad de curvas minimales o propiedades de la distancia rectificable, y en menor medida...

  8. Valoración conductimétrica continua de grupos carboxilos finales, en poliamidas.

    OpenAIRE

    A. Salas; Areal Guerra, Rogelio; Tomás, J.; Crespo, R.

    1980-01-01

    El método que se propone se basa en una valoración condutimétrica, adaptable a un titulador automático de los grupos carboxílicos de poliamidas (6 y 6-6) por medio de una valoración de los iones anilinio formados al disolver la poliamida en anilina. The proposed method is based on a conductometric titration, adaptable to an automatic titrator of de carboxyl groups of polyamides (6 and 6-6) by means of he titration of the anilinium ions formed on dissolving polyamide in aniline. Peer Rev...

  9. Tensores polares e modelos de eletronegatividade para os hidretos do grupo IV e fluorosilanos

    OpenAIRE

    Anselmo Elcana de Oliveira

    1995-01-01

    Resumo: Tensores Polares Atômicos (TPA) obtidos das intensidades vibracionais do espectro de infravermelho são calculados para os hidretos do grupo IV (CH4, SiH4, GeH4, SnH4 e os deuterados) e SiF4. A escolha dos sinais das derivadas do momento de dipolo, dP/dQi, é feita, confrontando-se estes resultados com os obtidos à partir de cálculos de orbitais moleculares ab initio, em gráficos bidimensionais, suportados na análise de componentes principais, sendo os eixos as duas componentes principa...

  10. Procedimiento de formación de grupos de trabajo en el proceso software

    OpenAIRE

    Digión, Leda

    2005-01-01

    Para conseguir calidad en el trabajo de un equipo de proyecto informático, no es suficiente con determinar el rol funcional del individuo (analista, programador, etc.) es decir, formar el equipo en función de las tareas a desempeñar. También es necesario identificar el estilo de trabajo de cada integrante, y según este estilo definir grupos de trabajo a cargo de cada subproceso de gestión, dentro del equipo de proyecto informático. A partir de una diferenciación entre los conceptos de grup...

  11. Efectos adversos para la salud inducidos por los esteroides anabolizantes en un grupo controlado de fisioculturistas

    OpenAIRE

    Socas Hernández, Lourdes

    2004-01-01

    [ES]El consumo masivo por jóvenes y deportistas de esteroides anabolizantes androgénicos ha hecho que este grupo de hormonas derivadas de la testosterona sean consideradas en EE.UU. como ?drogas de abuso?. El consumo con fines no terapéuticos de estas sustancias y, por tanto, a elevadas dosis y sin ningún tipo de control médico, lleva a la aparición de efectos tóxicos en los consumidores habituales de los mismos (deportistas, culturistas o jóvenes que simplemente persiguen una mejora de su as...

  12. AS IMPLICAÇÕES DA MASTECTOMIA NO COTIDIANO DE UM GRUPO DE MULHERES

    OpenAIRE

    SONIA REGINA DE OLIVEIRA SILVA GONÇALVES; FÁTIMA MARIA DE ARAGÃO ARRAIS; ANA FÁTIMA CARVALHO FERNANDES

    2007-01-01

    El objetivo de este estudio fue identificar las reacciones de las mujeres ante el diagnóstico de cáncer de mama y los cambios que ocurrieron en su día a día después de la mastectomía, describiendo mecanismos de superación de las dificultades decurrentes de la misma. Entrevistamos 15 mujeres integrantes del Grupo de Enseñanza, Investigación y Asistencia a la Mujer con mastectomía en el período de marzo a junio de 2004. Los resultados muestran que los sentimientos vividos - con mayor frecuencia...

  13. La Psicoterapia de grupos en la crisis vital de la edad avanzada

    OpenAIRE

    Margarita Robertazzi

    2015-01-01

    Este artículo se propone narrar algunos aspectos del recorrido realizado por un grupo psicoterapéutico constituido por mujeres de edad avanzada y que lleva, hasta la actualidad, diez años de funcionamiento. Tomando como punto de partida esta experiencia, se desarrollan estos cuatro tópicos: el tratamiento grupal como una elección adecuada en las crisis vitales de la edad avanzada, algunas características de esta etapa evolutiva, las particularidades que la misma adquiere en un país com...

