WorldWideScience

Sample records for cucumis melo grupo

  1. Agrobacterium mediated transformation of Tunisian Cucumis melo ...

    African Journals Online (AJOL)

    Transgenic Cucumis melo cv. Maazoun containing the neomycin phosphotransferase II (NPT II) chimeric gene conferring resistance to kanamycin were obtained from cotyledons explants inoculated with Agrobacterium tumefaciens (GV3101) that contained the binary vector plasmid pADI. Transformed shoots were obtained ...

  2. Penetration, Post-penetration Development, and Reproduction of Meloidogyne incognita on Cucumis melo var. texanus.

    Science.gov (United States)

    Faske, T R

    2013-03-01

    Cucumis melo var. texanus, a wild melon commonly found in the southern United States and two accessions, Burleson Co. and MX 1230, expressed resistance to Meloidogyne incognita in preliminary experiments. To characterize the mechanism of resistance, we evaluated root penetration, post-penetration development, reproduction, and emigration of M. incognita on these two accessions of C. melo var. texanus. Additionally, we evaluated 22 accessions of C. melo var. texanus for their reaction against M. incognita in a greenhouse experiment. Fewer (P ≤ 0.05) J2 penetrated the root system of C. melo var. texanus accessions (Burleson Co. and MX 1230) and C. metuliferus (PI 482452) (resistant control), 7 days after inoculation (DAI) than in C. melo 'Hales Best Jumbo' (susceptible control). A delayed (P ≤ 0.05) rate of nematode development was observed at 7, 14, and 21 DAI that contributed to lower (P ≤ 0.05) egg production on both accessions and C. metuliferus compared with C. melo. Though J2 emigration was observed on all Cucumis genotypes a higher (P ≤ 0.05) rate of J2 emigration was observed from 3 to 6 DAI on accession Burleson Co. and C. metuliferus than on C. melo. The 22 accessions of C. melo var. texanus varied relative to their reaction to M. incognita with eight supporting similar levels of nematode reproduction to that of C. metuliferus. Cucumis melo var. texanus may be a useful source of resistance against root-knot nematode in melon.

  3. CmMDb: a versatile database for Cucumis melo microsatellite markers and other horticulture crop research.

    Science.gov (United States)

    Bhawna; Chaduvula, Pavan K; Bonthala, Venkata S; Manjusha, Verma; Siddiq, Ebrahimali A; Polumetla, Ananda K; Prasad, Gajula M N V

    2015-01-01

    Cucumis melo L. that belongs to Cucurbitaceae family ranks among one of the highest valued horticulture crops being cultivated across the globe. Besides its economical and medicinal importance, Cucumis melo L. is a valuable resource and model system for the evolutionary studies of cucurbit family. However, very limited numbers of molecular markers were reported for Cucumis melo L. so far that limits the pace of functional genomic research in melon and other similar horticulture crops. We developed the first whole genome based microsatellite DNA marker database of Cucumis melo L. and comprehensive web resource that aids in variety identification and physical mapping of Cucurbitaceae family. The Cucumis melo L. microsatellite database (CmMDb: http://65.181.125.102/cmmdb2/index.html) encompasses 39,072 SSR markers along with its motif repeat, motif length, motif sequence, marker ID, motif type and chromosomal locations. The database is featured with novel automated primer designing facility to meet the needs of wet lab researchers. CmMDb is a freely available web resource that facilitates the researchers to select the most appropriate markers for marker-assisted selection in melons and to improve breeding strategies.

  4. Characteristics and composition of cucumis melo seed oil

    International Nuclear Information System (INIS)

    Mushtaq, S.; Batool, F.; Akhtar, T.; Tariq, M.I.

    2011-01-01

    A comprehensive characterization study was carried out on Cucumis melo seed oil, in order to evaluate its suitability as an edible vegetable oil. The oil was extracted by sohxlet apparatus using n-hexane as solvent that produced a yield of 47.33% (w/w). The oil was found to have light yellow colour and an agreeable odour, showing density up to 0.728 g/cm/sup 3/. The values of refractive index, iodine number and saponification number came out to be 1.466 (at 25 deg. C), 135.6 g/100 g and 301.6 mg KOH/100 g, respectively. GC-analysis gave total unsaturation content of 64.9% with linolenic acid (C18:3) being the predominant showing a proportion of 43.4%, followed by heptadecanoic acid (C17:0) with 23.1% and palmitic acid (C16:0) with 8.7%. The physicochemical properties of this oil are highly comparable to those of soybean and sunflower oils. Therefore, the test melon seed-oil could be developed into different commercial products to serve as an alternate vegetable oil in region like Pakistan, where this melon grows abundantly. (author)

  5. Medieval emergence of sweet melons, Cucumis melo (Cucurbitaceae).

    Science.gov (United States)

    Paris, Harry S; Amar, Zohar; Lev, Efraim

    2012-07-01

    Sweet melons, Cucumis melo, are a widely grown and highly prized crop. While melons were familiar in antiquity, they were grown mostly for use of the young fruits, which are similar in appearance and taste to cucumbers, C. sativus. The time and place of emergence of sweet melons is obscure, but they are generally thought to have reached Europe from the east near the end of the 15th century. The objective of the present work was to determine where and when truly sweet melons were first developed. Given their large size and sweetness, melons are often confounded with watermelons, Citrullus lanatus, so a list was prepared of the characteristics distinguishing between them. An extensive search of literature from the Roman and medieval periods was conducted and the findings were considered in their context against this list and particularly in regard to the use of the word 'melon' and of adjectives for sweetness and colour. Medieval lexicographies and an illustrated Arabic translation of Dioscorides' herbal suggest that sweet melons were present in Central Asia in the mid-9th century. A travelogue description indicates the presence of sweet melons in Khorasan and Persia by the mid-10th century. Agricultural literature from Andalusia documents the growing of sweet melons, evidently casabas (Inodorous Group), there by the second half of the 11th century, which probably arrived from Central Asia as a consequence of Islamic conquest, trade and agricultural development. Climate and geopolitical boundaries were the likely causes of the delay in the spread of sweet melons into the rest of Europe.

  6. Fine genetic mapping of a locus controlling short internode length in melon (Cucumis melo L.)

    Science.gov (United States)

    Compact and dwarfing vining habits in melon (Cucumis melo L.; 2n = 2x = 24) may have commercial importance since they can contribute to the promotion of concentrated fruit set and can be planted in higher plant densities than standard vining types. A diminutive (dwarf) melon mutant line (PNU-D1) wi...

  7. A comparative analysis of phloem exudate proteins from Cucumis melo, Cucumis sativus and Cucurbita maxima by polyacrylamide gel electrophoresis and isoelectric focusing.

    Science.gov (United States)

    Sabnis, D D; Hart, J W

    1976-01-01

    Proteins in sieve tube exudate from Cucumis melo L., Cucumis sativus L. and Cucurbita maxima Duch. were analysed by gel electrophoresis and isoelectric focusing. Estimated molecular weights and isoelectric points for the major and minor proteins from each plant species are presented. Electrophoresis revealed striking differences between the protein complements of exudatc from the two genera investigated. Similarly, although a few exudate proteins from the two species of Cucumis possessed identical molecular weights, several major proteins were peculiar to each species. Isoelectric focusing of proteins in exudate samples from the three plants confirmed the marked differences in their protein complements. Furthermore, focusing also revealed differences between cultivars of Cucumis sativus. Both Cucumis sativus and Cucurbita maxima possessed relatively large amounts of basic proteins; these were absent in exudate from Cucumis melo. The implications of these results are discussed in relation to present concepts regarding the interrelationships and possible functional roles of P-proteins.

  8. Phylogenetics of Cucumis (Cucurbitaceae: Cucumber (C. sativus belongs in an Asian/Australian clade far from melon (C. melo

    Directory of Open Access Journals (Sweden)

    Schaefer Hanno

    2007-04-01

    Full Text Available Abstract Background Melon, Cucumis melo, and cucumber, C. sativus, are among the most widely cultivated crops worldwide. Cucumis, as traditionally conceived, is geographically centered in Africa, with C. sativus and C. hystrix thought to be the only Cucumis species in Asia. This taxonomy forms the basis for all ongoing Cucumis breeding and genomics efforts. We tested relationships among Cucumis and related genera based on DNA sequences from chloroplast gene, intron, and spacer regions (rbcL, matK, rpl20-rps12, trnL, and trnL-F, adding nuclear internal transcribed spacer sequences to resolve relationships within Cucumis. Results Analyses of combined chloroplast sequences (4,375 aligned nucleotides for 123 of the 130 genera of Cucurbitaceae indicate that the genera Cucumella, Dicaelospermum, Mukia, Myrmecosicyos, and Oreosyce are embedded within Cucumis. Phylogenetic trees from nuclear sequences for these taxa are congruent, and the combined data yield a well-supported phylogeny. The nesting of the five genera in Cucumis greatly changes the natural geographic range of the genus, extending it throughout the Malesian region and into Australia. The closest relative of Cucumis is Muellerargia, with one species in Australia and Indonesia, the other in Madagascar. Cucumber and its sister species, C. hystrix, are nested among Australian, Malaysian, and Western Indian species placed in Mukia or Dicaelospermum and in one case not yet formally described. Cucumis melo is sister to this Australian/Asian clade, rather than being close to African species as previously thought. Molecular clocks indicate that the deepest divergences in Cucumis, including the split between C. melo and its Australian/Asian sister clade, go back to the mid-Eocene. Conclusion Based on congruent nuclear and chloroplast phylogenies we conclude that Cucumis comprises an old Australian/Asian component that was heretofore unsuspected. Cucumis sativus evolved within this Australian

  9. Qualidade fisiológica e sanitária de sementes de melão (Cucumis melo Physiological and health quality of melon (Cucumis melo seeds

    Directory of Open Access Journals (Sweden)

    Marlove Fátima Brião Muniz

    2004-06-01

    Full Text Available O objetivo do trabalho foi avaliar a eficiência de diferentes testes na identificação do nível de vigor e da qualidade sanitária de lotes de sementes de melão (Cucumis melo L.. Foram avaliados quatro lotes de sementes das cultivares Gaúcho e Carvalho, submetidas aos testes de primeira contagem de germinação, emergência em campo, deterioração controlada, envelhecimento acelerado e sanidade. Os resultados indicaram que os testes de deterioração controlada e envelhecimento acelerado apresentam sensibilidade suficiente para avaliação do potencial fisiológico de sementes de melão, mas os testes de avaliação de plântulas não mostraram sensibilidade suficiente para realizar uma estratificação dos lotes pelo vigor. Aspergillus spp. e Fusarium oxysporum foram encontrados associados às sementes.The objective of this work was to evaluate the efficiency of different vigour tests in the identification of vigour levels and health quality of melon (Cucumis melo L. seeds. Four seed lots of Gaúcho and Carvalho cultivars were evaluated. Seeds were submitted to the first germination counting, field emergence, controlled deterioration and aging, cold vigour and health tests. Results indicated that controlled deterioration and accelerated aging tests presented enough sensibility for evaluating the physiological potential of melon seeds. Tests of seedling evaluation did not show enough sensibility to identify hiht quality seed lots. Aspergillus ssp. and Fusarium oxysporum were detected associated with seeds.

  10. KARAKTERISTIK ES KRIM HASIL MODIFIKASI DENGAN FORMULASI BUBUR TIMUN SURI (Cucumis melo L. DAN SARI KEDELAI [Characteristics of Modified Ice Cream Formulated with Cucumis melo L. Puree and Soybean Milk

    Directory of Open Access Journals (Sweden)

    Oksilia

    2012-06-01

    Full Text Available The objective of this research was to observe the physical and chemical characteristics of ice cream made with various formulations of Cucumis melo L. puree and soybean milk. The experiment was designed using Factorial Randomized Block Design with two treatments and each combination was replicated three times. The factors investigated were formulations of Cucumis melo L. puree (10, 12.5 and 15 % and soybean milk (40, 50 and 60%. The ice cream’s viscosity, overrun and melting time were determined, where as protein, fat and potassium content were analyzed. The results showed that the interaction of Cucumis melo L. puree and soybean milk formulation had significant effect on viscosity and overrun. Modified ice cream made with 12.5% Cucumis melo L. puree and 40% soybean milk was the best formula for producing modified ice cream. The resulted ice cream had viscosity of 1.03 cP, overrun 53.93% and melting time 23,58 minutes, while the protein, fat and potassium content were 5.18%, 70% and 1083.33 mg/L, respectively.

  11. Pengaruh Kombinasi Komposisi Media Organik dan Konsentrasi Nutrisi terhadap Daya Hasil Tanaman Melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Khoirul Bariyyah

    2015-08-01

    Full Text Available This research was addressed to study the effect of plant growth media composition and nutrients concentration on yield of Cucumis melo L. The research was designed in complete factorial test of 4x4 with three replicates. Mixed growth media of bokashi:cocopeat:husk charcoal were tested in four compositions, i.e. 90%:5%:5% (M1, 80%:10%:10%(M2, 70%:15%:15% (M3 and 60%:20%:20% (M4 respectively. The other tested factor was nutrients concentraion that consists of four levels, i.e. control/no nutrient given (K0, 2 g/L (K1, 4 g/L (K2 and 6 g/L (K3. The Action 434 variety of Cucumis melo L. seedlings were then transplanted into 10 kg’s polybag and allowed to grow till harvested. The results showed that Chlorophyll content of M1 plants were higher than others, but the highest sugar content was resulted by M3 plants, and the highest thick of flesh fruit was resulted by interaction 60% bokashi:20% cocopeat:20% husk charcoal with 4 g/L nutrient concentration.

  12. Pemacuan Pertumbuhan Melon (Cucumis melo L. dengan Cendawan Mikoriza Arbuskula dan Bakteri Azospirillum sp.

    Directory of Open Access Journals (Sweden)

    Lady Diana Tetelepta

    2016-10-01

    Full Text Available ABSTRACTMelon (Cucumis melo L. is a high economic value horticultural crop that is cultivated in some regions of Indonesia under fertilization management. Application of inorganic fertilizer continuously can reduce soil microbial abundance. One of the soil microbial that promote plant growth is arbuscular mycorrhizal fungi (AMF and Azospirillum sp. The aim of this study was to analysed the effect of AMF and Azospirillum sp. in promoting growth and production of melon. The experiment was carried out in a greenhouse and was arranged in a completely randomized design with five replicates. Five treatments tested were: control, fertilized with NPK, inoculated with AMF, inoculated with Azospirillum sp., inoculated with AMF + Azospirillum sp. The results showed that the effect of AMF on root growth and shoot growth were similar to NPK fertilizer. Azospirillum sp. increased root growth. On the other side, the effect of Azospirillum sp. on shoot growth was similar to NPK fertilizer. However, AMF and Azospirillum sp. inoculation solely increased plant height, fruit weight, fruit diameter, flavor and length of fruit storage. Meanwhile, combination of AMF and Azospirillum sp. increased plant height, root growth, shoot growth, fruit weight, fruit diameter, flavor and length of fruit storage. This study revealed that application of AMF and Azospirillum sp. in melon cultivation was more effective and efficient than NPK fertilizer.Keywords: arbuscular mycorrhizal fungi, Azospirillum sp., Cucumis melo L.

  13. Identification of Local Melon (Cucumis melo L. var. Bartek Based on Chromosomal Characters

    Directory of Open Access Journals (Sweden)

    BUDI SETIADI DARYONO

    2011-12-01

    Full Text Available Bartek is one of local melon varieties mainly cultivated in Pemalang, Central Java. Bartek has three variations of fruits; Long-Green, Ellips-Green, and Yellow. Chromosome characterization of the Bartek was investigated to determine the genetic variation. The main purpose of this research was to determine the genetic characters of Bartek including chromosome number, mitosis, cell cycle, and karyotype. Squash method was used for chromosome preparation. The results showed that all of Bartek observed in this study have similar diploid (2n chromosome number = 24. According to the total number of chromosome, Bartek is closer to melon than cucumber. The mitotic analysis exhibited that the Bartek has similar karyotype formula, 2n = 2x = 24m. Based on the R value of the three kinds of Bartek (R < 0.27, it indicated that three kinds of Bartek were considered to be originated from similar species and one of melon varieties (Cucumis melo L. var. Bartek.

  14. Neuroprotective effect of Cucumis melo Var. flexuosus leaf extract on the brains of rats with streptozotocin-induced diabetes.

    Science.gov (United States)

    Ibrahim, Doaa S

    2017-02-01

    The central nervous system is one of the most vulnerable organs affected by the oxidative stress associated with diabetes mellitus. Healthy food provides an important source for antioxidants. Therefore, the protective effect of Cucumis melo var. flexuosus (C. melo var. flexuosus) leaf extract on the brains of diabetic rats was investigated. Adult male albino rats divided into 5 groups of 6 rats each were assigned into a normal control group and four diabetic groups. Diabetes was induced in rats by a single intraperitoneal injection of streptozotocin (STZ; 60 mg/kg bw). One of the four diabetic groups was left untreated and was considered as a diabetic control group while the three other groups were treated with C. melo var. flexuosus leaf extract at the doses of 30, 60 and 120 mg/kg bw for a period of 30 days. After completion of experimental duration plasma and brains were used for evaluating biochemical changes. The obtained data showed that C. melo var. flexuosus leaf extract treatment lowered blood glucose, glycated hemoglobin, brain tumor necrosis factor-alpha, interleukin levels, brain malondialdehyde content and caspase-3 activity. Furthermore, the treatment resulted in a marked increase in plasma dopamine, melatonin, brain vascular endothelial growth factor-A levels, brain catalase and superoxide dismutase activities. From the present study, it can be concluded that the C. melo var. flexuosus leaf extract exerts a neuroprotective effect against oxidative damage associated with diabetes.

  15. Pembuatan Fruit Leather dari Campuran Buah Sirsak (Annoma Muricata L.)dan Buah Melon (Cucumis Melo L.)

    OpenAIRE

    Risti, Andika Pranata; Herawati, Netti

    2017-01-01

    Theaim of this study wasto get the best treatment fruit leather from mixed soursop (Annoma muricata L.) and melon (Cucumis melo L.). The study used a Complete Randomized Design (CRD) with 6 treatments and 3 replications.The treatments were SM1 (soursop 100 : melon 0), SM2 (soursop80 : melon 20), SM3 (soursop60 : melon40), SM4 (soursop40 : melon60) SM5 (soursop20 : melon80) and SM6 (soursop 0 : melon 100). The data were analyzed statistically using ANOVA and DNMRT at 5%. Thestudyshowed that ...

  16. Enhanced Virulence Gene Activity of Agrobacterium in Muskmelon (Cucumis melo L. cv. ‘Birdie’

    Directory of Open Access Journals (Sweden)

    Abul K.M. MOHIUDDIN

    2011-05-01

    Full Text Available Muskmelon (Cucumis melo L. cultivar ‘Birdie’, was evaluated for its response to the tumorigenic Agrobacterium tumefaciens and the oncogenic A. rhizogenes strains. Stem and petiole of three week-old in vitro-grown muskmelon plants were inoculated with five strains of A. tumefaciens and A. rhizogenes each and observed phenotypic expressions i.e. induction of crown galls and hairy roots. This phenotypic expression was efficaciously increased when virulence gene activity of different strains of two Agrobacterium species was enhanced. Intensive studies on enhancement of virulence gene activity of Agrobacterium found to be correlated to the appropriate light intensity (39.3 μmol m-2 s-1 with a specific concentration of monocyclic phenolic compound, acetosyringone (20 μM. The gene activity was also influenced by several other physical factors e.g. plant tissue type, Agrobacterium species and their strains, and plant tissue-Agrobacterium interaction. Among the different A. tumefaciens strains, LBA4404 showed the best virulence gene activity in both stem and petiole through the formation of higher rate of crown galls. On the other hand, strain 15834 of A. rhizogenes showed better gene activity in stem and 8196 in petiole through the formation of higher rate of hairy roots as well as higher average number of hairy roots. Among the two different types of explants, petiole was more susceptible to both Agrobacterium species. Thus it was concluded that future muskmelon transformation study can efficiently be carried out with LBA4404, 15834 and 8196 strains using petiole explants by adding 20 μM of acetosyringone in the medium.

  17. Heterologous Expression and Biochemical Characterization of Two Lipoxygenases in Oriental Melon, Cucumis melo var. makuwa Makino.

    Directory of Open Access Journals (Sweden)

    Songxiao Cao

    Full Text Available Lipoxygenases (LOXs are a class of non-heme iron-containing dioxygenases that catalyse oxidation of polyunsaturated fatty acids to produce hydroperoxidation that are in turn converted to oxylipins. Although multiple isoforms of LOXs have been detected in several plants, LOXs in oriental melon have not attracted much attention. Two full-length LOX cDNA clones, CmLOX10 and CmLOX13 which have been isolated from oriental melon (Cucumis melo var. makuwa Makino cultivar "Yumeiren", encode 902 and 906 amino acids, respectively. Bioinformatics analysis showed that CmLOX10 and CmLOX13 included all of the typical LOX domains and shared 58.11% identity at the amino acid level with each other. The phylogenetic analysis revealed that CmLOX10 and CmLOX13 were members of the type 2 13-LOX subgroup which are known to be involved in biotic and abiotic stress. Heterologous expression of the full-length CmLOX10 and truncated CmLOX13 in Escherichia coli revealed that the encoded exogenous proteins were identical to the predicted molecular weights and possessed the lipoxygenase activities. The purified CmLOX10 and CmLOX13 recombinant enzymes exhibited maximum activity at different temperature and pH and both had higher affinity for linoleic acid than linolenic acid. Chromatogram analysis of reaction products from the CmLOX10 and CmLOX13 enzyme reaction revealed that both enzymes produced 13S-hydroperoxides when linoleic acid was used as substrate. Furthermore, the subcellular localization analysis by transient expression of the two LOX fusion proteins in tobacco leaves showed that CmLOX10 and CmLOX13 proteins were located in plasma membrane and chloroplasts respectively. We propose that the two lipoxygenases may play different functions in oriental melon during plant growth and development.

  18. The quest for epigenetic regulation underlying unisexual flower development in Cucumis melo

    KAUST Repository

    Latrasse, David

    2017-05-08

    BackgroundMelon (Cucumis melo) is an important vegetable crop from the Cucurbitaceae family and a reference model specie for sex determination, fruit ripening and vascular fluxes studies. Nevertheless, the nature and role of its epigenome in gene expression regulation and more specifically in sex determination remains largely unknown.ResultsWe have investigated genome wide H3K27me3 and H3K9ac histone modifications and gene expression dynamics, in five melon organs. H3K9ac and H3K27me3 were mainly distributed along gene-rich regions and constrained to gene bodies. H3K9ac was preferentially located at the TSS, whereas H3K27me3 distributed uniformly from TSS to TES. As observed in other species, H3K9ac and H3K27me3 correlated with high and low gene expression levels, respectively. Comparative analyses of unisexual flowers pointed out sex-specific epigenetic states of TFs involved in ethylene response and flower development. Chip-qPCR analysis of laser dissected carpel and stamina primordia, revealed sex-specific histone modification of MADS-box genes. Using sex transition mutants, we demonstrated that the female promoting gene, CmACS11, represses the expression of the male promoting gene CmWIP1 via deposition of H3K27me3.ConclusionsOur findings reveal the organ-specific landscapes of H3K9ac and H3K27me3 in melon. Our results also provide evidence that the sex determination genes recruit histone modifiers to orchestrate unisexual flower development in monoecious species.

  19. The quest for epigenetic regulation underlying unisexual flower development in Cucumis melo

    KAUST Repository

    Latrasse, David; Rodriguez-Granados, Natalia Y.; Veluchamy, Alaguraj; Mariappan, Kiruthiga Gayathri; Bevilacqua, Claudia; Crapart, Nicolas; Camps, Celine; Sommard, Vivien; Raynaud, Cé cile; Dogimont, Catherine; Boualem, Adnane; Benhamed, Moussa; Bendahmane, Abdelhafid

    2017-01-01

    BackgroundMelon (Cucumis melo) is an important vegetable crop from the Cucurbitaceae family and a reference model specie for sex determination, fruit ripening and vascular fluxes studies. Nevertheless, the nature and role of its epigenome in gene expression regulation and more specifically in sex determination remains largely unknown.ResultsWe have investigated genome wide H3K27me3 and H3K9ac histone modifications and gene expression dynamics, in five melon organs. H3K9ac and H3K27me3 were mainly distributed along gene-rich regions and constrained to gene bodies. H3K9ac was preferentially located at the TSS, whereas H3K27me3 distributed uniformly from TSS to TES. As observed in other species, H3K9ac and H3K27me3 correlated with high and low gene expression levels, respectively. Comparative analyses of unisexual flowers pointed out sex-specific epigenetic states of TFs involved in ethylene response and flower development. Chip-qPCR analysis of laser dissected carpel and stamina primordia, revealed sex-specific histone modification of MADS-box genes. Using sex transition mutants, we demonstrated that the female promoting gene, CmACS11, represses the expression of the male promoting gene CmWIP1 via deposition of H3K27me3.ConclusionsOur findings reveal the organ-specific landscapes of H3K9ac and H3K27me3 in melon. Our results also provide evidence that the sex determination genes recruit histone modifiers to orchestrate unisexual flower development in monoecious species.

  20. REQUERIMENTOS DE POLINIZAÇÃO DO MELOEIRO (Cucumis melo l. NO MUNICÍPIO DE ACARAÚ - CE - BRASIL

    Directory of Open Access Journals (Sweden)

    Raimundo Maciel Sousa

    2009-01-01

    Full Text Available This work was carried in commercial areas cultivate with muskmelon (Cucumis melo L., variety AF- 646, in the municipal district of Acaraú, state of Ceará, Brazil. The investigation was split in four treatments: hand cross pollination, open pollination in presence of the honey bee hives, open pollination and resricted pollination. The observed variables were: rate of fruit set, fruit weight and seed number of fruits. The hand cross pollination showed the best effect to number of fruit set, fruit weight and seed number of fruits, following to open pollination in presence of the honey bee hives, open pollination and resricted pollination, without fruit set. Considering the melon cultivated at open fields and during the dry season in NE Brazil, it is possible to conclude that it depends on biotic pollinators and that honeybees promote efficientily the pollination.

  1. Qualidade de melão rendilhado (Cucumis melo L. em função do sistema de cultivo Quality of net melon (Cucumis melo L. in function of the culture system

    Directory of Open Access Journals (Sweden)

    Pablo Forlan Vargas

    2008-02-01

    Full Text Available Objetivou-se com este trabalho avaliar a qualidade de frutos de cinco cultivares de melão rendilhado (Cucumis melo L., cultivados em casa de vegetação, em função do sistema de produção. O experimento foi instalado em casa de vegetação na UNESP-FCAV, Jaboticabal-SP, no período de novembro de 2005 à fevereiro de 2006. O experimento foi delineado em esquema fatorial 5 X 2, em blocos casualizados com quatro repetições. Os tratamentos resultaram da combinação de cinco híbridos de melão rendilhado: Maxim, Bônus 2, Shinju 200, Fantasy e Louis e dois sistemas de cultivo: no solo e em substrato de fibra da casca de coco. As características avaliadas foram: massa fresca do fruto, espessura de mesocarpo, intensidade de rendilhamento da casca, pH, sólidos solúveis totais, acidez titulável, índice de maturação (RATIO, e vitamina C. Não houve interação significativa entre os sistemas de cultivo e cultivares para nenhuma das características avaliadas. O cultivo de melão em substrato resultou em frutos com qualidade superior ao cultivo em solo. Os híbridos Louis e Fantasy foram os que apresentaram melhor desempenho qualitativo de frutos.The aim of this study was to evaluate the fruit quality of five net melon (Cucumis melo L. cultivars, grown in a greenhouse, in function of production system. The study was carried out in a greenhouse at UNESP-FCAV, Jaboticabal-SP, Brazil, during the period of November, 2005 to February, 2006. The study was carried out using a 5 x 2 factorial scheme, in randomized complete block design with four repetitions. The treatments resulted the combination of five net melon hybrids: Maxim, Bônus 2, Shinju 200, Fantasy and Louis and two cultivations systems: in soil and in coconut fiber substrate. The characters evaluated were: fresh weight of fruit, mesocarp thickness, fruit shape index, pH, total soluble solids, titratable acidity, maturation index (RATIO; and vitamin C. No interactions were observed

  2. Pengaruh Pemberian Mikoriza Vesikula Arbuskula (MVA Campuran terhadap Kemunculan Penyakit Layu Fusarium pada Tanaman Melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Najmah Farhati

    2017-09-01

    Full Text Available Melon (Cucumis melo L. has economic potential to be cultivated because the fruit contains protein, fat, carbohydrate, calcium, phosphor, fiber, iron, vitamin A, vitamin B1, vitamin B2, vitamin C, and niacin. Fusarium wilt caused by Fusarium oxysporum will decrease melon crop production. One of controlling method to Fusarium wilt diseases on melon plants which safe for environtmental by using biological control. One of microorganisms which can be biological control agent is Vesicular Arbuscular Mycorrhiza (VAM. This research use experimental method with a Completely Randomized Design (CRD. The experimental treatment consists of two types of treatment which combine 5 doses of VAM mixture ( 0 g/plant, 10 g/plant, 12,5 g/plant, 15 g/plant, 17,5 g/plant and two inoculation method VAM is inoculated when seeds are planted and inoculation when the seedlings are replanted. Each treatment was repeated 3 times and each unit consist of three plant, so there are 30 units of experiments or 90 plants. The main variabels are observed consist of the incubation periode of the disease and the intensity of fusarium wilt and the supporting variabels consist of pH, temperature, humidity, and the scale of infection. The mixed MVA 15 g/plant dosage inoculated when seeds are planted and 15 g/plant dosage inoculated when the seedlings are replanted is the most effective to suppress incubation period of Fusarium wilt disease.

  3. Caractéristiques physiques de la production du melon cantaloup Cucumis melo L., cultivé sous serre

    Directory of Open Access Journals (Sweden)

    Hannachi, C.

    1994-01-01

    Full Text Available Physical Characteristics Of Muskmelon Production, Cucumis melo L., Cultivated Under Greenhouse- Tunisia. Seven varieties of cantaloup muskmelon (Pancha, Sugdor, Supersprint, F^6802, Gallicum, Polidor, Pallas were cultivated in plastic house and tested for yield and fruit quality (fruit weight, index of refraction, thickness of flesh. Supersprint, Pancha and Sugdor were the more productive varieties. Their early yield represents 61 %, 62 %> and 53 %> of total yield : 4, 2 ; 5, 2 and 5, 7 kg/m2 respectively. Fruits had a commercial weight of more than 500 g and an acceptable gustative quality ; IR> 10. Fruit weight was positively correlated with viable seed number (pancha : IR was appreciated for Pancha, Sugdor and F^802 (IR> 12. The flesh of these three varieties was well developped, and it was probably influenced by the important seed number (523-610 seeds/fruit. It was 3 cm wide and 6 times as thick as the cortex (0, 5 cm. Pancha was significantly distinguished from others by the fruit number (6 fruits/plant. The introduction of honey bees may improve pollination of flowers and allowed to exploit better its potentialities.

  4. Plantas hospederas de los virus más importantes que infectan el melón, Cucumis melo (Cucurbitaceae) en Costa Rica

    OpenAIRE

    Sánchez, M.V.; Agüero, R.; Rivera, C.

    1998-01-01

    Las especies hospederas naturales de los virus (PRSV, WMV-2, CMV y ZYMV) que infectan el cultivo de melón (Cucumis melo L.) para la exportación en Costa Rica se identificaron en plantaciones comerciales de dos fincas ubicadas, una en la provincia de Guanacaste, y la otra en la provincia de Puntarenas. En ambas fincas se cultiva el melon con irrigación durante la época seca, pero su manejo cultural es diferente. La finca A con una larga trayectoria en el cultivo de melón en rotación con maíz, ...

  5. Physiological effects of ozone on cultivars of watermelon (Citrullus lanatus) and muskmelon (Cucumis melo) widely grown in Spain.

    Science.gov (United States)

    Fernandez-Bayon, J M; Barnes, J D; Ollerenshaw, J H; Davison, A W

    1993-01-01

    Two cultivars of watermelon (Citrullus lanatus) and muskmelon (Cucumis melo), which are widely grown in Spain, were exposed to ozone (70 nl litre(-1), 6 h d(-1)) for 21 days. Ozone sensitivity was assessed by recording the extent of visible injury, changes in fast-fluorescence kinetics, the relative-growth rate (R) of root (RR) and shoot (RS), and effects on the number of flowers produced per plant. Leaf gas exchange was measured in order to provide some indication of the factors underlying differential response to ozone. After 9-10 days of fumigation, all the cultivars developed typical visible symptoms of zone injury on the older leaves. However, significant (P watermelon, there was a marked reduction in the rate of CO(2) assimilation as a result of exposure to ozone, and this was accompanied by a parallel decrease in stomatal conductance. Mean plant-relative-growth rate (R) was markedly (P watermelon, but there were no significant effects on R in muskmelon. Ozone reduced root growth relative to the shoot in three out of four cultivars-an effect that may be of considerable ecological significance. Moreover, exposure to ozone reduced flower production in both muskmelon and watermelon, which indicated effects on yield. There was no correlation between a variety of methods used to assess ozone sensitivity and visible injury, and reasons for this are discussed. This observation draws clear attention to the dangers in ranking plants for ozone sensitivity purely on the basis of visible symptoms. It is concluded from this study that ozone-insensitive genotypes should be identified and considered for planting in the major areas of melon production concentrated on the Mediterranean coast of Spain.

  6. Cucumis melo ssp. Agrestis var. Agrestis Ameliorates High Fat Diet Induced Dyslipidemia in Syrian Golden Hamsters and Inhibits Adipogenesis in 3T3-L1 Adipocytes.

    Science.gov (United States)

    Shankar, Kripa; Singh, Sumit K; Kumar, Durgesh; Varshney, Salil; Gupta, Abhishek; Rajan, Sujith; Srivastava, Ankita; Beg, Muheeb; Srivastava, Anurag Kumar; Kanojiya, Sanjeev; Mishra, Dipak K; Gaikwad, Anil N

    2015-10-01

    Cucumis melo ssp. agrestis var. agrestis (CMA) is a wild variety of C. melo. This study aimed to explore anti-dyslipidemic and anti-adipogenic potential of CMA. For initial anti-dyslipidemic and antihyperglycemic potential of CMA fruit extract (CMFE), male Syrian golden hamsters were fed a chow or high-fat diet with or without CMFE (100 mg/kg). Further, we did fractionation of this CMFE into two fractions namely; CMA water fraction (CMWF) and CMA hexane fraction (CMHF). Phytochemical screening was done with liquid chromatography-mass spectrometry LC- (MS)/MS and direct analysis in real time-MS to detect active compounds in the fractions. Further, high-fat diet fed dyslipidemic hamsters were treated with CMWF and CMHF at 50 mg/kg for 7 days. Oral administration of CMFE and both fractions (CMWF and CMHF) reduced the total cholesterol, triglycerides, low-density lipoprotein cholesterol, and very low-density lipoprotein-cholesterol levels in high fat diet-fed dyslipidemic hamsters. CMHF also modulated expression of genes involved in lipogenesis, lipid metabolism, and reverse cholesterol transport. Standard biochemical diagnostic tests suggested that neither of fractions causes any toxicity to hamster liver or kidneys. CMFE and CMHF also decreased oil-red-O accumulation in 3T3-L1 adipocytes. Based on these results, it is concluded that CMA possesses anti-dyslipidemic and anti-hyperglycemic activity along with the anti-adipogenic activity. The oral administration of Cucumis melo agrestis fruit extract (CMFE) and its fractions (CMWF and CMHF) improved serum lipid profile in HFD fed dyslipidemic hamsters.CMFE, CMWF and CMHF significantly attenuated body weight gain and eWAT hypertrophy.The CMHF decreased lipogenesis in both liver and adipose tissue.CMFE and CMHF also inhibited adipogenesis in 3T3-L1 adipocytes. Abbreviation used: CMA: Cucumis melo ssp. agrestis var. agrestis, CMFE: CMA fruit extract, CMWF: CMA water fraction, CMHF: CMA hexane fraction, FAS: Fatty acid

  7. Carbon dioxide evolution and temperature factors in early growth of plastic mulched plants. [Cucumis melo L. var. reticulatus; Lactuca sativa L. var. crispa

    Energy Technology Data Exchange (ETDEWEB)

    Betts, C.; Ruf, R.H. Jr.

    1966-01-01

    Cantaloupe (Cucumis melo L. var. reticulatus) and lettuce (Lactuca sativa L. var. crispa) were grown in the greenhouse in redwood boxes with bare and plastic mulched soil. Soil temperature in the bare boxes was equated to the plastic mulch with buried temperature coils. Bottled CO/sub 2/ was used to bring the concentration around the plants in bare soil up to the concentration around mulched plants. Carbon dioxide was sampled in leaf canopy. The temperature treatment increased the yields of the bare soil so that they were comparable to those of the plastic mulched soil. Yields from the soil with the auxiliary CO/sub 2/ were lower than those of the mulched treatment.

  8. Construction of a genome-anchored, high-density genetic map for melon (Cucumis melo L.) and identification of Fusarium oxysporum f. sp. melonis race 1 resistance QTL.

    Science.gov (United States)

    Branham, Sandra E; Levi, Amnon; Katawczik, Melanie; Fei, Zhangjun; Wechter, W Patrick

    2018-04-01

    Four QTLs and an epistatic interaction were associated with disease severity in response to inoculation with Fusarium oxysporum f. sp. melonis race 1 in a recombinant inbred line population of melon. The USDA Cucumis melo inbred line, MR-1, harbors a wealth of alleles associated with resistance to several major diseases of melon, including powdery mildew, downy mildew, Alternaria leaf blight, and Fusarium wilt. MR-1 was crossed to an Israeli cultivar, Ananas Yok'neam, which is susceptible to all of these diseases, to generate a recombinant inbred line (RIL) population of 172 lines. In this study, the RIL population was genotyped to construct an ultra-dense genetic linkage map with 5663 binned SNPs anchored to the C. melo genome and exhibits the overall high quality of the assembly. The utility of the densely genotyped population was demonstrated through QTL mapping of a well-studied trait, resistance to Fusarium wilt caused by Fusarium oxysporum f. sp. melonis (Fom) race 1. A major QTL co-located with the previously validated resistance gene Fom-2. In addition, three minor QTLs and an epistatic interaction contributing to Fom race 1 resistance were identified. The MR-1 × AY RIL population provides a valuable resource for future QTL mapping studies and marker-assisted selection of disease resistance in melon.

  9. Estimativa do plastocrono em meloeiro (Cucumis melo L. cultivado em estufa plástica em diferentes épocas do ano

    Directory of Open Access Journals (Sweden)

    Streck Nereu Augusto

    2005-01-01

    Full Text Available O meloeiro (Cucumis melo L. é uma hortaliça de alto valor econômico. A emissão de nós é um componente importante em modelos matemáticos de simulação do crescimento e desenvolvimento de culturas de hábito de crescimento decumbente como o meloeiro e outras cucurbitáceas. A emissão de nós pode ser calculada utilizando-se o conceito do plastocrono, que é o intervalo de tempo entre o aparecimento de nós sucessivos em uma haste de dicotiledôneas. Quando a soma térmica é usada como medida de tempo fisiológico em plantas, o plastocrono tem como unidades degreesC dia nó-1. Estudos anteriores mostraram que o plastocrono em meloeiro varia com o genótipo e a época de cultivo. Este trabalho teve por objetivo estimar o plastocrono em meloeiro transplantado em diferentes épocas de cultivo no interior de estufa plástica. Foram realizadas 12 épocas de semeadura e transplante no interior de uma estufa plástica de 10m X 25m, coberta com polietileno transparente de baixa densidade, localizada no Campo Experimental do Departamento de Fitotecnia da Universidade Federal de Santa Maria, RS. O híbrido utilizado foi o HY-MARK (grupo Cantaloupe. Em 12 plantas etiquetadas por época de transplante, contou-se o número de nós visíveis (NN na haste principal da planta duas vezes por semana. A soma térmica diária (STd, degreesC dia foi calculada levando-se em conta as temperaturas cardinais de aparecimento de nós em meloeiro (10, 34 e 45degreesC. A soma térmica acumulada (STa, degreesC dia, a partir da data de transplante das plântulas, foi calculada somando-se a STd. O plastocrono foi calculado como sendo o inverso do coeficiente angular da regressão linear entre NN e STa para cada época. O plastocrono calculado variou entre as épocas de cultivo de 13,4 a 21,8degreesC dia nó-1, com um valor médio de 18,6 (?2,3degreesC dia nó-1. Esta diferença de plastocrono entre as épocas de cultivo pode representar vários dias do calendário civil

  10. Identification and Molecular Characterization of the cDNA Encoding Cucumis melo Allergen, Cuc m 3, a Plant Pathogenesis-Related Protein

    Directory of Open Access Journals (Sweden)

    Mojtaba Sankian

    2014-05-01

    Full Text Available Background: Melon (Cucumis melo allergy is one of the most common food allergies, characterized by oral allergy syndrome. To date, two allergen molecules, Cuc m 1 and Cuc m 2, have been fully characterized in melon pulp, but there are few reports about the molecular characteristics of Cuc m 3. Methods:The Cuc m 3 cDNA has been characterized by rapid amplification of cDNA ends (RACE, which revealed a 456 base-pair (bp fragment encoding a 151-amino acid polypeptide with a predicted molecular mass of 16.97 kDa, and identified 79 and 178 bp untranslated sequences at the 5′ and 3´ ends, respectively. Results: In silico analysis showed strong similarities between Cuc m 3 and other plant pathogen-related protein 1s from cucumber, grape, bell pepper, and tomato. Conclusion: Here we report the identification and characterization of the Cuc m 3 cDNA, which will be utilized for further analyses of structural and allergenic features of this allergen

  11. Fungos isolados da rizosfera de plantios de melão (Cucumis melo L. ev. Gold Mine) adubados com compostos orgânicos, destacando os solubilizadores de fósforo

    OpenAIRE

    Paiva Coutinho, Flavia

    2007-01-01

    A rizosfera é a região do solo influenciada pelas raízes, as quais disponibilizam nutrientes através dos exsudados, afetando intensamente a atividade e o desenvolvimento dos microrganismos. Dentre esses, destacam-se os solubilizadores de P, considerados de grande importância na rizosfera por possuírem habilidade para disponibilizar, para as plantas, o fosfato insolúvel presente nos compostos. Foram coletadas amostras de solo rizosférico em áreas cultivadas com melão (Cucumis melo cv. Gold Min...

  12. Effect of CRC::etr1-1 transgene expression on ethylene production, sex expression, fruit set and fruit ripening in transgenic melon (Cucumis melo L.).

    Science.gov (United States)

    Switzenberg, Jessica A; Beaudry, Randy M; Grumet, Rebecca

    2015-06-01

    Ethylene is a key factor regulating sex expression in cucurbits. Commercial melons (Cucumis melo L.) are typically andromonoecious, producing male and bisexual flowers. Our prior greenhouse studies of transgenic melon plants expressing the dominant negative ethylene perception mutant gene, etr1-1, under control of the carpel- and nectary-primordia targeted CRAB'S CLAW (CRC) promoter showed increased number and earlier appearance of carpel-bearing flowers. To further investigate this phenomenon which could be potentially useful for earlier fruit production, we observed CRC::etr1-1 plants in the field for sex expression, fruit set, fruit development, and ripening. CRC::etr1-1 melon plants showed increased number of carpel-bearing open flowers on the main stem and earlier onset by 7-10 nodes. Additional phenotypes observed in the greenhouse and field were conversion of approximately 50% of bisexual buds to female, and elongated ovaries and fruits. Earlier and greater fruit set occurred on the transgenic plants. However, CRC::etr1-1 plants had greater abscission of young fruit, and smaller fruit, so that final yield (kg/plot) was equivalent to wild type. Earlier fruit set in line M5 was accompanied by earlier appearance of ripe fruit. Fruit from line M15 frequently did not exhibit external ripening processes of rind color change and abscission, but when cut open, the majority showed a ripe or overripe interior accompanied by elevated internal ethylene. The non-ripening external phenotype in M15 fruit corresponded with elevated etr1-1 transgene expression in the exocarp. These results provide insight into the role of ethylene perception in carpel-bearing flower production, fruit set, and ripening.

  13. Study of Bokashi’s Type and Dosages to Growth and Harvest Yield Honey Dews (Cucumis Melo L. In Low Land

    Directory of Open Access Journals (Sweden)

    Ana Amiroh

    2016-12-01

    Full Text Available Recently, most cultivation and planting of Melon (Cucumis melo L. by farmers using inorganic fertilizers with an excessive dosage, and this causes the lowland productivity decrease with consequent. The soil organic matter decreased as low as time increasing. Application and using of mature organic matter are an alternative to solve these problems in order the lowland become more conducive and productive for growth of melon. But increasing pests and diseases attaching to the plants may caused by adding immature organic matters into soil. Sources to make bokashi like as paddy straw and water hyacinth is immense but it’s not yet used. This research was aimed to study, know and usage of paddy straw and water hyacinth bokashi’s on melon growing at lowland. Experiment was conducted at Lowland Experiment Station of Agricultural Faculty, Brawijaya, in Jatikerto Village, Kromengan Distric, Malang, from April-June 2015. Experiment was applied in a Randomized Block Design (RBD with double factors Types and Dosages of Bokashis. There is seven combinations of treatment with three replications, each treatment consisted four individual plants. Result showed there is significant difference between types and dosages of bokashi on plant length at 28, 35, 42 dan 49 days after planting (d,a,p respectively. The significant difference between treatment also shown by leaf area at 28 - 49 (d.a.p.. Application of paddy straw bokashi was better than hyacinth bokashi on melon growth. The best yield shows that by using paddy straw bokashi with 5 ton/ha of dosage gives melon with 2,56 kg /plant fresh weight.

  14. Potencialidades fitoquímicas do melão (Cucumis melo L. na região Noroeste do Rio Grande do Sul - Brasil Phytochemical potentialities of melon (Cucumis melo L. in the northwest region of Rio Grande do Sul - Brazil

    Directory of Open Access Journals (Sweden)

    N.G. Muller

    2013-01-01

    Full Text Available O melão (Cucumis melo L. é uma fruta muito apreciada por suas qualidades e sua produção vem crescendo e ganhando espaço no mercado nacional e internacional. Em regiões como o Noroeste do Rio Grande do Sul, destaca-se como uma nova alternativa de renda para vários agricultores. Neste contexto, o presente trabalho teve como objetivo analisar o potencial fitoquímico de alguns cultivares de melão da região Noroeste do Rio Grande do Sul. A análise fitoquímica utilizando como farmacógeno as folhas, foi realizada para a verificação da presença de metabólitos secundários, tais como: saponinas, cumarinas, cardiotônicos, cianogenéticos, alcalóides, taninos, antraquinonas, flavonoides, e óleos voláteis. Também foi avaliado o teor de suco a partir dos frutos. Dentre os cinco cultivares analisados, Gaúcho, Imperial, Hy Mark, Magelan, e Cantaloupe, o cultivar Gaucho apresentou a maior variedade em metabólitos secundários. Na avaliação do teor de suco a cultivar Magelan se destacou em comparação às demais cultivares testadas.The melon (Cucumis melo L. is a fruit highly appreciated for its qualities and its production has been growing and gaining space in the national and in the international market. In regions like the northwest of Rio Grande do Sul - Brazil, it stands out as a new income alternative for farmers. In this context, this study aimed to analyze the phytochemical potential of some melon cultivars in the northwest region of Rio Grande do Sul. The phytochemical analysis, using the leaves as pharmacogen, was performed to verify the presence of secondary metabolites such as saponins, coumarins, cardiac glycosides, cyanogenetic glicosides, alkaloids, tannins, anthraquinones, flavonoids and volatile oils. The juice content from the fruits was also evaluated. Among the five analyzed cultivars, Gaucho, Imperial, Hy Mark, Magelan and Cantaloupe, cultivar Gaucho had the greatest variety of secondary metabolites. In the

  15. Una nueva especie de Meloe Linnaeus, 1758 del suroeste de Marruecos incluida en el grupo de M. (Eurymeloe rugosus Marsham, 1802 (Coleoptera: Meloidae

    Directory of Open Access Journals (Sweden)

    Ruiz, José L.

    2015-06-01

    ínez de la Escalera. El estudio morfológico del material del género Meloe Linnaeus, 1758 (Coleoptera: Meloidae revela la existencia de poblaciones morfológicamente diferenciadas en las regiones costeras de Essaouira e Ifni. Estas poblaciones se encuadran en el grupo de Meloe rugosus Marsham, 1802 dentro del subgénero Eurymeloe Reitter, 1911. Sus características diferenciales y constantes respecto al resto de las especies norteafricanas y europeas del grupo, permiten tratar a este conjunto de poblaciones como una entidad taxonómicamente independiente que se describe aquí, Meloe baamarani n. sp. Esta especie nueva se caracteriza por presentar la coloración del cuerpo y apéndices negra, de aspecto mate; pilosidad negra, corta; cabeza ancha y de sienes ampliamente redondeadas, sin surco longitudinal medio; antenas largas, con los artejos III a VIII más largos que anchos, subcilíndricos; pronoto transverso, con los lados netamente convergentes hacia atrás, sin surco mediano; punteado de cabeza y pronoto denso; edeago estrecho, lóbulo medio largo y robusto, sinuado dorsalmente, con los dientes ventrales próximos al ápice. En la región occidental del noroeste africano M. baamarani puede confundirse únicamente con Meloe mediterraneus Müller, 1925, especie con la que comparte un aspecto general similar, pero de la que se diferencia por numerosos caracteres morfológicos, entre los que se incluyen la microrreticulación del tegumento, la ausencia de surco medio en la cabeza, la morfología y macroescultura del pronoto, y la configuración de la genitalia masculina. urn:lsid:zoobank.org:pub:D5A8AFFA-D7E9-4E65-8E73-C6AC58AF20B6

  16. A consensus linkage map for molecular markers and Quantitative Trait Loci associated with economically important traits in melon (Cucumis melo L.)

    Science.gov (United States)

    2011-01-01

    Background A number of molecular marker linkage maps have been developed for melon (Cucumis melo L.) over the last two decades. However, these maps were constructed using different marker sets, thus, making comparative analysis among maps difficult. In order to solve this problem, a consensus genetic map in melon was constructed using primarily highly transferable anchor markers that have broad potential use for mapping, synteny, and comparative quantitative trait loci (QTL) analysis, increasing breeding effectiveness and efficiency via marker-assisted selection (MAS). Results Under the framework of the International Cucurbit Genomics Initiative (ICuGI, http://www.icugi.org), an integrated genetic map has been constructed by merging data from eight independent mapping experiments using a genetically diverse array of parental lines. The consensus map spans 1150 cM across the 12 melon linkage groups and is composed of 1592 markers (640 SSRs, 330 SNPs, 252 AFLPs, 239 RFLPs, 89 RAPDs, 15 IMAs, 16 indels and 11 morphological traits) with a mean marker density of 0.72 cM/marker. One hundred and ninety-six of these markers (157 SSRs, 32 SNPs, 6 indels and 1 RAPD) were newly developed, mapped or provided by industry representatives as released markers, including 27 SNPs and 5 indels from genes involved in the organic acid metabolism and transport, and 58 EST-SSRs. Additionally, 85 of 822 SSR markers contributed by Syngenta Seeds were included in the integrated map. In addition, 370 QTL controlling 62 traits from 18 previously reported mapping experiments using genetically diverse parental genotypes were also integrated into the consensus map. Some QTL associated with economically important traits detected in separate studies mapped to similar genomic positions. For example, independently identified QTL controlling fruit shape were mapped on similar genomic positions, suggesting that such QTL are possibly responsible for the phenotypic variability observed for this trait in

  17. Visita de abejas (Apis mellifera, Hymenoptera: Apoidea a flores de melón Cucumis melo (Cucurvitaceae en Panamá

    Directory of Open Access Journals (Sweden)

    Juan Carlos Di Trani de la Hoz

    2007-06-01

    Full Text Available Se observaron las visitas observadas a flores seleccionadas en un cultivo del Distrito de San Lorenzo, Chiriquí, del 6 de Enero y el 19 de Febrero del 2002, desde las 6:30 am hasta las 4:30 pm, y se anotaron características de las visita, como el tiempo de visita y el tipo de recurso colectado. Las visitas fueron mayormente para la recolección de néctar (casi 3/4. La recolección de polen se concentró hacia las primeras horas de la mañana, cesando definitivamente a las 11:00 am. El tiempo medio de recolección fue similar para ambos recursos, pero fue marcadamente distinto para cada sexo floral. Las visitas a flores femeninas fueron significativamente (Prueba t Student, pBee (Apis mellifera, Hymenoptera: Apoidea visitation to cantaloupe Cucumis melo (Cucurvitaceae flowers in Panama. Flower visits by bees were observed in a melon cultivated field of San Lorenzo district, in Chiriquí, Panama, from January 6 to February 19, 2002, from 6:30 am to 4:30 pm We recorded the duration of each foraging event and the type of resource collected. Flower visits were mostly for nectar collection (∼75 %. Pollen foraging was concentrated in the first hours of the morning and ended by 11:00 am The mean collection time was similar for both food resources, but was different between flower sexes. Flower visits to female flowers took longer (Student's t test, p<0.0001, with a mean time duration of 8.4±4.4 s, whereas in male flowers mean visitation time was of 4.0±1.5 s. Finally, the mean time for each floral sex remained practically constant through the evolution of the crop. Our results were similar to the found ones in temperate zone crops, so apparently tropical conditions of Panama do not change the bee visit patterns on melon flowers. Rev. Biol. Trop. 55 (2: 677-680. Epub 2007 June, 29.

  18. A consensus linkage map for molecular markers and Quantitative Trait Loci associated with economically important traits in melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Schaffer Arthur

    2011-07-01

    Full Text Available Abstract Background A number of molecular marker linkage maps have been developed for melon (Cucumis melo L. over the last two decades. However, these maps were constructed using different marker sets, thus, making comparative analysis among maps difficult. In order to solve this problem, a consensus genetic map in melon was constructed using primarily highly transferable anchor markers that have broad potential use for mapping, synteny, and comparative quantitative trait loci (QTL analysis, increasing breeding effectiveness and efficiency via marker-assisted selection (MAS. Results Under the framework of the International Cucurbit Genomics Initiative (ICuGI, http://www.icugi.org, an integrated genetic map has been constructed by merging data from eight independent mapping experiments using a genetically diverse array of parental lines. The consensus map spans 1150 cM across the 12 melon linkage groups and is composed of 1592 markers (640 SSRs, 330 SNPs, 252 AFLPs, 239 RFLPs, 89 RAPDs, 15 IMAs, 16 indels and 11 morphological traits with a mean marker density of 0.72 cM/marker. One hundred and ninety-six of these markers (157 SSRs, 32 SNPs, 6 indels and 1 RAPD were newly developed, mapped or provided by industry representatives as released markers, including 27 SNPs and 5 indels from genes involved in the organic acid metabolism and transport, and 58 EST-SSRs. Additionally, 85 of 822 SSR markers contributed by Syngenta Seeds were included in the integrated map. In addition, 370 QTL controlling 62 traits from 18 previously reported mapping experiments using genetically diverse parental genotypes were also integrated into the consensus map. Some QTL associated with economically important traits detected in separate studies mapped to similar genomic positions. For example, independently identified QTL controlling fruit shape were mapped on similar genomic positions, suggesting that such QTL are possibly responsible for the phenotypic variability

  19. Qualidade de melões (Cucumis melo L. var. cantalupensis Naud., híbrido Torreon, produzidos em hidroponia e armazenados em embalagens de polietileno Quality of Torreon hybrid melon fruits (Cucumis melo L. var. cantalupensis Naud. grown in hydroponic system and stored in polyethylene packaging

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2006-08-01

    Full Text Available Este experimento teve por objetivos avaliar a permeabilidade de filmes de polietileno de diferentes espessuras e densidades ao O2 e ao CO2, a composição gasosa (O2, CO2 e etileno formada no interior das embalagens e a qualidade físico-química de melões (Cucumis melo L. var. cantalupensis Naud., híbrido Torreon, produzidos no sistema hidropônico "Nutrient Film Technique" (NFT e armazenados em embalagens de polietileno. Os tratamentos avaliados foram: (1 armazenamento refrigerado (sem uso de filme; (2 polietileno de baixa densidade (PEBD de 40µm; (3 PEBD de 60µm; (4 PEBD de 90µm; (5 polietileno de média densidade (PEMD de 40µm; (6 PEMD de 60µm. Os frutos permaneceram armazenados durante 25 dias a 3,8±0,2°C e por mais dois dias a 20°C. Os filmes de PEBD de 60 e 90µm e o PEMD de 60µm apresentaram menor permeabilidade ao CO2, mantendo as maiores concentrações de CO2 nas embalagens. O filme de PEBD de 90µm apresentou menor permeabilidade ao O2. A menor concentração de etileno foi obtida com o uso de PEBD de 40µm. O uso de filmes reduziu drasticamente a perda de massa dos frutos, quando comparados aos frutos não embalados. Os frutos acondicionados na embalagem de PEBD de 40µm mantiveram uma maior firmeza da polpa após o período de armazenamento, não diferindo estatisticamente dos frutos armazenados em PEMD de 40µm. Já a incidência de podridões foi significativamente menor nos frutos armazenados em PEMD de 60µm. De modo geral, os filmes avaliados mantêm semelhante a qualidade físico-química de melões híbrido Torreon produzidos hidroponicamente no sistema NFT.This study was carried out to evaluate the permeability to O2 and CO2, and gas composition (O2, CO2 and ethylene inside packages of different thickness and density polyethylene films. Moreover, the physical and chemical quality of Torreon hybrid melon fruit (Cucumis melo L. var. cantalupensis Naud. grown in a Nutrient Film Technique hydroponic system and stored

  20. Crescimento e mudanças físico-químicas durante a maturação de frutos de meloeiro (Cucumis melo var. cantalupensis Naud. híbrido Torreon Growth and physicochemical changes during the ripening of hybrid Torreon muskmelon fruits (Cucumis melo var. cantalupensis Naud.

    Directory of Open Access Journals (Sweden)

    Ricardo Fabiano Hettwer Giehl

    2008-04-01

    Full Text Available Objetivou-se neste trabalho avaliar o crescimento e as mudanças físico-químicos durante a maturação de melões (Cucumis melo var. cantalupensis Naud., híbrido Torreon. As plantas foram cultivadas no sistema hidropônico NFT ("Nutrient Film Technique", em Santa Maria, RS, durante o período de janeiro a abril. Diariamente, foram marcadas as flores pistiladas em antese, anotando-se a data desse evento. Foram efetuadas as medidas lineares do diâmetro longitudinal e transversal dos frutos a cada três dias, iniciando-se após a antese. A partir dos 25 dias após a antese (DAA, realizou-se, a cada três dias, a colheita de 10 frutos, aleatoriamente. Foram analisados os parâmetros: síntese de etileno, respiração, firmeza da polpa, teor de sólidos solúveis totais, acidez total titulável e coloração da polpa. O aumento no diâmetro longitudinal e transversal dos frutos ocorreu até aproximadamente os 26-29 DAA. A partir desse momento, iniciou-se o processo de maturação dos frutos. Nessa fase, verificou-se intenso incremento na síntese de etileno, com pico aos 37 DAA (44 ± 4,6mL kg-1 h-1, o que culminou no aumento da respiração e na diminuição da acidez total titulável e da firmeza de polpa. Além disso, a cor da polpa dos frutos tornou-se gradativamente mais vermelha. Os frutos desprenderam da planta aproximadamente aos 37 DAA, quando apresentaram uma média de 10,5°Brix de sólidos solúveis totais.This research had the aim of evaluating the physicochemical growth and changes during maturation of hybrid Torreon melons (Cucumis melo var. cantalupensis Naud.. Melon plants were cultivated in the NFT (Nutrient Film Technique hidroponic system from January to April 2004 in Santa Maria, RS, Brazil. Flowers in anthesis were daily tagged and linear measures of longitudinal and transverse diameter were made at a 3-day interval, beginning at anthesis. Starting from 25 days after anthesis (DAA, 10 fruits were randomly harvested each 3

  1. Filamentous fungi isolated from the rhizosphere of melon plants (Cucumis melo L. cv. Gold Mine cultivated in soil with organic amendments Fungos filamentosos isolados da rizosfera de meloeiros (Cucumis melo L. cv. Gold Mine cultivados em solo com compostos orgânicos

    Directory of Open Access Journals (Sweden)

    Flavia Paiva Coutinho

    2010-03-01

    Full Text Available Rhizosphere soil samples were collected in a semiarid area, in the region of the São Francisco River valley, Petrolina, Pernambuco state, Brazil, to study the diversity of filamentous fungi in a soil cultivated with melon (Cucumis melo L. cv. Gold Mine and receiving different organic amendments: Treatment 1 (control, without organic compost; T2 (77% coconut fiber, 20% goat manure and 3% K2SO4; T3 (10% Ricinus communis leaves and stems, 50% Pennisetum purpureum leaves and 40% goat manure; T4 (77% coconut fiber, 20% goat manure and 3% termophosphate; T5 (47% Pennisetum purpureum leaves, 50% goat manure and 3% K2SO4; and T6 (57% Pennisetum purpureum leaves, 40% goat manure and 3% termophosphate. Fungal isolation was carried out by the serial dilution technique to 1:1000. The Sorensen index of similarity, frequency and distribution of the fungi were evaluated. Seventy-eight species of filamentous fungi were isolated and identified, plus several Basidiomycota (04 and Mycelia sterilia (02. The predominant genera were Aspergillus and Penicillium, with 15 and 13 species, respectively. A greater number of species was found in the sowing period (49, and in relation to the organic fertilization, treatment 6 provided the greatest species diversity (43 species. Most of the species are saprobes and only a few are considered to be potential pathogens on melon plants, such as Fusarium oxysporum, F. solani and Myrothecium roridum.Foram coletadas amostras de solo rizosférico em uma área semiárida, na região do Vale do São Francisco, Petrolina, Pernambuco, Brasil, com o objetivo de conhecer a diversidade dos fungos filamentosos presentes em solo cultivado com melão (Cucumis melo cv. Gold Mine e adubado com diferentes compostos orgânicos: Tratamento 1 (controle, sem adição de compostos orgânicos; T2 (77% de bagaço de côco, 20% de esterco de caprino e 3% de K2SO4; T3 (10% de torta de mamona, 50% de capim elefante e 40% de esterco de caprino; T4 (77% de

  2. Caracterización química y sensorial de vino artesanal de melón (Cucumis melo L. var. reticulatus Naud., cv. Ovation

    Directory of Open Access Journals (Sweden)

    C. Padín

    2012-12-01

    Full Text Available En los últimos años la producción de melón (Cucumis melo L. ha experimentado un notable aumento generando excedentes en el mercado y no siempre se consigue vender a los mejores precios, por lo que los porcentajes de pérdidas poscosecha son altos (Martínez, 2007. El objetivo de esta investigación fue caracterizar química y sensorialmente vino de melón. La intención fue generar una tecnología sencilla para la producción de una bebida alcohólica de alta calidad a partir de este fruto y con ello aportar una alternativa de comercialización en la región Falconiana y otras regiones productoras del país. Los ensayos se condujeron, para las variables químicas, en un diseño completamente aleatorizado con 3 tratamientos. Los vinos se elaboraron a partir de 8 L de jugo puro de melón de concentración inicial de sólidos solubles totales 16, 20 y 25 ºBx, acidez total (5,5 g/L y pH (3,8 ajustados, respectivamente denominados tratamientos V1, V2, V3 (3 repeticiones. Colocados en fermentadores de 9 L de capacidad, estériles. Inoculados con 1 g/L de Saccharomyces cerevisiae, e incubados a 28 ºC por 10 días; seguido de trasiego, embotellado, encorchado y almacenamiento por 2 meses. El jugo de melón mostró, sólidos solubles totales 8,00 ºBx, acidez total titulable 0,15 % y pH 5,20. Los vinos, respectivamente V1, V2 y V3, presentaron las siguientes características: grado alcohólico 7, 8, 10 ºGL; alcohol metílico 0,008; 0,002; 0,004 g/L; acetato de etilo 0,02; 0,04; 0,08 mg/L; azúcares totales 20, 40, 58 g/L; acidez volátil 0,814; 0,854; 0,815 g/L; acidez total 6,26; 6,08; 6,00 g/L; acidez iónica 4,00; 3,91; 3,93. Se evidenciaron diferencias estadísticamente significativas (p ≤ 0,05 entre los tratamientos. Los 3 vinos de melón cumplieron con los requisitos: grado alcohólico, alcohol metílico, acetato de etilo, acidez volátil y acidez total establecidos en la norma venezolana COVENIN 3342-1997. V1 y V2 presentaron caracter

  3. Caracterización química y sensorial de vino artesanal de melón (Cucumis melo L. var. reticulatus Naud., cv. Ovation

    Directory of Open Access Journals (Sweden)

    C. Padín

    2012-01-01

    Full Text Available En los últimos años la producción de melón (Cucumis melo L. ha experimentado un notable aumento generando excedentes en el mercado y no siempre se consigue vender a los mejores precios, por lo que los porcentajes de pérdidas poscosecha son altos (Martínez, 2007. El objetivo de esta investigación fue caracterizar química y sensorialmente vino de melón. La intención fue generar una tecnología sencilla para la producción de una bebida alcohólica de alta calidad a partir de este fruto y con ello aportar una alternativa de comercialización en la región Falconiana y otras regiones productoras del país. Los ensayos se condujeron, para las variables químicas, en un diseño completamente aleatorizado con 3 tratamientos. Los vinos se elaboraron a partir de 8 L de jugo puro de melón de concentración inicial de sólidos solubles totales 16, 20 y 25 ºBx, acidez total (5,5 g/L y pH (3,8 ajustados, respectivamente denominados tratamientos V1, V2, V3 (3 repeticiones. Colocados en fermentadores de 9 L de capacidad, estériles. Inoculados con 1 g/L de Saccharomyces cerevisiae, e incubados a 28 ºC por 10 días; seguido de trasiego, embotellado, encorchado y almacenamiento por 2 meses. El jugo de melón mostró, sólidos solubles totales 8,00 ºBx, acidez total titulable 0,15 % y pH 5,20. Los vinos, respectivamente V1, V2 y V3, presentaron las siguientes características: grado alcohólico 7, 8, 10 ºGL; alcohol metílico 0,008; 0,002; 0,004 g/L; acetato de etilo 0,02; 0,04; 0,08 mg/L; azúcares totales 20, 40, 58 g/L; acidez volátil 0,814; 0,854; 0,815 g/L; acidez total 6,26; 6,08; 6,00 g/L; acidez iónica 4,00; 3,91; 3,93. Se evidenciaron diferencias estadísticamente significativas (p ≤ 0,05 entre los tratamientos. Los 3 vinos de melón cumplieron con los requisitos: grado alcohólico, alcohol metílico, acetato de etilo, acidez volátil y acidez total establecidos en la norma venezolana COVENIN 3342-1997. V1 y V2 presentaron caracter

  4. Plantas hospederas de los virus más importantes que infectan el melón, Cucumis melo (Cucurbitaceae en Costa Rica

    Directory of Open Access Journals (Sweden)

    M.V. Sánchez

    1998-03-01

    Full Text Available Las especies hospederas naturales de los virus (PRSV, WMV-2, CMV y ZYMV que infectan el cultivo de melón (Cucumis melo L. para la exportación en Costa Rica se identificaron en plantaciones comerciales de dos fincas ubicadas, una en la provincia de Guanacaste, y la otra en la provincia de Puntarenas. En ambas fincas se cultiva el melon con irrigación durante la época seca, pero su manejo cultural es diferente. La finca A con una larga trayectoria en el cultivo de melón en rotación con maíz, sorgo y arroz, y con poco control de malezas; mientras que la finca B con una corta trayectoria en la producción del melón y un mayor control de malezas. La diversidad de especies vegetales fue estudiada en cuadrantes de 100 m2 en cinco diferentes comunidades de plantas previamente seleccionadas en la finca A (cultivo, canal de drenaje, charral, potrero mejorado, y semi-bosque y tres en la finca B (cultivo, charral, pastizal natural, semi-bosque. El número de cuadrantes estudiados dependió del área total cultivada en cada una de las fincas. Todas las especies de plantas representadas en cada cuadrante se recolectaron e identificaron pero solo aquellas especies que presentaron síntomas virales en el campo fueron analizadas por ELISA para determinar la presencia de los cuatro virus estudiados. La diversidad de especies, porcentaje de cobertura y época de aparición de las especies hospederas fue monitoreada durante un año calendario en cinco fechas diferentes. Un total de 86 y 72 especies de plantas fueron identificadas en las fincas A y B respectivamente. Catorce encontradas positivas por lo menos para uno de los cuatro virus. Los cuatro virus fueron encontrados en cada finca en cada fecha de muestreo indicando que la permanencia y abundancia de algunas especies hospederas garantiza la permanencia de los cuatro virus en el campo como fuente de inóculo primario para la próxima siembra. Varias especies de plantas hospederas silvestres previamente

  5. Kinetic study on adsorption of Cr(VI), Ni(II), Cd(II) and Pb(II) ions from aqueous solutions using activated carbon prepared from Cucumis melo peel

    Science.gov (United States)

    Manjuladevi, M.; Anitha, R.; Manonmani, S.

    2018-03-01

    The adsorption of Cr(VI), Ni(II), Cd(II) and Pb(II), ions from aqueous solutions by Cucumis melo peel-activated carbon was investigated under laboratory conditions to assess its potential in removing metal ions. The adsorption behavior of metal ions onto CMAC was analyzed with Elovich, intra-particle diffusion rate equations and pseudo-first-order model. The rate constant of Elovich and intra-particle diffusion on CMAC increased in the sequence of Cr(VI) > Ni(II) > Cd(II) > Pb(II). According to the regression coefficients, it was observed that the kinetic adsorption data can fit better by the pseudo-first-order model compared to the second-order Lagergren's model with R 2 > 0.957. The maximum adsorption of metal ions onto the CMAC was found to be 97.95% for Chromium(VI), 98.78% for Ni(II), 98.55% for Pb(II) and 97.96% for Cd(II) at CMAC dose of 250 mg. The adsorption capacities followed the sequence Ni(II) ≈ Pb(II) > Cr(VI) ≈ Cd(II) and Ni(II) > Pb(II) > Cd(II) > Cr(VI). The optimum adsorption conditions selected were adsorbent dosage of 250 mg, pH of 3.0 for Cr(VI) and 6.0 for Ni(II), Cd(II) and Pb(II), adsorption concentration of 250 mg/L and contact time of 180.

  6. Effect of different sources of fertilizers on the phosphorus absorption and the yield of the under irrigation melon (Cucumis melo L) sowing

    International Nuclear Information System (INIS)

    Villegas Ocampo, A.

    2002-01-01

    The fertilizer injection through irrigation system is a common practice in second melon sowings. Nevertheless, the application of some phosphoric sources by that way can have problems due to the absorption reactions and precipitation in the ground, which reduces its mobility and assimilation by the plants. Phosphoric sources of fertirrigation to diverse doses, were evaluated in melon (Cucusmis melo L.) Cantaloupe cv Hy Mark in second sowings, about the phosphoric absorption and the fruit commercial production , (b) the content of soluble P in the solution of the ground, to correlate this with the optimal production and thus obtain the external requirement of P and (c) to quantify the economic costs of the application of the different sources. The experiment took place in the ground of the Inceptisol order, sub-group Vertic Haplustepts in Carrillo, Guanacaste, in the property Melones de Sardinal S.A. The used sources of P2O5 were: Map(12-60-0) in doses of 36 and 54 kg/ha, H3PO4 to 36kg/ha and Fertg (8-24-0) in doses of 18 and 36 kg/ha. Besides, establishing in absolute witness 0 kg/ha. The melon redeeming was evaluated in number of cajas/ha, sizes 9, 12, 15 and 18. According to the dry weight and the nourishment concentration of the aerial biomass of each sample, the absorption of nourishment in the cultivation in kg/ha and g/ha was calculated, for a sowing density of 12940 plantas/ha. The external efficiency of phosphorus for melon with the different sources was determined, for getting this were made applications of progressively increasing doses of P. The dose of phosphorus to reach that requirement (concentration of P in the solution of the ground that is necessary for an optimal yield), in the balance point it's obtained by means of interpolation of the dose of P through the isotherm and the correlation of the optimal yield of the cultivation. The greater absorption of P took place in the stage of previous growth to the flowering and in the beginning and arrival

  7. Melo carboniferous basin

    International Nuclear Information System (INIS)

    Flossdarf, A.

    1988-01-01

    This report is about of the Melo carboniferous basin which limits are: in the South the large and high Tupambae hill, in the west the Paraiso hill and the river mountains, in the North Yaguaron river basin to Candidata in Rio Grande del Sur in Brazil.

  8. Polyploidization facilitates biotechnological in vitro techniques in the genus Cucumis.

    Science.gov (United States)

    Skálová, Dagmar; Ondřej, Vladan; Doležalová, Ivana; Navrátilová, Božena; Lebeda, Aleš

    2010-01-01

    Prezygotic interspecific crossability barrier in the genus Cucumis is related to the ploidy level of the species (cucumber (C. sativus), x = 7; muskmelon (C. melo) and wild Cucumis species, x = 12). Polyploidization of maternal plants helps hybridization among other Cucumis species by overcoming prezygotic genetic barriers. The main objective of this paper is to compare the results of several methods supporting interspecific crosses in cucumber without and with polyploidization (comparison between diploid (2x) and mixoploid (2x/4x) cucumber maternal plants). Mixoploid plants were obtained after in vivo and in vitro polyploidization by colchicine and oryzalin. Ploidy level was estimated by flow cytometry. Embryo rescue, in vitro pollination, and isolation of mesophyll protoplast were tested and compared. Positive effect of polyploidization was observed during all experiments presented by higher regeneration capacity of cultivated mixoploid cucumber embryos, ovules, and protoplasts. Nevertheless, the hybrid character of putative hybrid accessions obtained after cross in vivo and in vitro pollination was not confirmed.

  9. Cantaloupe melon ( Cucumis melo L. conservation using hydrocooling

    Directory of Open Access Journals (Sweden)

    Edna Maria Mendes Aroucha

    2016-04-01

    Full Text Available ABSTRACT Maintaining cantaloupe melon at field temperature impairs conservation as it speeds up cell metabolism and transpiration, and, consequently, reduces shelf life. This study aimed to evaluate the conservation of Torreon hybrid cantaloupe using the hydrocooling treatment. Fruits were harvested at the commercial maturity stage (60 days after planting, in the morning, at the Nova California Farm, municipality of Mossoró-RN, in September 2007. One set of fruit was immersed in chilled water at 5 ºC for 5 min, at the packing house, while the remaining set was not hydro cooled. Then, both sets (treated and untreated with hydrocooling were pre-cooled in air forced tunnels at 7 ºC, until the temperature in the pulp reached 10 ºC. Both fruit sets were stored for 0, 14, 21, 28 and 35 days under modified atmosphere at 3 ± 1 oC and 90 ± 5% RH. After each storage period, the fruits were incubated in an atmosphere-controlled chamber at 20 ± 2 oC and 80 ± 5% de RH, for seven days. The following characteristics were evaluated: external and internal appearance, mass loss, soluble solids, firmness and titrable acidity. The experiment was arranged in a completely randomized split-plot design with four replications of three fruits. The plots consisted of the hydrocooling conditions (with and without fruit soaking in chilled water, and the sub-plots consisted of the storage times (0, 14, 21, 28 and 35 days.The treatment with hydrocooling was efficient in keeping the firmness and soluble solids of the fruits and shortened the pre-cooling time in the cooling tunnel. However, hydrocooling did not increase fruit shelf-life.

  10. Chromosomal structures and repetitive sequences divergence in Cucumis species revealed by comparative cytogenetic mapping.

    Science.gov (United States)

    Zhang, Yunxia; Cheng, Chunyan; Li, Ji; Yang, Shuqiong; Wang, Yunzhu; Li, Ziang; Chen, Jinfeng; Lou, Qunfeng

    2015-09-25

    Differentiation and copy number of repetitive sequences affect directly chromosome structure which contributes to reproductive isolation and speciation. Comparative cytogenetic mapping has been verified an efficient tool to elucidate the differentiation and distribution of repetitive sequences in genome. In present study, the distinct chromosomal structures of five Cucumis species were revealed through genomic in situ hybridization (GISH) technique and comparative cytogenetic mapping of major satellite repeats. Chromosome structures of five Cucumis species were investigated using GISH and comparative mapping of specific satellites. Southern hybridization was employed to study the proliferation of satellites, whose structural characteristics were helpful for analyzing chromosome evolution. Preferential distribution of repetitive DNAs at the subtelomeric regions was found in C. sativus, C hystrix and C. metuliferus, while majority was positioned at the pericentromeric heterochromatin regions in C. melo and C. anguria. Further, comparative GISH (cGISH) through using genomic DNA of other species as probes revealed high homology of repeats between C. sativus and C. hystrix. Specific satellites including 45S rDNA, Type I/II, Type III, Type IV, CentM and telomeric repeat were then comparatively mapped in these species. Type I/II and Type IV produced bright signals at the subtelomeric regions of C. sativus and C. hystrix simultaneously, which might explain the significance of their amplification in the divergence of Cucumis subgenus from the ancient ancestor. Unique positioning of Type III and CentM only at the centromeric domains of C. sativus and C. melo, respectively, combining with unique southern bands, revealed rapid evolutionary patterns of centromeric DNA in Cucumis. Obvious interstitial telomeric repeats were observed in chromosomes 1 and 2 of C. sativus, which might provide evidence of the fusion hypothesis of chromosome evolution from x = 12 to x = 7 in

  11. Melo

    Directory of Open Access Journals (Sweden)

    José María Vargas Vila

    1965-05-01

    Full Text Available No fue una dictadura, fue una aventura. No fue un golpe de Estado, fue un golpe de cuartel, pero atrevido, generoso, brillante, no como aquel otro grotesco de la triste figura de Urdaneta, tumulto vergonzoso, en que surgió a una dictadura efímera, problamada por pretorianos extranjeros, aquel servidor incondicional, manchado todavía con la sangre de Padilla, el Nelson Colombiano.

  12. Genetic Characterization of Turkish Snake Melon (Cucumis melo L. subsp. melo flexuosus Group) Accessions Revealed by SSR Markers.

    Science.gov (United States)

    Solmaz, Ilknur; Kacar, Yildiz Aka; Simsek, Ozhan; Sari, Nebahat

    2016-08-01

    Snake melon is an important cucurbit crop especially in the Southeastern and the Mediterranean region of Turkey. It is consumed as fresh or pickled. The production is mainly done with the local landraces in the country. Turkey is one of the secondary diversification centers of melon and possesses valuable genetic resources which have different morphological characteristics in case of snake melon. Genetic diversity of snake melon genotypes collected from different regions of Turkey and reference genotypes obtained from World Melon Gene Bank in Avignon-France was examined using 13 simple sequence repeat (SSR) markers. A total of 69 alleles were detected, with an average of 5.31 alleles per locus. The polymorphism information content of SSR markers ranged from 0.19 to 0.57 (average 0.38). Based on cluster analysis, two major groups were defined. The first major group included only one accession (61), while the rest of all accessions grouped in the second major group and separated into different sub-clusters. Based on SSR markers, cluster analysis indicated that considerably high genetic variability exists among the examined accessions; however, Turkish snake melon accessions were grouped together with the reference snake melon accessions.

  13. Desarrollo del cultivo de melón (Cucumis melo con vermicompost bajo condiciones de invernadero / Development of muskmelon (Cucumis melo with vermicompost under greenhouse conditions

    Directory of Open Access Journals (Sweden)

    Alejandro Moreno-Reséndez

    2014-04-01

    Full Text Available Se determinó el efecto del vermicompost (VC sobre el desarrollo del melón en invernadero utilizando como sustratos cuatro tipos de VC mezclados con arena de río (AR, con relaciones 25 : 75, 30 : 70, 35 : 65 y 40 : 60 (% en volumen. Los VC se prepararon a partir de estiércoles de caballo, cabra, conejo y bovino. Los sustratos se colocaron en bolsas de polietileno negro, de 20 kg de capacidad, en donde se sembraron semillas del melón Cantaloupe. Las plantas se condujeron a un solo tallo, tutorando con rafia y la demanda hídrica se cubrió con riego por goteo. Las bolsas, utilizadas como macetas, se colocaron en fila a doble hilera, con arreglo a tresbolillo. Se utilizó un diseño de bloques completos al azar en arreglo factorial 4x4 con cuatro repeticiones. El factor A fueron las mezclas VC : AR y el B los diferentes VC. El análisis de varianza mostró que con 40 % de VC, independientemente del VC usado, se registraron diferencias altamente significativas (P ≤ 0.01 para rendimiento, peso de fruto, diámetros ecuatorial y polar, espesor de pulpa, cavidad de la placenta y días a cosecha, con 96.386 t ha-1, 1.688 kg fruto-1, 14.55 cm, 16.73 cm, 3.77 cm, 5.57 cm y 89 d respectivamente, sin importar el tipo de estiércol utilizado en las mezclas con VC. El contenido promedio de sólidos solubles en los frutos resultó estadísticamente igual en cualquier nivel y tipo de VC empleado.

  14. Cucumis sativus L, Nasim variety

    African Journals Online (AJOL)

    ... practice for reducing water consumption and improving product quality. ... Since cucumbers (Cucumis sativus L, Nasim variety) is considered as the main and ... to a significant yield increase (P<0.001), while MAD of 50% had the least yield.

  15. Controlling fusarium wilt disease in melon(cucumis melo L.) using tilllered onion bulb extract

    International Nuclear Information System (INIS)

    Yushu, Z.; Guo, Q.; Xuezheng, W.; Yanan, Z.; Yuting, Li.

    2017-01-01

    Melon wilt disease is a soil-borne disease caused by Fusarium oxysporum f. sp. niveum. This disease incur of the heavy economic loss in melon crops. To decrease damage to melons, many control methods have been developed. However, many of the current control methods have limitations and disadvantages. For example, fungicides may cause health concerns for both humans and the environment due to high toxin content and the presence of residues. Therefore, biological control methods that reduce or eliminate the risk of environmental contamination and threats to human health are urgently needed to solve these issues and to protect melon crops from wilt disease.In this research, we assessed the efficacy of tillered onion bulb extract (TOE) for biocontrol of melon wilt disease in melon. Different concentrations of the TOE have been shown to have inhibitory effects on Fusariumspore germination and growth, pathogenic bacterial biomass, and fungal sporulation, with increased inhibitory effects at higher TOE concentrations. In melon wilt disease, concentrations of TOE greater than 250 mg/mL produced the highest protective effects in both susceptible and resistant melon cultivars. The disease index in resistant varieties was 18%, and the disease control effect was 63.51%, while the disease index in susceptible varieties was 21.41%, and the disease control effect reached 65.96%. These values indicate stronger control effects than those achieved using 40% Ning WP melon blight. High concentrations (over 500 mg/mL) of TOE had strong inhibitory effects on melon seed germination and the activity of protective enzymes in melon cultivars. (author)

  16. The Alcohol Dehydrogenase Gene Family in Melon (Cucumis melo L.: Bioinformatic Analysis and Expression Patterns

    Directory of Open Access Journals (Sweden)

    Yazhong eJin

    2016-05-01

    Full Text Available Alcohol dehydrogenases (ADH, encoded by multigene family in plants, play a critical role in plant growth, development, adaptation, fruit ripening and aroma production. Thirteen ADH genes were identified in melon genome, including 12 ADHs and one formaldehyde dehydrogenease (FDH, designated CmADH1-12 and CmFDH1, in which CmADH1 and CmADH2 have been isolated in Cantaloupe. ADH genes shared a lower identity with each other at the protein level and had different intron-exon structure at nucleotide level. No typical signal peptides were found in all CmADHs, and CmADH proteins might locate in the cytoplasm. The phylogenetic tree revealed that 13 ADH genes were divided into 3 groups respectively, namely long-, medium- and short-chain ADH subfamily, and CmADH1,3-11, which belongs to the medium-chain ADH subfamily, fell into 6 medium-chain ADH subgroups. CmADH12 may belong to the long-chain ADH subfamily, while CmFDH1 may be a Class III ADH and serve as an ancestral ADH in melon. Expression profiling revealed that CmADH1, CmADH2, CmADH10 and CmFDH1 were moderately or strongly expressed in different vegetative tissues and fruit at medium and late developmental stages, while CmADH8 and CmADH12 were highly expressed in fruit after 20 days. CmADH3 showed preferential expression in young tissues. CmADH4 only had slight expression in root. Promoter analysis revealed several motifs of CmADH genes involved in the gene expression modulated by various hormones, and the response pattern of CmADH genes to ABA, IAA and ethylene were different. These CmADHs were divided into ethylene-sensitive and –insensitive groups, and the functions of CmADHs were discussed.

  17. Molecular Cloning, Characterization, and Expression of Cuc m 2, a Major Allergen in Cucumis melo

    Directory of Open Access Journals (Sweden)

    Mojtaba Sankian

    2013-05-01

    Full Text Available Background: Several studies reported the clinical features of IgE-mediated hypersensitivity after ingestion of melon. Melon allergy is a common IgE-mediated fruit allergy in Iran. This prompted us to investigate immunochemical and molecular properties of the major allergen in melon fruit, to compare the IgE-binding capacity of the natural protein with the recombinant allergen, and to determine cross-reactivity of the major allergen with closely-related allergens from other plants displaying clinical cross-reactivity with melon. Methods: Identification and molecular characterization of the major melon allergen were performed using IgE immunoblotting, allergen-specific ELISA, affinity-based purifications, cross-inhibition assays, cloning, and expression of the allergen in Escherichia coli. Results: Melon profilin was identified and isolated as a major IgE-binding component and designated as Cuc m 2. Sequencing corresponding cDNA revealed an open reading frame of 363 bp coding for 131 amino acid residues and two fragments of 171 bp and 383 bps for the 5’and 3’ UTRs, respectively. Significant cross-reactivity was found between melon profilin and Cynodon dactylon, tomato, peach, and grape profilins in cross-inhibition assays. Although the highest degree of amino acid identity was revealed with watermelon profilin, there was no significant cross-reactivity between melon and watermelon profilins. Conclusion: Melon profilin is the major IgE-binding component in melon extract, and the recombinant and natural forms exhibited similar IgE-binding capacities. A part of the fruit-fruit and pollen-fruit cross-reactions could be explained by the presence of this conserved protein; however, sequence homology provides insufficient information to predict IgE cross-reactivity of profilins.

  18. High-quality total RNA isolation from melon (Cucumis melo L. fruits rich in polysaccharides

    Directory of Open Access Journals (Sweden)

    Gabrielle Silveira de Campos

    2017-08-01

    Full Text Available Melon, a member of the family Cucurbitaceae, is the fourth most important fruit in the world market and, on a volume basis, is Brazil’s main fresh fruit export. Many molecular techniques used to understand the maturation of these fruits require high concentrations of highly purified RNA. However, melons are rich in polyphenolic compounds and polysaccharides, which interfere with RNA extraction. This study aimed to determine the most appropriate method for total RNA extraction from melon fruits. Six extraction buffers were tested: T1 guanidine thiocyanate/phenol/chloroform; T2 sodium azide/?-mercaptoethanol; T3 phenol/guanidine thiocyanate; T4 CTAB/PVP/?-mercaptoethanol; T5 SDS/sodium perchlorate/PVP/?-mercaptoethanol, and T6 sarkosyl/PVP/guanidine thiocyanate, using the AxyPrepTM Multisource Total RNA Miniprep Kit. The best method for extracting RNA from both mature and green fruit was based on the SDS/PVP/?-mercaptoethanol buffer, because it rapidly generated a high quality and quantity of material. In general, higher amounts of RNA were obtained from green than mature fruits, probably due to the lower concentration of polysaccharides and water. The purified material can be used as a template in molecular techniques, such as microarrays, RT-PCR, and in the construction of cDNA and RNA-seq data.

  19. (Cucumis melo L.) cultivars to soil-borne plant pathogenic fungi in Iran

    African Journals Online (AJOL)

    ajl11

    2012-10-30

    Oct 30, 2012 ... Melon is an important dessert fruit in the Sistan region of. Iran, but its cultivation is threatened by attacks of. Macrophomina phaseolina (Tassi), Monosporascus cannonballus (Pollack and Uecker) and Rhizoctonia solani (Kuhn) (Safarnezhad, 2004). Melon death induced by these soil-borne plant pathogenic ...

  20. Endogenous microbial contamination of melons (Cucumis melo) from international trade: an underestimated risk for the consumer?

    Science.gov (United States)

    Esteban-Cuesta, Irene; Drees, Nathalie; Ulrich, Sebastian; Stauch, Peter; Sperner, Brigitte; Schwaiger, Karin; Gareis, Manfred; Gottschalk, Christoph

    2018-03-31

    Fruits and vegetables have increasingly been related to foodborne outbreaks. Besides surface contamination, a possible internalization of microorganisms into edible parts of plants during growth has already been observed. To examine an actual risk for the consumer, microbial contamination of the rind and pulp of 147 muskmelons from international trade was assessed using cultural and biochemical methods, polymerase chain reaction and matrix-assisted laser desorption/ionization-time of flight mass spectrometry. One hundred percent of the rind samples [3.69-8.92 log colony forming units (CFU) g -1 ] and 89.8% of the pulp samples (maximum load 3.66 log CFU g -1 ) were microbiologically contaminated. Among the 432 pulp isolates, opportunistic and potentially pathogenic bacteria were identified, mainly Staphylococcus spp. (48.9%), Clostridium spp. (42.9%) and Enterobacteriaceae (27.9%). Salmonella spp., Escherichia coli and isolates of the Bacillus cereus group were found on the rind (1.4%, 0.7% and 42.9%, respectively) and in the pulp (0.7%, 1.4% and 4.7%). Clostridium perfringens was isolated from the rind of seven melons. The present study revealed a regularly occurring internal contamination of melons. Possible health risks for consumers because of an occurrence of microorganisms in melon pulp should be considered in future food safety assessments. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

  1. Marker-assisted selection of Fusarium wilt-resistant and gynoecious melon (Cucumis melo L.).

    Science.gov (United States)

    Gao, P; Liu, S; Zhu, Q L; Luan, F S

    2015-12-08

    In this study, molecular markers were designed based on the sex determination genes ACS7 (A) and WIP1 (G) and the domain in the Fusarium oxysporum-resistant gene Fom-2 (F) in order to achieve selection of F. oxysporum-resistant gynoecious melon plants. Markers of A and F are cleaved amplified polymorphic sequences that distinguish alleles according to restriction analysis. Twenty F1 and 1863 F2 plants derived from the crosses between the gynoecious line WI998 and the Fusarium wilt-resistant line MR-1 were genotyped based on the markers. The results showed that the polymerase chain reaction and enzyme digestion results could be effectively used to identify plants with the AAggFF genotype in F2 populations. In the F2 population, 35 gynoecious wilt-resistant plants were selected by marker-assisted selection and were confirmed by disease infection assays, demonstrating that these markers can be used in breeding to select F. oxysporum-resistant gynoecious melon plants.

  2. Effects of gamma irradiation of pollen on parthenogenetic haploid production in muskmelon (Cucumis melo L.)

    International Nuclear Information System (INIS)

    Cuny, F.; Grotte, M.; Dumas de Vaulx, R.; Rieu, A.

    1993-01-01

    The effects of increasing gamma ray exposures on muskmelon pollen of the Védrantais genotype were evaluated after autofertilization and hybridization with the F1.G1 genotype. Regardless of doses of between 0.15 and 1.6 kGy, fruit set and number of seeds per fruit were comparable to those of the control. The pollen tube from pollen irradiated with up to 2.5 kGy grew in styles and reached the ovules. When pollen was cultivated in vitro, relatively high doses of irradiation (1.6 kGy) were needed to reduce the level of germination. Radiation-induced changes in the generative nucleus led to the formation of two chromosomally unbalanced sperm cells (as indicated by the appearance of morphological dimorphism) which induced parthenogenetic development of the egg to form a haploid embryo. Haploid embryo production by gamma-irradiated pollen was genotype dependent. For exposures of between 0.15 and 2.5 kGy, the production of embryos was the same, about 3.4%; a maximum of 70% of these embryos placed in a specific culture medium produced haploid plants. The ploidy of the plantlets in vitro was determined by flow cytometry. No aneuploidy was detected. All resulting plants exhibited normal phenotypes. (author) [fr

  3. (Cucumis melo L.) cultivars to soil-borne plant pathogenic fungi in Iran

    African Journals Online (AJOL)

    ajl11

    2012-10-30

    Oct 30, 2012 ... resistance of melon cultivars to three important soil-borne plant pathogens found worldwide. Key words: Melon ... use of cultivars resistant to plant diseases is one of the ..... emerging disease of melons worldwide. Plant Dis.

  4. The use of gamma radiation aiming to post harvest conservation of Cantaloupe melon (Cucumis melo L. var. Cantaloupensis);Utilizacao de radiacao gama em meloes cantaloupe (Cucumis melo L. var. Cantaloupensis) como tecnica de conservacao pos-colheita

    Energy Technology Data Exchange (ETDEWEB)

    Siqueira, Alessandra Aparecida Zilio Cozzo de

    2007-07-01

    Although Brazilian fruit culture has been growing in the international market, the fruit quality and the post harvest technology have not been improved properly. In Brazil, fruit nutritional factors are very important because of their potential to provide suitable nutrients for a significant part of the Country population. Some post harvest technologies, such as ionizing radiation, can keep the physical, chemical, nutritional and sensorial characteristics of the natural fruit, improving the quality of the fruits in the market. This work evaluated the effects of Cobalt 60 irradiation in Cantaloupe melon, aiming the post harvest conservation during 7 days of storage, at a temperature ranging from 20 to 22 deg C. The doses of irradiation were set to 0, 150, 300, 450, 600, 750 and 900 Gy, based on the multiple of 150 Gy quarantine dose, aiming to establish the lowest, the highest and the ideal doses. Afterwards, physical, chemical and nutritional characteristics of irradiated fruit were checked and, finally, the sensorial characteristics through acceptability test. Results indicated that the doses higher than 450 Gy affected firmness, pulp yield and color (L and a{sup *}) parameters. Nevertheless, analyzing physical, chemical and nutritional parameters, doses of 450 and 900 Gy kept pH, tetrable acidity, soluble solids, color (a{sup *} and b{sup *}), chlorophyll and carotenoids, phenolic compounds, respiratory rate and ethylene level. The storage period was the most important factor that affected the quality of the fruit, despite of the radiation doses. Based on the acceptability test, the best evaluated fruits were from the treatments of 450 and 900 Gy. This work allowed to conclude that fruit radiation is an appropriate technology for Cantaloupe melon post harvest conservation, but it is necessary to be used in combination with other technologies, especially to fungi control. (author)

  5. Temas de Historia: El golpe de Melo

    Directory of Open Access Journals (Sweden)

    Fernando Serpa Flórez

    1965-07-01

    Full Text Available El 16 de abril de 1854, en las horas de la noche, el general José María Melo, comandante general del ejército, se apoderó de los cuarteles de Bogotá. Al día siguiente, por la mañana, envió una comisión ante el Presidente de la República, José María Obando, a ofrecerle la dictadura. El presidente rechazó tal propuesta y convocó al Consejo de Gobierno, al vicepresidente José de Obaldía, al Procurador General de la Nación y al designado, general Tomás Herrera, para estudiar la situación.

  6. Medieval herbal iconography and lexicography of Cucumis (cucumber and melon, Cucurbitaceae) in the Occident, 1300-1458.

    Science.gov (United States)

    Paris, Harry S; Janick, Jules; Daunay, Marie-Christine

    2011-09-01

    The genus Cucumis contains two species of important vegetable crops, C. sativus, cucumber, and C. melo, melon. Melon has iconographical and textual records from lands of the Mediterranean Basin dating back to antiquity, but cucumber does not. The goal of this study was to obtain an improved understanding of the history of these crops in the Occident. Medieval images purportedly of Cucumis were examined, their specific identity was determined and they were compared for originality, accuracy and the lexicography of their captions. The manuscripts having accurate, informative images are derived from Italy and France and were produced between 1300 and 1458. All have an illustration of cucumber but not all contain an image of melon. The cucumber fruits are green, unevenly cylindrical with an approx. 2:1 length-to-width ratio. Most of the images show the cucumbers marked by sparsely distributed, large dark dots, but images from northern France show them as having densely distributed, small black dots. The different size, colour and distribution reflect the different surface wartiness and spininess of modern American and French pickling cucumbers. The melon fruits are green, oval to serpentine, closely resembling the chate and snake vegetable melons, but not sweet melons. In nearly all manuscripts of Italian provenance, the cucumber image is labelled with the Latin caption citruli, or similar, plural diminuitive of citrus (citron, Citrus medica). However, in manuscripts of French provenance, the cucumber image is labelled cucumeres, which is derived from the classical Latin epithet cucumis for snake melon. The absence of melon in some manuscripts and the expropriation of the Latin cucumis/cucumer indicate replacement of vegetable melons by cucumbers during the medieval period in Europe. One image, from British Library ms. Sloane 4016, has a caption that allows tracing of the word 'gherkin' back to languages of the geographical nativity of C. sativus, the Indian

  7. Medieval herbal iconography and lexicography of Cucumis (cucumber and melon, Cucurbitaceae) in the Occident, 1300–1458

    Science.gov (United States)

    Paris, Harry S.; Janick, Jules; Daunay, Marie-Christine

    2011-01-01

    Background The genus Cucumis contains two species of important vegetable crops, C. sativus, cucumber, and C. melo, melon. Melon has iconographical and textual records from lands of the Mediterranean Basin dating back to antiquity, but cucumber does not. The goal of this study was to obtain an improved understanding of the history of these crops in the Occident. Medieval images purportedly of Cucumis were examined, their specific identity was determined and they were compared for originality, accuracy and the lexicography of their captions. Findings The manuscripts having accurate, informative images are derived from Italy and France and were produced between 1300 and 1458. All have an illustration of cucumber but not all contain an image of melon. The cucumber fruits are green, unevenly cylindrical with an approx. 2:1 length-to-width ratio. Most of the images show the cucumbers marked by sparsely distributed, large dark dots, but images from northern France show them as having densely distributed, small black dots. The different size, colour and distribution reflect the different surface wartiness and spininess of modern American and French pickling cucumbers. The melon fruits are green, oval to serpentine, closely resembling the chate and snake vegetable melons, but not sweet melons. In nearly all manuscripts of Italian provenance, the cucumber image is labelled with the Latin caption citruli, or similar, plural diminuitive of citrus (citron, Citrus medica). However, in manuscripts of French provenance, the cucumber image is labelled cucumeres, which is derived from the classical Latin epithet cucumis for snake melon. The absence of melon in some manuscripts and the expropriation of the Latin cucumis/cucumer indicate replacement of vegetable melons by cucumbers during the medieval period in Europe. One image, from British Library ms. Sloane 4016, has a caption that allows tracing of the word ‘gherkin’ back to languages of the geographical nativity of C

  8. A conserved ethylene biosynthesis enzyme leads to andromonoecy in two cucumis species.

    Directory of Open Access Journals (Sweden)

    Adnane Boualem

    Cucumis sativus (cucumber and Cucumis melo (melon that have diverged over 40 My ago. The isolation of the genes for andromonoecy in Cucumis species provides a molecular basis for understanding how sexual systems arise and are maintained within and between species.