  14. Alteración de la imagen corporal en un grupo de usuarios de gimnasios

    OpenAIRE

    José I. Baile Ayensa; Karina Elvira Monroy Martínez; Fernando Garay Rancel

    2005-01-01

    Se estima que los hombres que practican deportes de gimnasio lo hacen en parte porque tienen altos niveles de insatisfacción corporal. En Latinoamérica se dispone de pocos datos que confirmen esta posible relación. El presente estudio tuvo por objeto averiguar el nivel de insatisfacción corporal que tenía un grupo de usuarios de gimnasios. Se recabó una muestra de 83 hombres que asistía a siete gimnasios. Para la valoración de la imagen corporal, se utilizó una adaptación de...

  15. Una nueva especie del grupo Hyloscirtus larinopygion (Amphibia: Anura: Hylidae) del suroccidente de Colombia

    OpenAIRE

    Jonh Jairo Mueses-Cisneros; Marvin Alfredo Anganoy-Criollo

    2008-01-01

    Se describe una nueva especie del grupo Hyloscirtus larinopygion del Nudo de los Pastos en el departamento de Nariño, Colombia. Hyloscirtus tigrinus sp. nov. puede ser distinguida fácilmente de sus especies similares por la presencia de un tubérculo calcar carnoso y prominente, además de su distintivo patrón de coloración. Se realizan algunos comentarios sobre la coloración de la garganta y coloración ventral en Hyloscirtus caucanus, H. larinopygion, H. lindae y H. tigrinus. La coloración de ...

  16. Tolerancia al calor y humedad atmosférica de diferentes grupos raciales de ganado bovino

    Directory of Open Access Journals (Sweden)

    Ariel Guillén T

    2011-04-01

    Full Text Available Objetivo. Comparar algunas respuestas fisiológicas al calor y humedad atmosférica entre bovinos Chinampos (Bos taurus; Ch, ½ Charolais ½ Brahman (CB, Holstein (H y Jersey (J. Materiales y métodos. Se realizó un estudio en La Paz, México. Se utilizaron 12 vacas H, 10 J, 15 Ch y 8 CB. Durante el verano se midieron cada semana (a las 0600 y 1600 horas la frecuencia respiratoria (FR y temperatura rectal (TR. Se registraron las variables climáticas para calcular el índice de temperatura-humedad (ITH. Resultados. Durante todo el verano, la FR en los cuatro grupos estuvo por encima de los valores fisiológicos para el ganado bovino, siendo superior en H y J que en Ch y CB (p<0.01. En todos los grupos, la TR estuvo dentro de los límites fisiológicos de la especie estudiada. El grupo racial más afectado fue H (p<0.05. Cuando las constantes fisiológicas fueron analizadas dentro de cada una de tres categorías de ITH (<72, ≥72<78, y ≥78, las vacas H y J mostraron FR superior a las Ch y CB (p<0.01. La TR aumentó conforme se elevó el ITH siendo más marcado en J y H. El incremento de la FR entre la mañana y la tarde de cada día de medición fue mayor en H y J que en Ch y CB (p<0.05. La TR se incrementó más en H que en Ch (p<0.05. Conclusiones. Los grupos raciales más tolerantes al estrés por calor, determinado con base en FR y TR fueron Ch y CB.

  17. Grupos domésticos pobres, diabetes y género: renovarse o morir

    OpenAIRE

    Laura Elena Trujillo Olivera; Austreberta Nazar Beutelspacher; Emma Zapata Martelo; Erin I.J. Estrada Lugo

    2008-01-01

    Con base en las categorías de análisis de género se propone una tipología de grupo doméstico. Se aplicó metodología cualitativa para explorar las formas en que las relaciones de género conforman interacciones generadoras de oportunidades desiguales para el autocuidado de diabetes mellitus entre mujeres y hombres. Se entrevistó en profundidad a 23 mujeres y hombres que padecen diabetes para acercarse a comprender la forma en que unas y otros, durante la cotidiana interacción doméstica...

  18. Actividad física, tabaquismo y consumo de alcohol, en un grupo de estudiantes universitarios

    OpenAIRE

    Mantilla Toloza, Sonia Carolina; Gómez Conesa, Antonia Aurelia; Hidalgo Montesinos, Maria Dolores

    2012-01-01

    Objetivo Determinar la prevalencia de actividad física, tabaquismo y consumo de alcohol, en un grupo de estudiantes universitarios.Metodología Con una muestra de 548 estudiantes del área socio-sanitaria (431 mujeres y 117 hombres, edad media: 20 años DT: 2,3) se aplicó la versión abreviada del Cuestionario Internacional de Actividad Física y una encuesta sobre hábitos de vida, para obtener información relacionada con el consumo de alcohol y tabaquismo. Se calcularon el índice de actividad fís...

  19. Características epidemiológicas del asma en un grupo de pacientes adultos

    OpenAIRE

    Barrero de Lizarazo, Elvira

    2010-01-01

    Se realizó un estudio descriptivo epidemiológico con el propósito de contribuir al conocimiento de las características epidemiológicas del asma en un grupo de 38 pacientes adultos asmáticos que consultaron al hospital Santa Clara de Bogotá D.C. durante los meses de octubre y noviembre de 1987. Mediante el análisis del comportamiento de los factores de riesgo asociados a las variables de persona, tiempo y lugar, se establecieron categorías de interés para plantear alternativas de enfe...

  20. La gimnasia estética de grupo, un nuevo modelo de competición

    OpenAIRE

    Conesa, E.; Martínez-Gallego, Francisca María

    2015-01-01

    El propósito de este trabajo es realizar una revisión bibliográfica sobre los orígenes históricos, las características técnicas y los aspectos claves del reglamento de una modalidad deportiva relativamente desconocida y novedosa como es la Gimnasia Estética de Grupo (GEG). En este contexto, la GEG originaria de los países nórdicos, especialmente Finlandia y Suecia en el siglo XVIII, sirve a la sociedad para motivar especialmente a las mujeres a la práctica de actividad física y mantenerla en ...

  1. Grupos finitos e quebra de simetria no código genético

    OpenAIRE

    Fernando Martins Antoneli Junior

    2003-01-01

    Neste trabalho resolvemos o problema da classicação dos possíveis esquemas de quebra de simetria que reproduzem as degenerescências do código genético na categoria dos grupos finitos simples, contribuindo assim para a busca de modelos algébricos para a evolução do código genético, iniciada por Hornos & Hornos. In this work we solve the problem of classifying the possible symmetry breaking schemes based on simple finite groups that reproduce the degeneracies of the genetic code, ...

  2. Una introducción al estudio de las estructuras algebraicas de grupo y de anillo

    OpenAIRE

    Asmar Charris, Iván Francisco

    1984-01-01

    Con este trabajo he querido hacer un estudio elemental de las estructuras algebraicas de grupos y anillos, intentando lograr que quien las estudien adquieren los conocimientos básicos indispensables para un mayor comprensión de los cursos de algebra moderna (algebra abstracta) dictados en la carrera de matemáticas, por esto propongo este material para ser desarrollando en el curso fundamento II de esta carrera en el primer capítulo, desarrolle el tema de las permutaciones ya que históricame...

  3. Incontinencia urinaria en un grupo de personas vinculadas con el programa de adultos mayores del municipio de Sabaneta, Colombia

    National Research Council Canada - National Science Library

    Gloria Ángel Jiménez; Heidi Andrea Cortés Hernández

    2015-01-01

      Objetivo: determinar la prevalencia de Incontinencia urinaria (IU) en un grupo de adultos mayores del municipio de Sabaneta, Colombia e identificar factores de riesgo, características clínicas...

  4. FUNCIONALIDADE DOS GRUPOS DE PESQUISA DE ADMINISTRAÇÃO/GESTÃO/ GERÊNCIA DE ENFERMAGEM

    OpenAIRE

    Alacoque Lorenzini Erdmann; Ana Lúcia Ferreira de Mello; Selma Regina de Sndrade; Patrícia Klock

    2010-01-01

    El objetivo de ese estudio es entender los modos de organización y funcionamiento de los Grupos de Investigación (GI) de Administración/Gestión/Gerencia (AGG) de Enfermería, con catastro en el Consejo Nacional de Investigación Científica y Tecnológica – (CNPq). Se utilizó la referencia metodológica de la Teoría Fundamentada en los Datos, realizándose 12 entrevistas con líderes de grupos de investigación, distribuidos en 2 grupos de muestra. El funcionamiento del grupo es visto como el modo es...