  9. An AFLP marker linked to the Pm-1 gene that confers resistance to Podosphaera xanthii race 1 in Cucumis melo

    Directory of Open Access Journals (Sweden)

    Ana Paula Matoso Teixeira

    2008-01-01

    Full Text Available Brazil produced 330,000 metric tons of melons in 2005, principally in the Northeast region where one of the most important melon pathogens is the powdery mildew fungus Podosphaera xanthii. The disease is controlled mainly by incorporating single dominant resistance genes into commercial hybrids. We report on linkage analysis of the Pm-1 resistance gene, introgressed from the AF125Pm-1 Cantalupensis Charentais-type breeding line into the yellow-fleshed melon (Group Inodorus breeding line AF426-S by backcrossing to produce the resistant line AF426-R, and the amplified fragment length polymorphism (AFLP marker M75/H35_155 reported to be polymorphic between AF426-S and AF426-R. Segregation analysis of M75/H35_155 using a backcross population of 143 plants derived from [AF426-R x AF426-S] x AF426-S and screened for resistance to P. xanthii race 1 produced a recombination frequency of 4.9%, indicating close linkage between M75/H35_155 and Pm-1. Using the same segregating population, the M75/H35_155 marker had previously been reported to be distantly linked to Prv¹, a gene conferring resistance to papaya ringspot virus-type W. Since M75/H35_155 is linked to Prv¹ at a distance of 40.9 cM it is possible that Pm-1 and Prv¹ are also linked.

  10. Linkage Map Construction and QTL Analysis of Fruit Traits in Melon (Cucumis melo L.) Based on CAPS Markers

    International Nuclear Information System (INIS)

    Baloch, A. M.; Liu, S.; Wang, X.; Luan, F.; Baloch, A. W.; Baloch, M. J.

    2016-01-01

    In the current experiment, the quantitative trait loci (QTL) analysis was done by composite interval mapping method to detect QTLs in edge, central parts and fruit shape of melon. In this context, 235 F/sub 2/ populations along with their parents were evaluated for fruit size, shape and color under replicated trail at Horticulture Experimental Station of Northeast Agricultural University, Harbin, China, during the growing year 2014. Moreover, 96 pairs of CAPS markers were used to construct a linkage map using F/sub 2/ population that was derived from the cross between two contrasting parents (MR-1 and Topmark). The total length of linkage map was found to be 4984.1cM with an average of 51.9177 cM between the markers. In a total, we detected ten QTLs, in which one was major, while others were minor. Five QTLs were detected in the edge part of melon fruit and three QTLs were detected in central parts of melon and all were considered as Brix content. Two QTLs were related with fruit shape. Our present genetic and QTLs mapping would be proved useful in plant breeding programs for the improvement of economically important horticultural traits. (author)

  11. Effect of Seed Pretreatment on Germination Parameters, Growth, and Fruit Yield of Muskmelon (Cucumis melo var reticulates L..

    Directory of Open Access Journals (Sweden)

    T. Moghbeli

    2015-03-01

    Full Text Available Seed pretreated with plant growth regulators can improve germination parameters, growth, and yield of crops. Thus, in two greenhouse and field experiments, effects of seed treatment with 0.1 mM salicylic acid (SA, 1µM methyl jasmonate (MJ, 1.5% humic acid (HA, and water (as Control on germination parameters, seedling growth, and also growth and fruit yield were studied. In the first experiment which was conducted on two cultivars (Semsuri and Shahpasandi, all the treatments improved most of parameters the recorded, and the response of two cultivars was rather similar for most parameters. In the second experiment which was conducted on one cultivar (Shahpasandi in the field, all the treatments improved most of parameters the recorded. Compared with the control, SA, MJ and HA increased total plant fresh weight (19, 41 and 19%, fruit number (30, 35 and 20% and fruit yield (31, 45 and 31, respectively. Significant correlations were found between fruit yield and relative water content (r = -0.95*, ion leakage (r = -0.93*, final plant shoot fresh weight (r = 0.99** and fruit number (r = 0.93*, indicating that treatments could increase fruit yield by improving ion leakage and relative water content.

  12. Plantas hospederas de Aphis gossypii (Aphididae), vector de virus del melón Cucumis melo (Cucurbitaceae) en Costa Rica

    OpenAIRE

    Sánchez, M.V.; Agüero, R.; Rivera, C.

    2001-01-01

    Se identificaron las especies hospederas naturales de Aphis gossypii Glover (Aphididae: Homoptera) en plantaciones comerciales de melón para la exportación en Costa Rica. El estudio se realizó en dos fincas, ubicadas una en la provincia de Guanacaste y la otra en la provincia de Puntarenas, correspondientes a dos zonas de vida vegetal diferentes. Se identificaron como especies hospederas del áfido todas aquellas especies vegetales en las que se observó la presencia del áfido en su forma ápter...

  13. [Host plants of Aphis gossypii (Aphididae), vector of virus of Cucumis melo melon (Cucurbitaceae) in Costa Rica].

    Science.gov (United States)

    Sánchez, M V; Agüero, R; Rivera, C

    2001-03-01

    Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families) and 72 plant species (40 families) were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families) were colonized by A. gossypii and 16 (10 families) are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.

  14. Plantas hospederas de Aphis gossypii (Aphididae, vector de virus del melón Cucumis melo (Cucurbitaceae en Costa Rica

    Directory of Open Access Journals (Sweden)

    M.V. Sánchez

    2001-03-01

    Full Text Available Se identificaron las especies hospederas naturales de Aphis gossypii Glover (Aphididae: Homoptera en plantaciones comerciales de melón para la exportación en Costa Rica. El estudio se realizó en dos fincas, ubicadas una en la provincia de Guanacaste y la otra en la provincia de Puntarenas, correspondientes a dos zonas de vida vegetal diferentes. Se identificaron como especies hospederas del áfido todas aquellas especies vegetales en las que se observó la presencia del áfido en su forma áptera. En ambas fincas el estudio se realizó en los alrededores y dentro del cultivo de melón. En la finca A en cinco diferentes comunidades vegetales (cultivo, canal de drenaje, charral, potrero mejorado y semi-bosque previamente seleccionadas y en la finca B en cuatro comunidades vegetales (cultivo, charral, pastizal natural y semi-bosque. Especímenes de las plantas colonizadas por áfidos y los áfidos colonizadores de cada especie fueron recolectadas para su identificación. Los áfidos se preservaron en alcohol al 70% v/v e identificaron utilizando las claves taxonómicas para áfidos, confirmándose como especie dominante a A. gossypii. La diversidad, cobertura y época de aparición de las especies de plantas hospederas fue monitoreada durante un año calendario en las diferentes comunidades vegetales presentes en ambas fincas, observándose diferencias entre las dos fincas estudiadas. En la finca A se observaron 86 diferentes especies vegetales, pertenecientes a 49 familias, asociadas al cultivo del melón, mientras que en la finca B se identificaron 72 especies de 40 familias. En conjunto para ambas fincas, un de 24 especies de plantas (16 familias estaban colonizadas por el áfido A. gossypii. De éstas, 16 especies de 10 familias, son reportes nuevos de plantas hospederas para este áfido: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia y Corchorus orinocensis.Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families and 72 plant species (40 families were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families were colonized by A. gossypii and 16 (10 families are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.

  15. A new strategy to protect Katsura-uri (Japan's heirloom pickling melon, Cucumis melo var. conomon from extinction

    Directory of Open Access Journals (Sweden)

    Azusa Sasaki

    2017-03-01

    Conclusion: This demonstrated a new strategy to protect this heirloom vegetable from extinction by adding a new function that could increase its demand as a low-calorie fruit in the present diet habit for human health.

  16. Evaluación agronómica de melón (cucumis melo l bajo condiciones de campo

    Directory of Open Access Journals (Sweden)

    Fernando Borrego

    2001-01-01

    Full Text Available Con el objetivo de determinar las variables más relacionadas con el rendimiento, así como los principales componentes de variación, se establecieron en campo, en Ramos Arizpe, Coahuila, 12 genotipos de melón, en un diseño de Bloques Completos al Azar, con cuatro repeticiones. La parcela experimental fue de dos surcos de cinco metros de largo sembrados a doble hilera. Los genotipos en estudio fueron: híbridos: Primo, Pronto, Challenger, Cheyenne, Hi-Line, Cruiser, Durango, Apache, Laguna, Caravelle y Main Pak, y la variedad Top Mark, testigo; las variables evaluadas fueron: rendimiento (11 variables: cuantitativas y cualitativas; fenológicas (tres variables; agroclimáticas (cinco Variables y fisiológicas (cuatro variables. Se encontraron correlaciones significativas (p<0,05 y negativas, entre rendimiento y precocidad, peso promedio de frutos y número de frutos, así como entre número de frutos y longitud de fruto. Las variables fisiológicas más relacionadas fueron fotosíntesis y uso eficiente del agua. En el análisis de componentes principales, se encontró que hasta el componente tres, se explica el 65% de la varianza. En el componente uno, se encuentra un alto valor en las características de rendimiento (producción, peso y tamaño, por lo que se llamaría “Características Cuantitativas del Rendimiento”. En el componente dos, la mayor variación es el de “Componente de Precocidad”. Los componentes tres al seis, explican en proporciones muy similares las otras variables, siendo en el seis donde se encuentra con mayor valor la fotosíntesis. El análisis de regresión lineal múltiple fue significativo (p<0,057 que, por las condiciones del estudio, se considera adecuado. El rendimiento en t/ha, se explica por una ecuación lineal múltiple (r2=0,99 de 10 variables

  17. Identifikasi berat, diameter, dan tebal daging buah melon (Cucumis melo L. kultivar action 434 tetraploid akibat perlakuan kolkisin

    Directory of Open Access Journals (Sweden)

    Y. Ulung Anggraito

    2012-02-01

    Full Text Available Indonesian farmers are very dependence on certificated seed from another countries. In the other side the natural resources andmen powers very abundance. For these reason it is properly developed the research in agriculture sector, especially on plants breeding.It can be hoped that in the future the dependence on certificated seed from another countries can be minimized. The objective of thisresearch were: (1 to find out the concentration and dipping period which is effective to induce polyploid in musk melon plant, (2identify the weight, diameter, dan flesh thickness of tetraploid musk melon as result of colchicines treatment. The sample of this researchwas Action 434 musk melon cultivar, product of Chia-Thai Seed, Thailand. The number of sample was 480 plants, which plants on fieldrandomly. There were four colchicines concentration as an independent variable: 0.0%, 0.05%, 0.10% and 0.2%. The dipping periodwere 12, 16, 20, and 24 hours for each concentration respectively. Completely Random Design was used in three replications. Datameasurement were analyzed with Two Way ANOVA, DMRT, and LSD. From this research can be concluded that: (1 0.2 % colchicinesis the most effective concentration to induce polyploid on musk melon, with dipping period effective varied from 16–24 hours, (2 thereare changes in weight, diameter, and flesh thickness characters, with the increased tendency of each character in definite norm.

  18. Hexanoic Acid Treatment Prevents Systemic MNSV Movement in Cucumis melo Plants by Priming Callose Deposition Correlating SA and OPDA Accumulation

    Directory of Open Access Journals (Sweden)

    Emma Fernández-Crespo

    2017-10-01

    Full Text Available Unlike fungal and bacterial diseases, no direct method is available to control viral diseases. The use of resistance-inducing compounds can be an alternative strategy for plant viruses. Here we studied the basal response of melon to Melon necrotic spot virus (MNSV and demonstrated the efficacy of hexanoic acid (Hx priming, which prevents the virus from systemically spreading. We analysed callose deposition and the hormonal profile and gene expression at the whole plant level. This allowed us to determine hormonal homeostasis in the melon roots, cotyledons, hypocotyls, stems and leaves involved in basal and hexanoic acid-induced resistance (Hx-IR to MNSV. Our data indicate important roles of salicylic acid (SA, 12-oxo-phytodienoic acid (OPDA, jasmonic-isoleucine, and ferulic acid in both responses to MNSV. The hormonal and metabolites balance, depending on the time and location associated with basal and Hx-IR, demonstrated the reprogramming of plant metabolism in MNSV-inoculated plants. The treatment with both SA and OPDA prior to virus infection significantly reduced MNSV systemic movement by inducing callose deposition. This demonstrates their relevance in Hx-IR against MNSV and a high correlation with callose deposition. Our data also provide valuable evidence to unravel priming mechanisms by natural compounds.

  19. Differential metabolism of L-phenylalanine in the formation of aromatic volatiles in melon (Cucumis melo L.) fruit.

    Science.gov (United States)

    Gonda, Itay; Davidovich-Rikanati, Rachel; Bar, Einat; Lev, Shery; Jhirad, Pliaa; Meshulam, Yuval; Wissotsky, Guy; Portnoy, Vitaly; Burger, Joseph; Schaffer, Arthur A; Tadmor, Yaakov; Giovannoni, James J; Fei, Zhangjun; Fait, Aaron; Katzir, Nurit; Lewinsohn, Efraim

    2018-04-01

    Studies on the active pathways and the genes involved in the biosynthesis of L-phenylalanine-derived volatiles in fleshy fruits are sparse. Melon fruit rinds converted stable-isotope labeled L-phe into more than 20 volatiles. Phenylpropanes, phenylpropenes and benzenoids are apparently produced via the well-known phenylpropanoid pathway involving phenylalanine ammonia lyase (PAL) and being (E)-cinnamic acid a key intermediate. Phenethyl derivatives seemed to be derived from L-phe via a separate biosynthetic route not involving (E)-cinnamic acid and PAL. To explore for a biosynthetic route to (E)-cinnamaldehyde in melon rinds, soluble protein cell-free extracts were assayed with (E)-cinnamic acid, CoA, ATP, NADPH and MgSO 4 , producing (E)-cinnamaldehyde in vitro. In this context, we characterized CmCNL, a gene encoding for (E)-cinnamic acid:coenzyme A ligase, inferred to be involved in the biosynthesis of (E)-cinnamaldehyde. Additionally we describe CmBAMT, a SABATH gene family member encoding a benzoic acid:S-adenosyl-L-methionine carboxyl methyltransferase having a role in the accumulation of methyl benzoate. Our approach leads to a more comprehensive understanding of L-phe metabolism into aromatic volatiles in melon fruit. Copyright © 2018 Elsevier Ltd. All rights reserved.

  20. The use of gamma radiation aiming to post harvest conservation of Cantaloupe melon (Cucumis melo L. var. Cantaloupensis)

    International Nuclear Information System (INIS)

    Siqueira, Alessandra Aparecida Zilio Cozzo de

    2007-01-01

    Although Brazilian fruit culture has been growing in the international market, the fruit quality and the post harvest technology have not been improved properly. In Brazil, fruit nutritional factors are very important because of their potential to provide suitable nutrients for a significant part of the Country population. Some post harvest technologies, such as ionizing radiation, can keep the physical, chemical, nutritional and sensorial characteristics of the natural fruit, improving the quality of the fruits in the market. This work evaluated the effects of Cobalt 60 irradiation in Cantaloupe melon, aiming the post harvest conservation during 7 days of storage, at a temperature ranging from 20 to 22 deg C. The doses of irradiation were set to 0, 150, 300, 450, 600, 750 and 900 Gy, based on the multiple of 150 Gy quarantine dose, aiming to establish the lowest, the highest and the ideal doses. Afterwards, physical, chemical and nutritional characteristics of irradiated fruit were checked and, finally, the sensorial characteristics through acceptability test. Results indicated that the doses higher than 450 Gy affected firmness, pulp yield and color (L and a * ) parameters. Nevertheless, analyzing physical, chemical and nutritional parameters, doses of 450 and 900 Gy kept pH, tetrable acidity, soluble solids, color (a * and b * ), chlorophyll and carotenoids, phenolic compounds, respiratory rate and ethylene level. The storage period was the most important factor that affected the quality of the fruit, despite of the radiation doses. Based on the acceptability test, the best evaluated fruits were from the treatments of 450 and 900 Gy. This work allowed to conclude that fruit radiation is an appropriate technology for Cantaloupe melon post harvest conservation, but it is necessary to be used in combination with other technologies, especially to fungi control. (author)

  1. Grupos de Lie

    OpenAIRE

    Rubio Martí, Vicente

    2016-01-01

    En el presente proyecto definimos lo que es un grupo de Lie, así como su respectiva álgebra de Lie canónica como aproximación lineal a dicho grupo de Lie. El proceso de linealización, que es hallar el algebra de Lie de un grupo de Lie dado, tiene su

  2. ECHR Melo Tadeu: A Tax Case Which Should Bring on More Carefully Selected Criminal Procedures

    NARCIS (Netherlands)

    Poelmann, E.

    2016-01-01

    The European Court of Human Rights (ECHR) judged in the Melo Tadeu case that the refusal of the authorities to undo the seizure of assets after a criminal acquittal, is disproportional, regardless whether the appeal was too late. The Melo Tadeu judgment implies mainly that the presumption of

  3. Geological map of Uruguay Esc 1,100,000. Melo Sheet D-15

    International Nuclear Information System (INIS)

    Ferrando, L.; Andreis, R.

    1990-01-01

    This work is about the geological map of Uruguay Esc.1.100.000 (Melo) and the explanatory memoranda which describes the geological , lithological and sedimentological characteristics soils belong to the pre devonian period in Melo, Buena Vista Yaguari and Tres islas formations. These metamorphic rocks would be compared with the orogenic cycle of the east and southeast groups

  4. Melos: a Rhetoric Proof in Songs in Semiotic Perspective

    Directory of Open Access Journals (Sweden)

    Adriano Dantas de Oliveira

    2016-12-01

    Full Text Available We will have, in this work, the exposure of an approach to cancional text as a specific rhetorical situation. We assimilated the melos as all musical aspects of the song as a rhetorical proof that articulates the traditional trilogy: ethos, logos and pathos. We will use an interdisciplinary theoretical framework, articulating the classical rhetoric to semiotics applied to the song, exploring, from this model, discursive aspects of cancional text. As corpus, we have the analysis of a buarquiana song sample sociopolitical theme composed and recorded during the period of dictatorship.

  5. (cucumis sativus l.) in spent engine oil contaminated soil amended

    African Journals Online (AJOL)

    compost treatment recorded the highest number of leaves while the number of leaves for 0% ... KEYWORDS: Growth, Cucumis sativus, Urena lobata, spent engine oil, contamination, .... sawdust, peat, waste cotton and organic manures are.

  6. Hidrogeologic and geophysical studies into Agro school Melo UTU Cerro Largo province

    International Nuclear Information System (INIS)

    Heinzen, W.; Santana, I.; Mari, C.

    1986-01-01

    The technical University UTU of Uruguay requested and Hidrogeologic study with the aim to analyze the factibility to discover underground stream waters which supply groundwaters into agro school Ing Agr. Alcides E Pintos Melo, Cerro Largo province.

  7. The genome of the cucumber, Cucumis sativus L.

    NARCIS (Netherlands)

    Huang, S.W.; Li, R.Q.; Vossen, van der E.A.G.

    2009-01-01

    Cucumber is an economically important crop as well as a model system for sex determination studies and plant vascular biology. Here we report the draft genome sequence of Cucumis sativus var. sativus L., assembled using a novel combination of traditional Sanger and next-generation Illumina GA

  8. Genetic identification of a dwarf mutant in cucumber ( Cucumis ...

    African Journals Online (AJOL)

    The dwarf (compact) plant architecture is an important trait in cucumber (Cucumis sativus L.) breeding. A dwarf type mutant was selected from the cucumbers. The morphological and reproductive characteristics of the dwarf were compared with the vine plants. The dwarf type of cucumbers is characterized by its short ...

  9. The genome of the cucumber, Cucumis sativus L

    DEFF Research Database (Denmark)

    Huang, Sanwen; Li, Ruiqiang; Zhang, Zhonghua

    2009-01-01

    Cucumber is an economically important crop as well as a model system for sex determination studies and plant vascular biology. Here we report the draft genome sequence of Cucumis sativus var. sativus L., assembled using a novel combination of traditional Sanger and next-generation Illumina GA seq...

  10. A single recessive gene controls fragrance in cucumber (Cucumis ...

    Indian Academy of Sciences (India)

    2013-04-10

    Apr 10, 2013 ... Genetic studies in rice (Sood and Siddiq 1978), soybean. (AVRDC .... difficulty, marker-assisted selection (MAS) is an alternative for breeding ... 31, 823–826. de Wilde W. J. J. O and Duyfjes B. E. E. 2010 Cucumis sativus.

  11. Mapping the Flavor Contributing Traits on "Fengwei Melon" (Cucumis melo L. Chromosomes Using Parent Resequencing and Super Bulked-Segregant Analysis.

    Directory of Open Access Journals (Sweden)

    Hong Zhang

    Full Text Available We used a next-generation high-throughput sequencing platform to resequence the Xinguowei and Shouxing melon cultivars, the parents of Fengwei melon. We found 84% of the reads (under a coverage rate of "13×" placed on the reference genome DHL92. There were 2,550,000 single-nucleotide polymorphisms and 140,000 structural variations in the two genomes. We also identified 1,290 polymorphic genes between Xinguowei and Shouxing. We combined specific length amplified fragment sequencing (SLAF-seq and bulked-segregant analysis (super-BSA to analyze the two parents and the F2 extreme phenotypes. This combined method yielded 12,438,270 reads, 46,087 SLAF tags, and 4,480 polymorphic markers (average depth of 161.81×. There were six sweet trait-related regions containing 13 differential SLAF markers, and 23 sour trait-related regions containing 48 differential SLAF markers. We further fine-mapped the sweet trait to the genomic regions on chromosomes 6, 10, 11, and 12. Correspondingly, we mapped the sour trait-related genomic regions to chromosomes 2, 3, 4, 5, 9, and 12. Finally, we positioned nine of the 61 differential markers in the sweet and sour trait candidate regions on the parental genome. These markers corresponded to one sweet and eight sour trait-related genes. Our study provides a basis for marker-assisted breeding of desirable sweet and sour traits in Fengwei melons.

  12. Comparison of Different Methods for Separation of Haploid Embryo Induced through Irradiated Pollen and Their Economic Analysis in Melon (Cucumis melo var. inodorus

    Directory of Open Access Journals (Sweden)

    Gökhan Baktemur

    2013-01-01

    Full Text Available Irradiated pollen technique is the most successful haploidization technique within Cucurbitaceae. After harvesting of fruits pollinated with irradiated pollen, classical method called as “inspecting the seeds one by one” is used to find haploid embryos in the seeds. In this study, different methods were used to extract the embryos more easily, quickly, economically, and effectively. “Inspecting the seeds one by one” was used as control treatment. Other four methods tested were “sowing seeds direct nutrient media,” “inspecting seeds in the light source,” “floating seeds on liquid media,” and “floating seeds on liquid media after surface sterilization.” Y2 and Y3 melon genotypes selected from the third backcross population of Yuva were used as plant material. Results of this study show that there is no statistically significant difference among methods “inspecting the seeds one by one,” “sowing seeds direct CP nutrient media,” and “inspecting seeds in the light source,” although the average number of embryos per fruit is slightly different. No embryo production was obtained from liquid culture because of infection. When considered together with labor costs and time required for embryo rescue, the best methods were “sowing seeds directly in the CP nutrient media“ and ”inspecting seeds in the light source.”

  13. Pewarisan Karakter Fenotip Melon (Cucumis melo L. ‘Hikapel Aromatis’ Hasil Persilangan ♀ ‘Hikapel’ dengan ♂ ‘Hikadi Aromatik’

    Directory of Open Access Journals (Sweden)

    Budi Setiadi Daryono

    2018-01-01

    Full Text Available This research aims to develop cultivars with superior phenotypes of melon and high level of productivity. This research used the individual results of crossing between melon  ♀ ‘Hikapel' with ♂ 'Hikadi Aromatik'. The research included qualitative and quantitative phenotype characterization test. The research was conducted in Center of Agrotechnology Innovation University of Gadjah Mada (PIAT-UGM, Kalitirto, Berbah, Sleman, Yogyakarta and Laboratory of Genetics Faculty of Biology UGM on December 2016 until March 2017. Quantitative data analysis used ANOVA testing through PKBT-STAT 2.02 software with Random Complete Block Design (RCBD method at significance level of 1% and 5%. Melon 'Hikapel Aromatik' has several advantages including oval shape, without net, without lobes, crispy texture, skin-collored yellow RHS (6A, has a 7-14 brix, has volatile aromatic compound and transposon influenced. Based on the results of recapitulation of variance, the characters of 'Hikapel Aromatik' was not uniform.

  14. Effect of bio activators’ application and manual fruit thinning on yield and quality of melon (Cucumis melo L.) grown under protected cultivation in Costa Rica

    OpenAIRE

    Alvarado-Sánchez, Tania; Monge-Pérez, José Eladio

    2015-01-01

    Se evaluó el efecto del raleo manual de frutos y de la aplicación de los bioactivadores Algamix y Engordone sobre el rendimiento y la calidad del melón amarillo var. JMX-902. No se encontraron diferencias significativas con respecto a la firmeza del fruto, concentración de sólidos solubles totales, peso del fruto, rendimiento total, peso del fruto comercializable, rendimiento comercializable, y rendimiento por planta. Se encontraron diferencias significativas entre los tratamientos para el nú...

  15. Controlling the Sex of Flowers in Different Stages of Growth and Development of Melon (Cucumis melo var. reticualus L. with Ethephon Application

    Directory of Open Access Journals (Sweden)

    K. Arabsalmani

    2013-06-01

    Full Text Available To investigate the effect of ethephon on control of male flowers in melon, a split plot experiment, with randomized complete blocks design and three replications, was conducted in Agricultural and Natural Resources Research Center of Varamin, Iran, during 2005-2006. The main factor included three levels of plant growth stage (3-leaf, 6-leaf and early reproductive stage and sub-plots included four ethephon levels (0, 100, 200 and 300 mg/L. The appearance time of female flowers, number of male and female flowers (7 and 14 days after application of ethephon, total yield and female/male flowers ratio were evaluated. Results showed that plant response to increasing concentration of ethephon depends on plant growth stage. By using the ethephon concentrations of 100, 200 and 300 mg/L, the emergence of female flowers was delayed 6, 13 and 15 days, respectively, in comparison to control. The highest yield (26430 kg/ha was obtained with spraying of 200 mg/L ethephon in trifoliate plants. In this case, the ratio of female to male flowers was highest (81.5%. A high dose of ethephon (over 200 mg/L was associated with reduced yield and ratio of female to male flowers, at all stages of plant growth, especially in reproductive growth stage. The results this research showed that the beneficial effects of ethephon application is possible only if the right time is chosen with respect to plant growth.

  16. Changes in evapotranspiration of summer and winter crops of netted melon [Cucumis melo] grown under glass in relation to meteorological and plant-related factors

    International Nuclear Information System (INIS)

    Asakura, T.

    1998-01-01

    Measurements of evapotranspiration taken in the summer and winter on netted melon crops grown under glass were taken to characterize seasonal and daily changes. The data were compared to meteorological and plant-related factors to seek some relationships. Evapotranspiration followed a sigmoid curve until one week after pollination, and then decreased gradually during fruit growth. Cumulative evapotranspirations after transplanting were about 116 kg and 60 kg, respectively, for the summer and winter crops, whereas the peak evapotranspirations were 3.O kg plant(-1) day(-1) and 1.3 kg plant(-1) day(-1). The rapid increase h the evapotranspiration during the early stage was associated with the increase in leaf area; its gradual decrease during fruit growth was associated with a decrease in the transpiration potential of leaves. Therefore, irrigation amounts should be increased with leaf development and decreased with fruit growth. The curve of solar radiation in sunny summer days peaked at noon, whereas vapor pressure deficit usually peaked in early or mid afternoon; evapotranspirations in the afternoon had higher values than had those in the morning. In winter, vapor pressure deficit was relatively high during late afternoon and early morning because of heating, whereas it was low during the remainder of the day on account of low ventilation. These fluctuations led to a weak correlation between evapotranspiration and vapor pressure deficit. Regression analyses indicated that solar radiation was a main meteorological factor affecting evapotranspiration

  17. Analytical traceability of melon (Cucumis melo var reticulatus): proximate composition, bioactive compounds, and antioxidant capacity in relation to cultivar, plant physiology state, and seasonal variability.

    Science.gov (United States)

    Maietti, Annalisa; Tedeschi, Paola; Stagno, Caterina; Bordiga, Matteo; Travaglia, Fabiano; Locatelli, Monica; Arlorio, Marco; Brandolini, Vincenzo

    2012-06-01

    Two morphologically different cultivars of Italian melons (Baggio and Giusto) were characterized considering samples harvested in different times, at the beginning (BPP) and at the end of the physiological plant production period (EPP). Proximate composition, protein, minerals, pH, phenolic content, antioxidant capacity, ascorbic acid, carotenoids, condensed tannins, and flavonoids were measured, showing a significant decrease in EPP samples (phenolics, antioxidant capacity, condensed tannins, and flavonoids); ascorbic acid decreased in Giusto cv, carotenoids in Baggio cv. Mineral content increased in either the cultivars (EPP samples). Year-to-year difference was significantly highlighted; the plant growing cycle significantly affected the chemotype. Despite these effects, the Principal Component Analysis (PCA) permitted the discrimination of Baggio from Giusto cv, and the discrimination of BPP from EPP samples as well. © 2012 Institute of Food Technologists®

  18. Oxidative stability, chemical composition and organoleptic properties of seinat (Cucumis melo var. tibish) seed oil blends with peanut oil from China.

    Science.gov (United States)

    Siddeeg, Azhari; Xia, Wenshui

    2015-12-01

    Seinat seed oil was blended with peanut oil for the enhancement of stability and chemical characteristics of the blend. The physicochemical properties (relative density, refractive index, free fatty acids, saponification value, iodine value and peroxide value) of seinat seed and peanut oil blends in ratios 95:5, 85:15, 30:70 and 50:50 proportions were evaluated, as well as oxidative stability index, deferential scanning calorimetric (DSC) characteristics and tocopherols content. Results of oil blend showed that there was no negative effect by the addition of seinat seed oil to peanut oil and also had decreased percentages of all saturated fatty acids except stearic acid, conversely, increased the levels of unsaturated fatty acids. As for the sensory evaluation, the panelist results showed that seinat seed oil blends had no significant differences (p blending of seinat seed oil with peanut oil had also increased the stability and tocopherols content. As Sudan is the first producer of seinat oil, blending of seinat seed oil with traditional oil like quality, and may decrease the consumption of other expensive edible oils.

  19. Identification of QTLs for resistance to powdery mildew and SSR markers diagnostic for powdery mildew resistance genes in melon (Cucumis melo L.).

    Science.gov (United States)

    Fukino, Nobuko; Ohara, Takayoshi; Monforte, Antonio J; Sugiyama, Mitsuhiro; Sakata, Yoshiteru; Kunihisa, Miyuki; Matsumoto, Satoru

    2008-12-01

    Powdery mildew caused by Podosphaera xanthii is an important foliar disease in melon. To find molecular markers for marker-assisted selection, we constructed a genetic linkage map of melon based on a population of 93 recombinant inbred lines derived from crosses between highly resistant AR 5 and susceptible 'Earl's Favourite (Harukei 3)'. The map spans 877 cM and consists of 167 markers, comprising 157 simple sequence repeats (SSRs), 7 sequence characterized amplified region/cleavage amplified polymorphic sequence markers and 3 phenotypic markers segregating into 20 linkage groups. Among them, 37 SSRs and 6 other markers were common to previous maps. Quantitative trait locus (QTL) analysis identified two loci for resistance to powdery mildew. The effects of these QTLs varied depending on strain and plant stage. The percentage of phenotypic variance explained for resistance to the pxA strain was similar between QTLs (R (2) = 22-28%). For resistance to pxB strain, the QTL on linkage group (LG) XII was responsible for much more of the variance (41-46%) than that on LG IIA (12-13%). The QTL on LG IIA was located between two SSR markers. Using an independent population, we demonstrated the effectiveness of these markers. This is the first report of universal and effective markers linked to a gene for powdery mildew resistance in melon.

  20. Modulation of aroma volatiles and phytochemical quality of fresh-cut melon (Cucumis melo L.) by oxygen levels, 1-methylcyclopropene and lysophosphatidylethanolameine

    OpenAIRE

    Amaro, Ana Luísa Leite Fernandes

    2012-01-01

    Current fresh-cut technologies are effective in the effort of maintaining visual quality during the fresh-cut fruit supply chain. However, studies on extended shelf life based on appearance attributes or microbial stability have neglected the understanding of the effect of processing technologies and conservation techniques in the aromatic, nutritional, and functional properties of processed fruit. Three technologies were evaluated for their effects on quality of fresh-cut melon, with emphasi...

  1. Effect of Digestate and Biochar Amendments on Photosynthesis Rate, Growth Parameters, Water Use Efficiency and Yield of Chinese Melon (Cucumis melo L. under Saline Irrigation

    Directory of Open Access Journals (Sweden)

    Mohammed M. A. Elbashier

    2018-02-01

    Full Text Available Despite the recent interest in biochar and digestate as soil amendments for improving soil quality and increasing crop production, there is inadequate knowledge of the effect of the combination of biochar and digestate, particularly under saline irrigation conditions. A pot experiment with Chinese melon was conducted in a greenhouse, biochar (5% and digestate (500 mL/pot were used with and without the recommended mineral NPK (Nitrogen, Phosphorus and Potassium fertilizer dose (120-150-150 Kg ha−1. The plants were irrigated with tap water (SL0 and 2 dS/m (SL1 NaCl solution. The growth, photosynthesis rate, water use efficiency (WUE and yield of Chinese melon were affected positively when biochar was combined with digestate amendment, particularly under saline irrigation water with and without mineral NPK fertilizer. The maximum yield under normal water was obtained by digestate (SL0: 218.87 t ha−1 and biochar amendment combined with digestate (SL1: 118.8 t ha−1 under saline water. The maximum WUE values were noticed with the biochar and digestate combination under all water treatments (SL0: 32.2 t ha−1 mm−1 and SL1: 19.6 t ha−1 mm−1. It was concluded that digestate alone was more effective than the use of biochar, particularly with normal water. The combination of biochar with digestate had a significant effect on the Chinese melon growth, photosynthesis rate, water use efficiency and yield under saline irrigation, and it can be used as an alternative fertilizer for mineral NPK fertilizer.

  2. Calidad de melón cantaloupe ( Cucumis melo cubierto con una película comestible de alginato - hpmc - parafina

    Directory of Open Access Journals (Sweden)

    Ma Concepción Reyes-Avalos

    2017-01-01

    Full Text Available Introducción : El melón es un fruto que tiene un corto periodo de almacenamiento. Una alternativa para extender este periodo es el uso de películas comestibles. En el presente estudio se evaluó el efecto de la aplicación de una película comestible de alginato de sodio - hidroxipropilmetilcelulosa - parafina (ALG - HPMC - PAR, sobre la calidad de melón Cantaloupe durante dos tipos de almacenamiento. Método : Frutos de melón Cantaloupe se cubrieron con una película comestible de alginato - hidroxipropilmetil celulosa - parafina (ALG - HPMC - PAR, y no cubiertos (CONTROL. Los melones se almacenaron por 21 días a 5ºC y 95% de humedad relativa (Hr. Cada siete días, los frutos se sometieron a análisis de índice de daños por frío, pérdida de peso, textura, y concentración de CO 2 y etileno d e la atmósfera interna del fruto. Además, para simular manejo comercial, al término de cada periodo de siete días en refrigeración, una muestra de melones era extraída del frigorífico y expuesta a condiciones ambientales de temperatura y humedad relativa ( 25ºC y 21 - 25% respectivamente durante tres días (almacenamiento combinado, y medidos los parámetros anteriormente mencionados. Resultados : La aplicación de la película comestible provocó que los frutos cubiertos tuvieran una mayor concentración de CO 2 y menor concentración de etileno en la atmósfera interna del fruto, contribuyendo a que los melones cubiertos mantuvieron su calidad por un mayor tiempo de almacenamiento, manteniéndose más firmes, con menor pérdida de peso y sufrir menor índice de daños por frío con respecto los frutos control. Discusión : Los resultados demuestran la factibilidad de la aplicación de películas comestibles para mantener la calidad del melón Cantaloupe almacenado en refrigeración y en almacenamiento combinado.

  3. Storage and irradiation of Cucumis pollen and their influence on pollen vitality

    International Nuclear Information System (INIS)

    Oost, E.H.; Nijs, A.P.M. den

    1979-01-01

    In connection with an interspecific hybridization programme and a mentor pollen experiment in Cucumis, the optimal storage conditions and in vitro germination medium for both fresh and irradiated pollen of the cultivated cucumber and two wild African Cucumis species have been searched for. (Auth.)

  4. Last instar larva of Microstigmus nigrophthalmus Melo (Hymenoptera, Crabronidae, Pemphredoninae, with notes on biology

    Directory of Open Access Journals (Sweden)

    Sandor Christiano Buys

    2002-09-01

    Full Text Available The last instar larva of Microstigmus nigrophthalmus Melo, 1992 is described. It markedly differs from that of M. comes Krombein, 1967 the only other species in the genus whose mature larva have been described, for features as follows: presence of spinnerets; setae on the labrum, maxillae and labium; mandibles with tridentate apex and a bidentate lateral projection; lack of the conical supranal processo Notes on habitat, structure, and content of nests are also presented.

  5. O "desenho de arquiteto" de João Cabral de Melo Neto

    Directory of Open Access Journals (Sweden)

    Rafaela Cardeal

    2015-12-01

    Full Text Available Tomando como ponto de partida a metáfora “desenho de arquiteto”, este ensaio aborda os aspectos arquitetônicos da poesia de João Cabral de Melo Neto. Para tal, propõe uma leitura retrospectiva da obra até o livro A educação pela pedra (1966, considerado pela crítica o mais arquitetônico da produção cabralina.

  6. Ancient Greek Legend in Modern Japanese Literature: “Run, Melos!” by Dazai Osamu

    Directory of Open Access Journals (Sweden)

    Lija GANTAR

    2017-12-01

    Full Text Available Dazai Osamu (1909-1948, a modern Japanese writer, wrote “Run, Melos!” in 1940. The short story is a rework of an Ancient Greek legend of Damon and Pythias from the 4th century B.C., which was introduced to Dazai through Schiller’s version of the legend, “The Hostage”. The legend, based on a true event, represents the perfect friendship and was reworked a number of times by different antique writers. After having been forgotten for a while, it reappeared in the Middle Ages as a fictional story and has gotten many new adaptations from then on. One of them was Schiller’s ballad in 1798, which – alongside an anecdote from Dazai’s own life – represented the basis for Dazai’s story. Even though “Run, Melos!” is not an autobiographical work, Dazai managed to pass his own feelings onto the characters, add some biblical elements, and included a never-before-employed dark twist in the story, thus making his version more realistic than the preceding ones. Despite the distance in time and place between him and the legend, with “Run, Melos!”, Dazai managed to retell a Western literature story, making it a part of the Japanese literature as well, adding motifs and themes influenced by his own life, time, and place.

  7. Sterilization of DACUS CUCUMIS FRENCH (DIPTERA: TEPHRITDAE) by gamma radiation

    International Nuclear Information System (INIS)

    Hooper, G.H.S.

    1976-01-01

    When newly emerged adult Dacus cucumis French were irradiated in nitrogen, following a 15 min exposure to an atmosphere of pure nitrogen, the degree of sterility induced by a given dose was less than that obtained with the same dose in air. To achieve sterility in males of approximately 98 per cent doses of 7 krad in air and 13 krad in nitrogen were required. With females, total sterility through infecundity was achieved by 6 krad in air and 13 krad in nitrogen. Based on the hatch of eggs from competitive mating tests, males receiving 14 krad in nitrogen were significantly more competitive than males given 9 krad in air. The optimal light intensity for mating of D. cucumis under artificial conditions was 16.2, 1x. With this light intensity the mating propensity of males irradiated with 9 and 11 krad in air was significantly less than that of untreated males. The mating propensity of males given 14 krad in nitrogen approximated that of untreated males. (author)

  8. Efeito do tipo de corte nas características físico-químicas e microbiológicas do melão 'cantaloupe' (Cucumis melo L. Híbrido hy-Mark minimamente processado Effect of type of cutting on the physical chemical and microbiological characteristics of 'Cantaloupe' melon (Cucumis melo L. Hybrid hy-Mark minimally processed

    Directory of Open Access Journals (Sweden)

    Ariane Cordeiro de Oliveira

    2007-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito de dois tipos de cortes (manual e mecânico nas características físico-químicas e microbiológicas do melão 'Cantaloupe' minimamente processado e refrigerado. Frutos com grau de maturação adequado foram selecionados, lavados, sanificados (200 ppm de cloro ativo/2 minutos e processados de acordo com o tipo de corte. Os frutos utilizados para o corte mecânico foram descascados em máquina descascadora e após a retirada das sementes, submetidos ao corte com auxílio de máquina de corte. Os destinados ao corte manual foram descascados e cortados com auxílio facas, colocados em imersão em solução de hipoclorito de sódio (20 ppm de cloro ativo por 30 segundos e acondicionados em embalagens flexíveis PET, armazenados a 4°C ± 1°C e avaliados a cada três dias por um período de 15 dias. Ao final dos experimentos, concluiu-se que para o processamento mínimo de melão 'Cantaloupe', o corte manual foi o mais indicado, por apresentar melhor estabilidade das características de cor, textura, pH, umidade e contagens microbiológicas durante o armazenamento.The purpose of this work was to evaluate the effect of two types of cutting (manual and mechanic on the physical-chemical and microbiological characteristics of processed and refrigerated 'Cantaloupe' melon. The fruits in the appropriate stage of ripening were selected, washed, sanitized (200ppm of active chlorine/2 minutes and processed in agreement with types of cutting. The fruits used for the mechanical cutting were cutting in peeling machine and after at retreat of the seeds, submitted to the cutting with aid of cutting machine. The fruits destined at manual cutting were peeled and cut with aid of knives, immerged in chlorinated water (20 mg.L-1 of active chlorine for 30 seconds and conditioned in PET flexible packing, stored at 4°C ± 1°C and were carried out each three days during 15 days. At the end of the experiments it was concluded that for the minimally processed of 'Cantaloupe' melon, the manually cutting was the more indicated method, since it presented the best stability of characteristics concerning to color, firmness, pH, moisture and microbiological counting during storage.

  9. Phosphate-solubilizing fungi isolated from a semiarid area cultivated with melon (Cucumis melo L. cv. gold mine Fungos solubilizadores de fosfato isolados de área semiárida cultivada com melão (Cucumis melo L. cv. gold mine

    Directory of Open Access Journals (Sweden)

    Flavia Paiva Coutinho

    2011-12-01

    Full Text Available Considering that little is known about the occurrence of phosphate-solubilizing fungi from areas cultivated with melon, the phosphate solubilization ability of filamentous fungi isolated in these areas was evaluated. Three hundred and eighteen filamentous fungal isolates belonging to 23 genera were evaluated, besides Aphyllophorales and Mycelia sterilia. From those, 52 were able to solubilize P: Aphyllophorales (2, Aspergillus (34, Penicillium (10 and Rhizopus (6. These results will contribute to subsidizing further research regarding the capacity of these fungi to solubilize other sources of phosphate applied to the melon crop, as well as indicate the need for a screening program to select those with higher capacity and potential for solubilization.Considerando que pouco se conhece sobre a ocorrência de fungos solubilizadores de fosfato de áreas cultivadas com melão, foi avaliada a habilidade de solubilização desse nutriente por fungos filamentosos isolados dessas áreas. Foram avaliadas 318 amostras de fungos filamentosos pertencentes a 23 gêneros, além de Aphyllophorales e Mycelia sterilia. Dessas amostras, 52 apresentaram habilidade para solubilizar o fosfato: Aphyllophorales (2, Aspergillus (34, Penicillium (10 e Rhizopus (6. Esses resultados contribuem para subsidiar pesquisas que testem a capacidade desses fungos em solubilizar outras fontes fosfatadas aplicadas na cultura do melão, assim como indicam a necessidade de selecionar isolados com maior capacidade e potencial para solubilização.

  10. GRUPO OPERATIVO FAMILIAR NA EQUOTERAPIA

    OpenAIRE

    Taborda, Cristina; da Costa, Greice Quelle; Monteiro, Mariliane Adriana

    2011-01-01

    Este trabalho versa sobre atividades terapêuticas no contexto do grupo operativo familiar realizado no Centro Missioneiro de Equoterapia Santo Ângelo Custódio, no período de 2009 a 2010, totalizando 40 sessões com 64 participantes. Apresentamos questões acerca do grupo operativo que tem como finalidade a psicoterapia focal, por meio de textos, brincadeiras, dinâmicas, cujos temas são planejados e sistematizados atendendo as necessidades dos pais e/ou cuidadores. A Equoterapia é um método tera...

  11. Cucumber (Cucumis sativus L.) and kabocha squash (Cucurbita moschata Duch).

    Science.gov (United States)

    Nanasato, Yoshihiko; Tabei, Yutaka

    2015-01-01

    We established improved methods for Agrobacterium-mediated transformation of cucumber (Cucumis sativus L.) and kabocha squash (Cucurbita moschata Duch). Vacuum infiltration of cotyledonary explants with Agrobacterium suspension enhanced the Agrobacterium infection efficiency in the proximal regions of explants. Wounding treatment was also essential for kabocha squash. Cocultivation on filter paper wicks suppressed necrosis of explants, keeping regeneration efficacy. Putative transgenic plants were screened by kanamycin resistance and green fluorescent protein (GFP) fluorescence. These putative transgenic plants grew normally and T1 seeds were obtained, and stable integration and transmission of the transgene in T1 generations were confirmed by Southern hybridization and PCR. The average transgenic efficiency for cucumber and kabocha squash was 11.9 ± 3.5 and 9.2 ± 2.9 %, respectively.

  12. Arsenic speciation in xylem sap of cucumber (Cucumis sativus L.)

    Energy Technology Data Exchange (ETDEWEB)

    Mihucz, Victor G. [Joint Research Group of Environmental Chemistry of the Hungarian Academy of Sciences and L. Eoetvoes University, Budapest (Hungary); Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); Tatar, Eniko [Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary); Virag, Istvan [L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary); Cseh, Edit; Fodor, Ferenc [L. Eoetvoes University, Department of Plant Physiology, Budapest (Hungary); Zaray, Gyula [Joint Research Group of Environmental Chemistry of the Hungarian Academy of Sciences and L. Eoetvoes University, Budapest (Hungary); Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary)

    2005-10-01

    Flow injection analysis (FIA) and high-performance liquid chromatography double-focusing sector field inductively coupled plasma mass spectrometry (HPLC-DF-ICP-MS) were used for total arsenic determination and arsenic speciation of xylem sap of cucumber plants (Cucumis sativus L.) grown in hydroponics containing 2 {mu}mol dm{sup -3} arsenate or arsenite, respectively. Arsenite [As(III)], arsenate [As(V)] and dimethylarsinic acid (DMA) were identified in the sap of the plants. Arsenite was the predominant arsenic species in the xylem saps regardless of the type of arsenic treatment, and the following concentration order was determined: As(III) > As(V) > DMA. The amount of total As, calculated taking into consideration the mass of xylem sap collected, was almost equal for both treatments. Arsenite was taken up more easily by cucumber than arsenate. Partial oxidation of arsenite to arsenate (<10% in 48 h) was observed in the case of arsenite-containing nutrient solutions, which may explain the detection of arsenate in the saps of plants treated with arsenite. (orig.)

  13. grupos virtuales de aprendizaje colaborativo

    Directory of Open Access Journals (Sweden)

    Ángel Torres Velandia

    2002-01-01

    Full Text Available Diversas experiencias de educación superior, virtual y a distancia, en las que hemos participado demuestran que la revolución tecnológica, en el contexto de la sociedad de la información, propicia cambios comunicacionales y educativos que favorecen la preparación profesional de cientos de jóvenes y adultos que, de otra manera, difícilmente llegarían a desarrollar autonomía e iniciativa propias para emprender y autodirigir procesos de aprendizaje personales, así como para trabajar en entornos virtuales colaborativos, mediante el uso racional y crítico de una variedad de herramientas y recursos técnicos y pedagógicos. Por lo que pretendemos: a analizar la naturaleza y aspectos básicos de las comunidades virtuales de aprendizaje (CVA y los grupos virtuales de aprendizaje colaborativo (GVAC, y b registrar los avances y las limitaciones de tres proyectos de investigación y desarrollo de la UAM-Xochimilco: 1 Red electrónica de la UAM para la formación virtual de tutores e investigadores de los sistemas de educación superior a distancia (SESAD. 2 Formación de docentes-tutores para la enseñanza y el aprendizaje en ambientes presenciales, virtuales y a distancia. 3 La experiencia de interacción y cooperación de dos tipos diferentes de grupos de aprendizaje: los del sistema modular de la UAM-Xochimilco y los de la Universitat Oberta de Catalunya, UOC.

  14. Asynchronous meiosis in Cucumis hystrix-cucumber synthetic tetraploids resulting in low male fertility

    Science.gov (United States)

    Wide hybridization is an important tool for crop improvement. Recently, we successfully developed a synthetic allotetraploid from interspecific cross between cucumber and its relative Cucumis hystrix-(2n = 2x =24) followed by chemical induction of chromosome doubling. The resulting allotetraploid wa...