  5. UM ESTUDO SOBRE REDUÇÃO DO ESTADO DE ANSIEDADE ATRAVÉS DE DINÂMICA DE GRUPO

    OpenAIRE

    Marilene Schmarczek

    1986-01-01

    Estuda-se a ansiedade-estado de um grupo de enfermeiras pediátricas que se reuniram para discutir suas preocupações de trabalho. A ansiedade-estado, verificada através da aplicação de Inventário de Ansiedade Traço-Estado de SPIELBERGER, indicou redução significativa no estado de ansiedade no final das sessões de grupo.

  6. Evaluation of cucumber (Cucumis sativus L. accessions (cultivars and lines against the two-spotted spider mite (Tetranychus urticae Koch. and kanzawa spider mite (T. kanzawai Kishida, Acari: Tetranychidae

    Directory of Open Access Journals (Sweden)

    Farhatullh

    2006-07-01

    Full Text Available Forty three cucumber (Cucumis sativus L. accessions (cultivars and lines were tested against the two-spotted spider mite (Tetranychus urticae Koch and kanzawa spider mite (Tetranychus kanzawai Kishida. The highest number of T. urticae and T. kanzawai eggs /female/ day (5.98, and 6.23 respectively was recorded on the cucumber genotype Blackish Green while the lowest eggs/female/day (2.95 and 3.31 was recorded on Winter Long Green (WLG for T. urticae and T. kanzawai respectively. On a scale of 1 to 5, the highest visual damage rating was recorded on Blackish Green (4.75 for T. urticae and 4.78 for T. kanzawai and the lowest damages rating of 1.50 and 1.70 were recorded on WLG for T. urticae and T. kanzawai respectively. Instead of distinct categories of resistance and/or susceptibility, an array of responses (number of eggs laid/female/ day and damage rating was recorded on the tested cucumber accessions, suggesting two or more genes with additive effects. Based on our findings, Blackish Green was foud to be a susceptible cultivar and Winter Long Green proved to be a resistant one. These two cultivars could be used as a differential host in further studies. Among the Korean cucumber lines, K-4, K-6, and K-20 where found susceptible while K-1, K-2, K-13, and K-15 exhibited some type of resistance to the two mite species.

  7. FUNCIONALIDADE DOS GRUPOS DE PESQUISA DE ADMINISTRAÇÃO/GESTÃO/ GERÊNCIA DE ENFERMAGEM

    Directory of Open Access Journals (Sweden)

    Alacoque Lorenzini Erdmann

    2010-01-01

    Full Text Available El objetivo de ese estudio es entender los modos de organización y funcionamiento de los Grupos de Investigación (GI de Administración/Gestión/Gerencia (AGG de Enfermería, con catastro en el Consejo Nacional de Investigación Científica y Tecnológica – (CNPq. Se utilizó la referencia metodológica de la Teoría Fundamentada en los Datos, realizándose 12 entrevistas con líderes de grupos de investigación, distribuidos en 2 grupos de muestra. El funcionamiento del grupo es visto como el modo estructural de las actividades de los grupos de investigación, las contribuciones teórico-metodológicas más usadas, las vivencias en el ambiente de la investigación, las relaciones intergrupales, las actitudes del líder del G I, las dificultades enfrentadas, así como las estrategias de supervivencia que garantizan la longevidad y productividad del GI. El funcionamiento de los grupos de investigación es el reflejo del calificar, legitimar, aumentar y congregar potencias para la productividad en líneas de investigación y liderazgo de los investigadores en esa área.