  15. Cucumber (Cucumis sativus L.) seed performance as influenced by ovary and ovule position

    NARCIS (Netherlands)

    Jing, H.C.; Jalink, H.; Bergervoet, J.W.; Klooster, M.; Du, S.L.; Bino, R.J.; Hilhorst, H.W.M.; Groot, S.P.C.

    2000-01-01

    The performance of cucumber (Cucumis sativus L.) seeds in relation to ovary and ovule position was monitored during seed production. Seeds from three (first, seventh and tenth nodes) fruit positions and three (stylar, intermediate and peduncular) ovule positions were harvested serially during

  16. Infraspecific variation of C-banded karyotype and chiasma frequency in Cucumis sativus (Cucurbitaceae)

    NARCIS (Netherlands)

    Ramachandran, C.; Brandenburg, W.A.; Nijs, de S.A.P.M.

    1985-01-01

    Infraspecific cytogenetical variation was studied in a diverse collection of five non-cultivated and cultivatedCucumis sativus accessions. The individual chromosomes of different accessions could be identified by the C-banding pattern and chromosome measurements. About 40–50% of the genomic area are

  17. Multispectral fluorescence imaging technique for discrimination of cucumber (Cucumis Sativus) seed viability

    Science.gov (United States)

    In this study, we developed a nondestructive method for discriminating viable cucumber (Cucumis sativus) seeds based on hyperspectral fluorescence imaging. The fluorescence spectra of cucumber seeds in the 420–700 nm range were extracted from hyperspectral fluorescence images obtained using 365 nm u...

  18. The Effect of Different Cucurbit Rootstocks on Some Morphological and Physiological Traits of Cucumber (Cucumis sativus cv. Super Dominus

    Directory of Open Access Journals (Sweden)

    reihane Mesgari

    2017-02-01

    Full Text Available Introduction: Cucumber is one of the most important vegetable crops for the local consumption and exportation. The use of grafted vegetable seedlings has been popular in many countries during recent years. Growing fruit-bearing vegetables, chiefly tomato, cucumber and watermelon through grafted seedlings become a widespread practice worldwide. Grafting is a valuable technique to avoid soil-borne diseases, provide biotic and abiotic stress tolerance, enhance nutrient uptake, optimize water use, and increase fruit yield and quality. Vegetable grafting is a new topic in Iran and there are a limited number of studies on grafted vegetable production. However, attention to grafting by researchers has recently increased. Suitable rootstocks should be identified and characterized for the effective utilization of grafting. The rootstock's vigorous root system increases the efficiency of water and nutrient absorption, and may also serve as a source of endogenous plant hormones, thus leading to increased growth and yield in addition to disease control. In the present study, we investigated the response of two Cucurbita sp. and an Iranian melon as rootstocks for cucumber. Materials and methods: In order to study the effect of cucurbit rootstocks and grafting method on growth, yield and fruit quality of cucumber (Cucumis sativus cv. Super Dominus, an experiment was conducted as a factorial design in the base of RCBD with three replications in the greenhouse and research farm, University of Zanjan. Treatments were included three rootstocks (Cucurbita moschata L., Lagenaria siceraria and Cucumis melo L. and ungrafted plants (control and two grafting method (hole insertion and splice grafting. Seeds were sown simultaneously in plastic pots. For obtaining the same stem diameter of scion and rootstocks, cucumber seeds were planted four days earlier than rootstocks seeds. The seedlings were grown in an environment-controlled greenhouse with 25/20 day

  19. Descripción de una especie nueva de Meloe Linnaeus, 1758 del subgénero Eurymeloe Reitter, 1911 (Coleoptera, Meloidae del norte de Marruecos

    Directory of Open Access Journals (Sweden)

    García-París, M.

    2009-12-01

    Full Text Available We describe a new species of Meloe (Coleoptera: Meloidae, subgenus Eurymeloe, included in the M. rugosus species group, related to species of the M. murinus subgroup. The specimens of the new species studied were found along the western Rif mountain chain (Talassemtane National Park in northwestern Morocco, and were located in hiperhumid montane forest habitats. The new species is characterized by having: a dull black coloration with greyish hue; a very short, curved, and not dense, yellow-whitish pilosity, which does not form tufts; a subrectangular transverse pronotum with a marked median grove and two longitudinal lateral depressions; head and pronotum punctures well impressed and subconfluent; elytra sligtly rugose; tarsomeres with slightly developed ventral pads; aedeagus with curved parameres, laterally depressed, apically pointed, with the distal ventral hook of median lobe close to apex. The new taxon es phenetically similar to M. nanus, M. baudueri and M. flavicomus, but distinguished from all of them by the mentioned morphological external and male genitalia characters. The distribution of the new species, only known from its type locality, overlaps those of M. murinus, M. nanus and possibly M. baudueri, but so far it has not been found in strict sympatry with any of them. The habitat type inhabited by the new species, mountain areas with mixed forests of Pinus pinaster hamiltonii var. maghrebiana, P. nigra mauritanica and Abies maroccana (endemic taxa of the limestone northwestern Rif mountain chain, contrasts with other habitat types recorded for species of the M. (E. murinus species subgroup of the subgenus Eurymeloe.Se describe una especie nueva de Meloe (Coleoptera: Meloidae del subgénero Eurymeloe, del grupo de M. rugosus, relacionada con especies del subgrupo de M. murinus. Los ejemplares estudiados de la especie nueva proceden del Rif occidental (Parque Nacional de Talassemtane, dorsal caliza rifeña, en el noroeste de

  20. Screening of Furanone in Cucurbita melo and Evaluation of its Bioactive Potential Using In Silico Studies.

    Science.gov (United States)

    Singh, Nidhi; Sudandiradoss, C; Abraham, Jayanthi

    2016-12-01

    The work presented here attempts to screen for the presence of 4-Hydroxy-2,5-dimethyl-3(2H)-furanone in fruits and also any bioactive potential present in the fruit extracts. Curcurbita melo was selected for the study, and the fruit was crushed, filtered and extracted with ethyl acetate as the solvent. The resulting extract was subjected to disk diffusion test using Kirby Bauer method for checking its antimicrobial potential. Melon extract showed promising results against different clinical pathogens, 19-mm zone being the largest against Klebsiella pneumoniae and 17 mm against Shigella dysenteriae. GC-MS data of the melon extract confirmed the existence of furanone derivative in the extract. To evaluate the antimicrobial activity, in silico studies were performed using AutoDock 4.0 software, and topoisomerase was used as the target protein molecule for the isolated compound and 3-methyl-2-(2-oxopropyl)furan as the ligand. Further, the results were interpreted using PyMol and Ligplot plus softwares. The results confirmed the presence of molecular interactions between the protein molecule and the ligand. It can be envisaged that these interactions are responsible for the inhibitory effects of the extract .

  1. O Sol Laranja e Negro de João Cabral de Melo Neto

    Directory of Open Access Journals (Sweden)

    Luciana Tiscoski

    2011-12-01

    Full Text Available O poeta pernambucano João Cabral de Melo Neto publica Sevilha andando em 1990, já aposentado da carreira diplomática que lhe possibilitou o contato com a cidade e o povo sevilhano, desde 1956, quando trabalha em pesquisas históricas no Arquivo das Índias de Sevilha. Após ter morado em cidades como Londres, Marselha e Barcelona, é transferido para a andaluza Cadiz, e novamente reside em Sevilha em 1962. Tendo ainda passado no decorrer de sua carreira diplomática por Berna, Senegal e Honduras, é a Andaluzia que se estabelece como lugar da linguagem poética e concreta, eleita Sevilha a cidade onde os elementos de sua poesia se realizam em lâmina, pedra, o sol laranja e negro, a mulher que anda. Sevilha andando e Andando Sevilha finalizam sua produção poética e reproduzem em serena e bruta semelhança o homem da terra que lhe remete ao sertanejo, a Pernambuco, a Recife.

  2. Chemical signature of two Permian volcanic ash deposits within a bentonite bed from Melo, Uruguay

    Directory of Open Access Journals (Sweden)

    Liane M. Calarge

    2006-09-01

    Full Text Available A Permian bentonite deposit at Melo, Uruguay is composed of a calcite-cemented sandstone containing clay pseudomorphs of glass shards (0-0.50 m overlying a pink massive clay deposit (0.50-2.10m. The massive bed is composed of two layers containing quartz and smectite or pure smectite respectively. The smectite is remarkably homogeneous throughout the profile: it is a complex mixed layer composed of three layer types whose expandability with ethylene glycol (2EG 1EG or 0EG sheets in the interlayer zone which correspond to low-, medium- and high-charge layers respectively varies with the cation saturating the interlayer zone. The smectite homogeneity through the profile is the signature of an early alteration process in a lagoonal water which was over saturated with respect to calcite. Compaction during burial has made the bentonite bed a K-depleted closed system in which diagenetic illitization was inhibited. Variations in major, REE and minor element abundances throughout the massive clay deposit suggest that it originated from two successive ash falls. The incompatible element abundances are consistent with that of a volcanic glass fractionated from a rhyolite magma formed in a subduction/collision geological context.Um depósito Permiano de bentonita em Melo, Uruguai,é composto por um arenito com cimento calcítico contendo pseudomorfos de argila sobre detritos vítreos(0-0.50 m superpostos a um deposito maciço de argila rosado (0.50-2.10 m. A camada maciça é composta por dois níveis contendo quartzo e esmectita ou esmectita pura, respectivamente. A homogeneidade de esmectita ao longo do perfil é notável: trata-se de um interestratificado composto de três tipos de camadas, cuja expansibilidade com etileno-glicol (folhas 2EG, 1EG ou 0EG na zona interfoliar correspondentes a camadas com baixa, média e alta carga, respectivamente variam com o tipo de cátion que satura a zona interfoliar. A homogeneidade da esmectita ao longo do perfil

  3. Marcas da violência e jogos do poder no romance urbano de Patrícia Melo

    Directory of Open Access Journals (Sweden)

    Cláudia Castanheira

    2010-01-01

    Full Text Available This work analyzes the romance O Matador (The Killer by Patrícia Melo. Its thematic universe and discursive strategies break not only with the prospects of the more contemporary feminist literary criticism, but also with the bourgeois ideological system, more broadly. The object is to highlight how the use of the male voice and masculine cultural experiences, taken to its ultimate consequences, may be converted into a subliminal criticism regarding the ways of how the discriminating speeches are built, through sexual, economic and social criteria in our society.

  4. Efecto de la aplicación de bioactivadores y del raleo manual de frutos sobre el rendimiento y la calidad de melón (Cucumis melo L. bajo cultivo protegido en Costa Rica

    Directory of Open Access Journals (Sweden)

    Tania Alvarado-Sánchez

    2015-12-01

    Full Text Available Se evaluó el efecto del raleo manual de frutos y de la aplicación de los bioactivadores Algamix y Engordone sobre el rendimiento y la calidad del melón amarillo var. JMX-902. No se encontraron diferencias significativas con respecto a la firmeza del fruto, concentración de sólidos solubles totales, peso del fruto, rendimiento total, peso del fruto comercializable, rendimiento comercializable, y rendimiento por planta. Se encontraron diferencias significativas entre los tratamientos para el número de frutos por planta; las plantas tratadas con solo Engordone y solo Algamix presentaron mayor número de frutos por planta con respecto a otros tratamientos, pero estos resultados no fueron distintos de los del Testigo. Se encontraron diferencias significativas al distribuir la producción según distintas categorías de peso; el rendimiento de frutos de melón con un peso de entre 601-800 gramos fue superior en plantas tratadas con solo Algamix respecto a los demás tratamientos; el rendimiento de frutos de melón con un peso de entre 801-1000 gramos fue superior en plantas tratadas con solo Engordone respecto a los demás tratamientos.

  5. Efecto de la aplicación de bioactivadores y del raleo manual de frutos sobre el rendimiento y la calidad de melón (Cucumis melo L .) bajo cultivo protegido en Costa Rica

    OpenAIRE

    Alvarado-Sánchez, Tania; Monge-Pérez, José Eladio

    2015-01-01

    ResumenSe evaluó el efecto del raleo manual de frutos y de la aplicación de los bioactivadores Algamix y Engordone sobreel rendimiento y la calidad del melón amarillo var. JMX-902. No se encontraron diferencias significativas con respecto a la firmeza del fruto, concentración de sólidos solubles totales, peso del fruto, rendimiento total, peso del fruto comercializable, rendimiento comercializable, y rendimiento por planta. Se encontraron diferencias significativas entre los tratamientos para...

  6. Identificação de marcadores moleculares ligados a gene de resistência ao vírus do mosaico (PRSV-W) em melão (Cucumis melo L.).

    OpenAIRE

    Ana Paula Matoso Teixeira

    2004-01-01

    A importância da cultura do meloeiro é crescente no Brasil, sobretudo na região Nordeste, tanto pelo volume comercializado como por ser estabelecida geralmente em pequenas propriedades. Diversas enfermidades acometem esta cultura, destacando-se as viroses. Dentre estas, o mosaico, causado pelo Papaya ringspot virus - estirpe melancia (PRSV-W) é das mais importantes. Dentre as estratégias de controle desta doença, o emprego de cultivares resistentes apresenta-se como um método prático e ...

  7. DOBRAS ESTRUTURAIS: RUPTURA GENERATIVA EM GRUPOS SOBREPOSTOS

    Directory of Open Access Journals (Sweden)

    David Stark

    2010-04-01

    Full Text Available Os grupos empresariais enfrentam um desafio duplo: reconhecer e implementar novas ideias. O presente artigo sugere que oempreendedorismo está mais relacionado com a geração de novos conhecimentos, por meio da recombinação de recursos, doque com a importação de ideias. Em contraste com a perspectiva “intermediação mais fechamento”, enfocamos a sobreposiçãode estruturas coesas de grupos. Ao analisar processos de intercoesão de redes, identificamos uma topologia de rede distinta:a dobra estrutural. Os atores de uma dobra estrutural são membros de múltiplos grupos, o que facilita o acesso familiar a diversosrecursos. Nosso conjunto de dados permite observar laços pessoais entre as 1.696 maiores empresas húngaras de 1987a 2001. Primeiro, testamos se dobras estruturais contribuem para o desempenho de grupos. Segundo, como o empreendedorismoé um processo de ruptura generativa, testamos a contribuição das dobras estruturais para a instabilidade do grupo.Terceiro, passamos de métodos dinâmicos à análise histórica de redes, e demonstramos que a coerência é uma propriedadede genealogias entrelaçadas de coesão, construídas por meio de repetidas separações e reunificações.

  8. Protein (Viridiplantae): 832567 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available NYNSMNASIEIKQQESCQTNINHESCMFSKCMGGMQRFAIPPLPSFEVEQLNVVQGSRHCLSPHFQNSLVTFISYQKEKES... ... 1003877:124 ... 3655:124 ... 3656:1142 ... PREDICTED: transcription factor bHLH143-like Cucumis melo MVGTDTWQLH

  9. Protein (Viridiplantae): 128519 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 9:7 3650:7 ... 1003877:7 ... 3655:7 ... 3656:1095 ... PREDICTED: pectinesterase inhibitor-like Cucumis melo MANNSCLV...IVSLIGVLLFTIILNVASSNYVISTICSKSSNPPFCSSVLKSSGTTYLKGLAVYTLNLAHTNASKSLTLARSLATTTTNPQ

  10. Grupo de Nutrición Animal

    OpenAIRE

    Grupo de Nutrición Animal

    2000-01-01

    El grupo de Nutrición Animal nace hace dos años de la iniciativa de un estudiante de participar en los proyectos de investigación que se realizaban en el Laboratorio de Nutrición Animal. Desde ese momento el grupo de nutrición bajo la dirección de Juan Carulla y Martha Pabón les ha dado cabida a los estudiantes de pregrado que se muestran interesados en la investigación y en la participación en proyectos relacionados con la nutrición de rumiantes, especialmente c...

  11. Acerca del trabajo en grupos o equipos

    OpenAIRE

    Gómez Mujica, Aleida; Acosta Rodríguez, Heriberto

    2003-01-01

    Se definen, caracterizan y comparan los grupos y equipos de trabajo. Se señalan las características y funciones que convierten gradual y paulatinamente un grupo en un equipo de trabajo. Se señalan las ventajas y desventajas de cada uno de ellos, tanto para los individuos como para las organizaciones. Se analizan algunas variables estructurales, las normas para la formación de los equipos, las características esenciales y las funciones que desempeñan sus miembros. Se anexa una lista con las ca...

  12. Cytoprotection mediated antiulcer effect of aqueous fruit pulp extract of Cucumis sativus

    Directory of Open Access Journals (Sweden)

    Swapnil Sharma

    2012-05-01

    Full Text Available Objective: The study was aimed to evaluate the gastroprotective potential of Cucumis Sativus fruit pulp aqueous extract (CSE in gastric ulcerated rats. Methods: Cytoprotective potential was evaluated via oral administration of CSE at the doses of 250, 500 &1000 mg/kg three times in a day, for 5 days before the induction of ulcers in indomethacin and pyloric ligation induced ulcer model. Further, its effects were studied on various parameters volume of gastric juice, pH, free and total acidity, protein concentration, acid output in gastric juice, lipid peroxide (LPO, and activities of enzymic antioxidants-super oxide dismutase (SOD and catalase (CAT in gastric mucosa. The levels of hexose, hexosamine, sialic acid, fucose in gastric mucosa and gastric juice were also examined. The extent of healing was also determined with post administration of CSE at the same doses & dosage schedule in acetic acid induced model. Results: In indomethacin and pyloric ligation model, the pretreatment with CSE and ranitidine significantly reduced the lesion index, in comparison with control treated group (P< 0.05. The percentages of protection of ulcers were 25.8, 65.7, 80.6 & 93.8 for the treated groups of CSE and ranitidine whereas in pyloric ligation it was 31.26, 55.18, 93.26 & 95.51 respectively. In pyloric ligation model, CSE resulted in significant increase in pH, enzymic antioxidants i.e. SOD & CAT, with a significant decrease in volume of gastric juice, free and total acidity, protein & carbohydrate concentration and LPO levels. In acetic acid inducer model, treatment with Cucumis sativus (CSE caused significant reduction in lesion index in when compared to control treated group, providing evidence for ulcer healing capacity of it. The presence of the flavonoids and polyphenols may be responsible for the gastroprotective effect of CSE. Conclusions: The aqueous fruit pulp extract of Cucumis sativus (CSE has a gastroprotective property.

  13. En Otras Palabras... (Grupo Mujer Y Sociedad)

    OpenAIRE

    Herminia Gonzálvez Torralbo

    2006-01-01

    En otras palabras.... nace en Colombia en 1996 como una publicación especializada editada por el Grupo Mujer y Sociedad, Escuela de Estudios de Género de la Universidad Nacional de Colombia y la Corporación Casa de la Mujer de Bogotá.

  14. Sterilization of DACUS CUCUMIS FRENCH (DIPTERA:TEPHRITIDAE) by gamma radiation

    International Nuclear Information System (INIS)

    Hooper, G.H.S.

    1975-01-01

    The effect of gamma radiation administered to newly emerged adults of Dacus cucumis French on sterility and competitiveness was evaluated. A dose of 11 krad caused almost complete sterility in males while females given 6 krad were totally sterile, through infecundity. Sterilized males showed reduced competitiveness. In competitive mating tests a dose of 7 krad gave the lowest egg hatch and this hatch was significantly lower than that given by 9 and 11 krad. In a paired comparison mating test, 7 and 9 krad treated males mated significantly less frequently than untreated males, but the ability of 6 krad treated males was unimpared. (author)

  15. Purification and MIC analysis of antimicrobial proteins from Cucumis sativus L. seeds.

    Science.gov (United States)

    Al Akeel, Raid; Mateen, Ayesha; Alharbi, Khalid K; Alyousef, Abdullah A; Al-Mandeel, Hazem M; Syed, Rabbani

    2018-04-03

    Cucumis sativus L. (cucumber), from the family Cucurbitaceae, is a therapeutic plant with various pharmacological benefits, broadly utilized as a part of complementary medicine (e.g., Unani, Ayurveda, Siddha, and Traditional Chinese). In light of past research discoveries, this plant had been chosen to consider its potential antibacterial action. Extracts were purified by dialysis and ion exchange chromatography strategy and then assayed for antibacterial activity against four standard pathogenic bacterial strains known to cause foodborne infections and spoilage of food and herbal drugs. Antimicrobial peptides were extracted from seeds using a sodium phosphate citrate (pH 7.2) - CTAB cradle (pH 6.0). The highest protein concentration was seen with elute fractions 1 and 3 (370 mg/mL) compared with elute fractions 2 and 4 (340 mg/mL). Among the bacteria utilized, E. coli was clearly the most sensitive out of selected four strains. Our results suggest that Cucumis sativus L seeds extracts have significant potentials as new antimicrobial agents.

  16. Use of molecular markers aids in the development of diverse inbred backcross lines in Beit Alpha cucumber (Cucumis sativus L.)

    Science.gov (United States)

    Beit Alpha cucumber (Cucumis sativus L.) is a Mediterranean fresh-market type with a relatively narrow genetic base. To broaden its base for plant improvement, 42 diverse accessions were compared employing a previously defined standard marker array to choose wide-based parental lines for use in bac...

  17. Genome-wide characterization of microsatellites in Cucumis hystrix and in silico identification of polymorphic SSR markers

    Science.gov (United States)

    Cucumis hystrix (2n = 2x = 24, genome HH) is a wild relative of cucumber (C. sativus L., 2n = 2x = 14) that possesses multiple disease resistances and has a great potential for cucumber improvement. Despite its importance, there is no genomic resource currently available for C. hystrix. To expedite ...

  18. First report of powdery mildew on cucumis zambianus, cucurbita digitata and zehneria scabraCaused by podosphaera xanthii

    Science.gov (United States)

    Powdery mildew is a serious disease of cucurbit crops worldwide. In the fall of 2016, symptoms of powdery mildew were observed on 2-month old plants of Cucumis zambianus, Cucurbita digitata and Zehneria scabra in research plots in Charleston, SC. Incidence on 28 plants of C. zambianus was 64.3%. On ...

  19. Investigation of the Use of "Cucumis Sativus" for Remediation of Chromium from Contaminated Environmental Matrices: An Interdisciplinary Instrumental Analysis Project

    Science.gov (United States)

    Butler, Lynsey R.; Edwards, Michael R.; Farmer, Russell; Greenly, Kathryn J.; Hensler, Sherri; Jenkins, Scott E.; Joyce, J. Michael; Mann, Jason A.; Prentice, Boone M.; Puckette, Andrew E.; Shuford, Christopher M.; Porter, Sarah E. G.; Rhoten, Melissa C.

    2009-01-01

    An interdisciplinary, semester-long project is presented in which students grow Cucumis sativus (cucumber) plants from seeds and study the ability of the plants to remediate a heavy metal from contaminated soil or water or both. Phytoremediation strategies for environmental cleanup are presented as possible alternatives to chemical based clean-up…

  20. Inmunidad de grupo. Significado e importancia

    OpenAIRE

    Vaqué Rafart, Josep

    2005-01-01

    En los últimos veinte años el concepto de “inmunidad de grupo” ha adquirido gran relevancia debido a su utilidad para definir los objetivos y estrategias de los programas de vacunación, pues permite determinar la intensidad de las actuaciones a aplicar para impedir brotes epidémicos y para controlar y eliminar enfermedades infecciosas. Su definición clásica, establecida por Fox en 1971, dice: "Es la resistencia de un grupo a una infección ante la que una amplia proporción de individuos posee ...

  1. The Effect of Microwave Radiation on Prickly Paddy Melon (Cucumis myriocarpus

    Directory of Open Access Journals (Sweden)

    Graham Brodie

    2012-01-01

    Full Text Available The growing list of herbicide-resistant biotypes and environmental concerns about chemical use has prompted interest in alternative methods of managing weeds. This study explored the effect of microwave energy on paddy melon (Cucumis myriocarpus plants, fruits, and seeds. Microwave treatment killed paddy melon plants and seeds. Stem rupture due to internal steam explosions often occurred after the first few seconds of microwave treatment when a small aperture antenna was used to apply the microwave energy. The half lethal microwave energy dose for plants was 145 J/cm2; however, a dose of at least 422 J/cm2 was needed to kill seeds. This study demonstrated that a strategic burst of intense microwave energy, focused onto the stem of the plant is as effective as applying microwave energy to the whole plant, but uses much less energy.

  2. Effects of UV-B irradiation on photomovement in the desmid, Cosmarium cucumis

    International Nuclear Information System (INIS)

    Haeder, D.-P.

    1987-01-01

    Monochromatic UV-B irradiation affects neither the absorption nor the fluorescence of the bulk pigments in the desmid Cosmarium cucumis but it impairs photomovement of these organisms at fluence rates which are not higher than the ambient level of solar UV-B irradiation. Photoaccumulations and phototaxis are strongly inhibited especially at wavelengths <= 300 nm while photodispersal at higher white light fluence rates is hardly affected by supplementary UV-B. This effect has important consequences for the growth and survival of populations in their natural environment: these photosynthetic organisms utilize photomovement to find and stay in areas of suitable visible light fluence rates. The UV-B component of solar irradiation both impairs the strategy of the organisms to find a suitable position and the escape mechanism by which the cells move out of areas with too strong white illuminances which photooxidize the bulk pigments and bleach the population within a few days. (author)

  3. Assessment of Salicylic Acid Impacts on Seedling Characteristic of Cucumber (Cucumis sativus L. under Water Stress

    Directory of Open Access Journals (Sweden)

    Hossein MARDANI

    2012-02-01

    Full Text Available Impacts of various concentrations of salicylic acid (SA on cucumber (Cucumis sativus L. seedling characteristic were evaluated under different water stress levels by using a factorial arrangement based on completely randomized design with three replications at experimental greenhouse of Ferdowsi University of Mashhad, Iran. The studied factors included three water deficit levels (100% FC, 80% FC, and 60% FC considered as first factor and five levels of SA concentrations (0, 0.25, 0.5, 0.75, and 1 mM as second factor. Results showed that foliar application of SA at the highest concentration enhanced leaf area, leaf and dry weight while decreased stomatal conductance under high level of water deficit stress. Though, severe water deficit stress sharply raised the SPAD reading values. In general, exogenous SA application could develop cucumber seedling characteristic and improve water stress tolerance.

  4. COOPERACIÓN HUMANA Y SELECCIÓN DE GRUPO

    OpenAIRE

    Luis Alvaro Cadena Monroy

    2017-01-01

    Darwin pensaba que la cooperación entre los seres humanos podía ir en contra de su idea de selección natural. Para enfrentar este problema, introdujo la selección de grupos: se seleccionan grupos de seres humanos cooperadores por sobre los grupos de no cooperadores, No obstante, con el advenimiento del neodarwinismo, la selección de grupos cayó en el desprestigio. Poco a poco, y recientemente, fueron apareciendo varias propuestas para la selección de grupos. Aquí se miran algunas de estas pro...

  5. Cucurbita spp. and Cucumis sativus enhance the dissipation of polychlorinated biphenyl congeners by stimulating soil microbial community development.

    Science.gov (United States)

    Qin, Hua; Brookes, Philip C; Xu, Jianming

    2014-01-01

    A number of Cucurbita species have the potential to extract polychlorinated biphenyls (PCBs) from soil, but their impact on the soil microbial communities responsible for PCB degradation remains unclear. A greenhouse experiment was conducted to investigate the effect of three Cucurbita and one Cucumis species on PCB dissipation and soil microbial community structure. Compared to the unplanted control, enhanced losses of PCBs (19.5%-42.7%) were observed in all planted soils. Cucurbita pepo and Cucurbita moschata treatments were more efficient in PCB dissipation, and have similar patterns of soil phospholipid fatty acids (PLFAs) and PCB congener profiles. Cucurbita treatments tend to have higher soil microbial biomass than Cucumis. Gram-negative (G(-)) bacteria were significantly correlated with PCB degradation rates (R(2) = 0.719, p Cucurbita related soil microorganisms could play an important role in remediation of PCB contaminated soils. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. Grupo Escolar Solferino Colombes-Francia

    Directory of Open Access Journals (Sweden)

    Tessier, J.

    1978-11-01

    Full Text Available This school complex is divided into three different facilities, one for boys, one for girls and a kindergarten, all in a two-storey Steel structure building. The dining halls and kitchen are located in a separate building connected to the main one, the toilets and the medical department, being a part of the connecting area. The design of the entire complex is highly decorative and yet, very functional.

    Este Grupo Escolar está formado por tres escuelas destinadas, cada una de ellas, a niñas, niños y jardín de infancia. Se halla instalado en un edificio de dos plantas, realizado a base de estructura metálica. Los comedores y la cocina se han situado en un edificio anexo. En la zona de comunicación entre los dos edificios se encuentran los lavabos y el departamento médico. Todo el conjunto se ha desarrollado de una manera muy decorativa y, a la vez, cómoda.

  7. The preface by João Cabral de Melo Neto to Em Va Fer Joan Brossa: Theory and practice of realism in two poets from the post-war.

    Directory of Open Access Journals (Sweden)

    Melcion Mateu

    2009-12-01

    Full Text Available In 1951, the book Em va fer Joan Brossa [Joan Brossa  Made me] was published in Barcelona, with a preface by João Cabral de Melo Neto. It is a useful text to better understand Brossa as well as Cabral; it is a significant text in order to grasp the individual response of these poets to the problem of returning to realism for the early post-war period. A translation of João Cabral de Melo Neto's preface, previously unpublished in Portuguese, is presented here.

  8. Raman Imaging of Plant Cell Walls in Sections of Cucumis sativus.

    Science.gov (United States)

    Zeise, Ingrid; Heiner, Zsuzsanna; Holz, Sabine; Joester, Maike; Büttner, Carmen; Kneipp, Janina

    2018-01-25

    Raman microspectra combine information on chemical composition of plant tissues with spatial information. The contributions from the building blocks of the cell walls in the Raman spectra of plant tissues can vary in the microscopic sub-structures of the tissue. Here, we discuss the analysis of 55 Raman maps of root, stem, and leaf tissues of Cucumis sativus , using different spectral contributions from cellulose and lignin in both univariate and multivariate imaging methods. Imaging based on hierarchical cluster analysis (HCA) and principal component analysis (PCA) indicates different substructures in the xylem cell walls of the different tissues. Using specific signals from the cell wall spectra, analysis of the whole set of different tissue sections based on the Raman images reveals differences in xylem tissue morphology. Due to the specifics of excitation of the Raman spectra in the visible wavelength range (532 nm), which is, e.g., in resonance with carotenoid species, effects of photobleaching and the possibility of exploiting depletion difference spectra for molecular characterization in Raman imaging of plants are discussed. The reported results provide both, specific information on the molecular composition of cucumber tissue Raman spectra, and general directions for future imaging studies in plant tissues.

  9. Somatic embryogenesis and plant regeneration from cell suspension cultures of Cucumis sativus L.

    Science.gov (United States)

    Chee, P P; Tricoli, D M

    1988-06-01

    A procedure for the regeneration of whole cucumber plants (Cucumis sativus L. cv. Poinsett 76) by embryogenesis from cell suspension cultures is described. Embryogenic callus was initiated from the primary leaves of 14-17 day old plants. Suspension cultures of embryogenic cells were grown in liquid Murashige and Skoog basal medium containing 5 uM 2,4,5-trichlorophenoxyacetic acid and 4 uM 6-benzylaminopurine. Suspension cultures were composed of a population of cells that were densely cytoplasmic and potentially embryogenic. Differentiation of embryos was enhanced by washing the suspension culture cells with MS basal medium containing 0.5% activated charcoal and twice with MS basal medium followed by liquid shake cultures in MS basal medium. Sixty to 70 percent of the embryos prewashed with activated charcoal germinated into plantlets with normal morphology. Embryos obtained from suspension cultured cells without prewashing with activated charcoal organized into plantlets with abnormal primary leaves. Morphologically normal plantlets were obtained by excising the shoot tips and transferring them to fresh medium.

  10. INFLUENCIA DE LA DENSIDAD DE SIEMBRA Y LA PODA EN EL CULTIVO DEL PEPINO (Cucumis sativus

    Directory of Open Access Journals (Sweden)

    Paublo Javier Bravo Bravo

    2011-12-01

    Full Text Available El objetivo de la investigación fue determinar la influencia de la densidad de siembra y el número de poda de ejes en el cultivo de pepino (Cucumis sativus. Se estudiaron tres distancias de siembra 1.0x0.2, 1.0x0.4 y 1.0x 0.6 m y la poda de ejes productivos dejando 1, 2 y 3 ejes por planta. La poda se realizó a los 30 días después del trasplante. Se evaluaron las características del fruto de diámetro (cm, longitud (cm, peso (g, fruto por planta y rendimiento por hectárea. Los tratamientos se distribuyeron en un diseño de bloques al azar y los datos se analizaron mediante análisis de varianza. Se obtuvo diferencias para la variable rendimiento/hectárea con respecto al resto de las variables evaluadas.

  11. Trabalho em grupo com enlutados Trabajo en grupo con enlutados Work group with bereaved

    Directory of Open Access Journals (Sweden)

    Melissa Pascoal

    2012-12-01

    Full Text Available A cada dia temos mais famílias vivenciando o luto gerado por homicídios, acidentes e violência, e isso tem causado alguns problemas psicológicos para as pessoas que estão nesta situação. Este artigo é um relato da experiência profissional vivida no Hospital e Maternidade Mauá com um grupo de autoajuda para pacientes em processo de luto, e seu objetivo é compartilhar a experiência e difundir este trabalho. Em 15 encontros pré-estruturados de acordo com a demanda apresentada pelo próprio grupo, foi possível trabalhar diversos temas relacionados à perda que influenciaram as participantes e ao mesmo tempo proporcionaram, além de conforto, uma possibilidade de identificação e troca, e consequentemente o ressurgimento da autoconfiança. Por meio da articulação da teoria com a prática, é evidenciado que o atendimento em grupo para enlutados é uma alternativa viável que trouxe resultados positivos e inspiradores e sua divulgação é importante para ampliar horizontes e criar novas possibilidades.Cada día tenemos más familias que experimentan el luto generado por homicidios, accidentes y violencia, esto ha causado algunos problemas psicológicos para las personas que se encuentran en esta situación. Este artículo es un relato de la experiencia profesional vivida en el Hospital de Mauá con un grupo de autoayuda para pacientes en el proceso de luto, y su objetivo es compartir la experiencia y difundir este trabajo. A través de quince reuniones preestructuradas de acuerdo con la demanda presentada por el propio grupo, fue posible trabajar diversos temas relacionados a la pérdida que influyeron a las participantes y al mismo tiempo proporcionaron, además de confort, una posibilidad de identificación y cambio, y consecuentemente el resurgimiento de autoconfianza. A través de la articulación de la teoría con la práctica, es evidenciado que la atención en grupo para enlutados es una alternativa viable que trajo resultados

  12. Transferência e psicoterapia de grupo Transferencia y psicoterapia de grupo Transference and group psychotherapy

    Directory of Open Access Journals (Sweden)

    Luiz Paulo de C. Bechelli

    2006-02-01

    Full Text Available No presente estudo, examinamos o conceito de transferência, focalizando suas peculiaridades no contexto grupal. A natureza da situação terapêutica e a ampla liberdade proporcionada ao paciente para abordar o material inconsciente, de acordo com seu próprio ritmo e dentro de um ambiente seguro e sem censura, estimula o estabelecimento gradual da transferência. Devido ao mecanismo de deslocamento, o psicoterapeuta e os participantes do grupo são percebidos não como são, com seus atributos reais, mas como objetos que suscitam emoções oriundas do mundo infantil, mais precisamente do acervo de influências afetivas profundas. Uma peculiaridade da situação de grupo em comparação com a psicoterapia individual é que, naquela modalidade, coexistem múltiplas transferências que os membros do grupo estabelecem entre si, potencializando uma gama de possibilidades de sentimentos. Ambas as modalidades guardam em comum o pressuposto de que os conflitos psíquicos que impeliram o paciente à busca de ajuda podem ser reduzidos ou mesmo suprimidos mediante a interpretação e a elaboração da transferência, que funcionam como procedimentos para a mudança no decorrer do processo terapêutico.En este estudio investigamos el concepto de la transferencia, enfocando sus peculiaridades en el contexto grupal. La naturaleza de la situación terapéutica y la amplia libertad proporcionada al paciente para abordar el material inconciente según su propio ritmo y dentro de un ambiente seguro y sin censura estimula el establecimiento gradual de la transferencia. Debido al mecanismo de desplazamiento, el psicoterapeuta y los participantes del grupo son percibidos no como son, con sus atributos reales, pero como objetos que suscitan emociones oriundas del mundo infantil, más precisamente del acervo de influencias afectivas profundas. Una peculiaridad de la situación de grupo en comparación con la psicoterapia individual es que, en aquella modalidad

  13. Cucurbits [Cucumber, melon, pumpkin and squash

    Science.gov (United States)

    The focus of this chapter is on the edible members of the Cucurbitaceae family. The three important food-grade cucurbit genera Citrullus, Cucumis, and Cucurbita include the species Citrullus lanatus watermelons), Cucumis melo (cantaloupes and other sweet melons), Cucumis sativa (cucumbers and pick...

  14. MENTIMUN(Cucumis Sativus L DI DESA TIRTA MULYA KECAMATAN MAKARTI JAYA KABUPATEN BANYUASIN II

    Directory of Open Access Journals (Sweden)

    Irham Falahudin

    2015-08-01

    Full Text Available Cucumber plants (Cucumis sativus L. that includes or creeping vines and is one type of vegetable-fruit of the gourd family labuan (Cucurbitaceae that has been popular throughout the world and favored from Asia. Cucumber cultivation in Indonesia, found almost in every region, ranging from lowland to highland hot climate (tropical and moderate. One animal that has an abundant amount in cucumber plants are insects. This study aims to know the different types of species that exist on the Order Coleoptera cucumber farm in the village of Tirta Mulya District of makarti Jaya Banyuasin II and determine the role of the Order Coleoptera insects on cucumber plantations in the village of Tirta Mulya District of makarti Jaya Banyuasin II. This is a qualitative study conducted in October-November 2014 held in Cucumber Plants in the village of Tirta Mulya District of makarti Jaya Banyuasin II. Catching insects done using transect method and pitfall traps such as sweeping the net, pit fall traps and light traps, results in identification in the laboratory penelitanya UIN Raden Fatah Palembang. The results of this study indicate that insects are caught in a cucumber plantation obtained as many as 113 individual 3 families and 7 species. Insects which dominates in the village of Tirta Mulya District of makarti Jaya Banyuasin II is Cocinella repanda, Curinus coeruleus, Coelophora inaequalis, and Aulacophora similis, and insects that have the fewest number is Micraspis discolor, Micraspis vincta and Oryctes rhinoceros. The role of the Order Coleoptera Insects in general predators of the family Coccinellidae to eradicate mites while the family Chrysomelidae Scarabacidae and are pests that attack on cucumber plants that can cause death.

  15. Cucumis sativus Aqueous Fraction Inhibits Angiotensin II-Induced Inflammation and Oxidative Stress In Vitro

    Directory of Open Access Journals (Sweden)

    Celeste Trejo-Moreno

    2018-02-01

    Full Text Available Inflammation and oxidative stress play major roles in endothelial dysfunction, and are key factors in the progression of cardiovascular diseases. The aim of this study was to evaluate in vitro the effect of three subfractions (SFs from the Cucumis sativus aqueous fraction to reduce inflammatory factors and oxidative stress induced by angiotensin II (Ang II in human microvascular endothelial cells-1 (HMEC-1 cells. The cells were cultured with different concentrations of Ang II and 0.08 or 10 μg/mL of SF1, SF2, or SF3, or 10 μmol of losartan as a control. IL-6 (Interleukin 6 concentration was quantified. To identify the most effective SF combinations, HMEC-1 cells were cultured as described above in the presence of four combinations of SF1 and SF3. Then, the effects of the most effective combination on the expression of adhesion molecules, the production of reactive oxygen species (ROS, and the bioavailability of nitric oxide (NO were evaluated. Finally, a mass spectrometry analysis was performed. Both SF1 and SF3 subfractions decreased the induction of IL-6 by Ang II, and C4 (SF1 and SF3, 10 μg/mL each was the most effective combination to inhibit the production of IL-6. Additionally, C4 prevented the expression of adhesion molecules, reduced the production of ROS, and increased the bioavailability of NO. Glycine, arginine, asparagine, lysine, and aspartic acid were the main components of both subfractions. These results demonstrate that C4 has anti-inflammatory and antioxidant effects.

  16. Boron toxicity is alleviated by hydrogen sulfide in cucumber (Cucumis sativus L.) seedlings.

    Science.gov (United States)

    Wang, Bao-Lan; Shi, Lei; Li, Yin-Xing; Zhang, Wen-Hao

    2010-05-01

    Boron (B) is an essential micronutrient for plants, which when occurs in excess in the growth medium, becomes toxic to plants. Rapid inhibition of root elongation is one of the most distinct symptoms of B toxicity. Hydrogen sulfide (H(2)S) is emerging as a potential messenger molecule involved in modulation of physiological processes in plants. In the present study, we investigated the role of H(2)S in B toxicity in cucumber (Cucumis sativus) seedlings. Root elongation was significantly inhibited by exposure of cucumber seedlings to solutions containing 5 mM B. The inhibitory effect of B on root elongation was substantially alleviated by treatment with H(2)S donor sodium hydrosulfide (NaHS). There was an increase in the activity of pectin methylesterase (PME) and up-regulated expression of genes encoding PME (CsPME) and expansin (CsExp) on exposure to high B concentration. The increase in PME activity and up-regulation of expression of CsPME and CsExp induced by high B concentration were markedly reduced in the presence of H(2)S donor. There was a rapid increase in soluble B concentrations in roots on exposure to high concentration B solutions. Treatment with H(2)S donor led to a transient reduction in soluble B concentration in roots such that no differences in soluble B concentrations in roots in the absence and presence of NaHS were found after 8 h exposure to the high concentration B solutions. These findings suggest that increases in activities of PME and expansin may underlie the inhibition of root elongation by toxic B, and that H(2)S plays an ameliorative role in protection of plants from B toxicity by counteracting B-induced up-regulation of cell wall-associated proteins of PME and expansins.

  17. Boron excess affects photosynthesis and antioxidant apparatus of greenhouse Cucurbita pepo and Cucumis sativus.

    Science.gov (United States)

    Landi, Marco; Remorini, Damiano; Pardossi, Alberto; Guidi, Lucia

    2013-11-01

    This study aimed to evaluate the behavior of zucchini (Cucurbita pepo L.) and cucumber (Cucumis sativus L.) under boron (B) excess. Plants were grown under greenhouse conditions in a sandy soil-peat mixture using a nutrient solution containing 0.2 (control), 10 and 20 mg L(-1) B. Visible symptoms were quantified and leaf B accumulation, gas exchanges, chlorophyll (Chl) a fluorescence, malondialdehyde by-products and antioxidants were investigated 20 days after the beginning of the treatments. Boron toxicity induced oxidative load and leaf necrotic burns coupled with the reduction of leaf growth and biomass accumulation in both species. Boron excess resulted in a decrease of Chl a/b ratio, potential (Fv/Fm) and actual (ΦPSII) PSII quantum efficiency, photosynthetic rate (Pn), stomatal conductance (gs), and transpiration (E) as well. A general stimulation of the antioxidant enzymes ascorbate peroxidase, catalase and superoxide dismutase was observed, and a significant increase in the oxidized form of ascorbate and glutathione was evidenced for treated plants of both species. A difference between the two species was observed: C. pepo appeared to be more sensitive to B stress being damaged at all B concentration. C. sativus grown at 10 mg L(-1) B in nutrient solution showed some down-regulated mechanisms, i.e. increase in Chl b content and a good photochemical PSII efficiency as well as a higher amount of constitutive antioxidant molecules, that, however, are not sufficient to contrast the negative effects of B.

  18. Silicon improves salt tolerance by increasing root water uptake in Cucumis sativus L.

    Science.gov (United States)

    Zhu, Yong-Xing; Xu, Xuan-Bin; Hu, Yan-Hong; Han, Wei-Hua; Yin, Jun-Liang; Li, Huan-Li; Gong, Hai-Jun

    2015-09-01

    Silicon enhances root water uptake in salt-stressed cucumber plants through up-regulating aquaporin gene expression. Osmotic adjustment is a genotype-dependent mechanism for silicon-enhanced water uptake in plants. Silicon can alleviate salt stress in plants. However, the mechanism is still not fully understood, and the possible role of silicon in alleviating salt-induced osmotic stress and the underlying mechanism still remain to be investigated. In this study, the effects of silicon (0.3 mM) on Na accumulation, water uptake, and transport were investigated in two cucumber (Cucumis sativus L.) cultivars ('JinYou 1' and 'JinChun 5') under salt stress (75 mM NaCl). Salt stress inhibited the plant growth and photosynthesis and decreased leaf transpiration and water content, while added silicon ameliorated these negative effects. Silicon addition only slightly decreased the shoot Na levels per dry weight in 'JinYou 1' but not in 'JinChun 5' after 10 days of stress. Silicon addition reduced stress-induced decreases in root hydraulic conductivity and/or leaf-specific conductivity. Expressions of main plasma membrane aquaporin genes in roots were increased by added silicon, and the involvement of aquaporins in water uptake was supported by application of aquaporin inhibitor and restorative. Besides, silicon application decreased the root xylem osmotic potential and increased root soluble sugar levels in 'JinYou 1.' Our results suggest that silicon can improve salt tolerance of cucumber plants through enhancing root water uptake, and silicon-mediated up-regulation of aquaporin gene expression may in part contribute to the increase in water uptake. In addition, osmotic adjustment may be a genotype-dependent mechanism for silicon-enhanced water uptake in plants.

  19. Uptake and/or utilization of two simple phenolic acids by Cucumis sativus

    International Nuclear Information System (INIS)

    Shann, J.R.

    1986-01-01

    The uptake of ferulic acid (FA) and p-hydroxybenzoic acid (p-HBA) from solutions (0.1 to 1.00 mM, pH 4.0 to 7.0), was determined for intact and excised roots of Cucumis sativus. Uptake methods based on high performance liquid chromatographic (HPLC) analysis of phenolic acid depletion from solution were compared to those radioisotopic methods employing [U-ring- 14 C]FA or p-HBA. Although radiotracer methods more accurately reflected actual uptake of the compounds by cucumber seedlings, HPLC solution depletion methods may be useful in the elucidation of trends over very limited periods of time. The uptake of FA was unaffected by the presence of p-HBA. The uptake of p-HBA was reduced by 30% in the presence of FA when compared to the uptake from solutions containing p-HBA alone. Ferulic acid acts both as an allelopathic agent and precursor in the endogenous process of lignification. To evaluate the involvement of exogenous FA in lignin biosynthesis, roots of hydroponically grown cucumber seedlings were exposed to concentrations of FA labeled with [U-ring- 14 C]FA. Radiotracer was distributed throughout the seedling. A quantitative change in lignification occurred in treated seedlings. In roots and stems, the level of lignin increased with the number of exposures and as the concentrations of exogenous FA increased. Radiotracer was found in the residues of lignin isolated from seedling tissue treated with [U-ring- 14 C]FA. This suggested the utilization of the exogenously applied FA in the endogenous process of lignification

  20. Occidental diffusion of cucumber (Cucumis sativus) 500–1300 CE: two routes to Europe

    Science.gov (United States)

    Paris, Harry S.; Daunay, Marie-Christine; Janick, Jules

    2012-01-01

    Background The cucumber, Cucumis sativus, is one of the most widely consumed fruit vegetables the world over. The history of its dispersal to the Occident from its centre of origin, the Indian subcontinent, has been incorrectly understood for some time, due to the confusion of cucumbers with vegetable melons. Iconographic and literary evidence has shown that cucumber was absent in Roman times, up to 500 CE, but present in Europe by late medieval times, 1300. The objective of the present investigation was to determine more accurately when the cucumber arrived in Europe and by what route. Findings and Conclusions The evidence for the movement of C. sativus westward is entirely lexicographical until the 10th century. Syriac, Persian and Byzantine Greek sources suggest the presence of cucumbers, to the east and north-east of the Mediterranean Sea (modern Iran, Iraq and Turkey), by the 6th or 7th century. Arabic medical writings suggest the presence of cucumbers in Spain as early as the mid-9th century and in Tunisia by the early 10th century. Descriptive evidence in Arabic establishes the presence of cucumbers in Andalusia by the second half of the 10th century. Latin translations from Arabic sources indicate the presence of cucumbers in southern Italy by the second half of the 11th century. These writings, together with lexicographical discrepancies in names of cucurbits in late medieval Latin writings, suggest that cucumber was introduced to Europe by two independent diffusions. One diffusion appears to have been overland from Persia into eastern and northern Europe and preceded the Islamic conquests. The other, subsequent diffusion into western and southern Europe, was probably by a mostly maritime route from Persia or the Indian subcontinent into Andalusia. PMID:22104164

  1. Equilibrium and Kinetics Study of Adsorption of Crystal Violet onto the Peel of Cucumis sativa Fruit from Aqueous Solution

    Directory of Open Access Journals (Sweden)

    T. Smitha

    2012-01-01

    Full Text Available The use of low-cost, locally available, high efficiency and eco-friendly adsorbents has been investigated as an ideal alternative to the current expensive methods of removing dyes from wastewater. This study investigates the potential use of the peel of Cucumis sativa fruit for the removal of crystal violet (CV dye from simulated wastewater. The effects of different system variables, adsorbent dosage, initial dye concentration, pH and contact time were investigated and optimal experimental conditions were ascertained. The results showed that as the amount of the adsorbent increased, the percentage of dye removal increased accordingly. Optimum pH value for dye adsorption was determined as 7.0. The adsorption of crystal violet followed pseudo-second order rate equation and fit well Langmuir and Freundlich equations. The maximum removal of CV was obtained at pH 7 as 92.15% for adsorbent dose of 0.2 g/50 mL and 25 mg L-1 initial dye concentration at room temperature. The maximum adsorption capacity obtained from Langmuir equation was 34.24 mg g-1. Furthermore, adsorption kinetics of (CV was studied and the rate of adsorption was found to conform to pseudo-second order kinetics with a good correlation (R2 > 0.9739. The peel of Cucumis sativa fruit can be attractive options for dye removal from diluted industrial effluents since test reaction made on simulated dyeing wastewater show better removal percentage of (CV.