  8. Mantenimiento y adaptación cultural de diferentes grupos inmigrantes: variables predictoras

    Directory of Open Access Journals (Sweden)

    Marisol Navas

    2013-01-01

    Full Text Available Este estudio pretende analizar las dimensiones de mantenimiento y adaptación cultural expresadas por inmigrantes de diferentes orígenes en España, así como las variables psicosociales y sociodemográficas que las predicen. Se realizó un estudio correlacional en el que participaron inmigrantes marroquíes (N = 71, rumanos (N = 74 y ecuatorianos (N = 70 que respondieron a un cuestionario manifestando el grado de mantenimiento de su cultura de origen, de adaptación a la cultura de acogida, y de obligación percibida a adaptarse a la cultura de acogida. También se midieron los estereotipos sobre los españoles (dimensiones de calidez y competencia, la amenaza exogrupal, la identificación con el endogrupo, la similitud intergrupal percibida, la naturaleza del contacto con el exogrupo, la percepción de la relación intergrupal, el enriquecimiento percibido debido a la inmigración, y algunas variables sociodemográficas. Los resultados mostraron la importancia del origen de los inmigrantes en todas las variables del estudio. Además, los predictores de las dimensiones de aculturación también eran diferentes dependiendo del grupo inmigrante considerado. Estos resultados enfatizan la necesidad de intervenciones específicas, ya que cada grupo inmigrante afronta el proceso de adaptación a una nueva sociedad de acogida de forma diferente.

  9. DIALOGANDO COM ADOLESCENTES DE GRUPOS RELIGIOSOS SOBRE HIV: DESAFIOS PARA A ENFERMAGEM

    Directory of Open Access Journals (Sweden)

    Adriana Gomes Nogueira Ferreira

    2013-01-01

    Full Text Available El objetivo fue el diálogo con jóvenes participantes de iglesias sobre el VIH/SIDA, basado en el pensamiento de Paulo Freire. Desarrollada la investigación-acción, en 2009 por el Círculo de Cultura, con 10 grupos de jóvenes miembros de la Renovación Carismática Católica. El análisis e interpretación de los resultados favorecieron a la discusión como la experiencia del grupo. Los adolescentes mostraron por primera vez la sorpresa y el desinterés por el tema, lo que sugiere ampliar el área que incluye la información, y utilizar el diálogo como herramienta para permitir que el debate sobre la infección por el VIH. Así, cabe a la enfermería conocer las realidades de los sujetos y utilizar metodologías para promover el diálogo emancipador, basado en la confianza, para fortalecer la amistad y la adopción de conductas sexuales seguras y saludables y de promoción de la salud.

  10. Hipertensão e obesidade em um grupo populacional no Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    SABRY Maria Olganê Dantas

    2002-01-01

    Full Text Available O objetivo deste estudo foi identificar a prevalência de hipertensão arterial e obesidade, bem como sua inter-relação em funcionários de uma instituição de ensino superior da cidade de Fortaleza, Ceará. Foram entrevistados e avaliados, a partir de dados antropométricos e de pressão arterial, 317 funcionários. Para a aferição e classificação da pressão arterial, foram adotados os critérios do III Consenso Brasileiro de Hipertensão Arterial de 1998 e do Joint National Committee de 1997. Foi utilizado o Índice de Massa Corporal para a classificação nutricional, segundo critérios da Organização Mundial da Saúde de 1995. Encontrou-se uma prevalência de hipertensão arterial de 25,6% e de excesso de peso de 59,9%, ambas significativamente mais prevalentes no sexo masculino (p<0,05. A obesidade foi fator de risco para hipertensão arterial no grupo estudado (OR 7,53; IC95 3,08-18,92; p= 0,00. Os resultados encontrados enquadram a comunidade pesquisada como grupo alvo de ações de saúde destinadas ao controle das doenças crônicas.