  2. Cucurbita spp. and Cucumis sativus enhance the dissipation of polychlorinated biphenyl congeners by stimulating soil microbial community development

    International Nuclear Information System (INIS)

    Qin, Hua; Brookes, Philip C.; Xu, Jianming

    2014-01-01

    A number of Cucurbita species have the potential to extract polychlorinated biphenyls (PCBs) from soil, but their impact on the soil microbial communities responsible for PCB degradation remains unclear. A greenhouse experiment was conducted to investigate the effect of three Cucurbita and one Cucumis species on PCB dissipation and soil microbial community structure. Compared to the unplanted control, enhanced losses of PCBs (19.5%–42.7%) were observed in all planted soils. Cucurbita pepo and Cucurbita moschata treatments were more efficient in PCB dissipation, and have similar patterns of soil phospholipid fatty acids (PLFAs) and PCB congener profiles. Cucurbita treatments tend to have higher soil microbial biomass than Cucumis. Gram-negative (G − ) bacteria were significantly correlated with PCB degradation rates (R 2 = 0.719, p − bacteria were correlated with dissipation of the penta homologue group (R 2 = 0.590, p − bacteria contributed significantly to soil PCB dissipation. • Fungi have a great potential in the dissipation of high chlorinated biphenyls. -- Cucurbita associated fungi and G − bacteria have important influence on soil PCB dissipation rate and congener profile

  3. Variation in herbivory-induced volatiles among cucumber (Cucumis sativus L.) varieties has consequences for the attraction of carnivorous natural enemies

    NARCIS (Netherlands)

    Kappers, I.F.; Hoogerbrugge, H.; Bouwmeester, H.J.; Dicke, M.

    2011-01-01

    In response to herbivory by arthropods, plants emit herbivory-induced volatiles that attract carnivorous enemies of the inducing herbivores. Here, we compared the attractiveness of eight cucumber varieties (Cucumis sativus L.) to Phytoseiulus persimilis predatory mites after infestation of the

  4. COOPERACIÓN HUMANA Y SELECCIÓN DE GRUPO

    Directory of Open Access Journals (Sweden)

    Luis Alvaro Cadena Monroy

    2017-12-01

    Full Text Available Darwin pensaba que la cooperación entre los seres humanos podía ir en contra de su idea de selección natural. Para enfrentar este problema, introdujo la selección de grupos: se seleccionan grupos de seres humanos cooperadores por sobre los grupos de no cooperadores, No obstante, con el advenimiento del neodarwinismo, la selección de grupos cayó en el desprestigio. Poco a poco, y recientemente, fueron apareciendo varias propuestas para la selección de grupos. Aquí se miran algunas de estas propuestas y se las critica. El autor se inclina por una propuesta de L. A. Cadena para la selección de grupos, y la aplica al caso del crecimiento poblacional inusual y al patrullaje de los chimpancés de Ngogo, a los cazadores y recolectores y a la extinción de los neandertales por manos del Homo sapiens.

  5. O grupo operativo intervindo na Síndrome de Burnout

    Directory of Open Access Journals (Sweden)

    Vivien Rose Böck

    Full Text Available O presente estudo teve como objetivo verificar a alteração do nível de Burnout em professores por intermédio da intervenção da técnica de grupos operativos. A amostra foi composta por professores de 5ª a 8ª série de uma escola particular de Porto Alegre, subdividindo-se em dois grupos, o de controle e o experimental, com 12 professores em cada grupo. Para medir a Síndrome de Burnout foi utilizado o MBI (Maslach Burnout Inventory. Após a primeira aplicação do teste em todos os professores, realizaram-se 9 encontros sob a técnica de grupos operativos com o grupo experimental e posteriormente, todos responderam novamente ao teste. Os resultados demonstraram aumento do nível de Burnout, bem como nas suas dimensões: esgotamento emocional, realização profissional e despersonalização para o grupo experimental. Na análise da intervenção constatou-se a importância tanto da sensibilização profissional do trabalho docente como do apoio social entre os professores como estratégias para a prevenção e o enfrentamento da Síndrome de Burnout.

  6. O enfermeiro como coordenador de grupos: contribuições da Dinâmica de Grupo

    Directory of Open Access Journals (Sweden)

    Carla Natalina da Silva Fernandes

    2008-03-01

    Full Text Available Na enfermagem a utilização do recurso grupal tem sido utilizada para trabalhar com pessoas o que exige dos profissionais um conhecimento específico, para atender aos objetivos do grupo sem causar danos aos envolvidos. O objetivo desta pesquisa foi discutir à luz do referencial teórico da Dinâmica de Grupo os atributos desejáveis para o enfermeiro como coordenador de grupos, suas possibilidades e limitações. Trata-se de uma investigação teórica, de natureza descritiva e analítica desenvolvida por meio de pesquisa bibliográfica. Consideramos como fontes bibliográficas, inicialmente, os livros clássicos de Lewin (1948, Mailhiot (1981 e Cartwright e Zander (1975 por serem as primeiras referências na construção da ciência da dinâmica de grupo e, ainda, para a discussão teórica, a contribuição de outros autores da literatura contemporânea nacional e internacional, de acordo com sua adequação ao objetivo proposto nesse trabalho. A análise das obras foi direcionada pelo interesse na busca de elementos para o alcance do objetivo proposto. Estruturamos os resultados do trabalho em três capítulos. O primeiro capítulo Dinâmica e Funcionamento de Grupo: perspectiva histórica, conceito e fundamentos, traz conceitos fundamentais sobre a origem da dinâmica de grupo e os pressupostos iniciais. Discutimos as diferentes e complementares concepções de grupo, sendo que a fundamentação teórica e filosófica do coordenador norteará o caminho da satisfação dos objetivos propostos pelo grupo. No segundo capítulo Coordenação de Grupos: fundamentos da Ciência da Dinâmica de Grupo, abordamos os aspectos da coordenação de grupo, incluindo o planejamento e várias fases que o grupo percorre no seu desenvolvimento. Discutimos ainda os fundamentos para a sistematização da atividade grupal. No último capítulo: O enfermeiro como coordenador de grupos: discutindo caminhos para a atuação na assistência, formação de

  7. Aspectos técnicos da psicoterapia de grupo

    Directory of Open Access Journals (Sweden)

    Bernardo Blay Neto

    1959-09-01

    Full Text Available São estudados os mecanismos psíquicos que se desenvolvem em agrupamentos humanos e a sua utilização para fins terapêuticos, sendo focalizado o fenômeno da interação como o dinamismo básico dessas reações. O autor compara a forma pela qual encara o grupo com as idéias de Bion, Moreno e Sullivan, encarando a hipótese de que os sentimentos de amor e hostilidade se manifestem em função do bom ou do mau funcionamento dos contactos primários que caracterizam a dependência. O autor comenta resultados que obteve usando o psicodrama, mediante o qual estudou reações emocionais de inveja, ódio, agressividade e amor. O autor analisa as técnicas de Slavson e Pratt baseando-se nos dinamismos inerentes ao grupo e refere os estudos de Beukemkamp para a compreensão do fenômeno transferenciai que, no grupo, tem características próprias. As diferenças entre a terapia de grupo e a individual são apontadas, sendo a contra-transferência considerada como elemento construtivo. Pensa o autor que o aspecto dramático vivenciado pelo grupo ou por um dos seus componentes tem alto valor, pois engloba a verbalização, os componentes emocionais e os componentes posturais. O tono emocional vivenciado pelo grupo é mais intenso e opressivo que o que é despertado na terapêutica individual, o que é explicável pela somação de efeitos provocada pela reação circular. Segundo o autor, a Psicoterapia de Grupo e a Psicoterapia Individual não se opõem, mas se completam.

  8. Molecular mapping and candidate gene analysis for resistance to powdery mildew in Cucumis sativus stem.

    Science.gov (United States)

    Liu, P N; Miao, H; Lu, H W; Cui, J Y; Tian, G L; Wehner, T C; Gu, X F; Zhang, S P

    2017-08-31

    Powdery mildew (PM) of cucumber (Cucumis sativus), caused by Podosphaera xanthii, is a major foliar disease worldwide and resistance is one of the main objectives in cucumber breeding programs. The resistance to PM in cucumber stem is important to the resistance for the whole plant. In this study, genetic analysis and gene mapping were implemented with cucumber inbred lines NCG-122 (with resistance to PM in the stem) and NCG-121 (with susceptibility in the stem). Genetic analysis showed that resistance to PM in the stem of NCG-122 was qualitative and controlled by a single-recessive nuclear gene (pm-s). Susceptibility was dominant to resistance. In the initial genetic mapping of the pm-s gene, 10 SSR markers were discovered to be linked to pm-s, which was mapped to chromosome 5 (Chr.5) of cucumber. The pm-s gene's closest flanking markers were SSR20486 and SSR06184/SSR13237 with genetic distances of 0.9 and 1.8 cM, respectively. One hundred and fifty-seven pairs of new SSR primers were exploited by the sequence information in the initial mapping region of pm-s. The analysis on the F 2 mapping population using the new molecular markers showed that 17 SSR markers were confirmed to be linked to the pm-s gene. The two closest flanking markers, pmSSR27and pmSSR17, were 0.1 and 0.7 cM from pm-s, respectively, confirming the location of this gene on Chr.5. The physical length of the genomic region containing pm-s was 135.7 kb harboring 21 predicted genes. Among these genes, the gene Csa5G623470 annotated as encoding Mlo-related protein was defined as the most probable candidate gene for the pm-s. The results of this study will provide a basis for marker-assisted selection, and make the benefit for the cloning of the resistance gene.

  9. HABILIDADES E ATRIBUTOS DO ENFERMEIRO COMO COORDENADOR DE GRUPOS

    Directory of Open Access Journals (Sweden)

    CARLA NATALINA DA SILVA FERNANDES

    2008-01-01

    Full Text Available Coordinar grupos es una actividad cada vez más frecuente para los enfermeros, que deben tener conocimiento especí- fico para alcanzar los objetivos propuestos y para aprovechar el potencial de las personas implicadas. Se trata de una investigación teórica que tiene como objetivo discutir y reflexionar sobre algunos atributos deseables en los enfermeros como coordinadores de grupos, basado en el estudio de Godoy, literatura clásica de la Dinámica de Grupo y estudios contemporáneos publicados en periódicos especializados nacionales e internacionales. El artículo está organizado en dos momentos; en el primero se presentan algunas bases teóricas de la coordinación de grupos y, en el segundo, las cualidades deseadas en un coordinador. Estos elementos son discutidos como herramientas aprovechadas por los enfermeros en la conducción de los grupos con el propósito de realizar actividades de asistencia, formación de recursos humanos o para el desarrollo de investigaciones. La praxis de la coordinación implica un sistema de capacidades técnicas y científicas; amplio conocimiento de las relaciones interpersonales, auto conocimiento, sensibilidad y creatividad para que, en efecto, el desempeño del enfermero promueva una mayor atención de las demandas en el área de la salud.

  10. O Melos e Harmonia Acústica (1988 de César Guerra-Peixe, Koellreutter e Hindemith: similaridades e princípios básicos The Melos e Harmonia Acústica (1988 of César Guerra-Peixe, Koellreutter and Hindemith: basic principles and similarities

    Directory of Open Access Journals (Sweden)

    Ernesto Hartmann

    2013-06-01

    Full Text Available O Melos e Harmonia Acústica de César GUERRA-PEIXE (1988 apresenta um compêndio da atividade didática deste compositor expresso em forma de apostila. O presente trabalho busca traçar as possíveis influências comparando-o ao Caderno de Estudos com Koellreutter do próprio GUERRA-PEIXE (1944 e ao The Craft of Musical Composition de Paul HINDEMITH (1937, visando compreender melhor os pressupostos técnicos e teóricos.The Melos e Harmonia Acústica by César GUERRA-PEIXE (1988, presented a survey of the didactical activity of this composer expressed in a textbook form. This research attempts to trace possible influences, comparing it to The Craft of Musical Composition by Paul HINDEMITH (1937 and Caderno de Estudos com Koellreutter by GUERRA-PEIXE (1944 in order to better understand the technical and theoretical approaches embodied in it.

  11. Psicoterapia de grupo en las crisis esquizofrénicas.

    OpenAIRE

    Manuel González de Chávez

    1985-01-01

    En los últimos años, crece la evidencia de que es la combinación de farmacoterapia con psicoterapia de grupo la que mejores perspectivas ofrece en el pronóstico de las psicosis esquizofrénicas. Sin embargo, este tipo de terapia de grupo está aún muy lejos de practicarse de forma habitual en las instituciones psiquiátricas. A pesar de tener tras de sí una historia de más de medio siglo, sigue siendo un campo joven, lleno de enfoques, estilos y técnicas diferentes, que está necesitando un ampli...

  12. Changes in the physiological regulation of transpiration caused by the effects of industrial air pollution. [Cucumis sativus

    Energy Technology Data Exchange (ETDEWEB)

    Kozinka, V; Klasova, A; Niznansky, A

    1963-01-01

    Through Hygen's method of quantitative analysis of transpiration curves, the authors studied the intensity of stomatal and cuticular transpiration of germinating leaves of Cucumis sativus which were experimentally exposed to solid impurities containing F. The difference between the control and experimental plants shows that the impurities not only blocked the regulating system of breathing but also caused increased cuticular transpiration. Numerous lesions were observed; cuticle damage also spread to the inner tissues. A direct relationship between microscopic and macroscopic symptoms was not proven. The creation of conditions adverse to the normal development of the water balance was intensified when the impurities were dropped onto the surface of the leaves. The possible protective function of trichomes is mentioned, but applies only when the impurities settle on a dry surface.

  13. The genome sequence of the North-European cucumber (Cucumis sativus L.) unravels evolutionary adaptation mechanisms in plants.

    Science.gov (United States)

    Wóycicki, Rafał; Witkowicz, Justyna; Gawroński, Piotr; Dąbrowska, Joanna; Lomsadze, Alexandre; Pawełkowicz, Magdalena; Siedlecka, Ewa; Yagi, Kohei; Pląder, Wojciech; Seroczyńska, Anna; Śmiech, Mieczysław; Gutman, Wojciech; Niemirowicz-Szczytt, Katarzyna; Bartoszewski, Grzegorz; Tagashira, Norikazu; Hoshi, Yoshikazu; Borodovsky, Mark; Karpiński, Stanisław; Malepszy, Stefan; Przybecki, Zbigniew

    2011-01-01

    Cucumber (Cucumis sativus L.), a widely cultivated crop, has originated from Eastern Himalayas and secondary domestication regions includes highly divergent climate conditions e.g. temperate and subtropical. We wanted to uncover adaptive genome differences between the cucumber cultivars and what sort of evolutionary molecular mechanisms regulate genetic adaptation of plants to different ecosystems and organism biodiversity. Here we present the draft genome sequence of the Cucumis sativus genome of the North-European Borszczagowski cultivar (line B10) and comparative genomics studies with the known genomes of: C. sativus (Chinese cultivar--Chinese Long (line 9930)), Arabidopsis thaliana, Populus trichocarpa and Oryza sativa. Cucumber genomes show extensive chromosomal rearrangements, distinct differences in quantity of the particular genes (e.g. involved in photosynthesis, respiration, sugar metabolism, chlorophyll degradation, regulation of gene expression, photooxidative stress tolerance, higher non-optimal temperatures tolerance and ammonium ion assimilation) as well as in distributions of abscisic acid-, dehydration- and ethylene-responsive cis-regulatory elements (CREs) in promoters of orthologous group of genes, which lead to the specific adaptation features. Abscisic acid treatment of non-acclimated Arabidopsis and C. sativus seedlings induced moderate freezing tolerance in Arabidopsis but not in C. sativus. This experiment together with analysis of abscisic acid-specific CRE distributions give a clue why C. sativus is much more susceptible to moderate freezing stresses than A. thaliana. Comparative analysis of all the five genomes showed that, each species and/or cultivars has a specific profile of CRE content in promoters of orthologous genes. Our results constitute the substantial and original resource for the basic and applied research on environmental adaptations of plants, which could facilitate creation of new crops with improved growth and yield in

  14. Comparative chromosomal localization of 45S and 5S rDNAs and implications for genome evolution in Cucumis.

    Science.gov (United States)

    Zhang, Zhen-Tao; Yang, Shu-Qiong; Li, Zi-Ang; Zhang, Yun-Xia; Wang, Yun-Zhu; Cheng, Chun-Yan; Li, Ji; Chen, Jin-Feng; Lou, Qun-Feng

    2016-07-01

    Ribosomal DNAs are useful cytogenetic markers for chromosome analysis. Studies investigating site numbers and distributions of rDNAs have provided important information for elucidating genome organization and chromosomal relationships of many species by fluorescence in situ hybridization. But relevant studies are scarce for species of the genus Cucumis, especially in wild species. In the present study, FISH was conducted to investigate the organization of 45S and 5S rDNA among 20 Cucumis accessions, including cultivars and wild accessions. Our results showed that the number of 45S rDNA sites varied from one to five pairs in different accessions, and most of these sites are located at the terminal regions of chromosomes. Interestingly, up to five pairs of 45S rDNA sites were observed in C. sativus var. sativus, the species which has the lowest chromosome number, i.e., 2n = 14. Only one pair of 5S rDNA sites was detected in all accessions, except for C. heptadactylus, C. sp, and C. spp that had two pairs of 5S rDNA sites. The distributions of 5S rDNA sites showed more variation than 45S rDNA sites. The phylogenetic analysis in this study showed that 45S and 5S rDNA have contrasting evolutionary patterns. We find that 5S rDNA has a polyploidization-related tendency towards the terminal location from an interstitial location but maintains a conserved site number, whereas the 45S rDNA showed a trend of increasing site number but a relatively conserved location.

  15. TTI Phase 2 Institutional Support: Grupo FARO | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    For Grupo FARO, this project will help enhance its research quality, organizational performance, and policy engagement. ... International Water Resources Association, in close collaboration with IDRC, is holding a webinar titled “Climate change and adaptive water management: Innovative solutions from the Global South”.

  16. Grupos áulicos: aprendendo com os pares

    Directory of Open Access Journals (Sweden)

    Nair Cristina da Silva Tuboiti

    Full Text Available Resumo:Este estudo visa evidenciar as contribuições dos grupos áulicos no processo de aprendizagem entre pares. Pressupõe-se que grupos áulicos garantem o espaço relacional na perspectiva multidirecional. A coleta de dados foi realizada em uma turma de 1º ano do Ensino Fundamental de uma escola pública de Samambaia, Distrito Federal, por meio de observação participante, entrevista não estruturada e análise documental. Os dados foram analisados na perspectiva sociocultural em diálogo com a teoria interpretativa de Geertz. Os resultados indicam que os grupos áulicos permitem reorganizar o pensamento fazendo diferença no campo do ensino e aprendizagem, na perspectiva de um espaço que possibilite a diversidade de relações, rompendo com as profecias de fracasso e instaurando um lugar real do aluno nessa relação de construção de conhecimentos. A interlocução entre os pares ocorre no grupo heterogêneo que possibilita que se aprendam conceitos com os diferentes saberes, afinal aprende-se em meio à diversidade.

  17. Biotecnología aplicada Un logro del Grupo BIOSEC

    Directory of Open Access Journals (Sweden)

    Marina Caro Muñoz

    2008-07-01

    Full Text Available Un sueño hecho realidad, de la academia al campo, gracias a la unión de la empresa privada, Metapetroleum Company, y las entidades públicas Alcaldía de Puerto Gaitán y el Grupo Biosec del Instituto de Biotecnología de la Universidad Nacional de Colombia.

  18. Effect of chromium toxicity on germination and early seedling growth ...

    African Journals Online (AJOL)

    USER

    2010-07-19

    Jul 19, 2010 ... germination and early seedling growth of melon (Cucumis melo L.). Chromium ... chromium on seed germination and seedling growth- biomass in early ..... such critical regulatory mechanisms are likely to operate in seeds at ...

  19. Macronutrient composition of three cucurbit species cultivated for ...

    African Journals Online (AJOL)

    .) Matsum. & Nakai., Cucumeropsis mannii Naudin, and Cucumis melo var. agrestis L.] largely cultivated in Côte d'Ivoire and consumed as sauce thickeners were analyzed for their proximate composition and compared to a local landrace of ...

  20. Effects of different irrigation regimes and nitrogen levels on yield and ...

    African Journals Online (AJOL)

    Jane

    2011-08-31

    Aug 31, 2011 ... levels on yield and quality of melon (Cucumis melo L.) M. Simsek1* and N. ... fertilization have significant adverse effects on water resources ... usage of water to meet the needs of plants (Stewart and. Nielsen, 1990).

  1. Pepino japonês (Cucumis sativus L. submetido ao tratamento com fécula de mandioca Japonese cucumber (Cucumis sativus L. submitted of the treatment with cassava starch film

    Directory of Open Access Journals (Sweden)

    Kelen Cristina dos Reis

    2006-06-01

    Full Text Available Com o presente trabalho objetivou-se avaliar a qualidade e a vida útil do pepino (Cucumis sativus L., utilizando recobrimento com película de fécula de mandioca. Após seleção, amostras de pepino japonês foram mergulhadas em suspensões de fécula de mandioca a 0, 2, 3 e 4%, secos ao ar e armazenados em câmara fria a 5ºC e 95% de UR por 8 dias. As análises realizadas foram perda de massa, pH, sólidos solúveis (SS , acidez titulável (AT, Cor L*a*b e firmeza. O delineamento utilizado foi o DIC com 3 repetições, com os tratamentos dispostos em esquema fatorial 4 x 5. O valor encontrado para firmeza nas amostras tratadas com película a 4% foram menores em comparação aos outros tratamentos, isto, provavelmente se deve à plasticidade do tecido que estas amostras apresentaram. A película reduziu significativamente a perda de massa das amostras mantidas sob refrigeração. A aplicação de película de fécula de mandioca na concentração mais elevada (4%, proporcionou ao pepino um aspecto melhor de conservação, tornando o produto mais atraente.This work was made to evaluate the properties and postharvest life of cucumber (Cucumis sativus L. coated with cassava starch film. After the selection the fruits were dipped in suspensions 0, 2, 3 and 4% starch, dried naturally and stored in chamber cold (5ºC ± 1ºC and 90% ± 5% HR during 8 days and the analyses were done in the time zero and in intervals of 2 days. The analyses done were loss mass, titratable acidity (TA, pH, soluble solids (SS, color L*a*b and firmness. The test was conducted in completely randomized design, with three repetitions, with the treatments disposed in factory layout 4x5. The value found for firmness in the samples treated with biofilm at 4% was smaller in comparison to the other treatments, this, is probably due to the plasticity of the tissue that these samples presented. The film reduced the loss of mass of the samples maintained under refrigeration

  2. viver de um grupo de mulheres de classes populares

    Directory of Open Access Journals (Sweden)

    Kleyde Ventura de Souza

    2007-01-01

    Full Text Available Para la realización del presente estudio hicimos una encuesta a través de la cual conformamos un tipo especial de grupo llamado “Círculo de Ciudadanía”, con el objetivo de presentar los hechos & actos que han influenciado en la conquista de los derechos sexuales y reproductores de un grupo formado por 16 mujeres de clases populares. La encuesta fue desarrollada en 15 encuentros, en el período de diciembre de 2003 hasta julio de 2004. Los temas generadores fueron discutidos a la luz de los conceptos de Paulo Freire: “el cuerpo” y “derecho a tener derechos”. Las discusiones hechas en estos encuentros, originaron unidades temáticas que evidenciaron las desigualdades sociales, económicas y culturales, reforzando con ello, la condición de subordinación de las mujeres de clases populares, así como los dilemas y desafíos originados de la condición de ser mujer en el (difícil ejercicio de los derechos sexuales y reproductores, como integrantes del proceso de vivir del grupo estudiado.

  3. O Primeiro Ano do Grupo de Apoio ao Primeiranista

    Directory of Open Access Journals (Sweden)

    Rodolfo Furlan Damiano

    Full Text Available Este trabalho é um relato de experiência do primeiro ano de funcionamento do Grupo de Apoio ao Primeiranista (GAP. O GAP é um grupo desenvolvido por alunos de Medicina de uma universidade privada do Estado de São Paulo, apoiado por sua direção, com o intuito de amparar e humanizar a recepção aos ingressantes. O início das atividades do GAP ocorreu em 2013 com base nos conceitos de tutoria/mentoring, aplicado por outras escolas médicas brasileiras. Nas reuniões semanais do GAP, os participantes (alunos do primeiro ano e mentores (acadêmicos veteranos e uma psicóloga institucional discutiam temas como resiliência, compaixão, humildade e respeito. Durante as reuniões, notou-se uma problemática extensa em relação ao trote universitário, referido pelos primeiranistas como o pior problema enfrentado na universidade. Na sequência dos encontros, o grupo direcionou suas ações para reduzir o trote na universidade. O GAP, apesar de estar em seu primeiro ano de funcionamento, mostrou ter eficácia relevante, podendo ser um modelo a ser implementado em outras universidades.

  4. O uso do grupo focal em pesquisa qualitativa

    Directory of Open Access Journals (Sweden)

    Lúcia Beatriz Ressel

    2008-01-01

    Full Text Available Este estudio tuvo como objetivo presentar el uso del grupo focal como técnica de recolección de datos en una tesis de doctorado, resultado de una investigación cualitativa. El grupo focal utiliza sesiones grupales de discusión, teniendo como foco central un tópico específico a ser debatido por los participantes. La investigación focalizó la temática de la sexualidad en la asistencia de enfermería, bajo una perspectiva cultural, siendo desarrollada con dos grupos de enfermeras: docentes y asistenciales. Comprendió ocho encuentros, y cada uno fue planeado por separado. La evaluación del proceso se realizó por medio de entrevistas con las enfermeras, destacando como puntos positivos la conducción hacia el pensamiento crítico y al proceso de desalineación; y la posibilidad de que esta técnica revele significados singulares y a que ellos se relacionen desde el punto de vista de los sujetos investigados. Esa técnica facilitó el abordaje de la sexualidad, desconstruyendo y reconstruyendo conceptos y buscando respuestas para las inquietudes del tema.

  5. JOÃO CABRAL DE MELO NETO: LA IMAGEN DEL RÍO EN LA POÉTICA DE LOS DESVALIDOS

    Directory of Open Access Journals (Sweden)

    GLORIA VERGARA

    2013-11-01

    Full Text Available In this article we review the cosmic image of water, from the theory of Gaston Bachelard, in two long poems of João Cabral de Melo Neto: O Rio ("The River" and O cão sem plumas ("The dog without feathers". I will see the river as cosmic image of the helpless in "The River" and the first part of "The dog without feathers", Paisagem do Capibaribe, understanding that poetry is not a complaint, but these texts denouncing misery. This poems project the worldview of those who resist the rigor, not only hunger and social spoils, but the river. The creatures that inhabit this world are as far away, the neglected, ignored what society. In the river, these beings are confused with the lama, not just your bank or depth, but the margin between liquid and solid, between the filth and survival. The gift of the destitute is his strength. Thus, the different shades reaching cosmic water image helps us to perceive the existence deployments in the "helpless" than lyrical subjects are depicted in Brazilian poetry.

  6. Insights into salicylic acid responses in cucumber (Cucumis sativus L.) cotyledons based on a comparative proteomic analysis.

    Science.gov (United States)

    Hao, J H; Dong, C J; Zhang, Z G; Wang, X L; Shang, Q M

    2012-05-01

    To investigate the response of cucumber seedlings to exogenous salicylic acid (SA) and gain a better understanding of SA action mechanism, we generated a proteomic profile of cucumber (Cucumis sativus L.) cotyledons treated with exogenous SA. Analysis of 1500 protein spots from each gel revealed 63 differentially expressed proteins, 59 of which were identified successfully. Of the identified proteins, 97% matched cucumber proteins using a whole cucumber protein database based on the newly completed genome established by our laboratory. The identified proteins were involved in various cellular responses and metabolic processes, including antioxidative reactions, cell defense, photosynthesis, carbohydrate metabolism, respiration and energy homeostasis, protein folding and biosynthesis. The two largest functional categories included proteins involved in antioxidative reactions (23.7%) and photosynthesis (18.6%). Furthermore, the SA-responsive protein interaction network revealed 13 key proteins, suggesting that the expression changes of these proteins could be critical for SA-induced resistance. An analysis of these changes suggested that SA-induced resistance and seedling growth might be regulated in part through pathways involving antioxidative reactions and photosynthesis. © 2012 Elsevier Ireland Ltd. All rights reserved.

  7. Exocarp Properties and Transcriptomic Analysis of Cucumber (Cucumis sativus) Fruit Expressing Age-Related Resistance to Phytophthora capsici.

    Science.gov (United States)

    Ando, Kaori; Carr, Kevin M; Colle, Marivi; Mansfeld, Ben N; Grumet, Rebecca

    2015-01-01

    Very young cucumber (Cucumis sativus) fruit are highly susceptible to infection by the oomycete pathogen, Phytophthora capsici. As the fruit complete exponential growth, at approximately 10-12 days post pollination (dpp), they transition to resistance. The development of age-related resistance (ARR) is increasingly recognized as an important defense against pathogens, however, underlying mechanisms are largely unknown. Peel sections from cucumber fruit harvested at 8 dpp (susceptible) and 16 dpp (resistant) showed equivalent responses to inoculation as did whole fruit, indicating that the fruit surface plays an important role in defense against P. capsici. Exocarp from 16 dpp fruit had thicker cuticles, and methanolic extracts of peel tissue inhibited growth of P. capsici in vitro, suggesting physical or chemical components to the ARR. Transcripts specifically expressed in the peel vs. pericarp showed functional differentiation. Transcripts predominantly expressed in the peel were consistent with fruit surface associated functions including photosynthesis, cuticle production, response to the environment, and defense. Peel-specific transcripts that exhibited increased expression in 16 dpp fruit relative to 8 dpp fruit, were highly enriched (Pfunctions. Specific transcripts included genes associated with potential physical barriers (i.e., cuticle), chemical defenses (flavonoid biosynthesis), oxidative stress, penetration defense, and molecular pattern (MAMP)-triggered or effector-triggered (R-gene mediated) pathways. The developmentally regulated changes in gene expression between peels from susceptible- and resistant- age fruits suggest programming for increased defense as the organ reaches full size.

  8. Phloem unloading follows an extensive apoplasmic pathway in cucumber (Cucumis sativus L.) fruit from anthesis to marketable maturing stage.

    Science.gov (United States)

    Hu, Liping; Sun, Huihui; Li, Ruifu; Zhang, Lingyun; Wang, Shaohui; Sui, Xiaolei; Zhang, Zhenxian

    2011-11-01

    The phloem unloading pathway remains unclear in fruits of Cucurbitaceae, a classical stachyose-transporting species with bicollateral phloem. Using a combination of electron microscopy, transport of phloem-mobile symplasmic tracer carboxyfluorescein, assays of acid invertase and sucrose transporter, and [(14)C]sugar uptake, the phloem unloading pathway was studied in cucumber (Cucumis sativus) fruit from anthesis to the marketable maturing stage. Structural investigations showed that the sieve element-companion cell (SE-CC) complex of the vascular bundles feeding fruit flesh is apparently symplasmically restricted. Imaging of carboxyfluorescein unloading showed that the dye remained confined to the phloem strands of the vascular bundles in the whole fruit throughout the stages examined. A 37 kDa acid invertase was located predominantly in the cell walls of SE-CC complexes and parenchyma cells. Studies of [(14)C]sugar uptake suggested that energy-driven transporters may be functional in sugar trans-membrane transport within symplasmically restricted SE-CC complex, which was further confirmed by the existence of a functional plasma membrane sucrose transporter (CsSUT4) in cucumber fruit. These data provide a clear evidence for an apoplasmic phloem unloading pathway in cucumber fruit. A presumption that putative raffinose or stachyose transporters may be involved in soluble sugars unloading was discussed. © 2011 Blackwell Publishing Ltd.

  9. Nivel de autotrascendencia en un grupo de adultos mayores mexicanos

    OpenAIRE

    Raúl Fernando Guerrero Castañeda; Ricardo Lara Pérez

    2017-01-01

    Introducción: La autotrascendencia es una expansión multidimensional personal, una conexión con los demás, el entorno y/o una entidad superior, está relacionada con el bienestar personal del adulto mayor. Objetivo: Determinar el nivel de autotrascendencia de un grupo de adultos mayores mexicanos. Materiales y Métodos: Estudio descriptivo de corte transversal; realizado en tres centros gerontológicos de Celaya, Guanajuato, México, muestra probabilística aleatoria n=118. Se incluyeron adultos m...

  10. NIVEL DE AUTOTRASCENDENCIA EN UN GRUPO DE ADULTOS MAYORES MEXICANOS

    OpenAIRE

    Guerrero Castañeda, Raúl Fernando; Lara Pérez, Ricardo

    2017-01-01

    RESUMEN Introducción: La autotrascendencia es una expansión multidimensional personal, una conexión con los demás, el entorno y/o una entidad superior, está relacionada con el bienestar personal del adulto mayor. Objetivo: Determinar el nivel de autotrascendencia de un grupo de adultos mayores mexicanos. Materiales y Métodos: Estudio descriptivo de corte transversal; realizado en tres centros gerontológicos de Celaya, Guanajuato, México, muestra probabilística aleatoria n=118. Se incluyero...

  11. Cultura no grupo de brinquedo Culture in the play group

    Directory of Open Access Journals (Sweden)

    Ana Maria Almeida Carvalho

    2002-01-01

    Full Text Available Discute-se o conceito de cultura em relação à microcultura do grupo de brinquedo. Concebe-se a criança como agente de criação e transmissão de cultura e o grupo de brinquedo como espaço de informação onde esses processos ocorrem. Essa concepção baseia-se no reconhecimento da espécie humana como biologicamente sócio-cultural e na pressuposição de adaptações precoces para essa especificidade. Episódios de atividade lúdica livre de crianças de 10 a 60 meses são analisados para detectar a ocorrência de criação, elaboração e transmissão de conteúdos culturais na interação criança-criança, ilustrando: (1 recuperação da cultura do ambiente social imediato e exploração de novas possibilidades de uso desses recursos; (2 criação de rituais lúdicos novos que podem tornar-se parte da microcultura do grupo; (3 aculturação, ou seja, assimilação de aspectos da microcultura do grupo. Os dados são interpretados como evidências da pré-adaptação humana para a vida sócio-cultural.This paper discusses the concept of culture in the context of playgroup microcultures. The child is viewed as an agent of culture creation and innovation, and the play group as a space of information where these processes occur. This view is based on the recognition of human species as biologically socio-cultural and on the assumption of precocious adaptations for this specificity. Episodes of free play activity among 10 to 60 month old children are analysed to detect the occurrence of creation, elaboration and transmission of cultural contents in child-child interactions, illustrating: (1 retrieval of the immediate social environment's culture and exploration of new possibilities of using these resources; (2 creation of new ludic rituals which can become part of the group's microculture; (3 aculturation, that is, assimilation of aspects of the group's microculture. Data are interpreted as evidences of the human pre-adaptation to a socio

  12. Organizaciones para el siglo XXI: grupos de trabajo autogestionados.

    Directory of Open Access Journals (Sweden)

    Luis Avendaño Fernández

    2013-11-01

    Full Text Available En la actualidad, muchas empresas exitosas están dejando atrás los esquemas rígidos y autoritarios de organización y orientan sus esfuerzos hacia la formación de equipos autogestionados que integran el logro de los objetivos de eficiencia, rentabilidad y crecimiento que requiere la empresa, con el logro de los objetivos individuales y grupales de desarrollo humano. En Colombia las OTAS (Organizaciones de Trabajo Asociado poseen características de grupos autodirigidos que la empresa debe conocer y adoptar con el fin de conservar su participación en el mercado.

  13. Saberes y poderes. Los grupos intelectuales en Colombia

    OpenAIRE

    Botero-Bernal, Andrés

    2011-01-01

    Este trabajo plantea una historia de la intelectualidad colombiana basada en ocho grandes grupos básicos, a saber: los próceres, los intelectuales gramáticos, los pedagogos y los críticos, los expertos, los intelectuales partidistas, los intelectuales filósofos, los científicos sociales y los intelectuales economistas. Esta clasificación fue hecha a partir de un esquema basado en profesiones (en especial, la del jurista, pero sin dejar de lado el militar, el médico, el economista, etc.) y en ...

  14. Psicoterapia em grupo de pacientes com transtorno afetivo bipolar

    OpenAIRE

    Gomes,Bernardo Carramão; Lafer,Beny

    2007-01-01

    CONTEXTO: Vem crescendo nos últimos anos o número de estudos com abordagens psicoterápicas no tratamento de pacientes com transtorno afetivo bipolar. Contudo, pouco ainda se sabe sobre o efeito que tem estas abordagens nestes pacientes. OBJETIVO: Avaliar a efetividade da terapia de grupo no tratamento do transtorno afetivo bipolar. MÉTODO: Levantamento bibliográfico no Medline, Lilacs, PubMed e ISI de artigos publicados em língua inglesa no período de 1975 a 2005 e busca manual com base na bi...

  15. REPRESENTACIONES DEL GRUPO SIMÉTRICO CON MATRICES ENTERAS

    Directory of Open Access Journals (Sweden)

    Fernando Novoa

    2002-12-01

    Full Text Available La representación de grupos de simetría es uno de los ternas en álgebra abstracta con más aplicaciones en la actualidad. El análisis espectral en diseño de experimentos, el diseño de redes de comunicación, la teoría de códigos, son algunos de los campos en donde esta teoría encuentra aplicación. A pesar de su utilidad, no siempre se encuentra a disposición del profesor y del estudiante una herramienta didáctica que le permita hacer ejemplos, cómputos y comprobaciones de los enunciados teóricos y se tiene que conformar con los ejemplos triviales que no le permiten ver realmente el grado de profundidad del concepto ni la complejidad del cálculo. El propósito de la siguiente nota es presentar un programa computacional para el sistema computacional CoCoA y en particular, ciertas rutinas que permiten calcular las representaciones irreducibles de los grupos de simetría en forma matricial, cuyas matrices tienen sus entradas enteras.

  16. SISTEMA DE CONTROL INTELIGENTE PARA UN GRUPO DE ELEVADORES

    Directory of Open Access Journals (Sweden)

    Andrés Enrique Rosso Mateus

    2008-01-01

    Full Text Available En este artículo se trata el problema del tráfico vertical en edificios de gran altura y se describe el análisis, diseño y evaluación de un sistema de control para un grupo elevadores que busca mejorar el desempeño respecto a un sistema de control tradicional. El controlador propuesto busca asignar de una forma inteligente las llamadas que se generan a los ascensores que hacen parte del grupo, el desempeño del sistema se traduce en una reducción de los tiempos de servicio y de la energía que invierte el sistema. El controlador propuesto está basado en lógica difusa y las reglas de inferencia expresan el conocimiento de un experto orientado hacia la obtención de los objetivos mencionados. El controlador inteligente se evalúa en un simulador gráfico desarrollado para este fin, este simulador permite ingresar parámetros de configuración para que se adapte y represente una edificación real. Se corrieron dos simulaciones, una usando un controlador convencional y otra usando el controlador inteligente, esto con el fin de comparar su desempeño y cuantificar valores como tiempo de esperar de los usuarios y energía consumida por el sistema.

  17. Peril Motivacional de un grupo de estudiantes universitarios

    Directory of Open Access Journals (Sweden)

    María del Carmen Aguilar-Rivera

    2016-01-01

    Full Text Available El objetivo de este trabajo es presentar un peril motivacional de un grupo de 562 estudiantes universitarios argentinos. Se estudiaron las metas académicas de aprendizaje y rendimiento, junto a otras variables y factores intervinientes en la motivación, como ser la atribución causal interna y externa y la satisfacción académica en sus tres dimensiones, la proveniente de la actuación de los profesores, la social y la institucional. Por medio de un análisis clúster se encontraron tres grupos diferenciados, el clúster 1, (337 sujetos, co n metas de aprendizaje y de rendimiento altas; el clúster 2, (212 sujetos, con metas de aprendizaje altas y de rendimiento medias y el clúster 3, (13 sujetos, con metas de aprendizaje y de rendimiento medias. Los integrantes del clúster 1 con metas elevadas también presentaron medias más altas en las atribuciones causales y en la satisfacción académica. Prevalecen en los tres clústeres las metas de aprendizaje, pero en la mayoría de los sujetos se conirma la presencia de múltiples metas, hecho favorable para aprender en el ámbito académico.

  18. Cultivation and uses of cucurbits

    Science.gov (United States)

    Cultivated cucurbits have spread through trade and exploration from their respective Old and New World centers of origin to the six arable continents and are important in local, regional and world trade. Cucumber (Cucumis sativus L.), melon (Cucumis melo L.), pumpkin, squash and gourd (Cucurbita spp...

  19. Nivel de autotrascendencia en un grupo de adultos mayores mexicanos

    Directory of Open Access Journals (Sweden)

    Raúl Fernando Guerrero Castañeda

    2017-01-01

    Full Text Available Introducción: La autotrascendencia es una expansión multidimensional personal, una conexión con los demás, el entorno y/o una entidad superior, está relacionada con el bienestar personal del adulto mayor. Objetivo: Determinar el nivel de autotrascendencia de un grupo de adultos mayores mexicanos. Materiales y Métodos: Estudio descriptivo de corte transversal; realizado en tres centros gerontológicos de Celaya, Guanajuato, México, muestra probabilística aleatoria n=118. Se incluyeron adultos mayores que acudían a los centros gerontológicos, hombres y mujeres, ≥ 60 años. Se utilizó la Escala de Autotrascendencia en español con valor resultante entre 15 y 60 (mayor puntaje = mayor autotrascendencia. Se realizó prueba piloto con 40 adultos mayores con Alpha de Cronbach de 0.80. Análisis estadístico descriptivo para variables categóricas (frecuencias y porcentajes, para variables numéricas: medidas de tendencia central y dispersión. Resultados: Media de Autotrascendencia fue 51.36. Se identificaron con “Encontrando significado en mis creencias espirituales” (85.6% y “Disfrutando mi ritmo de vida” (81.4%; hubo diferencia estadísticamente significativa en la media de Autotrascendencia (p˂0.05 por sexo, siendo mayor el nivel en las mujeres. No hubo diferencia entre grupos de edad. Discusión y Conclusiones: La media de autotrascendencia refleja un nivel alto, en comparación con otros estudios y se reportó entre 75-84 años una media mayor. Los adultos mayores se identifican con características como la religión y el disfrute de la vida. La Escala de Autotrascendencia se puede usar en adultos mayores mexicanos ya que demostró un buen nivel de consistencia interna. Cómo citar este artículo: Guerrero RF, Lara R. Nivel de autotrascendencia en un grupo de adultos mayores mexicanos. Rev Cuid. 2017; 8(1: 1476-87. http://dx.doi.org/10.15649/cuidarte.v8i1.354

  20. Screening of Phytoconstituents, Investigation of Antioxidant and Antibacterial Activity of Methanolic and Aqueous Extracts of Cucumis sativus

    International Nuclear Information System (INIS)

    Sahar, A.; Naqvi, S.A.; Khan, Z.A.; Ahmad, M.; Hussain, Z.; Sahar, T.; Nosheen, S.

    2013-01-01

    The phytoconstituents, antioxidant potential and antibacterial activity of Cucumis sativus (C. sativus) cultivated in Pakistan were studied. In addition, the effect of extraction techniques (mercerization and refluxing) on the total phenolics, antioxidant activity and antibacterial potential of C. sativus fruit pulp were also studied. Methanol extract was screened for its phytoconstituents. The antioxidant activity was assessed by determination of total phenolic contents (TPC), total flavonoid contents (TFC) and performing different in vitro antioxidant models such as 2,2-Diphenyl-1-picryl hydrazyl (DPPH) free radical scavenging, reducing power, percent inhibition of peroxidation in linoleic acid and nitric oxide free radical scavenging assays. Phytochemicals screening results revealed the presence of flavonoids, glycosides, tannic acid and saponins while absence of alkaloids, steroids and anthraquinones. The TPC was found in appreciable concentration (41.03 mg gallic acid equivalent (GAE)/g) in extract obtained by 4h methanolic mercerization. Long refluxing technique (4h refluxing) was found unfavorable to some extent as it resulted only 33.69 mg GAE/g TPC in methanolic extract. Anyhow the extraction with water using mercerization and refluxing techniques found least effective e.g. 4h mercerization and refluxing showed 14.14 and 18.16 mg GAE/g respectively. Antibacterial assay showed extract obtained by 4h and 2h methanolic mercerization have good potential to inhibit the growth (09.6+-0.7 to 18.5+-0.8 mm) of infection causing bacteria. The results of antioxidants and antibacterial in vitro assays advocated that 4h methanolic mercerization is an effective extraction technique. Therefore, it could be concluded that methanolic mercerization is a technique of maximum extraction of phenolics and bioactive constituents. (author)

  1. Control of cucumber (Cucumis sativus L. tolerance to chilling stress – evaluating the role of ascorbic acid and glutathione

    Directory of Open Access Journals (Sweden)

    Alexander S. Lukatkin

    2014-12-01

    Full Text Available Chilling temperatures (1-10 ºC are known to disturb cellular physiology, cause oxidative stress via creating imbalance between generation and metabolism of reactive oxygen species (ROS leading finally to cell and/or plant death. Owing to known significance of low molecular antioxidants - ascorbic acid (AsA and glutathione (GSH in plant stress-tolerance, this work analyzes the role of exogenously applied AsA and GSH in the alleviation of chilling stress (3°C-impact in cucumber (Cucumis sativus L. cv. Vjaznikowskij 37 plants. Results revealed AsA and GSH concentration dependent metabolism of ROS such as superoxide (O2•‾ and the mitigation of ROS-effects such as lipid peroxidation (LPO as well as membrane permeability (measured as electrolyte leakage in C. sativus leaf discs. AsA concentration (750 µM and GSH (100 µM exhibited maximum reduction in O2•‾ generation, LPO intensity as well as electrolyte leakage, all of these were increased in cold water (3°C and 25°C-treated leaf discs. However, AsA, in particular, had a pronounced antioxidative effect, more expressed in case of leaf discs during chilling (3°C; whereas, at temperature 25°C, some AsA concentrations (such as 50 and 100 mM AsA exhibited a prooxidative effect that requires molecular-genetic studies. Overall, it is inferred that AsA and GSH have high potential for sustainably increasing chilling-resistance in plants.

  2. SELDI-TOF MS-based discovery of a biomarker in Cucumis sativus seeds exposed to CuO nanoparticles.

    Science.gov (United States)

    Moon, Young-Sun; Park, Eun-Sil; Kim, Tae-Oh; Lee, Hoi-Seon; Lee, Sung-Eun

    2014-11-01

    Metal oxide nanoparticles (NPs) can inhibit plant seed germination and root elongation via the release of metal ions. In the present study, two acute phytotoxicity tests, seed germination and root elongation tests, were conducted on cucumber seeds (Cucumis sativus) treated with bulk copper oxide (CuO) and CuO NPs. Two concentrations of bulk CuO and CuO NPs, 200 and 600ppm, were used to test the inhibition rate of root germination; both concentrations of bulk CuO weakly inhibited seed germination, whereas CuO NPs significantly inhibited germination, showing a low germination rate of 23.3% at 600ppm. Root elongation tests demonstrated that CuO NPs were much stronger inhibitors than bulk CuO. SELDI-TOF MS analysis showed that 34 proteins were differentially expressed in cucumber seeds after exposure to CuO NPs, with the expression patterns of at least 9 proteins highly differing from those in seeds treated with bulk CuO and in control plants. Therefore, these 9 proteins were used to identify CuO NP-specific biomarkers in cucumber plants exposed to CuO NPs. A 5977-m/z protein was the most distinguishable biomarker for determining phytotoxicity by CuO NPs. Principal component analysis (PCA) of the SELDI-TOF MS results showed variability in the modes of inhibitory action on cucumber seeds and roots. To our knowledge, this is the first study to demonstrate that the phytotoxic effect of metal oxide NPs on plants is not caused by the same mode of action as other toxins. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Benefits from Bio and organic fertilization by cucumber (Cucumis Sativus) with application of 15N stable isotope

    International Nuclear Information System (INIS)

    Galal, Y. G. M.; Soliman, S. M.; Ahmed, F. A.; El-Sherbiny, A. E. A.; Dahdouh, S. M.

    2012-12-01

    Benefits from bio and organic fertilizer were evaluated under cucumber (Cucumis Sativus) crop grown on sandy soil at a field scale. The experiment was conducted under drip irrigation system. Fertilization treatment indicated that the combination of 50% mineral fertilizer (MF) + 50% organic compost (OC) was superior over all other fertilization treatment when the fresh weight of cucumber biomass or fruits was considered. It means that half of the recommended dose of of mineral fertilizer is enough to meet the requirement of cucumber crop when supplemented with organic compost. Nitrogen derived from mineral fertilizer (Ndff) by cucumber at different plant growth stages was significantly affected by the rate of addition and enhanced with microbial inoculation. Arbuscular mycorrhizea (AMF) was superior over Azospirillum and Rhizobium inoculations. The enhancement of Ndff uptake by plants was more pronounced at the fruit stage than at vegetative, flowering and hay growth stages. The highest values of Ndfa were induced by Rhizobium at hay stage followed by fruit. Similar trend, but to different extents was noticed with AMF and Azospirillum inoculum s. Most of nitrogen derived from compost (Ndfc) was occurred by addition of 50% MF + 50% Oc. Rhizobium and AMF were more effective than Azospirilum. High quantities of Ndfc were recognized at hay stage compared to other growth stages.The efficient use of mineral fertilizer-N (%NUE) was increased by addition of half:half mineral and organic fertilizer. Similarly, it seems that microbial inoculation in general has a synergistic effect on enhancement of %NUE. Higher NUE occurred at hay growth stage than others. (Author)

  4. [Effects of temperature regime on low-light tolerance of Cucumis sativus seedling leaves in their photosynthesis].

    Science.gov (United States)

    Li, Wei; Sui, Xiao-lei; Zhang, Zhen-xian

    2008-12-01

    In a phytotron, the effects of three temperature regimes (day/night 25 degrees C/18 degrees C, optimal temperature; 15 degrees C/9 degrees C, suboptimal temperature; and 9 degrees C/7 degrees C, low temperature) on the low-light (75-85 micromol x m(-2) x s(-1)) tolerance of two Cucumis sativus cultivars (shade-susceptible Jinyan 2 and shade-tolerant Deltastar) seedling leaves in their photosynthesis were studied. The results showed that under low light, the SPAD, net photosynthesis rate (Pn), stomatal conductance (Gs), transpiration rate (Tr), water use efficiency (WUE), actual photochemical efficiency of PS II in the light (phi(PS II)), and photochemical quenching of chlorophyll fluorescence (q(p)) of cucumber leaves decreased, with the decrement getting more with decreasing temperature, while the superoxide dismutase (SOD), peroxidase (POD) and catalase (CAT) activities were in adverse. During the recovery process after low-light stress relieved, the parameters of gas exchange and chlorophyll fluorescence of the leaves recovered gradually, and the recovery of some gas exchange parameters lagged to that of chlorophyll fluorescence parameters. Under low light, the lower the temperature, the more damage the photosynthesis apparatus suffered, and the lesser tolerance to low light the cucumber leaves had in their photosynthesis. During the low temperature and low light treatment period, the decrease of Pn, phi(PS II), and q(p) was more obvious for Jinyan 2 than for Deltastar; and during the relief period, the recovery of these parameters was slower for Jinyan 2 than for Deltastar. It was indicated that Jinyan 2 had weaker tolerance to low temperature and/or low light in its photosynthesis than Deltastar.

  5. Talleres de Genero con grupos de adolescentes y mujeres

    Directory of Open Access Journals (Sweden)

    Teresa Kleba Lisboa

    2010-07-01

    Full Text Available Este articulo presenta los resultados de lo Proyecto de Extensión intitulado “Oficinas de Genero con Grupo de Adolescentes y Mujeres” realizado en los Barios Mont Serrat y Jardin Zanelato en la Ciudad de Florianópolis/SC. Del mes de marzo a diciembre de 2008, fueran trabajadas quincenalmente, Talleres con diversas temáticas como “violencia en contra las mujeres, “cuerpo y sexualidad”, “modelos de familia”, y otras, a través de dinámicas que propiciaran la participación de las adolescentes y mujeres objetivando su emancipación. La intervención del Trabajo Social ha proporcionado para las estudiantes y para la maestra una experiencia práctica muy importante y innovadora a la vez que colocamos nuestro saber a lo servicio de las personas excluidas.

  6. Homicidas juveniles en Bogotá, estudio de grupos focales

    Directory of Open Access Journals (Sweden)

    Franklin Escobar Córdoba

    2015-07-01

    Materiales y Métodos. Estudio cualitativo mediante técnica de grupos focales. Resultados. Se encontró como el factor de riesgo más implicado la disponibilidad y uso de armas. Otros  factores de riesgo determinantes de la conducta delincuencial afectan la disposición del joven homicida para tener un comportamiento criminal y las estrategias de control que son elegidas por el individuo, dichos factores son apreciados de maneras distintas por los jóvenes homicidas y los no homicidas Conclusión. Este estudio arroja información clave que puede ser utilizada en el diseño e implementación de estrategias para enfrentar el homicidio juvenil como problema de salud pública.

  7. OS GRUPOS INDÍGENAS E OS DOCES BRASILEIROS

    Directory of Open Access Journals (Sweden)

    MÁRTIN CÉSAR TEMPASS

    2008-12-01

    Full Text Available ABSTRACT: In the books of Gilberto Freyre and Câmara Cascudo, that influencied so much the literature about brazilian alimentation, the participation of indigenous groups in the national sweets formation process is negligencied. However, is possible to find in book´s“interlineations” of these two authors valuables informations about indigenous contributions to this process. Starting from these two authors and based in the culinary system notion, this paper quests to situate the role of indigenous groups in the brazilian sweets formation and numbers the possibles causes to invisibility of sweets by indigenous at the culinary formation process.RESUMO: Nas obras de Gilberto Freyre e Câmara Cascudo, que tanto influenciaram a literatura sobre a alimentação brasileira, a participação dos grupos indígenas no processo de formação da doçaria nacional é negligenciada. Contudo, é possível encontrar nas“entrelinhas” das obras destes dois autores valiosas informações sobre as contribuições indígenas a este processo. A partir destes dois autores e baseado na noção de sistemas culinários, o presente artigo busca situar o papel dos grupos indígenas na formação da doçaria brasileira e elencar as possíveis razões para a invisibilidade da doçaria de origem indígena no processo de formação da culinária nacional.

  8. VALORACIÓN DE ATRIBUTOS DE CALIDAD EN PEPINO (Cucumis sativus L. FORTIFICADO CON VITAMINA E VALORAÇÃO DE ATRIBUTOS DE QUALIDADE EM PEPINO (Cucumis sativus L. FORTIFICADO COM VITAMINA E VALUATION OF QUALITY ATTRIBUTES IN CUCUMBER (Cucumis sativus L. FORTIFIED WITH VITAMIN E

    Directory of Open Access Journals (Sweden)

    MISAEL CORTÉS

    2011-06-01

    Full Text Available El objetivo de este trabajo fue desarrollar un producto mínimamente procesado fortificado con vitamina E, a partir de pepino (Cucumis sativus L, utilizando la ingeniería de matrices. Rodajas impregnadas al vacío (IV con DL-α-tocoferol acetato emulsificado en una fase acuosa isotónica al pepino (NaCl al 1%, son evaluadas en cuanto a propiedades fisicoquímicas, color, textura, estabilidad de la vitamina E y sensorialmente, por influencia del proceso, tiempo de almacenamiento y envasado (con y sin vacío. La vitamina E se cuantifica por HPLC (% del valor diario recomendado (VDR/100 g de pepino fresco, según la norma Colombiana. La respuesta IV alcanza niveles de 6.05±1.49%, correspondiente a 33.3±5.8 mg vitamina E y 110.5±19.1% VDR en 100 g de pepino fresco. Durante el almacenamiento en 9 días se presenta una pérdida aproximadamente del 50%, debido a la poca retención de la emulsión en el interior de la matriz. Los parámetros fisicoquímicos, el color y la textura son afectados por la IV, el tiempo y el envasado, siendo durante el almacenamiento más oscuras y más resistentes que el producto fresco. La ingeniería de matrices representa una metodología efectiva para fortificar el pepino con vitamina E.O objetivo deste estudo foi desenvolver um produto mínimamente processado fortificado com vitamina E, a partir de pepino (Cucumis sativus L, utilizando a engenharia de matrizes. Fatias de pepino foram impregnadas a vácuo (IV com DL-α- acetato de tocoferol emulsificado numa fase aquosa isotónica (NaCl a 1%, e foram avaliadas quanto às propiedades fisico-químicas, cor, textura, estabilidade da vitamina E e sensorialmente, tendo em consideração os factores: processo, tempo de armazenamento e envasado (com e sem vácuo. A vitamina E quantificou-se por HPLC (% do Valor Diario Recomendado (VDR/100 g de pepino fresco, de acordo com a norma Colombiana. A resposta à IV alcanzou niveis de 6.05±1.49%, correspondente a 33.3±5.8 mg

  9. Diferencias conductuales y cognitivas en dos grupos de escolares con TDAH intervenidos con Arteterapia -vsMetilfenidato y un grupo control

    Directory of Open Access Journals (Sweden)

    M. Aurora G. Gallardo Saavedra

    2018-01-01

    el WISC-IV. Resultados. Se encontraron diferencias conductuales al inicio inter grupos en 4 subescalas y después del tratamiento en 5, en “hiperactividad” para el grupo “A” y funciones ejecutivas en el “B”, los cambios cognitivos en el índice de comprensión verbal entre “B” y ”C” e Índice de velocidad de procesamiento para el grupo “A”. Discusión y conclusiones los resultados sugieren que el arteterapia podría mejorar la conducta pero no la cognición.

  10. Grupos avicaptores del Tardiglaciar : las aves de Berroberria

    Directory of Open Access Journals (Sweden)

    C. Diez Fernandez-Lomana

    1995-01-01

    Full Text Available En este artículo presentamos un estudio sobre marcas de cortes en aves de Berroberria. Los restos proceden de un nivel Magdaleniense superior final datable mediante C14 y con la ayuda de estudios palinológicos y arqueológicos. Los restos avianos pertenecen a la especie Lagopus mutus (perdiz nival y evidencian la caza de esta especie por grupos humanos. El estudio realizado plantea la existencia de poblaciones que recurrían a la caza de aves en épocas del año concretas, las cuales desarrollaron una estrategia de descuartizamiento primario en el lugar de caza y de descarnación en la cavidad. La ausencia de restos avianos quemados, y la minuciosidad en el desmembramiento y deshuesado, implican una búsqueda de carne aviar para un consumo no inmediato. Se postula un acopio de carne, con técnicas de secado y ahumado, para ulteriores necesidades alimenticias, ligadas al encarecimiento de los recursos durante el invierno. Las especies avianas presentes aportan algunas notas sobre las consiciones climáticas que imperaban en la zona.

  11. COMPETENCIAS EN ESCRITURA DE UN GRUPO DE ESTUDIANTES DE LA

    Directory of Open Access Journals (Sweden)

    Myriam Pastora Arias Agudelo

    2012-12-01

    Full Text Available Se presentan los resultados del análisis de las habilidades en escritura de un grupo de estudiantes de la Facultad de Odontología de la Universidad Nacional de Colombia. Se evaluaron las características gramaticales de coherencia y cohesión en textos académicos escritos en la asignatura Ortodoncia, Crecimiento y Desarrollo. Se utilizó un formato en programa Word®, que fue diligenciado por los estudiantes. Se empleó una plantilla para revisión de textos académicos y los datos obtenidos se incluyeron en Excel®. Se realizó el análisis estadístico con el paquete SPSS Versión 19® y con el fin de corroborar la relación entre algunas de las variables cuantitativas e identificar patrones de asociación entre pares de variables cualitativas, se realizaron seis cruces bivariados y cinco multivariados. Los resultados reflejan competencias gramaticales bajas (0-35% que limitan las capacidades de los estudiantes para expresar ideas de forma adecuada a través de textos académicos.

  12. COMPETENCIAS EN ESCRITURA DE UN GRUPO DE ESTUDIANTES DE LA

    Directory of Open Access Journals (Sweden)

    Myriam Pastora Arias Agudelo

    2012-07-01

    Full Text Available Se presentan los resultados del análisis de las habilidades en escritura de un grupo de estudiantes de la Facultad de Odontología de la Universidad Nacional de Colombia. Se evaluaron las características gramaticales de coherencia y cohesión en textos académicos escritos en la asignatura Ortodoncia, Crecimiento y Desarrollo. Se utilizó un formato en programa Word®, que fue diligenciado por los estudiantes. Se empleó una plantilla para revisión de textos académicos y los datos obtenidos se incluyeron en Excel®. Se realizó el análisis estadístico con el paquete SPSS Versión 19® y con el fin de corroborar la relación entre algunas de las variables cuantitativas e identificar patrones de asociación entre pares de variables cualitativas, se realizaron seis cruces bivariados y cinco multivariados. Los resultados reflejan competencias gramaticales bajas (0-35% que limitan las capacidades de los estudiantes para expresar ideas de forma adecuada a través de textos académicos.

  13. Inseguridad alimentaria en latinos de California: observaciones de grupos focales

    Directory of Open Access Journals (Sweden)

    Melgar-Quiñonez Hugo

    2003-01-01

    Full Text Available OBJETIVO: Estudiar la percepción y la experiencia sobre inseguridad alimentaria entre latinoamericanos de California, así como su interpretación de los insumos incluidos en la Escala de Seguridad Alimentaria. MATERIAL Y MÉTODOS: Entre noviembre y diciembre de 2000, en los condados californianos de Solano y San Joaquín, se efectuaron cuatro grupos focales, con 30 adultos de origen latinoamericano residentes allí. Los comentarios de los participantes fueron codificados por dos investigadores para determinar los temas principales, y fueron confrontados para verificar su convergencia. RESULTADOS: Las preguntas fueron bien comprendidas, no percibiéndose como ofensivas. El marco conceptual se confirmó como "proceso manejado" con diferentes niveles de severidad. Las causas de inseguridad alimentaria identificadas fueron: desempleo, alto costo de algunos alimentos y falta de información nutricional. La necesidad de educación nutricional fue una constante. CONCLUSIONES: Para interpretar datos nacionales de inseguridad alimentaria en latinoamericanos es esencial considerar su percepción particular de ese fenómeno.

  14. El desarrollo de la identidad de grupo andaluza

    Directory of Open Access Journals (Sweden)

    Marina Apaydin

    2014-07-01

    Full Text Available A lo largo de sus 700 años de historia, Al-Andalus tuvo de forma consistente la imagen de “Paraíso terrenal” a pesar de sus continuos problemas económicos, sociales y políticos y amenazas externas. Este estudio intenta explicar cómo se creó la Identidad Andaluza, cuáles fueron sus principales características, porqué se consideraron un grupo que desarrollaba admiración y cómo esta información ha sido mantenida y transmitida a lo largo del tiempo. Esta investigación tuvo lugar en 2005 en el Sur de España, zona antaño llamada Al-Andalus. Una combinación de fuentes primarias y secundarias, junto a artefactos visuales de naturaleza histórica sirven de base para este análisis. La base teórica para este trabajo fue desarollada utilizando diferentes teorías sociales de los autores Bourdieu, Ringrose, Piaget, Cavalli-Sforza y Maslow.

  15. Geologia e quimioestratigrafia do Grupo Vazante em Lagamar (Minas Gerais, Brasil)

    OpenAIRE

    Carla Sofia de Sousa Marques

    2015-01-01

    Este trabalho tem como base um mapeamento geologico na escala 1:50.000 de uma area de 400km2 nos arredores da cidade de Lagamar (MG) e um estudo de perfis quimioestratigraficos com isotopos estaveis de 13C, 18O e 87Sr/86Sr nas formacoes Lagamar e Rocinha do Grupo Vazante. Na regiao afloram rochas da porcao basal do Grupo Vazante, em contato tectonico com o Grupo Bambui. Foram identificadas as formacoes Santo Antonio do Bonito, Rocinha, Lagamar e Serra do Garrote no Grupo Vazante, e no Grup...

  16. Los grupos de crecimiento: camino hacia la autorrealización

    OpenAIRE

    Sierra, Gabriela; Quiroz, Lourdes

    1993-01-01

    Se profundiza en el conocimiento de las acciones facilitadoras de los procesos de autorrealización y desarrollo humano a través del trabajo realizado durante dos años con un grupo de crecimiento. Se abordan los grupos de crecimiento a través del existencialismo, el psicoanálisis y la psicología social y humanista. Se examina el concepto de crecimiento, las distintas etapas de un grupo de crecimiento, y se presentan conclusiones sobre el desarrollo personal en este tipo de grupos. Se incluye o...

  17. Compensation effect of bacterium containing biofertilizer on the growth of Cucumis sativus L. under Al-stress conditions.

    Science.gov (United States)

    Tóth, Brigitta; Lévai, L; Kovács, B; Varga, Mária Borbélyné; Veres, Szilvia

    2013-03-01

    Biofertilizers are used to improve soil fertility and plant production in sustainable agriculture. However, their applicability depends on several environmental parameters. The aim of our study was to evaluate the effect of free-living bacteria containing fertilizer on the growth of cucumber (Cucumis sativus L. cvs. Delicates) under aluminium (Al) stress. Different responses to Al stress of cucumber growth parameters were examined in terms of root elongation and physiological traits, such as Spad index (relative chlorophyll value), biomass accumulation of root and shoot, Al uptake and selected element contents (Fe, Mn, Zn, Mg) of leaves and root. The applied bacteria containing biofertilizer contains Azotobacter chroococcum and Bacillus megaterium. The dry weights of cucumber shoots and roots decreased in line with the increasing Al concentration. Due to different Al treatments (10-3 M, 10-4 M) higher Al concentration was observed in the leaves, while the amounts of other elements (Fe, Mn, Zn, Mg) decreased. This high Al content of the leaves decreased below the control value when biofertilizer was applied. In the case of the roots the additional biofertilizer treatments compensated the effect of Al. The relative chlorophyll content was reduced during Al-stress in older plants and the biofertilizer moderated this effect. The root/shoot ratio was decreased in all the Al-treatments in comparison to the control. The living bacteria containing fertilizer also had a modifying effect. The root/shoot ratio increased at the 10-4 M Al2(SO4)2 + biofertilizer and 10-4 M Al(NO3)3 + biofertilizer treatments compared to the control and Al-treatments. According to our results the biofertilizer is an alternative nutrient supply for replacing chemical fertilizers because it enhances dry matter production. Biofertilizer usage is also offered under Al polluted environmental conditions. Although, the nutrient solution is a clean system where we can examine the main processes without

  18. La financiarización de los grupos de comunicación en España: el caso del grupo PRISA

    OpenAIRE

    Almiron, Núria

    2006-01-01

    La presente comunicación tiene por objeto describir la creciente financiarización de los grupos de comunicación en España a través del caso del grupo PRISA, financiarización que se constituye en rasgo definitorio de la evolución reciente de los sistemas de medios en los sistemas capitalistas avanzados.

  19. El carácter híbrido de las dinámicas grupales online: del grupo de discusión al grupo focal

    Directory of Open Access Journals (Sweden)

    Francisco Javier Parada Dueñas

    2013-07-01

    Full Text Available Este artículo reflexiona sobre formas de acceder a la realidad social a través del uso de metodologías de investigación online que tienen características híbridas. Primero se dan algunas claves para la construcción y ejecución de grupos de discusión en un contexto online. Una de las características centrales de esta técnica es su composición híbrida, moviéndose entre lo que sería un grupo de discusión y un grupo focal. El paso de la mediación a la conducción marca fuertemente la transición de una fase de grupos de discusión a una fase de grupo focal. Segundo, se reflexiona sobre Facebook y algunos posibles usos que se le puede dar a esta red social digital con la finalidad de llevar a cabo de mejor manera técnicas de investigación aplicadas al contexto online. En este sentido, se reflexiona sobre el avatar o perfil de Facebook en dos direcciones: para efectos de la composición muestral de un grupo de discusión online y como material que ayuda al análisis de las posiciones discursivas que tienen los sujetos estudiados.

  20. Prueba de grupo. Una eficiente alternativa para estimar prevalencia animal

    Directory of Open Access Journals (Sweden)

    Osval Antonio Montesinos López

    2012-01-01

    Full Text Available La estimación de prevalencia animal o detección de agentes infecciosos, es de vital importancia para una nación o estado para proteger su seguridad alimentaria y garantizar el comercio local y exterior. Sin embargo, realizar estas dos tareas (estimación y detección eficientemente requiere de significativos recursos materiales y humanos. Por ello, el presente artículo presenta una revisión del proceso de estimación y detección usando la técnica estadística conocida como prueba de grupo (group testing que puede contribuir al ahorro de recursos cuantiosos para la estimación y detección de enfermedades infecciosas en ciencia animal cuando la prevalencia es menor o igual al 10%. Group testing es una ingeniosa técnica estadística propuesta por Dorfman (1943. Esta técnica consiste en juntar el material de k individuos, mezclarlos perfectamente y en lugar de realizar una prueba de laboratorio para cada individuo, se realiza una sola prueba con la mezcla de los k individuos. De esta forma se logran ahorros significativos. Por ello, se muestra el funcionamiento de algunos métodos para clasificar individuos; se expone el proceso de estimación puntual y por intervalo de prevalencia animal; y se ilustra el cálculo del tamaño de muestra bajo este modelo, con la finalidad de que los investigadores en ciencia animal la utilicen y ahorren recursos significativos.

  1. La perspectiva de la minoría: estereotipos y emociones entre grupos inmigrantes

    Directory of Open Access Journals (Sweden)

    Isabel Cuadrado

    Full Text Available Este trabajo se centra en la perspectiva de la minoría, y analiza las evaluaciones que los tres grupos inmigrantes más representativos en España mantienen entre sí a partir de las variables contempladas en el modelo del contenido de los estereotipos (MCE. Participaron 409 inmigrantes, que evaluaron a los otros dos grupos: los inmigrantes marroquíes fueron evaluados por ecuatorianos (grupo EM, N = 66 y rumanos (RM, N = 76; los inmigrantes rumanos por ecuatorianos (ER, N = 65 y marroquíes (MR, N = 62; y los inmigrantes ecuatorianos por rumanos (RE, N = 80 y marroquíes (ME, N = 60. Todos ellos indicaron cómo percibían al grupo correspondiente en moralidad, sociabilidad y competencia, en qué grado experimentaban las emociones de admiración, desprecio, envidia y compasión, así como su percepción de estatus y competición exogrupal. Los resultados con grupos minoritarios apoyan, en general, las predicciones del MCE ya confirmadas con miembros de grupos mayoritarios. El grupo más valorado en estatus y estereotipos fue el ecuatoriano (coincidiendo con las valoraciones de la mayoría, el cual también despertaba más admiración. Los resultados se discuten abordando la aplicabilidad del MCE para analizar las relaciones entre grupos minoritarios.

  2. El origen de la teoría de grupos: el teorema de lagrange (1771)

    OpenAIRE

    Roth, Richard

    2012-01-01

    En la actualidad, la teoría de grupos se estudia de una manera abstracta y sistemática; es decir, primero se da la definición abstracta de grupo, luego se ilustra esta definición, con unos ejemplos y se sigue con la demostración de varios Teoremas.

  3. Grupos económicos y productividad en Colombia, una mirada a la encuesta anual manufacturera

    Directory of Open Access Journals (Sweden)

    María Fernanda Murcia-Sandoval

    2011-06-01

    Full Text Available Este trabajo muestra las diferencias en la productividad entre los establecimientos industriales que pertenecen a empresas de grupos económicos colombianos y los establecimientos de empresas independientes para el periodo 1995-2006. Si bien la productividad es más alta para los establecimientos de grupos que para los individuales, esto se debe a que las empresas de los grupos se encuentran en sectores con mayor productividad y no al efecto de pertenencia a grupo que, de hecho, resulta negativo en un análisis de datos panel. De otro lado, los establecimientos de grupos tienden a invertir más en activos fijos que los independientes.

  4. Allelopathic influence of aqueous extracts from the leaves of Morus alba L. on seed germination and seedling growth of Cucumis sativus L. and Sinapsis alba L.

    Directory of Open Access Journals (Sweden)

    Katarzyna Możdżeń

    2014-04-01

    Full Text Available The aim of the present study was to elucidate impact of the aqueous extracts from leaves of Morus alba L. on germination, growth and photosynthetic activity of Cucumis sativus L. and Sinapis alba L. Plants were grown for 21 days at the temperature 25°C (day and 18°C (night, within 12/12 hours photoperiod, light intensity 150 μmol·m-2·s-1 and relative humidity 60-70% (day/night. Our experiments proved that allelopathic compounds in aqueous extracts of the leaves M. alba at high concentrations, reduce power and energy of germination. Biometric analysis of seedlings and adult plants grown showed that allelopathic substances have stimulating or inhibiting function depending on the stage of treatment. Moreover, they cause changes in chlorophyll contents and activity of photosystem II (PS II.

  5. Grupo escolar en Irurzun - Navarra - España

    Directory of Open Access Journals (Sweden)

    Guibert Tabar, J.

    1978-10-01

    Full Text Available The formal characteristics of this school complex are determined by the large roofs and the angled shape of the floorplans. The first is as a consequence of the interest in achieving a unity of concept and volume, at the same time maintaining the architectural tradition of the area. Insofar as the angular shape, this is the response to the idea of obtaining ideal conditions of light in each of the classrooms. The building consists of three upper levels, ground floor and semi-basement. In the last of these are found: the gymnasium, the dressing rooms for students and the technical premises serving the school. The ground floor, where the main access is found, includes a small administrative area, the dining room and kitchen, one classroom for girls, three for pre-school children, four for boys and one multifunctional room. The rest of the floors, with the same arrangement, house eight classrooms for girls and five for boys, along with a series of auxiliary premises, such as teachers' rooms, libraries, classrooms for various uses, archives, rooms for crafts, etc. . The construction is completed with an ample sports area and recreation zone.

    Las características formales de este grupo escolar —proyectado en 1969— vienen determinadas por las grandes cubiertas y la forma dentada de las plantas. La primera de ellas es consecuencia del interés por lograr una unidad de concepto y de volumen, manteniendo, al mismo tiempo, la tradición arquitectónica de la zona. En cuanto a la forma dentada, es la respuesta a la idea de obtener unas óptimas condiciones de iluminación en cada una de las aulas. El edificio se compone de tres niveles superiores, planta baja y semisótano. En este último se hallan: el gimnasio, los vestuarios de alumnos y los locales técnicos que sirven a la escuela. La planta baja, en la que se encuentra el acceso principal, comprende una pequeña zona administrativa, el comedor con su cocina, una clase de niñas, tres

  6. Vitamin D deficiency is associated with ethnicity and knee pain in a multi-ethnic South-East Asian nation: Results from Malaysian Elders Longitudinal Research (MELoR).

    Science.gov (United States)

    Mat, Sumaiyah; Jaafar, Mohamad Hasif; Sockalingam, Sargunan; Raja, Jasmin; Kamaruzzaman, Shahrul Bahyah; Chin, Ai-Vyrn; Abbas, Azlina Amir; Chan, Chee Ken; Hairi, Noran Naqiah; Othman, Sajaratulnisah; Cumming, Robert; Tan, Maw Pin

    2018-05-01

    To determine the association between vitamin D and knee pain among participants of the Malaysian Elders Longitudinal Research (MELoR) study. This was a cross-sectional study from the MELoR study consisting of a representative group of 1011 community-dwelling older persons (57% female), mean age 86.5 (54-94) years; 313 were Malays, 367 Chinese and 330 Indians. Participants were asked if they had knee pain. Levels of serum 25-hydroxy cholecalciferol (25-[OH]D), an indicator of vitamin D status, were measured using routine laboratory techniques. In unadjusted analysis, presence of knee pain was significantly associated with vitamin D deficiency (odds ratio [OR] 1.42; 95% confidence interval (CI) 1.08-1.85, P 0.011). Vitamin D levels were significantly associated with ethnicity differences where Malays (OR 7.08; 95% CI 4.94-10.15) and Indians (OR 6.10; 95% CI 4.28-9.71) have lower levels of vitamin D compared to Chinese. Subsequent multivariate analysis revealed that the association between vitamin D deficiency and knee pain was confounded by ethnic differences. A previous study suggested that vitamin D deficiency was associated with knee pain. This relationship was reproduced in our study, but we further established that the association was explained by ethnic variations. As vitamin D status is dependent on skin tone, diet and sunlight exposure, which are all effected by ethnicity, future studies are now required to determine whether a true relationship exists between vitamin D and knee pain. © 2018 Asia Pacific League of Associations for Rheumatology and John Wiley & Sons Australia, Ltd.

  7. MOTRICIDAD EN UN GRUPO DE PERSONAS CON NECESIDADES EDUCATIVAS ESPECIALES

    Directory of Open Access Journals (Sweden)

    P. Linares

    2010-09-01

    Full Text Available

    RESUMEN

    Aunque va incrementándose la literatura sobre una materia tan incipiente como la “Actividad Motriz Adaptada”, aún son escasos en nuestro país los estudios que abordan científicamente este tema. Así pues, en este artículo se presenta un trabajo de investigación basado en la actividad motriz, y que fue llevado a cabo con un alumnado que tiene necesidades educativas especiales.
    Siendo el propósito del presente estudio, el valorar los niveles motor y cognitivo-motriz alcanzados por un grupo de alumnos/as con discapacidad psicofísica, tras intervenir con un programa de actividad motriz adaptada.
    La programación estuvo enmarcada dentro de la reforma del Sistema educativo, y basada en las directrices que establece el MEC (1995 para el alumnado escolarizado en Centros de Educación Especial.
    El diseño experimental utilizado fue de tipo “intrasujeto” con medidas pretest y postest. Las variables dependientes estudiadas fueron la edad motriz y el nivel cognitivo-motor, y la independiente el propio Programa de Actividad Motriz Adaptada.
    Los resultados obtenidos fueron significativos en favor de un incremento de los aspectos motores y cognitivomotrices de todos los sujetos. Lo que nos permite concluir la importancia que tiene la Motricidad para este alumnado con necesidades educativas especiales permanentes.
    PALABRAS CLAVE: Necesidades educativas especiales, niños/as, aspectos cognitivo-motrices, adaptación curricular significativa, actividad motriz adaptada

     

    ABSTRACT

    Although literature about an incipient subject like “Adapted Motor Activity” increases day by day, the studies which approach in a scientific way this subject are not many in our country. So, in this article a research based on motor activity is

  8. Abordagem do enfermeiro no grupo educativo com gestantes candidatas à laqueadura

    Directory of Open Access Journals (Sweden)

    Arlete de Souza Barros

    1993-06-01

    Full Text Available Enfocamos neste trabalho a abordagem do enfermeiro enquanto coordenador de grupo educativo com gestantes candidatas à laqueadura. Enfatizamos a necessidade de um referencial teórico específico para trabalharmos com grupos de pacientes. Queremos evidenciar também o papel de educador inerente ao enfermeiro e a importância da sua atuação na equipe multiprofissional da área de saúde. A metodologia do grupo educativo é suscintamente descrita, na forma de um protocolo, que apresentamos como sugestão para o desenvolvimento de atividades semelhantes.

  9. App para promoción de artistas y grupos musicales

    OpenAIRE

    Pazos Buceta, José Ángel

    2015-01-01

    La idea general inicial se basa en desarrollar una app para dispositivos Android que permita promocionar a artistas y grupos musicales. Lo que se pretende es crear una red social especializada tipo consumidor/productor donde los artistas o grupos podrán publicar su proyecto musical y los fans o usuarios en general podrán seguir la trayectoria de cualquier grupo o artista. En consecuencia, esta app contemplará dos tipos de usuarios: activos, los que generan contenido, y pasivos, que sólo co...

  10. Filogenia e filogeografia do grupo Bothrops neuwiedi (Serpentes, Squamata)

    OpenAIRE

    Tais Machado

    2015-01-01

    O grupo Bothrops neuwiedi é composto por serpentes neotropicais que desempenham grande impacto na saúde pública, em decorrência de acidentes ofídicos. O grupo apresenta ampla distribuição ao longo da diagonal seca de formações abertas, desde o nordeste do Brasil até o noroeste da Argentina. A taxonomia atual, baseada principalmente em dados morfológicos qualitativos, não recupera as linhagens evolutivas apontadas pelas abordagens moleculares. O objetivo deste trabalho foi investigar o grupo B...

  11. Completamentos Pro-p de grupos de dualidade de Poincaré

    OpenAIRE

    Igor dos Santos Lima

    2012-01-01

    Resumo: Neste trabalho, nos Teoremas Principais, damos condições suficientes para que o completamento pro-p de um grupo abstrato PDn seja virtualmente um grupo pro-p PDs para algum s ? n - 2 com n ? 4. Esse resultado é uma generalização do Teorema 3 em [K-2009]. Nossa prova é baseada em [K-2009] e nos resultados de A. A. Korenev [Ko-2004] e [Ko-2005]. Além disso, damos alguns exemplos de grupos que satisfazem as condições dos Teoremas Principais. ;;Abstract:In this work we give in the Main T...

  12. A pesquisa sobre envelhecimento humano no Brasil: grupos e linhas de pesquisa

    Directory of Open Access Journals (Sweden)

    Shirley Donizete Prado

    2004-01-01

    Full Text Available Descrevemos a pesquisa científica sobre envelhecimento humano no Brasil a partir da versão 4.1 do Diretório dos Grupos de Pesquisa no Brasil (2000 do Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq. O critério para a identificação dos grupos estudados foi o desenvolvimento de, pelo menos, uma linha de pesquisa referente ao envelhecimento humano, e a busca na base de dados foi realizada a partir de palavras-chave associadas ao envelhecimento humano. Foram identificados 144 grupos, 209 linhas de pesquisa e 511 pesquisadores. Discutimos as áreas de conhecimento em que se inserem estes grupos, o período de seu surgimento e sua distribuição geográfica e institucional.

  13. Grupos de poder, familia e Iglesia en Gran Canaria en el Siglo XVII: el clero femenino

    OpenAIRE

    Alemán Ruiz, Esteban

    1996-01-01

    [ES] Estudio del clero regular femenino en la isla de Gran Canaria en el siglo XVII, desde la perspectiva de las estrategias familiares y de los grupos de poder de la sociedad isleña en aquella centuria.

  14. Fotometría de grupos compactos de galaxias: Shakhbazian 37, 45, 166, 331 y 362

    Science.gov (United States)

    Campos, J. M.; Calderón, J. H.; Gimeno, N. G.; Díaz, R. J.

    Continuando con la fotometría CCD de Grupos de Galaxias Compactos de Shakhbazyan (SCGG) en este trabajo se presentan nuevos resultados preliminares sobre los grupos Shakbazyan 37, 45, 166, 331 y 362. EL objeto del proyecto es contribuir al estudio de las propiedades físicas de tales grupos y contribuir a las bases de datos para mejora de las estadísticas. Los datos fueron adquiridos con el Telescopio JKT del Observatorio Norte Europeo. El análisis de las imágenes en las bandas I y B como del índice de color B-I permitió reidentificar las galaxias catalogadas, resultando las mismas muy enrojecidas y verificando que predominan las galaxias tempranas, resultados consistentes con los obtenidos para otros grupos y por otros autores.

  15. Introducción a la teoría geométrica de grupos

    Directory of Open Access Journals (Sweden)

    Olga Salazar-Díaz

    2011-06-01

    Full Text Available En este artículo haremos una introducción a la teoría geométrica de grupos. Veremos cómo a partir de una presentación finita de un grupo, se puede dotar a dicho grupo de una estructura de espacio métrico; se discute la acción del grupo sobre dicho espacio y se estudian propiedades geométricas que se preservan bajo cuasi isometría. Abstract. In this article we will give an introduction to geometric group theory. We will see how from a finite presentation of a group, we can give this group a metric space structure. We discuss the action of the group on this space and we study geometric properties preserved under quasiisometry.

  16. Una alternativa para el diseño de experimentos con grupos intactos

    Directory of Open Access Journals (Sweden)

    Raúl Hernández-Heredia

    2017-11-01

    Full Text Available Se ofrece una variante de la proyección del trabajo experimental con grupos docentes intactos. Sobre la base de seis grupos intactos no equivalentes, se conforma un grupo experimental y otro de control, a partir de la técnica de pareamiento grupal. El pareamiento se desarrolló tomando como punto de partida un diagnóstico inicial de tres capacidades físicas básicas de trascendencia para el entrenamiento deportivo. Como resultado se obtuvieron dos grupos equivalentes (experimental y control y se garantizó el control de variables ajenas, imprescindible para minimizar el nivel de incertidumbre en el trabajo experimental.

  17. TTI Phase 2 Institutional Support: Grupo de Análisis para el Desarrollo

    International Development Research Centre (IDRC) Digital Library (Canada)

    TTI Phase 2 Institutional Support: Grupo de Análisis para el Desarrollo. This funding ... -test, refine, and develop new strategies for financial sustainability. Over this ... IWRA/IDRC webinar on climate change and adaptive water management.

  18. Fraccionamiento y estudio de subpoblaciones linfocitarias en distintos grupos de amígdalas palatinas

    OpenAIRE

    Sánchez Rozas, José Antonio

    2011-01-01

    Se ha estudiado en linfocitos de am??gdala de distintos grupos cl??nicos de amigdalitis la expresi??n de una amplia bacteria de anticuerpos monoclonales y otros marcadores con la finalidad de investigar la existencia o no en am??gdalas de c??lulas inmaduras previrgenes y determinar la secuencia madurativa de diferenciaci??n en distintos grupos cl??nicos de am??gdala.

  19. Frecuencia de grupos sanguíneos y factor Rh en donantes de sangre, Colombia ,1996

    Directory of Open Access Journals (Sweden)

    Mauricio Beltrán

    1999-03-01

    Full Text Available El establecer un patrón nacional de distribución de los grupos sanguíneos por seccionales de salud con base en los datos de donantes de banco de sangre, permite la localización e intercambio de sangre y componentes con fines de transfusión de una manera oportuna, mejora la disponibilidad de sangre y ofrece, además, información útil para áreas como las de genética para identificación personal y pruebas de paternidad, y en el campo antropológico para hallar diferencias raciales según su distribución. Con el fin de estimar la frecuencia y distribución de los grupos A, 8, AB y O y factor Rh por seccionales de salud en donantes de sangre, se analizó la información enviada durante 1996 por todos los bancos del país a la Coordinación Nacional de Bancos de Sangre con sede en el lnstituto Nacional de Salud. Se realizó un estudio descriptivo de la información, diferenciando por grupos sanguíneos y la presencia o ausencia del factor Rhesus. Durante 1996, los 180 bancos de sangre del país recolectaron 393.063 unidades de sangre; éstos reportaron los datos de pruebas de grupos sanguíneos A, B, AB , O y factor Rhesus de 338.063 (86% unidades; no se obtuvo información de las unidades restantes. Del total de unidades hemoclasificadas, 91,16% correspondió al factor Rhesus positivo; para este factor, la distribución por grupos sanguíneos fue de 56,2% para el grupo 0; 26,0% para el grupo A; 7,3% para el grupo B, y 1,4% para el grupo sanguíneo AB. El 8,83% de las unidades de sangre restantes correspondió al factor Rhesusne-a ativo. con una distribución por grupos sanguíneos de 5,1%'para el grupo 0; 2,7% para el grupo A; 0,7% para el grupo B, y para el grupo AB 0,31%. Los bancos de sangre de las seccionales de Antioquia, Caldas y San Andrés, reportaron la mayor proporción de unidades de sangre hemoclasificadas como factor Rhesus negativo. Esta información debe ser utilizada por todos los bancos de sangre, para ubicar e

  20. Assessment of General and Specific Combining Ability and Heterosis of Some Cucumber (Cucumis sativus L. Lines for Vegetative Traits

    Directory of Open Access Journals (Sweden)

    Fatemeh Moradipour

    2017-10-01

    Full Text Available Introduction: Cucumber (Cucumis sativus L. is one of the most widely cultivated vegetables. Plant length is a quantitative trait is controlled by many genes. These traits are difficult to study due to the complex nature of their inheritance. The combining ability estimation is useful in determining the breeding value of cucumber lines by suggesting the appropriate use in a breeding program. In studying combining ability, the most commonly utilized experimental approach is the diallel design. General combining ability is a measure of additive genetic action; and specific combining ability (SCA is deviation from additivity. General combining ability is a main effect and SCA is an interaction. The aim is to determine the breeding value of the cross. Heterosis has been utilized to exploit dominance variance through production of hybrids. There are reports on positive and negative heterosis in cucumber however, there are differences between reports. This research was conducted to estimate general and specific combining ability and heterosis in cucumber inbred lines and hybrids to produce hybrids with high yield and quality. Material and Methods: In the spring of 2014, the seven parental lines and their 21 F1 hybrid were planted at the University of Guilan, in loamy sand field. Three replications were arranged in a randomized complete block design. The sandy loam soil was prepared by plowing and disking and formed into raised beds by plowed and harrow prior to plant establishment. Rows were on 1 m centers and plants were about 25 cm apart in the row. Prior to planting 150 kg·ha-1 of nitrogen from urea and 100 kg·ha-1 of phosphorous from triple superphosphate and 80 kg·ha-1 of potassium sulfate was applied. Side dressing with the same amount of nitrogen and phosphorus occurred at 50% flowering stage. Irrigation with 250 m3·ha-1, three times weekly, was begun at plant first flowering. In each replication, 12 individuals of each line or hybrid were

  1. PORSUK NEHRİ SUYUNUN CUCUMIS SATIVUS (L. TOHUMLARININ FİDE GELİŞİMİ ÜZERİNE ETKİLERİNİN BELİRLENMESİ

    Directory of Open Access Journals (Sweden)

    Mehmet ÇALISEKİ

    2016-03-01

    Full Text Available Porsuk Çayı 448 km uzunluğu ile Sakarya Irmağı’nın en uzun koludur ve Bayatçık Deresi ile Kızıltaş Suyu’nun birleşmesi ile oluşur. Kütahya Ovası’ndan geçip Eskişehir’in güneybatısında yer alan Porsuk-I ve Porsuk-II barajlarında toplandıktan sonra Eskişehir Ovası’ndan ve Eskişehir ilinden geçer ve Sakarya Irmağı’na ulaşır. Porsuk Çayı, Eskişehir’de tarım arazilerinin sulama suyu olarak kullanılmaktadır. Tüm İç Anadolu’da olduğu gibi Eskişehir’de de tarımı yapılan en yaygın bahçe bitkileri arasında Cucumis sativus (L. yer almaktadır. İnsan beslenmesinde ilk bakışta önemli gibi görünmese de Cucumis sativus; vitaminler, enzimler, mineral maddeler bakımından zengin bir bitkidir. Fakat protein, karbonhidrat ve yağ bakımından fakirdir. Bu çalışmada, tohumların çimlendirilmesinde şehir şebeke suyu ve farklı oranlarda seyreltilmiş, şehir içinde ve şehir dışında belirlenen istasyonlardan alınan Porsuk nehrine ait su örnekleri kullanılmıştır. Fidelerin kök-gövde uzunlukları, kök ve gövdeye ait yaş ve kuru ağırlıklar ölçülerek şebeke suyu ve Porsuk nehrine ait suyun fide gelişimi üzerine etkileri araştırılmıştır. Elde edilen verilere göre, kök uzunluğunun nehir suyunun seyreltme oranı ile doğru orantıda arttığı ve su içeriğinin seyreltme oranı arttıkça azaldığı tespit edilmiştir

  2. Poetry in transitional space (reflections about the Cacaso's grupo escolar A poesia passada a limbo (reflexões sobre grupo escolar de Cacaso

    Directory of Open Access Journals (Sweden)

    Debora Racy Soares

    2009-10-01

    Full Text Available The main purpose of this work is to think about two poems of the book Grupo Escolar (1974 by Antônio Carlos de Brito (1944-1987, known inside the Brazilian cultural universe as Cacaso. Despite being the second book by Cacaso, Grupo Escolar was the fi rst to be published independently, in the traditional editorial system, through Frenesi, a poetry collection pro Rio de Janeiro. It is interesting to realize that this book demands from the author a new poetical lettering, in agreement with the “alchemist days”. By the analysis of the poems chosen – “O futuro já chegou” and “Aquarela” – it’s possible to see how they dialogue with the production moment, in different ways. Both can be read as symptoms of a traumatic reality. Although, if in the fi rst poem we face a reference poetry based on extreme literality and on “reality excess”, in the second we face the sense mixtures modulations of allegory. Keywords: Cacaso. Grupo Escolar. 1974. O futuro já chegou. Aquarela. Dictatorship. O objetivo deste trabalho é refl etir sobre dois poemas do livro Grupo Escolar (1974, de Antônio Carlos de Brito (1944-1987, mais conhecido pelo pseudônimo Cacaso no universo cultural brasileiro. Apesar de ter sido o segundo livro de Cacaso, Grupo Escolar foi o primeiro a ser publicado de forma independente, à margem do sistema editorial tradicional, através da Frenesi, uma coleção carioca de poesia. É interessante perceber que este livro exige do autor uma nova alfabetização poética, mais condizente com os “tempos de alquimia”. Demonstraremos, por meio da análise dos poemas escolhidos – “O futuro já chegou” e “Aquarela” – como dialogam com o momento de produção, de diferentes formas. Ambos podem ser lidos como sintomas de uma realidade traumática. No entanto, se no primeiro poema estamos diante de uma poesia referencial, ancorada na literalidade extrema e no “excesso de realidade”, no segundo nos deparamos com

  3. Um olhar para a dinâmica do Coordenador de Grupos

    Directory of Open Access Journals (Sweden)

    Kátya Alexandrina Matos Barreto Mota

    2006-04-01

    Full Text Available No mundo contemporâneo a utilização de grupos enquanto estratégia na atenção em saúde e em atividades do ensino é cada vez mais utilizado, considerando inclusive as propostas oficiais do Ministério da Saúde e da Educação. Assim, o domínio dessa tecnologia pelos profissionais como fundamento para guiar suas ações assistenciais e gerenciais, torna-se, a cada dia de maior importância. Neste artigo de atualização propomos desenvolver alguns aspectos sobre os pressupostos teóricos e dilemas do coordenador de grupos, assim como apontar elementos que possam ajudar os profissionais que têm no grupo seu campo de trabalho. O texto aborda também a organização do setting grupal, o manejo das situações previsíveis, a administração do tempo, manejo de conflitos do grupo e o poder do contrato grupal. A essência do texto é ancorada no principal dilema do coordenador de grupo, que é encontrar a medida adequada, ou seja, equilíbrio para fazer intervenções sobre os conteúdos que emergem na dinâmica grupal, centradas no contexto científico e no emocional que surgem do contato com o grupo. Neste intervalo entre a prática e a teoria, entre o profissional e o pessoal é que acreditamos encontrar o equilíbrio. Nesse sentido, é fundamental ao coordenador a noção da complexidade grupal, para que diante de sua singularidade possa viver o grupo e tudo o que dele emana.

  4. Estrategias corporativas de crecimiento de los grupos económicos en chile1,2

    Directory of Open Access Journals (Sweden)

    Alex Medina Giacomozzi

    2009-10-01

    Full Text Available Los grupos económicos son una estructura corporativa muy importante en Chile y al igual que toda organización, éstos tienen una variedad de decisiones estratégicas que deben adoptar, entre las que resaltan las estrategias de crecimiento (composición de portafolio, por lo que en este artículo se profundizará en ellas, particularmente en sus estrategias de diversificación o concentración. Para el desarrollo de la investigación, se partió del total de grupos económicos registrados en la Superintendencia de Valores y Seguros de Chile y, mediante muestreo aleatorio simple, se obtuvo una muestra de 42 grupos, en donde uno de los principales hallazgos fue que la mayoría de los grupos económicos adoptan estrategias de concentración en un sector con un activo recambio de grupos económicos.

  5. ESTRATEGIAS CORPORATIVAS DE CRECIMIENTO DE LOS GRUPOS ECONÓMICOS EN CHILE

    Directory of Open Access Journals (Sweden)

    ALEX MEDINA GIACOMOZZI

    2009-01-01

    Full Text Available Los grupos económicos son una estructura corporativa muy importante en Chile y al igual que toda organización, éstos tienen una variedad de decisiones estratégicas que deben adoptar, entre las que resaltan las estrategias de crecimiento (composición de portafolio, por lo que en este artículo se profundizará en ellas, particularmente en sus estrategias de diversificación o concentración. Para el desarrollo de la investigación, se partió del total de grupos económicos registrados en la Superintendencia de Valores y Seguros de Chile y, mediante muestreo aleatorio simple, se obtuvo una muestra de 42 grupos, en donde uno de los principales hallazgos fue que la mayoría de los grupos económicos adoptan estrategias de concentración en un sector con un activo recambio de grupos económicos.

  6. Transcriptomic analysis of short-fruit 1 (sf1) reveals new insights into the variation of fruit-related traits in Cucumis sativus.

    Science.gov (United States)

    Wang, Lina; Cao, Chenxing; Zheng, Shuangshuang; Zhang, Haiyang; Liu, Panjing; Ge, Qian; Li, Jinrui; Ren, Zhonghai

    2017-06-07

    Fruit size is an important quality trait in different market classes of Cucumis sativus L., an economically important vegetable cultivated worldwide, but the genetic and molecular mechanisms that control fruit size are largely unknown. In this study, we isolated a natural cucumber mutant, short fruit 1 (sf1), caused by a single recessive Mendelian factor, from the North China-type inbred line CNS2. In addition to significantly decreased fruit length, other fruit-related phenotypic variations were also observed in sf1 compared to the wild-type (WT) phenotype, indicating that sf1 might have pleiotropic effects. Microscopic imaging showed that fruit cell size in sf1 was much larger than that in WT, suggesting that the short fruit phenotype in sf1 is caused by decreased cell number. Fine mapping revealed that sf1 was localized to a 174.3 kb region on chromosome 6. Similarly, SNP association analysis of bulked segregant RNA-Seq data showed increased SNP frequency in the same region of chromosome 6. In addition, transcriptomic analysis revealed that sf1 might control fruit length through the fine-tuning of cytokinin and auxin signalling, gibberellin biosynthesis and signal transduction in cucumber fruits. Overall, our results provide important information for further study of fruit length and other fruit-related features in cucumber.