  11. Práxis interdisciplinar de cuidado em grupo de pessoas que vivem com fibromialgia

    Directory of Open Access Journals (Sweden)

    Nathália Aparecida Costa Guedes Miranda

    Full Text Available RESUMO Objetivos: analisar o modelo da terapia comunitária integrativa para o empoderamento de pessoas que vivem com fibromialgia e discutir a repercussão dessa intervenção interdisciplinar no processo saúde-doença e autocuidado. Método: estudo qualitativo de abordagem participativa, desenvolvido em 2015 com 11 participantes, no Laboratório de Fisiologia aplicada à Educação Física da Universidade do Estado do Rio de Janeiro, RJ. A produção de dados abrangeu o World Café, a observação participante e entrevista semiestruturada. A análise foi realizada segundo Bardin, pela triangulação de dados em diálogo com a literatura pertinente. Resultados: o grupo de terapia comunitária integrativa é um dinamizador na construção e ampliação do conhecimento sobre a fibromialgia e no empoderamento para o autocuidado. Conclusão: esta estratégia de grupo revelou-se um instrumento de práxis interdisciplinar que permite construir redes solidárias de cuidado. Desse modo, gerou-se o conhecimento compartilhado, transformado em ambiente de escuta e reflexão para gerir os obstáculos pessoais e familiares.

  12. Grupos étnicos de Sonora: territorios y condiciones actuales de vida y rezago

    Directory of Open Access Journals (Sweden)

    José Luis Zárate Valdez

    2016-01-01

    Full Text Available En el presente artículo se ofrece una caracterización breve de los territorios y condiciones en que viven los gru - pos indígenas que habitan en el estado de Sonora, a partir de su historia. Además, se plasma su situación actual en indica - dores territoriales, demográficos, actividades económicas, educación, vivienda, salud y rezago social. En Sonora hay nueve grupos étnicos, integrados por alrededor de 138 mil personas, lo que representa 5.2 por ciento de la población total de la entidad. En conjunto, poseen 5.8 por ciento de la superficie estatal, aunque en áreas desérticas, montañosas, de difícil acceso y, en algunos casos, la comparten con gente no indígena. Ochenta por ciento de estos grupos vive en comunidades rurales, por lo general alejadas de los centros urbanos, con acceso insuficiente a la educación y a los ser - vicios médicos, con fuentes de trabajo de bajo perfil y paga, viviendas pequeñas con pocos bienes y carentes de electricidad, drenaje y agua potable de calidad. Los indicadores analizados confirman el estado de marginación, vulnerabilidad y fragilidad de este sector de la población, y marcan la necesidad urgente de apoyo real de parte del Estado.

  13. Representação social do pecado segundo grupos religiosos

    Directory of Open Access Journals (Sweden)

    Julio Cesar Cruz Collares-da-Rocha

    2014-04-01

    Full Text Available O objetivo deste trabalho foi estudar as representações sociais do pecado segundo grupos religiosos. Para tanto, realizamos a coleta de dados por meio de questionário com questões relacionadas aos dados pessoais dos sujeitos e sobre suas representações sobre o que é o pecado. Participaram da pesquisa, 223 estudantes de Ensino Médio da cidade do Rio de Janeiro, de ambos os sexos, com idades entre 18 e 30 anos, que se autodefiniram como Católicos, Evangélicos e Sem Religião. Os dados foram analisados utilizando a análise de conteúdo. Quanto aos resultados, católicos e evangélicos representaram o pecado a partir do caráter prescritivo da moral, enquanto os sem religião o representaram em face do caráter desviante/criminoso. A representação social do pecado para o grupo dos sem religião, como desvio/crime, aponta para o desenvolvimento de uma ética secular, isto é, não-religiosa, capaz de enfrentar a pressão prescritiva da maioria.

  14. LA FERTILIZACIÓN ASISTIDA EN LA AGENDA DE LOS GRUPOS FEMINISTAS MEXICANOS

    Directory of Open Access Journals (Sweden)

    Dora Cardaci

    2011-01-01

    Full Text Available La reproducción asistida (R. A. ha generado una importante reflexión teórica y política dentro del feminismo anglosajón; se han discutido sus efectos adversos, como la reproducción de inequidades sociales y de construcciones ideológicas que refuerzan el vínculo esencialista entre biología e identidad femenina, pero también se ha explorado su impacto desestabilizador en las formas tradicionales de concebir el parentesco, la familia, la paternidad y la maternidad. Al analizar el lugar de la R. A. en la agenda de grupos feministas mexicanos que trabajan en salud reproductiva, encontramos que la desmovilización y falta de discusión de una agenda común, la influencia del financiamiento en la definición de los asuntos que se priorizan, la resistencia a alejarse de los ejes de trabajo consagrados y la concepción de la maternidad como imposición, han llevado a que la R. A. no figure en la agenda política de la mayoría de los grupos analizados.