  7. The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis sativus Defense Response to Sphaerotheca fuliginea

    Directory of Open Access Journals (Sweden)

    Xiangnan Meng

    2018-04-01

    Full Text Available Pathogen stress often significantly decreases cucumber production. However, knowledge regarding the molecular mechanism and signals of cucumber disease resistance is far from complete. Here, we report two translationally controlled tumor protein genes, CsTCTP1 and CsTCTP2, that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization analysis showed that CsTCTP1 and CsTCTP2 were both localized in the cytoplasm. Expression analysis indicated that the transcript levels of CsTCTP1 and CsTCTP2 were linked to the degree of cucumber resistance to S. fuliginea. Transient overexpression of either CsTCTP1 or CsTCTP2 in cucumber cotyledons impaired resistance to S. fuliginea, whereas silencing of either CsTCTP1 or CsTCTP2 enhanced cucumber resistance to S. fuliginea. The relationship of several defense-related genes and ABA and target of rapamycin (TOR signaling pathway-related genes to the overexpressing and silencing of CsTCTP1/CsTCTP2 in non-infested cucumber plants was investigated. The results indicated that CsTCTP1 participates in the defense response to S. fuliginea by regulating the expression of certain defense-associated genes and/or ABA signaling pathway-associated genes, and CsTCTP2 participates through regulating the expression of TOR signaling pathway-associated genes. Our findings will guide enhancing the resistance of cucumber to powdery mildew.

  8. Effects of exogenous application of CPPU, NAA and GA4+7 on parthenocarpy and fruit quality in cucumber (Cucumis sativus L.).

    Science.gov (United States)

    Qian, Chunlu; Ren, Nannan; Wang, Jingye; Xu, Qiang; Chen, Xuehao; Qi, Xiaohua

    2018-03-15

    In protected vegetable fields, plant growth regulators are often used to improve cucumber fruit growth. However, the effects of plant growth regulators on the appearance and nutritional quality of cucumber (Cucumis sativus L.) remain largely unknown. In the present study, 100 mg/L N-(2-chloro-4-pyridyl)-N'-phenylurea (CPPU), naphthaleneacetic acid (NAA) or gibberellin A4+A7 (GA 4+7 ) was applied to the female cucumber flowers 1 day before anthesis and at anthesis. The CPPU, NAA and GA 4+7 treatments resulted in parthenocarpic fruits with similar weights, sizes and shapes as the pollinated fruits. NAA treatment did not affect the appearance and nutritional characteristics of cucumber at harvest and after storage. CPPU treatment increased the flesh firmness at harvest but decreased phenolic acid and vitamin C contents after storage. GA 4+7 treatment decreased the flesh firmness but increased total flavonoids and protein content after storage. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Study of the effect of uranium and thorium on the growing of pepper (Capsicum annuum var. longum) and cucumber (Cucumis sativus) plants

    International Nuclear Information System (INIS)

    Uenak, T.; Yildirim, Y.; Tokucu, G.; Uenak, G.; Oecal, J.; Konyali, D.; Kilic, S.

    2007-01-01

    The transportation rate of uranium and thorium to different plants grown in soils having high level of these elements varies closely with the plant characteristics. In this study, the pepper (Capsicum annuum var. longum) and cucumber (Cucumis sativus) plants were chosen as vegetables which are commonly consumed over different regions by different populations. The results obtained can be summarized as follows: (1) High uranium concentration in the soil prevents the growing of the plants. Only the plants in the pot having the uranium concentration of about 263 ppm grew significantly. The plants in other pots having a higher concentration turned pale and died in a few weeks. (2) In the pot having thorium level of about 263 ppm, the plants were well grown and fruited in comparison to the control plants, but the increase of thorium concentration inversely influenced their growing. (3) The gross activities measured in different parts of the plants were not particularly high, however, in both cases the maximum activities were measured in the stems rather than in the fruits and leaves. (4) The plants grown in soils having thorium content lived longer than the control plants and at the greenhouse conditions indicated above, all plants lived more than one whole year flowering and fruiting. (author)

  10. Acercamiento al Concepto de Grupos Empresariales: Concurrencia de Elementos para su Existencia

    Directory of Open Access Journals (Sweden)

    Carlos Mario Montiel Fuentes

    2009-06-01

    Full Text Available El grupo empresarial es el conjunto de una o más sociedades independientes jurídicamente entre sí, pero que se encuentran bajo un control o subordinación ejercido por una matriz o controlante y sometidas a una dirección unitaria que determina los lineamientos de cada una de ellas. Conformándose el grupo empresarial únicamente cuando concurran los dos elementos de su esencia; 1. El control o subordinación y 2. La unidad de propósito y dirección; sin que signifique esto, que se esté dando nacimiento a un nuevo ente autónomo e independiente, pues se mantiene intacta la personalidad jurídica de cada una de las sociedades vinculadas al grupo.

  11. Exposición a Estreptococo del grupo B en mujeres mexicanas en edad reproductiva

    Directory of Open Access Journals (Sweden)

    Palacios-Saucedo Gerardo

    2002-01-01

    Full Text Available Objetivo. Evaluar la seroprevalencia de la infección por Estreptococo del grupo B (EGB en una muestra representativa de mujeres en edad reproductiva de la República Mexicana. Material y métodos. Se estudió una muestra representativa de sueros de la población femenina mexicana de 15 a 40 años de edad, de todos los niveles socioeconómicos. La muestra fue seleccionada del Banco Nacional de Sueros por muestreo aleatorio simple por computadora. Los sueros se obtuvieron durante la última encuesta seroepidemiológica nacional realizada en 1987 y 1988. Los ensayos para la estandarización y la evaluación de la seroprevalencia se llevaron a cabo en el Hospital de Pediatría del Centro Médico Nacional Siglo XXI, del Instituto Mexicano del Seguro Social (IMSS entre enero y noviembre de 1995. Se midieron anticuerpos IgG antipolisacárido de grupo de EGB usando un ensayo inmunoenzimático (ELISA estandarizado y validado en el laboratorio, utilizando un antígeno específico de grupo, producido y purificado a partir de la cepa de referencia de EGB 110. Resultados. Se estudió un total de 2 669 muestras de suero, de las cuales 2 405 fueron positivas para la presencia de anticuerpos IgG contra el antígeno de grupo de EGB. Esto corresponde a una seroprevalencia de 90.2 %. No hubo diferencia en los porcentajes de seropositividad por grupos de edad ni por entidades federativas. Conclusiones. Se detectó una elevada prevalencia de anticuerpos contra el antígeno de grupo del EGB. Los resultados de este estudio sugieren que existe una elevada exposición de las mujeres mexicanas jóvenes a este microrganismo.

  12. Fatores terapêuticos em um grupo de apoio para pacientes psiquiátricos ambulatoriais

    Directory of Open Access Journals (Sweden)

    Guanaes Carla

    2001-01-01

    Full Text Available INTRODUÇÃO/OBJETIVOS: O emprego da psicoterapia de grupo no atendimento em saúde mental, sobretudo em contextos institucionais, tem se expandido aceleradamente, não havendo uma expansão correlata de pesquisas na área, conforme aponta a literatura especializada. Objetivou-se compreender algumas possibilidades e alguns limites de um grupo de apoio de curta duração (16 sessões para pacientes psiquiátricos ambulatoriais, investigando os fatores terapêuticos que operam nesse grupo, segundo a percepção de seus participantes. MÉTODOS: Questionários do Incidente Crítico (QIC, observação e registro do grupo, consultas aos prontuários dos pacientes e notas de campo constituíram as fontes de dados. A análise das respostas dos pacientes ao QIC foi realizada por procedimentos de avaliação categorial de conteúdo, tendo como base um sistema descritivo dos fatores terapêuticos proposto na literatura. As demais fontes foram tomadas como dados de contexto dos sentidos produzidos pelos pacientes em suas respostas ao QIC. RESULTADOS: Os resultados remetem a dez categorias derivadas da percepção dos pacientes, indicativas de vivências terapêuticas e não-terapêuticas no grupo. DISCUSSÃO/CONCLUSÃO: Este estudo possibilita uma compreensão sobre o modo como os pacientes vivenciaram o processo desse grupo, tendo em vista os sentidos que produziram a partir de sua participação neste, e, em conjunção com a compreensão de seus quadros clínicos, situa algumas possibilidades e alguns limites desse tipo de tratamento em saúde mental, considerando o contexto em que ocorre e a clientela que usualmente o integra.

  13. El grupo de discusión como situación social

    Directory of Open Access Journals (Sweden)

    ENRIQUE MARTÍN CRIADO

    1997-01-01

    Full Text Available se propone una fundamentacion metodologica del grupo de discusion que sustituya el enfoque psicoanalitico -que supone una esencia intemporal de "grupo"- por un enfoque que contempla la produccion de discurso como un acto que pone en relacion agentes dotados de unos esquemas de produccion de sentido -adquiridos en su trayectoria social e incorporados mediante familiarizacion inconscinete- con una serie de "situaciones sociales" que introducen una serie de reglas y constricciones sobre lo decible. el manejo de esta tecnica tendra que tener en cuenta, asi, la estructuracion del "orden publico interaccional" del medio social en que se pretende investigar.

  14. Vinculación a grupos armados: un resultado del conflicto armado en Colombia

    Directory of Open Access Journals (Sweden)

    Olga Lucía Valencia

    2010-01-01

    Full Text Available El presente artículo inicia con un recuento histórico sobre el conflicto en Colombia, y las consecuencias de permanecer en un grupo armado, para luego describir los motivos de vinculación en adultos, en menores de edad y en mujeres. Al final se mencionan las motivaciones para pertenecer a las fuerzas armadas encontrando algunas semejanzas entre los motivos de vinculación a los grupos armados ilegales en comparación con las fuerzas estatales.

  15. Grupo Archigram, 1961-1974.Uma Fábula da técnica

    OpenAIRE

    Pianta Costa Cabral, Claudia

    2002-01-01

    El tema de esta tesis es la producción del grupo inglés Archigram, constituido por Peter Cook (1936), Warren Chalk (1927-1987), Ron Herron (1930-1994), Dennis Crompton (1935), Michael Webb (1937) y David Greene (1937), articulado alrededor a la revista homónima publicada en Londres entre 1961 y 1974 (diez números). Dicha producción por lo tanto no consiste en obras construidas, pero en el conjunto de los proyectos, dibujos y textos desarrollados en estos años por los miembros del grupo, indi...

  16. Racionalización y optimización de mecanismos del Grupo Roca

    OpenAIRE

    Fernández Pérez, Alberto

    2015-01-01

    Este proyecto pretende replantear la elección de proveedores de los mecanismos de alimentación y descarga instalados en las tazas de los inodoros en las empresas que forman parte del Grupo Roca. Actualmente cada empresa dentro del Grupo elige de manera autónoma el proveedor que cree más conveniente para estos productos, y esto ha llevado a la utilización de más de 15 proveedores diferentes de estos mecanismos. El objetivo es por tanto, reducir el número de proveedores y escoger...

  17. Psicoterapia de grupo de criança : aspectos clinicos de um estudo de caso

    OpenAIRE

    Regina Celia Ciriano Calil

    2001-01-01

    Resumo: Essa tese de doutorado tem o objetivo de efetuar um estudo de caso referente ao atendimento de um grupo de psicoterapia realizado com crianças em idade escolar, no contexto institucional do Ambulatório de Saúde Mental Infantil do Hospital das Clínicas da Unicamp. Para o atendimento do grupo estudado, utilizou-se a técnica de psicoterapia infantil de abordagem psicodinâmica, adaptada à condição de trabalho grupal e às circunstâncias institucionais. Nesse estudo de caso, foram analisad...

  18. Grupos funcionais de gramíneas forrageiras tropicais Functional clusters of tropical forage grasses

    Directory of Open Access Journals (Sweden)

    Carlindo Santos Rodrigues

    2012-06-01

    Full Text Available Foram avaliadas as características morfogênicas e estruturais de gramíneas forrageiras com o objetivo de agrupá-las, de acordo com seu padrão de desenvolvimento, em seus respectivos grupos funcionais. As gramíneas foram plantadas em parcelas de 1,0 m² com 24 plantas, em delineamento de blocos completos casualizados com três repetições. Os dados foram submetidos à análise de fatores, reduzindo as variáveis em quatro fatores: desenvolvimento de massa, mortalidade de perfilhos, estádio de desenvolvimento e longevidade foliar. Os dados foram submetidos à análise de agrupamento por otimização de Tocher adotando-se a distância euclidiana média como medida básica de dissimilaridade. As gramíneas foram agrupadas da seguinte forma: Verão - grupo I (Xaraés, Massai, Mombaça e Marandu; grupo II (Gordura e Aruana; e grupo III (Jaraguá. Outono - grupo I (Mombaça, Massai, Xaraés, Marandu e Gordura; grupo II - (Jaraguá; e grupo III (Aruana. Possivelmente a maior participação do fator mortalidade de perfilhos na formação dos grupos no período de outono influenciou na reorganização dos grupos. Os padrões de desenvolvimento de massa dos diferentes grupos de gramíneas diferiram entre si quanto à forma de utilização dos recursos disponíveis. Houve mudança nos escores de todos os fatores com a mudança do período do verão para o outono. O agrupamento funcional comprova que gramíneas de gêneros e/ou espécies diferentes podem ser enquadradas em um mesmo grupo.Morphogenetic and structural characteristics of forage grasses were evaluated in order to group them according to their pattern of development in their respective functional groups. Grasses were planted in plots of 1.0 m² with 24 plants in a completely randomized block design with three replications. Data were submitted to factor analysis, reducing the variables to four factors: mass development, tiller mortality, developmental stage and leaf longevity. The data

  19. O complexo holosericeus de Ommatius Wiedemann no Brasil: nova espécie e primeiro registro do grupo ampliatus para o País e novos registros para o grupo holosericeus (Diptera, Asilidae

    Directory of Open Access Journals (Sweden)

    Rodrigo Vieira

    2011-12-01

    Full Text Available O complexo holosericeus de Ommatius Wiedemann no Brasil: nova espécie e primeiro registro do grupo ampliatus para o país e novos registros para o grupo holosericeus (Diptera, Asilidae. Neste trabalho é descrita uma nova espécie de Ommatius Wiedemann, 1821 para o estado do Amazonas, pertencente ao grupo ampliatus. Além disso, são fornecidos novos registros, variações taxonômicas, ilustrações e descrição das estruturas das terminálias masculina e feminina para as espécies do grupo holosericeus.

  20. Análisis de grupos de pilotes sometidos a cargas de sismo

    Directory of Open Access Journals (Sweden)

    Carlos Javier Sainea Vargas

    2012-05-01

    Full Text Available Se presentan los análisis de los resultados obtenidos al emplear la metodología p-y en el análisis de un amplio número de modelos de grupos de pilotes, en los que se aplicaron modificaciones a las curvas p-y para la inclusión de los efectos de grupo y carga sísmica; dichos modelos han sido elaborados incluyendo diferentes configuraciones geométricas de los grupos, y varios tipos de suelos de cimentación. Para el análisis de los modelos se ha empleado el software especializado FB-Multipier, que, además de incluir la metodología elegida, permite la aplicación de cargas sísmicas reales, como las dadas por señales acelerográficas. A partir de los resultados de deflexiones y momentos obtenidos en el análisis de losmodelos, se presentan algunas observaciones sobre el comportamiento de los grupos de pilotes sometidos a carga sísmica y se incluyen consideraciones referentes a su diseño.

  1. Grupo de Trabajo de Gestión del Conocimiento y Propiedad Intelectual

    OpenAIRE

    Grupo de Trabajo de Gestión del Conocimiento y Propiedad Intelectual, Universidad de Castilla-La Mancha.

    2015-01-01

    Presentación del Grupo de Gestión del Conocimiento y Propiedad Intelectual de la Universidad de Castilla-La Mancha, en la Jornada Técnica destinadas a bibliotecarios del Consorcio G9 de universidades, celebrada en Ciudad Real el 22 de enero de 2015.

  2. Análisis de grupos de pilotes sometidos a cargas de sismo

    Directory of Open Access Journals (Sweden)

    Carlos Javier Sainea Vargas

    2011-07-01

    Full Text Available Se presentan los análisis de los resultados obtenidos al emplear la metodología p-y en el análisis de un amplio número de modelos de grupos de pilotes, en los que se aplicaron modificaciones a las curvas p-y para la inclusión de los efectos de grupo y carga sísmica; dichos modelos han sido elaborados incluyendo diferentes configuraciones geométricas de los grupos, y varios tipos de suelos de cimentación. Para el análisis de los modelos se ha empleado el software especializado FB-Multipier, que, además de incluir la metodología elegida, permite la aplicación de cargas sísmicas reales, como las dadas por señales acelerográficas. A partir de los resultados de deflexiones y momentos obtenidos en el análisis de losmodelos, se presentan algunas observaciones sobre el comportamiento de los grupos de pilotes sometidos a carga sísmica y se incluyen consideraciones referentes a su diseño.

  3. Grupo multifamiliar no contexto dos Transtornos Alimentares: a experiência compartilhada

    Directory of Open Access Journals (Sweden)

    Manoel Antônio Santos

    2016-01-01

    Full Text Available Este estudio trata de explorar la experiencia compartida por los cuidadores que participaron en un grupo de apoyo para familiares de personas diagnosticadas con trastornos alimenticios (TA, buscando identificar los sentimientos experimentados y la posible reinterpretación de sus experiencias como cuidadores. Fueron analizadas cinco sesiones del Grupo de Apoyo Psicológico a Familiares, al que asistieron 23 familiares de pacientes registrados en una clínica especializada en TA en el estado de São Paulo, Brasil. Los datos fueron sometidos a análisis de contenido temático e interpretados a la luz de la teoría psicodinámica. Los resultados indican que los miembros de la familia tratan de comprender las causas del problema, perciben el miembro afectado por el trastorno como emocionalmente inmaduro, experimentan sentimientos de culpa y déficits de auto-cuidado, se benefician de la presencia del padre durante el tratamiento y de otros miembros de la familia que no sean las madres, y aprovechan el grupo para reforzar su papel como cuidadores familiares. Se hizo evidente que el grupo puede funcionar como una alternativa importante en la construcción de relaciones más sanas, induciendo cambios en la dinámica familiar.

  4. O grupo como fator de inclusão socioafetiva na terceira idade

    Directory of Open Access Journals (Sweden)

    Alexandra Cardoso da Silva

    2013-09-01

    Full Text Available http://dx.doi.org/10.5007/1807-0221.2013v10n15p44 O objetivo deste trabalho é o de demonstrar que a Dinâmica de Grupos - Grupo de Encontros Rogeriano - é fator de interação social na Terceira Idade, promovendo a integração dos idosos em grupos substitutivos devolvendo-lhes a auto-estima e cidadania. A experiência foi realizada no NETI / UFSC, com vários grupos a partir de 2001. Efetuaram-se 30 encontros com duração de duas horas cada sessão, ministrado por 2 facilitadoras . Como conclusão constatou-se que existe um processo adaptativo na velhice estimulando a formação dessas mudanças é multidimensional: a área emcional facilita a expressão dos sentimentos positivos; na cognitiva estimula aprendizagens relativas ao seu Eu e ao dos Outros; na comportamental á competência pessoal e social.

  5. Soutien organisationnel de la phase 2 de l'ITT : Grupo FARO | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La recherche pour influencer les politiques ... -accroître la visibilité du Grupo FARO dans les médias et les cercles d'élaboration de ... TTI Phase 2 Institutional Support: Fundacio´n Salvadoren~a para el Desarrollo Econo´mico y Social.

  6. Comportamento de poedeiras criadas a diferentes densidades e tamanhos de grupo em ambiente enriquecido

    Directory of Open Access Journals (Sweden)

    Danilo Florentino Pereira

    2013-06-01

    Full Text Available O objetivo deste trabalho foi determinar diferenças comportamentais entre poedeiras criadas sob diferentes densidades e tamanhos de grupo, em condições de ambiente enriquecido. Foram utilizadas poedeiras Isa Brown com idade entre 30 e 32 semanas alojadas em galpões de escala reduzida e distorcida. As aves foram criadas durante 28 dias, em baias com cama de maravalha, poleiro e ninho. Foram avaliados dois tamanhos de grupos (6 e 12 aves e duas densidades de criação (774 e 1.440 cm² por ave, em arranjo fatorial com três repetições. Em amostras de vídeo de 15 min, foram registrados as frequências e os tempos de expressão dos comportamentos: arrumar penas, banho de areia, bater asas, beber água, bicar, coçar a cabeça, ciscar, comer, empoleirar, esticar perna, perseguir, sentar e visitar o ninho. Foram observados efeitos significativos dos tratamentos e da interação entre eles. O grupo de seis aves manifestou aumento da frequência de comportamentos que indicam maior frustração das aves, independentemente da densidade. O tamanho de grupo é o fator mais importante para o bem-estar das aves.

  7. Plan estratégico TI para el Grupo de Investigación GRIAL

    OpenAIRE

    Blanco Mateos, Á. L.; Cabo Villalón, L.; Vázquez Ingelmo, A.; Zorita Garrote, S.

    2018-01-01

    Plan estratégico TI para el Grupo de Investigación GRIAL - Asignatura Gobierno de Tecnologías de la Información - Máster Universitario en Ingeniería Informática - Universidad de Salamanca. Curso 2016-2017

  8. Metacognição em Grupos de Problem-based Learning (PBL

    Directory of Open Access Journals (Sweden)

    Adriana Vargas

    2017-08-01

    Full Text Available Aprendizagem em grupo é um processo que envolve a mobilização de funções cognitivas e desenvolve competências necessárias no decorrer da vida. A Problem-based Learning (PBL, uma proposta de aprendizagem em grupo, enfatiza o desenvolvimento cognitivo e pode potencializar a metacognição. Objetivou-se responder as questões: 1 a PBL é uma metodologia que envolve o desenvolvimento da metacognição? 2 pode-se relacionar os estudos da metacognição no contexto grupal à PBL? Realizou-se o estado do conhecimento do tema, entre 2010 a 2015, contendo os termos metacognition e Problem-based Learning, no portal de periódicos da CAPES. Oito pesquisas foram selecionadas por descreverem evidências empíricas da metacognição em grupos de PBL. A PBL pode ser aplicada aos estudos de aprendizagem em grupo e metacognição, por mobilizar conhecimentos, a tomada de consciência e o autocontrole.

  9. O grupo como dispositivo das relações sociais do sujeito

    NARCIS (Netherlands)

    R. Quadros Rigoni (Rafaela); T.G. Santi (Thais); G.S. Campos (Gracielie)

    2007-01-01

    textabstractRESUMO: Pensar o grupo como um dispositivo de transformação nas relações dos sujeitos parece uma tarefa intensa; neste trabalho nos propomos a pensar questões grupais e as transformações subjetivas que ocorreram no desenrolar desse território que foi criado, dando ênfase ao processo de

  10. Los grupos armados ante el Derecho Internacional contemporáneo. : Obligaciones y responsabilidad

    NARCIS (Netherlands)

    Inigo Alvarez, L.

    2016-01-01

    Los grupos armados no estatales no son un fenómeno nuevo. Sin embargo, el incremento de los conflictos armados internos desde el final de la Guerra Fría así como el surgimiento del terrorismo internacional han abierto el debate sobre la eficacia del Derecho Internacional Humanitario (DIH)y del

  11. Soutien organisationnel de la phase 2 de l'ITT : Grupo FARO | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La recherche pour influencer les politiques. L'ITT est ... -accroître la visibilité du Grupo FARO dans les médias et les cercles ... Soutien organisationnel de la phase 2 de l'ITT : Fundacio´n Salvadoren~a para el Desarrollo Econo´mico y Social.

  12. El Grupo Cerúleo: Collaboration to assess nonbreeding range of Cerulean Warbler in South America

    Science.gov (United States)

    Gabriel Colorado; Paul Hamel; Amanda Rodewals; Wayne Thogmartin

    2008-01-01

    Cerulean Warbler (Dendroica cerulea. Parulidae) has been listed as a vulnerable species by the International Union for the Conservation of Nature because of recent population declines. An international, proactive approach to Cerulean Warbler conservation, the Cerulean Warbler Technical Group, was founded in 2001. One of its subcommittees, El Grupo...

  13. Diferencias conductuales y cognitivas en dos grupos de escolares con TDAH intervenidos con Arteterapia -vsMetilfenidato y un grupo control

    OpenAIRE

    M. Aurora G. Gallardo Saavedra; Ana Lucía Padrón García; M. del Consuelo Martínez-Wbaldo

    2018-01-01

    Introducción: El trastorno de défcit de atención e hiperactividad TDAH es una entidad neuropsiquiátrica, con prevalencia en la infancia entre 2% y 20%, su tratamiento actual asocia medicamentos y psicoterapia. El arteterapia en salud mental ha sido utilizado para tratar de cambiar el comportamiento y potenciar la cognición. Objetivo: comparar los cambios cognitivo-conductuales en escolares con TDAH tratados con arteterapia-vs-metilfenidato y un grupo control. Método: Ensayo clínico aleatoriza...

  14. Fatores terapêuticos em grupo de suporte na perspectiva da coordenação e dos membros do grupo Factores terapéuticos en un grupo de soporte en la perspectiva de la coordinación y de los miembros del grupo Therapeutic factors in group support from the perspective of the coordinators and group members

    Directory of Open Access Journals (Sweden)

    Leidiene Ferreira Santos

    2012-01-01

    Full Text Available OBJETIVO: Identificar os fatores terapêuticos presentes nas sessões de um Grupo de Apoio a Pais e Familiares de crianças hospitalizadas, na perspectiva dos participantes e da coordenação do grupo. MÉTODOS: Pesquisa descritiva, exploratória. Os dados foram obtidos por intermédio de um check list preenchido pelos familiares e pela identificação de fatores terapêuticos das coordenadoras do grupo. RESULTADOS: Os familiares indicaram a presença dos seguintes fatores terapêuticos no grupo: coesão, compartilhamento de informações, universalidade, fatores existenciais, desenvolvimento de técnicas de socialização, instilação de esperança, altruísmo, aprendizagem interpessoal e comportamento imitativo; as coordenadoras identificaram: coesão, compartilhamento de informações, universalidade e fatores existenciais. CONCLUSÃO: A identificação dos fatores terapêuticos é uma importante ferramenta que pode ser usada para avaliar se os membros estão se beneficiando de sua participação no grupo.OBJETIVO: Identificar los factores terapéuticos presentes en las sesiones de un Grupo de Apoyo a Padres y Familiares de niños hospitalizados, en la perspectiva de los participantes y de la coordinación del grupo. MÉTODOS: Investigación descriptiva, exploratoria. Los datos fueron obtenidos por medio de un check list llenando por los familiares y por la identificación de factores terapéuticos de las coordinadoras del grupo. RESULTADOS: Los familiares indicaron la presencia de los siguientes factores terapéuticos en el grupo: cohesión, intercambio de informaciones, universalidad, factores existenciales, desarrollo de técnicas de socialización, infunsión de esperanza, altruismo, aprendizaje interpersonal y comportamiento imitativo; las coordinadoras identificaron: cohesión, intercambio de informaciones, universalidad y factores existenciales. CONCLUSIÓN: La identificación de los factores terapéuticos es una herramienta

  15. O Papel da Psicoterapia de Grupo na Formação do Residente em Psiquiatria

    Directory of Open Access Journals (Sweden)

    Cláudia de Paula Juliano Souza

    Full Text Available RESUMO O objetivo deste trabalho foi analisar o papel da psicoterapia de grupo na formação do residente em psiquiatria do Programa de Residência Médica em Psiquiatria da Universidade Federal de Goiás. Trata-se de um estudo descritivo exploratório com abordagem qualitativa em educação médica. Os dados foram coletados por meio de relatórios descritivos e entrevistas semiestruturadas, submetidas à análise de conteúdo temático-categorial. Emergiram da análise dos dados duas categorias: as ações educativas do ensino da psicoterapia de grupo e as ações sociais do ensino da psicoterapia de grupo. Na análise da primeira categoria, obtivemos cinco subcategorias: relação médico-paciente, aprendizagem cognitiva, aprendizagem afetiva, diálogo interdisciplinar e desenvolvimento pessoal. Na segunda categoria, obtivemos duas subcategorias: socialização e encontro. Conclui-se que o ensino da psicoterapia de grupo tem papel educativo, pois contribui com a inovação dos cenários de prática, possibilitando mudanças na relação médico residente-paciente e consolidando o conceito ampliado de saúde na perspectiva da integralidade. Revela também seu papel social, pois contribui para uma aproximação sociointerativa entre preceptor-residente-grupo.

  16. Phytotoxicity of ZnO nanoparticles and the released Zn(II) ion to corn (Zea mays L.) and cucumber (Cucumis sativus L.) during germination.

    Science.gov (United States)

    Zhang, Ruichang; Zhang, Haibo; Tu, Chen; Hu, Xuefeng; Li, Lianzhen; Luo, Yongming; Christie, Peter

    2015-07-01

    Toxicity of engineered nanoparticles on organisms is of concern worldwide due to their extensive use and unique properties. The impacts of ZnO nanoparticles (ZnO NPs) on seed germination and root elongation of corn (Zea mays L.) and cucumber (Cucumis sativus L.) were investigated in this study. The role of seed coats of corn in the mitigation toxicity of nanoparticles was also evaluated. ZnO NPs (1,000 mg L(-1)) reduced root length of corn and cucumber by 17 % (p < 0.05) and 51 % (p < 0.05), respectively, but exhibited no effects on germination. In comparison with Zn(2+), toxicity of ZnO NPs on the root elongation of corn could be attributed to the nanoparticulate ZnO, while released Zn ion from ZnO could solely contribute to the inhibition of root elongation of cucumber. Zn uptake in corn exposed to ZnO NPs during germination was much higher than that in corn exposed to Zn(2+), whereas Zn uptake in cucumber was significantly correlated with soluble Zn in suspension. It could be inferred that Zn was taken up by corn and cucumber mainly in the form of ZnO NPs and soluble Zn, respectively. Transmission electron microscope confirmed the uptake of ZnO NPs into root of corn. Although isolation of the seed coats might not be the principal factor that achieved avoidance from toxicity on germination, seed coats of corn were found to mitigate the toxicity of ZnO NPs on root elongation and prevent approximately half of the Zn from entering into root and endosperm.

  17. Comparative studies of the phytochemistry, proximate analysis, mineral and vitamin compositions of the methanol leaf extracts of Cucumis sativus L. and Daucus carota L.

    Directory of Open Access Journals (Sweden)

    Essien Augustine Dick

    2016-08-01

    Full Text Available     Cucumis sativus  and Daucus carota are medicinal plants used in folkloric medicine to treat and prevent various diseases but the basis for this has not been highlighted. Quantitative phytochemicial analysis revealed the presence of anthocyanins, flavonoids, carotenoids and pyrrolidine in D. carota leaf methanol extract but in C. sativus only flavonoids and carotenoids was found present although in a lower amounts. Proximate analysis revealed  that both plants methanol leaf extracts contain moisture, protein, carbohydrate, fat, fiber and ash. The moisture content of C. sativus (95 ± 0.02% was more than that of D. Carota (82.20 ± 0.01% but the protein, carbohydrate, fat, ash and fiber contents of D. Carota was more than that of C. sativus. The mineral compositions also revealed the presence of Ca, P, Mg, Fe,Zn,Na, and K in both C.sativus and D. carota although in various proportions. The P, Ca, Mg, Fe and Na contents in D. carota were more than that of C. Sativus, but C. sativus has a higher Zn and K contents than D. carota. The vitamin analysis also revealed the presence of important vitamins including A, B1, B2,  B6 ,  C,E, niacin and folate. The vitamin A content of  D. carota were very high (2,901 ± 0.02µg compared to that of  C. Sativus (23 ± 0.01µg. These important macroelements, minerals and vitamins embedded in these important plants may be the reasons behind its use in forklore medicine for its various dietary and therapeutic applications.

  18. Differential Gene Expression in Response to Papaya ringspot virus Infection in Cucumis metuliferus Using cDNA- Amplified Fragment Length Polymorphism Analysis

    Science.gov (United States)

    Lin, Chia-Wei; Chung, Chien-Hung; Chen, Jo-Chu; Yeh, Shy-Dong; Ku, Hsin-Mei

    2013-01-01

    A better understanding of virus resistance mechanisms can offer more effective strategies to control virus diseases. Papaya ringspot virus (PRSV), Potyviridae, causes severe economical losses in papaya and cucurbit production worldwide. However, no resistance gene against PRSV has been identified to date. This study aimed to identify candidate PRSV resistance genes using cDNA-AFLP analysis and offered an open architecture and transcriptomic method to study those transcripts differentially expressed after virus inoculation. The whole genome expression profile of Cucumis metuliferus inoculated with PRSV was generated using cDNA-amplified fragment length polymorphism (cDNA-AFLP) method. Transcript derived fragments (TDFs) identified from the resistant line PI 292190 may represent genes involved in the mechanism of PRSV resistance. C. metuliferus susceptible Acc. 2459 and resistant PI 292190 lines were inoculated with PRSV and subsequently total RNA was isolated for cDNA-AFLP analysis. More than 400 TDFs were expressed specifically in resistant line PI 292190. A total of 116 TDFs were cloned and their expression patterns and putative functions in the PRSV-resistance mechanism were further characterized. Subsequently, 28 out of 116 candidates which showed two-fold higher expression levels in resistant PI 292190 than those in susceptible Acc. 2459 after virus inoculation were selected from the reverse northern blot and bioinformatic analysis. Furthermore, the time point expression profiles of these candidates by northern blot analysis suggested that they might play roles in resistance against PRSV and could potentially provide valuable information for controlling PRSV disease in the future. PMID:23874746

  19. Orthology Analysis and In Vivo Complementation Studies to Elucidate the Role of DIR1 during Systemic Acquired Resistance in Arabidopsis thaliana and Cucumis sativus

    Directory of Open Access Journals (Sweden)

    Marisa Isaacs

    2016-05-01

    Full Text Available AtDIR1 (Defective in Induced Resistance1 is an acidic lipid transfer protein essential for systemic acquired resistance (SAR in Arabidopsis thaliana. Upon SAR induction, DIR1 moves from locally infected to distant uninfected leaves to activate defense priming; however, a molecular function for DIR1 has not been elucidated. Bioinformatic analysis and in silico homology modeling identified putative AtDIR1 orthologs in crop species, revealing conserved protein motifs within and outside of DIR1’s central hydrophobic cavity. In vitro assays to compare the capacity of recombinant AtDIR1 and targeted AtDIR1-variant proteins to bind the lipophilic probe TNS (6,P-toluidinylnaphthalene-2-sulfonate provided evidence that conserved leucine 43 and aspartic acid 39 contribute to the size of the DIR1 hydrophobic cavity and possibly hydrophobic ligand binding. An Arabidopsis–cucumber SAR model was developed to investigate the conservation of DIR1 function in cucumber (Cucumis sativus, and we demonstrated that phloem exudates from SAR-induced cucumber rescued the SAR defect in the Arabidopsis dir1-1 mutant. Additionally, an AtDIR1 antibody detected a protein of the same size as AtDIR1 in SAR-induced cucumber phloem exudates, providing evidence that DIR1 function during SAR is conserved in Arabidopsis and cucumber. In vitro TNS displacement assays demonstrated that recombinant AtDIR1 did not bind the SAR signals azelaic acid (AzA, glycerol-3-phosphate or pipecolic acid. However, recombinant CsDIR1 and CsDIR2 interacted weakly with AzA and pipecolic acid. Bioinformatic and functional analyses using the Arabidopsis–cucumber SAR model provide evidence that DIR1 orthologs exist in tobacco, tomato, cucumber, and soybean, and that DIR1-mediated SAR signaling is conserved in Arabidopsis and cucumber.

  20. Brassinosteroids-Induced Systemic Stress Tolerance was Associated with Increased Transcripts of Several Defence-Related Genes in the Phloem in Cucumis sativus.

    Directory of Open Access Journals (Sweden)

    Pingfang Li

    Full Text Available Brassinosteroids (BRs, a group of naturally occurring plant steroidal compounds, are essential for plant growth, development and stress tolerance. Recent studies showed that BRs could induce systemic tolerance to biotic and abiotic stresses; however, the molecular mechanisms by which BRs signals lead to responses in the whole plant are largely unknown. In this study, 24-epibrassinosteroid (EBR-induced systemic tolerance in Cucumis sativus L. cv. Jinyan No. 4 was analyzed through the assessment of symptoms of photooxidative stress by chlorophyll fluorescence imaging pulse amplitude modulation. Expression of defense/stress related genes were induced in both treated local leaves and untreated systemic leaves by local EBR application. With the suppressive subtractive hybridization (SSH library using cDNA from the phloem sap of EBR-treated plants as the tester and distilled water (DW-treated plants as the driver, 14 transcripts out of 260 clones were identified. Quantitative Real Time-Polymerase Chain Reaction (RT-qPCR validated the specific up-regulation of these transcripts. Of the differentially expressed transcripts with known functions, transcripts for the selected four cDNAs, which encode an auxin-responsive protein (IAA14, a putative ankyrin-repeat protein, an F-box protein (PP2, and a major latex, pathogenesis-related (MLP-like protein, were induced in local leaves, systemic leaves and roots after foliar application of EBR onto mature leaves. Our results demonstrated that EBR-induced systemic tolerance is accompanied with increased transcript of genes in the defense response in other organs. The potential role of phloem mRNAs as signaling components in mediating BR-regulated systemic resistance is discussed.

  1. A fragment substitution in the promoter of CsHDZIV11/CsGL3 is responsible for fruit spine density in cucumber (Cucumis sativus L.).

    Science.gov (United States)

    Zhang, Haiyang; Wang, Lina; Zheng, Shuangshuang; Liu, Zezhou; Wu, Xiaoqin; Gao, Zhihui; Cao, Chenxing; Li, Qiang; Ren, Zhonghai

    2016-07-01

    The indel in the promoter of CsHDZIV11 co-segregates with fruit spine density and could be used for molecular breeding in cucumber. Fruit spine density is an important quality trait for marketing in cucumber (Cucumis sativus L.). However, the molecular basis of fruit spine density in cucumber remains unclear. In this study, we isolated a mutant, few spines 1 (fs1), from CNS2 (wild type, WT), a North China-type cucumber with a high density of fruit spines. Genetic analysis showed that fs1 was controlled by a single recessive Mendelian factor. Bulked segregant analysis combined with genome resequencing were used for mapping fs1 in the F2 population derived from a cross between the fs1 mutant and WT, and it was located on chromosome 6 through association analysis. To develop more polymorphic markers to locate fs1, another F2 population was constructed from the cross between fs1 and 'Chinese long' 9930. Then, fs1 was narrowed down to a 110.4-kb genomic region containing 25 annotated genes. A fragment substitution was identified in the promoter region of Csa6M514870 between fs1 and WT. This fragment in fs1 was also present in wild cucumber. Csa6M514870 encodes a PDF2-related protein, a homeodomain-leucine zipper IV transcription factor (CsHDZIV11/CsGL3) sharing high identity and similarity with proteins related to trichome formation or epidermal cell differentiation. Quantitative reverse-transcription PCR revealed a higher expression level of CsHDZIV11 in young fruits from fs1 compared to WT. A molecular marker based on this indel co-segregated with the spine density. This work provides a solid foundation not only for understanding the molecular mechanism of fruit spine density, but also for molecular breeding in cucumber.

  2. ANÁLISE DO DESEMPENHO DE UM GRUPO EXPORTADOR DE COSMÉTICOS SOB A PERSPECTIVA EMPRESARIAL: UM ESTUDO DE CASO DO GRUPO MINAS BEAUTY

    Directory of Open Access Journals (Sweden)

    Otávio Rezende

    2009-01-01

    Full Text Available O objetivo deste artigo é analisar resultados obtidos com a estruturação, a gestão e apromoção comercial de grupos setoriais exportadores. Partindo de um estudo de caso do setorde cosméticos, o artigo discorre sobre a expectativa inicial das empresas com a criação dogrupo exportador, o relacionamento com o mercado e a cooperação como meio de obtençãode resultados, uma vez que a política de promoção comercial internacional brasileira temadotado o modelo de rede de empresas como estratégia para potencializar a capacidadeprodutiva e reduzir custos de promoção. Como conclusão, destacam-se o baixo grau deconfiança no relacionamento inter-firma e a falta de indicadores de competitividade comofatores determinantes para os poucos resultados alcançados. A pesquisa assinala a necessidadede trabalharem-se modelos de cooperação empresarial em grupos setoriais exportadores e deinstituir-se uma forma de mensurar os resultados esperados pelas pequenas empresas nosprogramas de internacionalização.

  3. Induction of cinnamate 4-hydroxylase and phenylpropanoids in virus-infected cucumber and melon plants.

    OpenAIRE

    Belles Albert, José Mª; López-Gresa, María Pilar; Fayos, J.; Pallás Benet, Vicente; Rodrigo Bravo, Ismael; Conejero Tomás, Vicente

    2008-01-01

    [EN] In the present work, we have looked for the nature of the phenylpropanoids biosynthesized during the plant-pathogen reaction of two systems, Cucumis sativus and Cucumis melo infected with either prunus necrotic ringspot virus (PNRSV) or melon necrotic spot virus (MNSV), respectively. An accumulation of p-coumaric, caffeic and/or ferulic acids was observed in infected plant extracts hydrolysed with P-glucosidase or esterase. Analysis of undigested samples by HPLC/ESI revealed that these c...

  4. Evolucao dos precos relativos de grupos alimentares entre 1939 e 2010, em Sao Paulo, SP

    Directory of Open Access Journals (Sweden)

    Tania Yuka Yuba

    2013-06-01

    Full Text Available OBJETIVO: Analisar a evolução dos preços relativos dos grupos de produtos alimentares e sua influência nas políticas públicas para uma alimentação saudável. MÉTODOS: Foram analisados dados do município de São Paulo de 1939 a 2010, a partir da aplicação de métodos de cálculo de números-índices. Foram utilizados dados do banco de preços e estruturas de ponderação da Fundação Instituto de Pesquisas Econômicas (1939 a 1988 e do Instituto Brasileiro de Geografia e Estatística (1989 a 2010. O banco de preços foi organizado, sua consistência foi testada e os preços foram deflacionados pelo Índice de Preços ao Consumidor. Os dados relativos a preços deflacionados foram calculados e agregados por categorias e grupos alimentares da pirâmide alimentar adaptada. Os índices de preços de cada grupo foram construídos aplicando a fórmula de Laspeyres modificada. O índice geral de preços da alimentação foi comparado com índices de cada grupo alimentar e respectiva categoria: alimentos in natura; alimentos industrializados; bebidas; carnes, leguminosas, leite e ovos; cereais e tubérculos; e refeições fora do domicílio. RESULTADOS: Os grupos alimentares de gorduras, óleos, condimentos, açúcares e alimentos processados (alimentos industrializados apresentaram tendência de redução de preços em termos relativos. O índice dos alimentos in natura, como frutas e verduras, apresentaram tendência de elevação de preços. Outros grupos alimentares, como cereais, farinhas e massas, carnes, leite e ovos, apresentaram estabilidade de preços relativos ao longo do tempo. CONCLUSÕES: A evolução dos preços relativos dos alimentos no município de São Paulo mostra tendência desfavorável à manutenção da alimentação saudável em nível domiciliar em longo prazo.

  5. O processo decisório em grupo: uma análise temporal-ambiental

    Directory of Open Access Journals (Sweden)

    Fabiano Rodrigues

    2014-03-01

    Full Text Available Neste artigo, investiga-se a dinâmica do processo decisório conduzido por grupos de trabalho ao longo do tempo em ambientes com diferentes latitudes de ação (graus de liberdade para a atuação dos gestores distintos. O objetivo é verificar a influência do tempo e do ambiente nos processos decisórios em grupo. O tema é enfocado a partir de uma revisão teórica considerando três tópicos - o processo decisório conduzido por grupos, a influência do tempo nesses processos e a influência do ambiente nesses processos -, os quais dão origem às hipóteses a serem testadas. Na pesquisa de campo, de natureza quantitativa, utiliza-se o método survey e os dados foram coletados com 89 grupos da disciplina Jogos de Empresa, em um curso de graduação em Administração de Empresas. Para o tratamento dos dados, utilizou-se a modelagem por equações estruturais via partial least square para avaliação das relações entre os construtos. Como resultado, constatou-se influência temporal na associação entre qualidade do processo decisório e resultados organizacionais, reduzindo-se o efeito do perfil dos grupos. Já as relações interpessoais, independente do ambiente, influenciaram nos processos de planejamento e execução das decisões. Concluiu-se que diferentes relações entre perfil dos gestores, qualidade do processo e resultados são observadas pela incorporação simultânea das dimensões temporal e ambiental como contingências na análise do processo decisório em grupo.

  6. Sobre discurso feminista em publicações: a política do Grupo Transas do Corpo About feminist discourse in publications: Grupo Transas do Corpo's politics

    Directory of Open Access Journals (Sweden)

    Joana Plaza Pinto

    2004-12-01

    Full Text Available Uma sociedade não produz uma única forma de ver a realidade. Dividida pelos interesses antagônicos dos diferentes grupos, uma sociedade produz discursos contrários entre si. Mas há alguns que predominam sobre seus contrários numa dada época, refletindo os interesses de grupos dominantes: os discursos hegemônicos. As contrapartes antagônicas desses discursos dominantes são fortemente submetidas a formas de controle e conjuradas para se passarem por enfraquecidas. Cientes desse jogo discursivo de poder, os discursos feministas proliferam sua discussão sobre a problemática de gênero, defendendo uma sociedade plural, justa e solidária, sem contudo se deixar classificar dentro de alguma tipologia normatizadora. O Grupo Transas do Corpo, ONG feminista brasileira, busca tornar visível cada vez mais a diversidade discursiva feminista e promover a voz das mulheres no campo de discurso público. Para isso, identificou a necessidade de criar espaços de produção de textos de mulheres, de forma a criar e fortalecer a capacidade de letramento das mulheres no contexto das tecnologias de escrita contemporâneas. Para atender a esses objetivos, o Transas elaborou uma política de publicações.A society doesn't yield a only way to see reality. Divided between antagonistic interests of unequal groups, a society yield discourses in contrast and opposites. However there are some discourses that surpass yours antagonistic in your age, reproducing governing groups interests: the hegemoniacal groups. The antagonistic opponent of these governing groups are strongly submit to regulations and render void of power. Aware of these discoursive game of power, feminist discourse proliferate yours ideas about gender trouble, supporting a plural, fair and reciprocal society, although it don't go in on a standard interpretation of discourses types. Transas do Corpo Group, Brazilian feminist NGO, try to make apparent more and more the unlikeness of feminist

  7. Análisis del riesgo preconcepcional en un grupo básico de trabajo

    Directory of Open Access Journals (Sweden)

    Miguel Lugones Botell

    1995-04-01

    Full Text Available Se realiza un estudio en 669 pacientes dispensarizados con riesgo PRECONCEPCIONAL, en el grupo básico de trabajo No.4 del Policlínico Docente "26 de Julio" en el municipio Playa, y se analiza el trabajo realizado con estas pacientes durante 1990 y 1991. Se valoran diferentes parámetros tales como: edad, principales factores de riesgo, tipos de anticonceptivos utilizados, así como los resultados referentes a la mortalidad infantil, la muerte fetal tardía y el bajo peso al nacer. Se concluye que las adolescentes con actividad sexual y el riesgo social fueron los grupos más numerosos en las pacientes dispensarizadas y que hubo un buen control de la natalidad en las pacientes de riesgo en cuanto a la prenaturidad y/o bajo peso, y la mortalidad infantil, que fueron íntimos.

  8. Treinamento desportivo: perfil acadêmico dos líderes de grupos de estudo brasileiros

    Directory of Open Access Journals (Sweden)

    Hudson Fabricius Peres Nunes

    Full Text Available Resumo Este estudo objetivou caracterizar o perfil acadêmico dos professores líderes de grupos de estudo brasileiros que desenvolvem pesquisas na subárea de treinamento desportivo. A metodologia usada foi a pesquisa descritiva dos currículos acadêmicos encontrados no banco de dados da Plataforma Lattes, tendo em vista que os dados quantitativos foram interpretados a partir da análise qualitativa das informações. Os resultados revelam que os grupos estão vinculados principalmente a universidades da Região Sudeste, a maioria dos líderes é doutor e a prevalência da produção científica está relacionada à preparação orgânica, pedagógica, psicológica e desportiva dos atletas.

  9. Proposta de metodologia para análise dos grupos econômicos

    OpenAIRE

    Rabelo, Flávio Marcílio

    1996-01-01

    Este artigo discute importantes questões metodológicas relacionadas ao projeto "Grupos econômicos da indústria brasileira e a política econômica: estrutura, estratégias e desafios", pesquisa conjunta entre o Instituto de Economia da Universidade Estadual de Campinas e a Escola de Administração de Empresas de São Paulo da Fundação Getúlio Vargas (EAESP/FGV). Analisa as estratégias corporativas dos grupos econômicos baseando-se nos conceitos de sinergia, competências básicas e produtos básicos....

  10. Estudio epistemológico del objeto grupo: una mirada piagetiana a la luz del EOS

    OpenAIRE

    Omaida Sepúlveda Delgado; Nelsy Rocío González Gutiérrez; Eliécer Aldana Bermúdez

    2017-01-01

    En el artículo se presenta un análisis epistemológico sobre la evolución histórica del objeto Grupo según la visión de Piaget y García. En esta dirección, se describen unos mecanismos en el proceso evolutivo de dicho objeto matemático que parten de la premisa de que el conocimiento se produce por la interacción del individuo con su medio y de acuerdo con unas estructuras que forman parte del individuo. Así, según el análisis de la evolución del objeto Grupo, emergen los significados que este ...