  15. A TECNOLOGIA DE GRUPO OPERATIVO APLICADA NUM PROGRAMA DE CONTROLE DO TABAGISMO

    Directory of Open Access Journals (Sweden)

    Roselma Lucchese

    2013-01-01

    Full Text Available Estudio la natureza mista, exploratório y descriptivo, discucion el uso del grupo operativo como la tecnología en estrategia de afrontamiento del consumo de tabaco en programa de control del tabaco, en la atención primaria de salud de la ciudad interior de Goias, Brasil. Población de 20 personas que buscar tratamiento la Unidad Básica de Salud y una muestra de nueve personas que completaron el tratamiento. El proceso de análisis de contenido surgió categoría temática: el camino seguido durante el tratamiento: y trayectoria de un deseo de dejar de fumar; sintiendo los efectos de (desuso cigarrillos, los desafíos para el cambio. Por el test de Fagerström, mostró un patrón de dependencia de los tres sujetos para cada nivel. La tasa de abandono del tabaquismo fue de 78%, lo que se recomienda la adopción de tecnologías en la realización de las actividades del grupo operativo en la programa.

  16. REPRESENTAÇÕES DE UM GRUPO DE DOCENTES SOBRE DROGAS: ALGUNS ASPECTOS

    Directory of Open Access Journals (Sweden)

    Cláudia Virginia Galindo Cavalcante

    Full Text Available O abuso de drogas é atualmente um grave problema de saúde pública e a escola básica deve contribuir com a sua prevenção. O objetivo do trabalho foi identificar as representações sociais dos professores de um grupo de professores de educação básica sobre drogas. Utilizamos como instrumento de coleta de dados um formulário que continha a seguinte sentença: Para você, drogas são... , aplicado a um grupo de 75 docentes. Utilizando procedimentos da análise de conteúdo buscamos identificar alguns aspectos das representações destes profissionais. Verificamos que estes entendem drogas como algo extremamente maléfico, que produz danos muitas vezes irreversíveis. Programas de formação inicial e continuada devem levar em consideração estas representações e colaborar na ampliação destas.

  17. O ensino em grupo do processo de aplicação de insulina

    Directory of Open Access Journals (Sweden)

    Jéssica Magalhães Felipe Batista

    2013-03-01

    Full Text Available O presente estudo teve por objetivo analisar a habilidade da pessoa com diabetes mellitus (DM em realizar o processo de aplicação de insulina antes e após o ensino em grupo desse procedimento. A coleta de dados se deu pela aplicação de um instrumento em forma de check list, que avaliou a habilidade inicial da pessoa com DM em relação ao processo. Posteriormente, foi realizada uma intervenção educativa em grupo, sendo aplicado novamente o mesmo instrumento para avaliação da habilidade final. Os dados obtidos foram armazenados em um banco de dados e submetidos à análise estatística. Os resultados mostraram que a maioria das pessoas apresentou dúvidas em quase todas as etapas do processo de aplicação de insulina, não realizando algumas etapas essenciais ou executando-as de forma errada. Após a intervenção educativa houve aumento dos acertos, evidenciando que a atividade contribui para o autocuidado no tratamento insulinoterápico.

  18. From Multilatina to Global Latina: Unveiling the corporate-level international strategy choices of Grupo Nutresa

    Directory of Open Access Journals (Sweden)

    MARIA A DE VILLA

    Full Text Available Research on Multilatinas has underexplored multinationals from Colombia and their corporate-level international strategy choices to develop into Global Latinas. Building on interviews, documents, and archival data about Grupo Nutresa -Colombia's most international firm in manufactured goods-, this study unveils and discusses this firm's corporate-level international strategy choices between 1960 and 2014. A prevailing notion is that most multinationals from Latin America continue to target international operations to focus mainly on their home region through an export, multidomestic or transnational corporate-level international strategy. In contrast, data show that Grupo Nutresa chose to evolve through a sequential approach from an export to a transnational corporate-level international strategy while its international operations were able to transcend its home region to reach North America, Asia, Europe, Africa, and Oceania. These results add to international business research on emergent market multinational companies (EMNCs from Latin America by unveiling the corporate-level international strategy choices of a Colombian origin Multilatina that transformed into a Global Latina.

  19. C1. Pneumonia adquirida na comunidade (PAC num hospital central – comparação de um grupo de doentes idosos com um grupo de não idosos

    Directory of Open Access Journals (Sweden)

    S. Moreira

    2003-11-01

    Full Text Available O objectivo do nosso estudo foi comparar as características clínicas, agentes etiológicos e mortalidade da PAC entre um grupo de doentes idosos e não idosos.Efectuámos um estudo retrospectivo comparativo com 257 doentes internados no nosso serviço com PAC. Consideramos dois grupos: grupo I, doentes com idade igual ou superior a 65 anos (111 doentes e grupo II com idade inferior a 65 anos (146 doentes.A idade média no grupo I foi de 77.3 anos vs. 44.7 anos no grupo II. Foram encontradas diferenças significativas nas características clínicas da pneumonia: febre (54.1% no grupo I vs. 81.5% no grupo II e dor torácica: (27.0% vs 50.0%, respectivamente.O agente causal foi identificado nas culturas da expectoração em 31.6% e do sangue em 6.2% no grupo I vs. 29.1% e 13.9% no grupo II. O Streptococcus pneumoniae foi isolado em 8.8% das amostras de expectoração e 3.1% das hemoculturas dos idosos vs. 17.5% e 10.2% no grupo dos não-idosos. O isolamento de gram-negativos entéricos foi significativamente mais frequente no grupo I (57.1% vs. 8.3%.A duração média de internamento (13.1 vs. 11.1 dias e a mortalidade (10.8% vs. 0.7% foi superior no grupo I.Concluímos que no doente idoso hospitalizado a etiologia da PAC difere da dos outros grupos etários, apresenta pior prognóstico e requere maiores recursos de saúde. : The aim of our study was to compare CAP clinical attributes, etiologic agents and mortality between a group of elderly and a non-elderly patients.We performed a retrospective study analysing clinical data from 257 patients admitted to our hospital with CAP. Two groups were considered: group I with 65 years and over (111 patients and group II with less then 65 years (146 patients.Average age in group I was 77.3 years vs. 44.9 years in group II. Significant differences were found between two clinical characteristics: fever (54.1% in group I vs. 81.5% in group II and chest pain

  20. Blood group genotyping Genotipagem de grupos sangüíneos

    Directory of Open Access Journals (Sweden)

    Lilian Castilho

    2004-01-01

    Full Text Available Accurate phenotyping of red blood cells (RBCs can be difficult in transfusion-dependent patients such as those with thalassemia and sickle cells anemia because of the presence of previously transfused RBCs in the patient's circulation. Recently, the molecular basis associated with the expression of many blood group antigens was established. This allowed the development of a plethora of polymerase chain reaction-based tests for identification of the blood group antigens by testing DNA. The determination of blood group polymorphism at the genomic level facilitates the resolution of clinical problems that cannot be addressed by hemagglutination. They are useful to (a determine antigen types for which currently available antibodies are weakly reactive; (b type patients who have been recently transfused; (c identify fetuses at risk for hemolytic disease of the newborn; and (d to increase the reliability of repositories of antigen negative RBCs for transfusion. It is important to note that PCR based assays are prone to different types of errors that those observed with hemagglutination assays. For instance, contamination with amplified products may lead to false positive test results. In addition, the identification of a particular genotype does not necessarily mean that the antigen will be expressed on the RBC membrane.Os antígenos eritrocitários são herdados geneticamente e definidos por seqüências de aminoácidos específicos constituindo uma proteína ou por carboidratos ligados a estas proteínas ou à lipídios. A diversidade dos antígenos de grupos sangüíneos, como para qualquer outro traço biológico, encontra-se ao nível do gene. Existem atualmente mais de 250 antígenos eritrocitários que se encontram distribuídos em 29 sistemas de grupos sangüíneos, de acordo com a Nomenclatura da Sociedade Internacional de Transfusão Sangüínea (ISBT. Os genes que codificam 28 dos 29 sistemas de grupos sangüíneos já foram clonados e seq