  11. Grupo de pacientes de cirurgia cardíaca: relato de experiência

    Directory of Open Access Journals (Sweden)

    Elisa Helena Kuhn

    1986-09-01

    Full Text Available Neste trabalho relata-se uma experiência de grupo com pacientes de cirurgia cardíaca. A atividade realiza-se no INSTITUTO DE CARDIOLOGIA DO RIO GRANDE DO SUL e tem por objetivo proporcionar aos pacientes a oportunidade de verbalizarem suas ansiedades e conversarem sobre suas experiências relacionadas com a cirurgia e anestesia. Os grupos reúnem-se duas vezes por semana sendo constituídos por pacientes adultos em pré e pós-operatório imediato. A equipe de saúde é composta por enfermeiros, psicólogo, anestesista, cardiologistas e fisioterapeutas e sua atuação é no sentido de auxiliar na compreensão dos procedimentos aos quais o paciente vai se submeter, desfazendo fantasias distorcidas da realidade.

  12. GRUPO EMPRESARIAL ANTIOQUEÑO 1978-2002 ANÁLISIS DEL MODELO EMPRESARIAL

    Directory of Open Access Journals (Sweden)

    Carlos Felipe Londoño

    Full Text Available Como se había planteado en el artículo "Grupo Empresarial Antioqueño. Evolución de políticas y estrategias, 1978-2002", publicado en el número 1 de la Revista EIA, el análisis de las políticas y estrategias del GEA debe conducir a un modelo que permita pensar y estructurar el futuro del Grupo, a la luz de los cambios que afronta el país y el mundo. En esta oportunidad se presenta un análisis DOFA del modelo histórico del GEA, denominado .modelo de enroque., con una propuesta de un nuevo esquema de gobierno que responda en forma oportuna a las circunstancias cambiantes del mundo: el modelo de "holdings".

  13. Identidades sociales en jóvenes de sectores populares aproximaciones a un grupo de raperos

    Directory of Open Access Journals (Sweden)

    James Cuenca

    2008-01-01

    Full Text Available Este estudio se enfoca en la manera en que un grupo de jóvenes de sectores populares de Cali, Colombia, ha construido sus identidades sociales en relación con el rap. Los datos que se presentan como evidencia se apoyan en una investigación etnográfica hecha en 1998 y 2000 con grupos de raperos que tienen una fuerte ascendencia en esta ciudad. La discusión que se propone se centra, básicamente, en dos aspectos. Uno, caracterizar el tipo de identidad que los jóvenes construyen alrededor de esta oferta cultural y, dos, analizar estas identidades como un tipo de productividad simbólica que los jóvenes realizan para resistir y luchar contra las condiciones de pobreza y exclusión social en que viven.

  14. Educação para a saúde a grupo de obesos

    Directory of Open Access Journals (Sweden)

    Glaci de Oliveira Pinto Vargas

    1983-03-01

    Full Text Available Este trabalho foi realizado por enfermeiras que atuam a nível ambulatorial, num Programa de Adulto, no Serviço de Saúde Pública, de um hospital geral de Porto Alegre, RS. É uma contribuição original de uma pesquisa descritivo analítica, com grupos de clientes obesos, atendidos através de cursos de educação para a saúde. Pretende-se avaliar quatro aspectos sem ordem de prioridade: a interesse da clientela pela educação da saúde, em grupo; b impressão, em relação aso conteúdos desenvolvidos; c redução do peso; d mudança de algum hábito de vida.

  15. Metodologia de avaliação e desenvolvimento de grupos de alto desempenho

    Directory of Open Access Journals (Sweden)

    Ana Cristina Carneiro

    2008-11-01

    Full Text Available Este artigo discute a fundamentação teórica do Projeto de Avaliação e Desenvolvimento de Grupos de Alto Desempenho, concebido com base na metodologia da Meta-aprendizagem, e no Modelo Evolutivo, estendido à luz da Teoria da Complexidade. Visa ao desenvolvimento e aplicação de uma metodologia de avaliação/constituição de grupos de alto desempenho no ambiente de pesquisa e pós-graduação. A metodologia proposta validada empiricamente teve base no aproveitamento das virtudes e potencialidades das teorias que lhe deram origem. É destinado aos docentes e pesquisadores de vários campos do conhecimento, bem como aos dirigentes de instituições de educação superior e de pesquisa.

  16. Un hallazgo singular de un grupo de quipus inca en Huaycán De Cieneguilla

    OpenAIRE

    Ramos Vargas, Mario A.; Ministerio de Cultura

    2015-01-01

    El artículo informa sobre el hallazgo de un grupo de quipus inca en la Zona Arqueológica Huaycán de Cieneguilla, recuperados mediante excavación en un contexto de tumba saqueada, la cual fue intervenida como parte del PIA-2011 por el Proyecto Integral Huaycán de Cieneguilla, en el marco del Proyecto Qhapaq Ñan del Ministerio de Cultura.

  17. Psicoterapia de grupo: como surgiu e evoluiu Psicoterapia de grupo: como surgió y evolucionó Group psychotherapy: how it emerged and evolved

    Directory of Open Access Journals (Sweden)

    Luiz Paulo de C. Bechelli

    2004-04-01

    Full Text Available Este estudo tem por objetivo oferecer um panorama histórico do surgimento e evolução da psicoterapia de grupo, delineando suas raízes, principais modelos e pressupostos teóricos. Sua origem remonta ao início do século passado (1905, estendendo-se por cerca de cinco décadas: período de configuração e desenvolvimento técnico. Posteriormente, a psicoterapia de grupo passou pela fase de expansão teórica nos anos 50 e 60, seguida da fase de consolidação na década de 70, e de amadurecimento nos anos 80 e 90. Finalmente, examina-se sua evolução recente, dando ênfase especial à construção de novos modelos. Nos últimos anos, diversas técnicas desta modalidade de tratamento têm sido desenvolvidas para atendimento de populações específicas de pacientes, com as mais diversas condições médicas e psicossociais, o que sugere uma tendência crescente rumo a uma maior especificidade de sua aplicação.Este estudio tiene por objetivo mostrar un panorama histórico del surgimiento y evolución de la psicoterapia de grupo, delineando sus raíces, modelos principales y presupuestos teóricos. Su origen se remonta al inicio del siglo pasado (1905, extendiéndose por cerca de cinco décadas: periodo de configuración y desarrollo técnico. Posteriormente la psicoterapia de grupo paso por la fase de expansión teórica en los años 50 y 60, seguida de la fase de consolidación en la década de 70 y llegando a su madurez en los años 80 y 90. Finalmente, se examina su reciente evolución, dando especial énfasis a la construcción de nuevos modelos. En los últimos años, diversas técnicas en esta modalidad de tratamiento han sido desarrolladas para atención de poblaciones específicas de pacientes, con las más diversas condiciones médicas y psicosociales, lo que sugiere una tendencia creciente en dirección a una mayor especificidad para su aplicación.This study aims to offer a historical overview of the emergence and evolution of

  18. Ictericia e incompatibilidad por grupo Kell: caso clínico.

    Directory of Open Access Journals (Sweden)

    Miguel Zúñiga

    2010-08-01

    Full Text Available Dentro de las patologías más frecuentes que afectan al recién nacido se encuentra la ictericia. Sus etiologías son diversas y conforman una larga lista que varía desde causas infecciosas, metabólicas, hematológicas, inmunológicas, entre otras. Sin embargo, cuando se presenta durante las primeras horas, las causas más frecuentes corresponden a incompatibilidades de grupo sanguíneo y de ellas, la incompatibilidad Rh y ABO suelen ser más frecuentes. La incompatibilidad por grupo Kell, en cambio, es un trastorno mucho menos frecuente. Se presenta en un recién nacido con ictericia secundaria a una anemia hemolítica y que posee anticuerpos relacionados con el grupo sanguíneo Kell. Su evolución puede ser compleja y severa, requiriendo en algunos casos manejo en cuidados intensivos y apoyo importante de hemoderivados. Todo lo anterior hace importante conocer esta patología, de manera de poder identificarla y actuar a tiempo en su tratamiento.

  19. Morfología de las especies de Hyphessobrycon (Characiformes: Characidae, grupo heterorhabdus, en Colombia

    Directory of Open Access Journals (Sweden)

    Carlos A. García-Alzate

    2011-06-01

    Full Text Available El género Hyphessobrycon incluye dieciocho especies reportadas para Colombia de las cuales 13 son miembros del grupo heterorhabdus; con las mismas, se realizó un análisis morfogeométrico por medio del Método de Cerchas (Box Truss y Láminas Delgadas (TPS. Se usaron 13 hitos homólogos tipo I y tres tipo II. El resultado del análisis cluster, llevado a cabo con cada una de las metodologías indicó que estas especies están representadas en dos grandes grupos: robustas y delgadas. Las deformaciones parciales, los componentes uniformes, no uniformes, Warps principales y Warps parciales describieron cambios de la forma relacionados con la profundidad del cuerpo e involucraron desplazamientos relativos del esqueleto apendicular y de la región cefálica. Todas las especies se caracterizan por presentar crecimiento alométrico excepto Hyphessobrycon mavro con isometría entre los hitos 6-7. Se plantean dos nuevas medidas discriminantes (hocico-supraoccipital y supraoccipital-aleta pélvica para las especies del grupo.

  20. Fotometria de grupos compactos de galáxias no infravermelho próximo

    Science.gov (United States)

    Brasileiro, F.; Mendes de Oliveira, C.

    2003-08-01

    Apresentamos medidas nas bandas J, H e K de cerca de 90 galáxias em 34 grupos compactos. Através da combinação dos novos dados, com dados obtidos na literatura para a banda B, investigamos como as luminosidades, cores, tamanhos e massas das galáxias em grupos compactos foram afetadas por processos dinâmicos, e como essas diferem de galáxias em ambientes menos densos. Uma comparação dos novos valores obtidos com aqueles listados no catálogo 2MASS, mostram que para 50 galáxias estudadas em comum, as diferenças nas magnitudes J, H e K estão dentro dos erros fotométricos. Através da construção dos diagramas de cor (J-H x H-K e B-H x J-K), percebemos que as galáxias em grupos compactos ocupam posições no diagrama diferentes das posições de galáxias em campo ou em aglomerados, sendo mais parecidas com as posições ocupadas por galáxias HII, ou com excesso de poeira, acreditamos que tal deslocamento é derivado do aumento da taxa de formação estelar.

  1. La construcción de los derechos del grupo social transgénero

    Directory of Open Access Journals (Sweden)

    Jimena Cardona-Cuervo

    2016-01-01

    Full Text Available El presente artículo aborda el tema de los derechos sociales del grupo social transgénero, tradicionalmente marginado y discriminado por una sociedad que le niega la existencia de una identidad propia, a una vida digna y, por lo tanto, el derecho a la felicidad. Se asume como punto de partida que en las sociedades modernas la aceptación del derecho de igualdad sin distinción de sexo ha suprimido la correlación entre género y exclusión, pero no ha conseguido eliminar los efectos de la exclusión de la que son objeto algunos grupos con el consiguiente atentado a su dignidad, particularmente los que componen el grupo de las personas transgénero. En este sentido, y para lograr la concreción de los derechos fundamentales y sociales de todas las personas, se plantea que es preciso abandonar la concepción de la sociedad que obliga al ser humano a identificarse exclusivamente como hombre o mujer e implantar un nuevo paradigma acorde con la existencia de una ciudadanía democrática e incluyente mediante una política pública integral, que contemple la construcción de identidades de género no normativas.

  2. Espaço virtual de um grupo de pesquisa: o olhar dos tutores

    Directory of Open Access Journals (Sweden)

    Cláudia Prado

    2012-02-01

    Full Text Available O Grupo de Estudos e Pesquisas de Tecnologia da Informação nos Processos de Trabalho em Enfermagem (GEPETE visa produzir e socializar o conhecimento na área de tecnologia da informação e comunicação na saúde e enfermagem, articular a integração com grupos de pesquisas desta área e propiciar a participação de alunos. O estudo realizado pelos tutores teve como objetivo relatar a construção do ambiente virtual de aprendizagem (AVA e a experiência dos tutores como mediadores de um grupo de pesquisa na plataforma Moodle. Para tanto, foi construído um AVA, realizada a mediação pedagógica sob a temática tutoria e o diagnóstico inicial em relação às dificuldades na utilização da tecnologia na interatividade e na comunicação, o que permitiu a proposição da continuidade da utilização da plataforma como um recurso para apoiar as atividades de pesquisa, oferecer aos líderes pesquisadores mecanismos para socialização dos projetos e possibilidades de orientação à distância.

  3. Wiki como herramienta de aprendizaje en grupo y evaluación al alumno

    Directory of Open Access Journals (Sweden)

    María Jesús Miró Obradors

    2013-11-01

    Full Text Available “Estimular el aprendizaje autónomo, incentivar el estudio individual y colectivo y reducir las formas pasivas de enseñanza" es uno de los objetivos de los nuevos planes de estudios. Siendo una Wiki aquél espacio de trabajo en línea que posibilita la creación colectiva de documentos utilizando un navegador web, consideramos ésta, una buena herramienta para el desarrollo del trabajo en grupo de los alumnos, así como para realizar una evaluación continuada de los mismos. Metodología: 1 Establecer grupos de estudiantes, 2 Crear wikis en las asignaturas abiertas en Moodle del Campus Virtual UCM (CV, 2 Introducción por el profesor de las actividades, 3 Abrir un foro, 4 Envío de las tareas (CV, 5 Calificación. Resultados y conclusiones: Alumnos de asignaturas en el Área de Bioquímica y Biología Molecular y Celular del Grado en Farmacia (UCM, han trabajado en wikis: a Una tabla, en la cual cada grupo de estudiantes introduce dos palabras clave (sin repetir de cada tema impartido y a su vez, redacta el enunciado de dos preguntas relativas a palabras clave que han incluido previamente otro grupo de alumnos. La lista resultante y revisada de unas 75 cuestiones, se utilizó para elaborar exámenes, realizados en clase tras la finalización de cada bloque de contenidos. b Cuestiones relativas a seminarios y películas de cine proyectadas previamente. El módulo Wiki de Moodle ha permitido a cada estudiante trabajar en páginas web on line con sus compañeros, habiendo podido añadir, expandir o modificar su contenido en ellas. Las versiones antiguas nunca se eliminan y pueden restaurarse. Esto ha permitido, además de calificar el trabajo de grupo, hacer un seguimiento del trabajo individual de cada estudiante, para su mejor evaluación. PIMCD 2013 nº 3 (UCM.

  4. Diversidad genética, entre y dentro de los mayores grupos humanos

    Directory of Open Access Journals (Sweden)

    Barbujani, G.

    2003-01-01

    Full Text Available Varios estudios están de acuerdo cuando reportan que cerca del 85% de la diversidad del ADN autosomal y de los loci de las proteínas se debe a diferencias entre individuos dentro de la misma población, mientras que las diferencias entre los grupos de diferentes continentes son responsables de solamente 10% de la variación genética total. Estos resultados están en conflicto con nociones populares de razas humanas claramente distintas y relativamente homogéneas, y nos hacen cuestionar la utilidad de clasificaciones étnicas en diagnósticos médicos, en el campo forense y en genética farmacológica. Nuevos datos obtenidos de inserciones polimórficas de Alu y del cromosoma Y confirman los resultados previos, aunque indican una diversidad mayor en algunos (pero no todos los loci del cromosoma Y. Estos datos nos permiten investigar dos preguntas: (1 si las diferencias continentales, aunque pequeñas, son suficientemente grandes como para asignar a individuos a sus continentes basados en sus genotipos; (2 si los genotipos observados se agrupan en grupos de población o continentales cuando el origen de la muestra se ignora. Usando varios métodos estadísticos, veremos que los errores de clasificación son por lo menos de un 30% para los polimorfismos autosomales bi-alélicos, y de un 27% para el cromosoma Y. Cuatro series de datos genéticos de todo el mundo sugieren la existencia de grupos de genotipos diferentes, pero que éstos cuatro grupos no coinciden el uno con el otro. Adicionalmente, estudios de bloques de ADN del genoma humano indican que la mayor parte de dichos bloques es compartida entre los continentes, con solamente un pequeño porcentaje siendo específico a ciertos continentes. Estos resultados no indican que haya una base clara para subdividir a los humanos en grupos biológicamente definidos. Este puede no ser un problema en áreas aplicadas de genéticas, dado que los métodos rápidos para obtener genotipos individuales

  5. Identification and characterization of potential NBS-encoding resistance genes and induction kinetics of a putative candidate gene associated with downy mildew resistance in Cucumis

    Directory of Open Access Journals (Sweden)

    Wan Hongjian

    2010-08-01

    Full Text Available Abstract Background Due to the variation and mutation of the races of Pseudoperonospora cubensis, downy mildew has in recent years become the most devastating leaf disease of cucumber worldwide. Novel resistance to downy mildew has been identified in the wild Cucumis species, C. hystrix Chakr. After the successful hybridization between C. hystrix and cultivated cucumber (C. sativus L., an introgression line (IL5211S was identified as highly resistant to downy mildew. Nucleotide-binding site and leucine-rich repeat (NBS-LRR genes are the largest class of disease resistance genes cloned from plant with highly conserved domains, which can be used to facilitate the isolation of candidate genes associated with downy mildew resistance in IL5211S. Results Degenerate primers that were designed based on the conserved motifs in the NBS domain of resistance (R proteins were used to isolate NBS-type sequences from IL5211S. A total of 28 sequences were identified and named as cucumber (C. sativus = CS resistance gene analogs as CSRGAs. Polygenetic analyses separated these sequences into four different classes. Quantitative real-time polymerase chain reaction (qRT-PCR analysis showed that these CSRGAs expressed at different levels in leaves, roots, and stems. In addition, introgression from C. hystrix induced expression of the partial CSRGAs in cultivated cucumber, especially CSRGA23, increased four-fold when compared to the backcross parent CC3. Furthermore, the expression of CSRGA23 under P. cubensis infection and abiotic stresses was also analyzed at different time points. Results showed that the P. cubensis treatment and four tested abiotic stimuli, MeJA, SA, ABA, and H2O2, triggered a significant induction of CSRGA23 within 72 h of inoculation. The results indicate that CSRGA23 may play a critical role in protecting cucumber against P. cubensis through a signaling the pathway triggered by these molecules. Conclusions Four classes of NBS-type RGAs were

  6. The Infection of Cucumber (Cucumis sativus L. Roots by Meloidogyne incognita Alters the Expression of Actin-Depolymerizing Factor (ADF Genes, Particularly in Association with Giant Cell Formation

    Directory of Open Access Journals (Sweden)

    Bin Liu

    2016-09-01

    Full Text Available Cucumber (Cucumis sativus L. is threatened by substantial yield losses due to the south root-knot nematode (Meloidogyne incognita. However, understanding of the molecular mechanisms underlying the process of nematode infection is still limited. In this study, we found that M. incognita infection affected the structure of cells in cucumber roots and treatment of the cytoskeleton inhibitor (cytochalasin D reduced root-knot nematode (RKN parasitism. It is known that Actin-Depolymerizing Factor (ADF affects cell structure, as well as the organization of the cytoskeleton. To address the hypothesis that nematode-induced abnormal cell structures and cytoskeletal rearrangements might be mediated by the ADF genes, we identified and characterized eight cucumber ADF (CsADF genes. Phylogenetic analysis showed that the cucumber ADF gene family is grouped into four ancient subclasses. Expression analysis revealed that CsADF1, CsADF2-1, CsADF2-2, CsADF2-3 (Subclass I and CsADF6 (Subclass III have higher transcript levels than CsADF7-1, CsADF7-2 (Subclass II genes and CsADF5 (Subclass IV in roots. Members of subclass I genes (CsADF1, CsADF2-1, CsADF2-2 and CsADF2-3, with the exception of CsADF2-1, exhibited a induction of expression in roots 14 days after their inoculation (DAI with nematodes. However, the expression of subclass II genes (CsADF7-1 and CsADF7-2 showed no significant change after inoculation. The transcript levels of CsADF6 (Subclass III showed a specific induction at 21 DAI, while CsADF5 (Subclass IV was weakly expressed in roots, but was strongly up-regulated as early as 7 DAI. In addition, treatment of roots with cytochalasin D caused an approximately two-fold down-regulation of the CsADF genes in the treated plants. These results suggest that CsADF gene mediated actin dynamics are associated with structural changes in roots as a consequence of M. incognita infection.

  7. The effects of different sewage sludge amendment rates on the heavy metal bioaccumulation, growth and biomass of cucumbers (Cucumis sativus L.).

    Science.gov (United States)

    Eid, Ebrahem M; Alrumman, Sulaiman A; El-Bebany, Ahmed F; Hesham, Abd El-Latif; Taher, Mostafa A; Fawy, Khaled F

    2017-07-01

    When sewage sludge is incorrectly applied, it may adversely impact agro-system productivity. Thus, this study addresses the reaction of Cucumis sativus L. (cucumber) to different amendment rates (0, 10, 20, 30, 40 and 50 g kg -1 ) of sewage sludge in a greenhouse pot experiment, in which the plant growth, heavy metal uptake and biomass were evaluated. A randomized complete block design with six treatments and six replications was used as the experimental design. The soil electrical conductivity, organic matter and Cr, Fe, Zn and Ni concentrations increased, but the soil pH decreased in response to the sewage sludge applications. As approved by the Council of European Communities, all of the heavy metal concentrations in the sewage sludge were less than the permitted limit for applying sewage sludge to land. Generally, applications of sewage sludge of up to 40 g kg -1 resulted in a considerable increase in all of the morphometric parameters and biomass of cucumbers in contrast to plants grown on the control soil. Nevertheless, the cucumber shoot height; root length; number of leaves, internodes and fruits; leaf area; absolute growth rate and biomass decreased in response to 50 g kg -1 of sewage sludge. All of the heavy metal concentrations (except the Cu, Zn and Ni in the roots, Mn in the fruits and Pb in the stems) in different cucumber tissues increased with increasing sewage sludge application rates. However, all of the heavy metal concentrations (except the Cr and Fe in the roots, Fe in the leaves and Cu in the fruits) were within the normal range and did not reach phytotoxic levels. A characteristic of these cucumbers was that all of the heavy metals had a bioaccumulation factor sewage sludge used in this study could be considered for use as a fertilizer in cucumber production systems in Saudi Arabia and can also serve as a substitute method of sewage sludge disposal. Graphical Abstract The effects of different sewage sludge amendment rates on the heavy

  8. Crítica e invenção nas poéticas de João Cabral de Melo Neto e Manoel de Barros DOI - 10.5752/P.2358-3428.2013v17n33p147

    Directory of Open Access Journals (Sweden)

    Luiz Hernrique Barbosa

    2013-12-01

    Full Text Available Partindo da hipótese de que as poéticas de João Cabral de Melo Neto e Manoel de Barros são guiadas por um traço comum, o da convergência entre poesia e crítica, este estudo mostra as especificidades de cada poeta ao produzir poesia crítica e textos críticos sobre poesia. Chega-se à conclusão de que essa convergência tem por objetivo apresentar a matéria de poesia dos poetas: a eleição do elemento prosaico. É ressaltado que os dois poetas, ao elevarem ao estatuto de poesia elementos pouco nobres, ao fazerem da crítica a matéria fundamental de sua poesia, estariam renovando uma poesia que não se vale de tais elementos.Palavras-chave: Crítica. Poesia. João Cabral de Melo Neto. Manoel de Barros.

  9. Determinación de anticuerpos contra Cryptococcus neoformans en un grupo de colombófilos

    OpenAIRE

    Carmen Sofía Corrales; Nelly Ordóñez; Luisa Marcela Londoño; Elizabeth Castañeda

    1987-01-01

    Se evaluó la respuesta humoral, medida como anticuerpos específicos anti-Criptococcus neoformans, en 69 sueros de un grupo de colombófilos de Bogotá; grupo considerado como de alto riesgo dado el frecuente contacto con el material contaminado con el microorganismo. Además se estudiaron 65 sueros de un grupo control constituído por personas dedicadas a actividades diferentes. En las pruebas de inmunofluorescencia indirecta y aglutinación en tubo, no se evidenció diferencia entre los niveles de...

  10. Grupo de pais no psicodiagnóstico colaborativo : uma compreensão fenomenológica existencial

    OpenAIRE

    Andréa Cristina Tavelin Biselli

    2013-01-01

    Este estudo parte das inquietações vividas pela autora a partir da experiência na modalidade de prática psicológica do Psicodiagnóstico Colaborativo com pais e crianças em grupo, numa perspectiva fenomenológica existencial. Objetiva compreender a experiência de grupo de pais em tal modalidade de prática psicológica. Sua base fenomenal reside em quatro relatos de experiências de pais que vivenciaram o atendimento em grupo no processo do Psicodiagnóstico Colaborativo realizado na clínica-escola...

  11. Estudio de la evidencia del concepto de grupo en el modelo de adaptación de Roy

    OpenAIRE

    Cavalcante Guedes, María Vilaní; Lopes, Marcos Venícios de Oliveira; Araujo, Thelma Leite de

    2005-01-01

    El estudio tiene como objetivo evaluar el concepto de grupo en el Modelo de Adaptación de Roy tomando por parámetro el criterio interno de evidencia del modelo de análisis de teoría propuesto por Barnum (1998). Discutimos el concepto de grupo con base en diferentes autores, y también según descrito por Roy en sus diversos modos de adaptación. Encontramos que la evidencia del concepto grupo, en los modos de adaptación, se quedó perjudicada y que el Modelo Teórico ...

  12. Enfoques do comprometimento dos membros dos grupos PET da USP: um estudo comparativo entre grupos da capital e do interior [doi: 10.5329/RECADM.20090802005

    Directory of Open Access Journals (Sweden)

    Marcus Felipe Brito Castro

    2009-11-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 RESUMO O Comprometimento pode ser interpretado como vínculos entre pessoas e organizações e a natureza desses vínculos pode afetar o desempenho e resultados de ambos. O presente estudo, exploratório, de caráter qualitativo, tem como objetivo investigar os enfoques de comprometimento dos integrantes dos grupos PET – Programa de Educação Tutorial da Universidade de São Paulo – USP, da Capital e do Interior, comparando esses grupos em relação à predominância desses enfoques. Para desenvolver a análise foi utilizado o modelo tridimensional de Meyer e Allen (1991 com seus três enfoques de comprometimento: normativo, afetivo e instrumental, lembrando que uma pessoa pode apresentar os três, em maior ou menor grau. Os resultados encontrados indicam uma grande semelhança entre os enfoques dos grupos PET, sendo que o afetivo e o normativo apresentaram maior destaque nas amostras e, por serem enfoques que geram maior desempenho, contribuem para a perenidade e evolução do Programa. Ainda, o afetivo esteve relacionado principalmente aos objetivos, valores e metas, enquanto o normativo surgiu da valorização de esforço e obrigação.   Palavras-Chave: Comprometimento Organizacional; Enfoques; Organização PET.     ABSTRACT The commitment can be interpreted as links between a person and the organization, and the nature of these links can affect the performance and results of both. The present exploratory and qualitative study has as objective to study the approaches of commitment of the integrants of groups PET (Tutorial Education Program of University of São Paulo (USP, comparing groups PET of the Capital with those of the Internal in relation with the predominant approaches. To develop the analysis, was used the three-dimensional model of Allen and Meyer (1991 that shows and analysis the existence of three approaches of commitment: normative, affective

  13. Grupos de utilizacion de recursos en unidades de agudos y media estancia de servicios de geriatria

    Directory of Open Access Journals (Sweden)

    Solano Jaurrieta Juan José

    2001-01-01

    Full Text Available Fundamentos: En los últimos años se han implantado en nuestro país Sistemas de Clasificación de Pacientes (SCP con objeto de medir el «producto hospitalario». Sin embargo los sistemas más tradicionales resultan poco adecuados para la población anciana, en los que la incapacidad asociada a la enfermedad resulta determinante para explicar el consumo de recursos y los resultados asistenciales. Por ello, nos planteamos aplicar en servicios especializados de atención al anciano un sistema que contempla este parámetro, los Grupos de Utilización de Recursos (RUG, analizando las características y diferencias en la distribución en función de RUG en cuatro Servicios de Geriatría. Métodos: Se estudian transversalmente, mediante cortes sucesivos en períodos superiores a la estancia media en cada unidad, los pacientes ingresados en las unidades de agudos y media estancia de los Servicios de Geriatría del Hospital Monte Naranco (HMN (n=318, Hospital Central de la Cruz Roja (HCCR (n=384, Hospital General de Guadalajara (HG (n=272 y Hospital Virgen del Valle (HVV (n=390, en lo relativo a su distribución según la clasificación RUG-T18. Las posibles diferencias entre los centros se analizaron mediante el test estadístico chi-cuadrado (SPSS para windows Resultados: Para el conjunto de la muestra los pacientes se concentran en los grupos R, S y C de la clasificación, con muy escasa representación de los grupos P y B, detectándose diferencias entre los centros. Así, el HCCR es el que maneja una mayor proporción de pacientes del grupo R (47,64% vs. 23,66% en el HMN, 20,57% en el HG y 20,53% en el HVV y una menor proporción de pacientes del grupo S (3,12% vs 6,40% en el HMN, 9,92% en el HG y 9,76% en el HVV y C (48,94% vs 76,29% en el HMN, 66,89% en el HG y 68,36% en el HVV. Igualmente es posible detectar diferencias en el análisis individual para las unidades de agudos y media estancia. Conclusiones: Los grupos de utilización de recursos

  14. GRUPOS DE UTILIZACION DE RECURSOS EN UNIDADES DE AGUDOS Y MEDIA ESTANCIA DE SERVICIOS DE GERIATRIA

    Directory of Open Access Journals (Sweden)

    Juan José Solano Jaurrieta

    2001-01-01

    Full Text Available Fundamentos: En los últimos años se han implantado en nuestro país Sistemas de Clasificación de Pacientes (SCP con objeto de medir el «producto hospitalario». Sin embargo los sistemas más tradicionales resultan poco adecuados para la población anciana, en los que la incapacidad asociada a la enfermedad resulta determinante para explicar el consumo de recursos y los resultados asistenciales. Por ello, nos planteamos aplicar en servicios especializados de atención al anciano un sistema que contempla este parámetro, los Grupos de Utilización de Recursos (RUG, analizando las características y diferencias en la distribución en función de RUG en cuatro Servicios de Geriatría. Métodos: Se estudian transversalmente, mediante cortes sucesivos en períodos superiores a la estancia media en cada unidad, los pacientes ingresados en las unidades de agudos y media estancia de los Servicios de Geriatría del Hospital Monte Naranco (HMN (n=318, Hospital Central de la Cruz Roja (HCCR (n=384, Hospital General de Guadalajara (HG (n=272 y Hospital Virgen del Valle (HVV (n=390, en lo relativo a su distribución según la clasificación RUG-T18. Las posibles diferencias entre los centros se analizaron mediante el test estadístico chi-cuadrado (SPSS para windows Resultados: Para el conjunto de la muestra los pacientes se concentran en los grupos R, S y C de la clasificación, con muy escasa representación de los grupos P y B, detectándose diferencias entre los centros. Así, el HCCR es el que maneja una mayor proporción de pacientes del grupo R (47,64% vs. 23,66% en el HMN, 20,57% en el HG y 20,53% en el HVV y una menor proporción de pacientes del grupo S (3,12% vs 6,40% en el HMN, 9,92% en el HG y 9,76% en el HVV y C (48,94% vs 76,29% en el HMN, 66,89% en el HG y 68,36% en el HVV. Igualmente es posible detectar diferencias en el análisis individual para las unidades de agudos y media estancia. Conclusiones: Los grupos de utilización de recursos

  15. A DINÂMICA DAS COMPETÊNCIAS ORGANIZACIONAIS: A TRAJETÓRIA DO GRUPO PAQUETÁ

    Directory of Open Access Journals (Sweden)

    Cristiane Froehlich

    2009-01-01

    Full Text Available Este artigo busca analisar o desenvolvimento de competências organizacionais nos diferentes negócios de uma empresa do setor calçadista do RS e a sua articulação com as práticas de gestão, tendo como referência a sua história. Entende-se que as competências devem ser compreendidas sob uma perspectiva dinâmica, pois as mudanças são características constantes do mercado. Neste contexto, a trajetória de uma organização pode ser considerada como um dos pontos fundamentais para o entendimento da dinâmica de uma organização, pois sua análise gera informações que explicam as mudanças e estratégias tomadas ao longo do tempo. Trata-se de uma pesquisa qualitativa, de natureza exploratória e descritiva, desenvolvida através do método de estudo de caso no Grupo Paquetá. Os dados foram coletados através de entrevistas semi-estruturadas com diretores e gerentes (22 depoimentos e de análise documental. Os principais resultados encontrados revelam que o Grupo Paquetá possui as competências distintivas que se referem às capacidades de gestão e técnica. Essas competências distintivas originaram as competências intermediárias/funcionais, tendo como base os três elementos da competência organizacional do Grupo: inovação e tecnologia, pessoas, estrutura e processos consolidados ao longo da trajetória da empresa. Palavras-chave: Competência Organizacional. Estratégia. Visão Baseada em Recursos. Mudança. Trajetória.

  16. Contaminación acústica por grupos electrógenos

    Directory of Open Access Journals (Sweden)

    Yanexy Cepero-Aguilera

    2009-05-01

    Full Text Available El trabajo tiene como tema el impacto ambiental por ruido de grupos electrógenos (GE. Se muestran diferentes definiciones y conceptos referidos a la explotación de los GE y las consecuencias que puede provocar a las personas que permanezcan cerca de ellos durante su funcionamiento. Los grupos electrógenos son además de generadores de energía, generadores de ruido y por tanto contribuyen a la contaminación acústica del lugar donde estén situados. En el documento se aborda la importancia del correcto uso y selección de los protectores auditivos para aquellas personas que trabajen directamente en las baterías de grupos electrógenos, así como algunas formas de atenuar el ruido. También se caracteriza la emisión sonora de estos a partir de estudios realizados.This paper concerns with the environmental damage due to noise emission introduced by Engine Generator Sets. Definitions and concepts about Engine Generator operation are shown as well as the consequences over the personnel who stand near the Engine Generators during their operation. Obviously, such kind of machines generates energy but they also generate noise which contaminates the environment around them. The paper states how important are the right selection and use of noise protection devices for those whose main job is to operate engine generator sets. Some methods for noise damping are also shown. Finally, some case studies are presented in order to describe the noise emission registered in the real world.

  17. Distorsiones cognitivas: diferencias entre abusadores sexuales, delincuentes violentos y un grupo control

    Directory of Open Access Journals (Sweden)

    José Ignacio Ruiz Pérez

    2016-08-01

    Full Text Available A través de una investigación transeccional de tipo descriptivo- comparativo, se propuso como objetivo realizar la exploración, descripción y comparación de la variable distorsiones cognitivas en tres grupos diferentes: hombres condenados por delitos sexuales a menores de edad, delincuentes violentos no sexuales y personas sin historia de privación de la libertad en establecimientos carcelarios. Para la evaluación de la variable de estudio se tradujo y adaptó al español la Cognitive Scale, y posteriormente se aplicó a 149 personas del género masculino, en edades entre los 18 y 57 años. Los principales resultados obtenidos ponen de manifiesto que aun cuando no existen diferencias significativas a nivel general en la variable, el grupo de agresores sexuales presentó distorsiones asociadas a la justificación y minimización del hecho delictivo. Y considerándose un resultado sorprendente, el grupo de comparación mostró mayor presencia de distorsiones cognitivas que los conjuntos de personas reclusas. Finalmente, se sugiere recurrir a otros métodos de evaluación que permitan, por medio del relato hablado, la identificación de distorsiones cognitivas en población penitenciaria, las cuales podrían solaparse en técnicas de medición convencionales que son contestadas en términos de aquiescencia.

  18. Metasíntesis en alfabetización para el empoderamiento de grupos vulnerables

    Directory of Open Access Journals (Sweden)

    2017-10-01

    Full Text Available La vulnerabilidad se traduce en grupos humanos concretos que, si bien conocen lo que ocurre alrededor de ellos en materia digital, por su propia condición social y cultural están marginados y, en ese sentido, alejados del ejercicio del derecho a la información. El objetivo ha sido analizar la alfabetización crítica, mediática y digital para el empoderamiento de grupos vulnerables. La revisión sistemática de la literatura (meta-síntesis abarca el período comprendido entre los años 1996-2016 y arrojó 202 documentos, de los cuales 117 cumplieron con los criterios de inclusión (105 investigaciones documentales y 12 estudios cualitativos. Los resultados indican que niños, adolescentes y adultos se han beneficiado y empoderado de esta alfabetización, incluso con niveles bajos de educación, con situación de desventaja económica, con altos niveles de exclusión social o cultural. Son los espacios informales los que prevalecen para esta formación mediática y digital y la reflexión sobre la necesaria alfabetización. Se analiza también en este estudio la influencia del empode¬ramiento en la esfera social y personal, y las implicaciones educativas y comunicacionales para quienes tienen la responsabilidad de empoderar. Se concluye que los grupos son vulnerables si solamente se mantienen con bajos niveles de formación y que alfabetizarlos otorga el empoderamiento requerido para la vida ciudadana.

  19. Funcionamiento familiar: Su percepción por diferentes grupos generacionales y signos de alarma

    Directory of Open Access Journals (Sweden)

    Anagalys Ortega Alvelay

    2003-08-01

    Full Text Available Se estudió un grupo de familias pertenecientes a un área de salud del municipio Cienfuegos, con el objetivo de valorar la percepción que tiene cada grupo generacional sobre el funcionamiento de sus respectivas familias, así como los signos de alarma presentes en ellas. Se utilizó el instrumento APGAR para diagnosticar el funcionamiento familiar. Predominaron las respuestas positivas para los componentes del APGAR familiar crecimiento espiritual, resolución y participación. Los adultos mayores consideraron con mayor frecuencia que sus familias eran funcionales, mientras que en el resto de los grupos etáreos, el mayor porcentaje de sus miembros, consideró lo contrario; no encontramos diferencias estadísticas significativas entre estas variables. En las familias disfuncionales se presentaron de manera marcada los signos de alarma. La ansiedad crónica con síntomas difusos y la migraña atípica fueron los más fecuentes.A group of families, which belong to the health care area of Cienfuegos municipality, were studied to assess the perception that each generation group has on the functioning of their own families as well as the alarm signals found in them. The APGAR instrument was used to diagnose the family functioning. Positive responses were predominant for APGAR components such as spiritual growth, resolution and participation. Older adults often stated that their families were functional whereas a higher percentage of the members of the rest of the age groups considered that their families were not functional; however, no significant statistical differences were found among the variables. Dysfunctional families showed remarkable alarm signals. Chronic anxiety with diffuse symptoms and atypical migraine were the most frequent signs.

  20. El trabajo a turnos como factor de riesgo para lumbago en un grupo de trabajadores peruanos.

    Directory of Open Access Journals (Sweden)

    Juan Carlos Palomino Baldeon

    2005-07-01

    Full Text Available Objetivo: Identificar la asociación entre trabajo a turnos y lumbago en un grupo de trabajadores mineros. Materiales y métodos: Estudio Caso Control realizado el año 2003 en un grupo de trabajadores mineros. Se revisaron las historias electrónicas de los trabajadores con lumbago, en quienes se obtuvo la edad, sexo, estado civil, grado de instrucción, tiempo de trabajo, índice masa corporal (IMC, trabajo a turnos (8 horas y puesto de trabajo, éste último, se dividió en "white collar" (trabajo de oficina y "blue collar"(trabajo no oficina. Se calculó el Odds Ratio para trabajo a turnos y puesto de trabajo versus lumbago. Resultados: De 1 240 trabajadores, 149 (72% tuvieron lumbago sin ciática y 56 (28% con ciática. No se encontró diferencias estadísticamente significativas para las variables demográficas descritas entre los grupos de estudio. Se encontró que los trabajadores de trabajo por turnos tuvieron un OR para lumbago sin ciática de 1,28 (IC de 0,89 - 1,82 y lumbago con ciática un OR de 2,12 (CI 1,4- 3,93. En relación al puesto de trabajo tipo blue collar se encontró que para lumbago sin ciática tuvo un OR de 1,63 (IC 1,05-2,51 y para lumbago con ciática se tiene OR de 1,48 (IC 0,76-2,9. Conclusión: Existe un riesgo mayor en trabajadores de turnos de trabajo para lumbago con ciática y mayor riesgo en trabajadores con puestos de trabajo tipo blue collar para lumbago sin ciática. (Rev Med Hered 2005;16:184-189.

  1. Posibilidades educativas de las redes sociales y el trabajo en grupo. Percepciones de los alumnos universitarios

    Directory of Open Access Journals (Sweden)

    Julio Cabero Almenara

    2014-01-01

    Full Text Available El cambio en las metodologías de aula viene de la mano, en muchos casos, de Internet y de las herramientas de la Web 2.0. Por otra parte, el desarrollo de una perspectiva de corte constructivista apoyado en el trabajo en grupo, suponen que la formación de los estudiantes puede ser alimentada a través de este tipo de recursos, dado que potencia, entre otros aspectos la socialización, la búsqueda de información, el logro de una meta común, etc. La investigación que aquí se presenta versa sobre la realidad de los procesos de aprendizaje universitario con TIC y las preferencias para trabajar dentro y fuera del aula de los estudiantes de las universidades de Córdoba, Huelva, Sevilla y País Vasco. Los objetivos se centran en conocer las percepciones que los alumnos tienen sobre el software social y el trabajo en grupo y colaborativo, cuáles son las herramientas de software social que emplean y si hay diferencias en función de la universidad de procedencia. Se empleó como instrumento de recogida de datos un cuestionario conformado por cuatro dimensiones. Se concluye que el alumnado está interesado en el empleo del trabajo en grupo como metodología de aula, así como su escaso conocimiento de las herramientas tecnológicas, salvo de las redes sociales. Al mismo tiempo, estos resultados aportan un instrumento fiable para el diagnóstico de las variables que lo conforman.

  2. Grupo reflexivo de professores da educação superior: Estudo sobre seus movimentos construtivos

    Directory of Open Access Journals (Sweden)

    Hedioneia Maria F. Pivetta

    2014-01-01

    Full Text Available El foco de ese estudio está concentrado en los movimientos constructivos del grupo de profesores reflexivos como dispositivos de aprendizaje docente de la educación superior. Tubo por objetivos identificar cuales los movimientos constructivos de este grupo, analizar la dinámica grupal y el aprendizaje de la docencia a partir de él. El camino recorrido envolvió el abordaje metodológica de cuño cualitativo narrativo con características de investigación-formación e investigación-acción (Maciel, 2006. Se desarrolló a partir de quince encuentros con un grupo de dieciséis profesores de una institución confesional del Rio Grande do Sul, Brasil, teniendo como estrategia propulsora de la reflexión el diario de clase adoptado por los profesores y vivencias planeadas para los encuentros. La análisis textual discursiva (Moraes & Galiazzi, 2007 constituyó la escoja para la sistematización de los resultados. El trayecto hecho permitió identificar la dinámica grupal envolviendo tres movimientos constructivos: (1 articulación inicial; (2 aproximaciones y alejamientos; y (3 continuum reflexivo. El aprendizaje docente se constituyó en un proceso inter e intrapersonal e inter-relacional en el contexto grupal, establecido como un lugar motivacional y de compartir, agentes de la transformación en el sentir, en el pensar y en el actuar de los profesores.

  3. Exploración de las emociones percibidas en cuatro grupos de edad

    Directory of Open Access Journals (Sweden)

    Claudia J. Arias

    2013-12-01

    Full Text Available En el presente artículo se presentan los resultados de un estudio empírico de comparación de grupos de edad sobre Emociones Percibidas. Los antecedentes sobre este tema son escasos –tanto a nivel internacional como local- y poco claros, por lo que se considera necesario explorar el constructo. Se utilizó la versión validada para población local  de las escalas de Lawton  (Intensidad del afecto; Moderación del afecto positivo; Búsqueda de sensaciones; Control cognitivo; Madurez emocional; Disimulación afectiva; Responsividad psicofisiológica; Variabilidad afectiva; Duración del afecto y Rapidez de la respuesta afectiva. Se seleccionó una muestra intencional de 480 sujetos de ambos sexos, 240 de la ciudad de Mar del Plata y 240 de la ciudad de Buenos Aires. Se encontraron puntajes significativamente más altos en los grupos de adultos mayores en las dimensiones Moderación del afecto positivo, el Control cognitivo, Disimulación afectiva y la Madurez emocional. No se encontraron diferencias significativas entre los distintos grupos de edad en las dimensiones Intensidad del afecto y Responsividad psicofisiológica. Los resultados son consistentes con los antecedentes de investigación que señalan que los adultos mayores presentan elevados niveles de habilidades de regulación emocional, lo que fortalece la mirada de la psicología positiva y del curso vital sobre el envejecimiento.  

  4. Comportamiento de las Crisis Hipertensivas en un Grupo de Pacientes Hipertensos

    OpenAIRE

    Osvaldo Valdés Dupeyrón; Ernesto Chávez Pérez; Francisco M. Torres Barrera

    2014-01-01

    Introducción: La Hipertensión Arterial (HTA) está considerada uno de los problemas de salud más significativos en la actualidad, por considerarse el principal factor de riesgo de las enfermedades cardiovasculares y cerebrovasculares. Objetivo: Describir el comportamiento de las crisis hipertensivas en el grupo de pacientes estudiados. Materiales y Métodos: Se realizó un estudio longitudinal prospectivo en 130 pacientes adultos hipertensos, pertenecientes a la población de un consultorio médic...

  5. ACTIVIDADES DE LA VIDA DIARIA EN ADULTOS MAYORES: LA EXPERIENCIA DE DOS GRUPOS FOCALES

    OpenAIRE

    Christian Oswaldo Acosta Quiroz; Ana Luisa Mónica González-Celis Rangel

    2010-01-01

    El presente estudio tuvo como objetivo obtener una muestra de ejemplos de actividades recreativas físicas y mentales, sociales, de independencia y de protección a la salud, como propuesta inicial de un inventario de actividades de la vida diaria en adultos mayores, a través del desarrollo de dos grupos focales organizados alrededor del tema de actividades cotidianas en ancianos, con ocho y quince adultos mayores, respectivamente. Los resultados reflejan una amplia variedad de actividades de l...

  6. Modelo de decisão em grupo para gerenciar perdas de água

    OpenAIRE

    Morais, Danielle Costa; Almeida, Adiel Teixeira de

    2006-01-01

    O planejamento de ações em sistemas de abastecimento, especialmente quanto à redução de perdas e desperdícios de água, normalmente envolve grupos ou instituições com diferentes objetivos, responsabilidades e interesses. Inclui também uma grande variedade de alternativas para minimização do problema, principalmente em termos de custo e desempenho, fazendo com que a escolha se torne uma tarefa bastante complexa, requerendo uma metodologia específica para tratamento dos conflitos. Com o intuito ...

  7. Empatía: diferencias entre abusadores sexuales, delincuentes violentos y un grupo control

    OpenAIRE

    Cepeda Rodríguez, Zulma Yadira; Ruiz Pérez, José Ignacio

    2015-01-01

    El objetivo fue explorar, describir y comparar la variable empatía en tres grupos: agresores sexuales de menores de edad, delincuentes violentos no sexuales y personas sin historia de reclusión en establecimientos carcelarios, por medio de una investigación transeccional de tipo descriptivo- comparativo. Para evaluar la variable de estudio se tradujo y adaptó al español el instrumento de medición The Child Molester Empathy Measure. Posteriormente esta escala se aplicó a una muestra de conveni...

  8. Aporte de vitaminas y minerales por grupo de alimentos en estudiantes universitarios chilenos

    OpenAIRE

    Samuel Durán Agüero; Susanne Reyes García; María Cristina Gaete

    2013-01-01

    Introducción: La etapa universitaria es un proceso en el cual las personas pasan por periodos prolongados de inactividad física y horarios irregulares de comidas, lo que conlleva al incremento en el consumo de alimentos procesados y de comida rápida. Objetivo: Fue determinar el aporte vitaminas y minerales por grupo de alimentos en la alimentación de estudiantes universitarios. Métodos: Se trabajó con una muestra de 654 estudiantes universitarios chilenos (18-24 años, 54% mujeres), a quienes ...

  9. Coordinación de grupos en juegos móviles basados en posicionamiento

    OpenAIRE

    Inafuku, Fernando Gabriel; Galella, Pablo Fernando

    2017-01-01

    Coordinar tareas para ser llevadas a cabo por un grupo de personas permite obtener una acción unificada y uniforme donde la suma de los esfuerzos individuales se potencian en pos de resolver actividades. En el caso de los Juegos Móviles basados en Posicionamiento, requiere que los participantes se coordinen en posiciones (o áreas) determinadas del ambiente físico para poder avanzar en el juego. Se tomó como base la tesina de grado de Matías Apezteguía y Darío Rapetti denominada “Juego Educati...

  10. Brote de faringo-amigdalítis por estreptococo ?-hemolítico grupo A

    OpenAIRE

    Culqui,Dante R; Manzanares-Laya,Sandra; Van Der Sluis,Sarah Lafuente; Fanlo,Albert Anton; Comas,Rosa Bartolomé; Rossi,Marcello; Caylá,Joán A

    2014-01-01

    El objetivo fue describir un brote de faringo-amigdalitis causado por estreptococos β-hemolíticos del grupo A (EGA) en profesionales de la salud. El estudio que se transmite de persona-persona o por vía alimentaria. El estudio transversal descriptivo se realizó en 17 clientes, localizados en la misma mesa, que participaron de una cena en restaurante de Barcelona, España, en julio de 2012. Se analizaron, la frecuencia de síntomas de los afectados, el tiempo y la s...

  11. Neuropsicologia transcultural: grupo indígena guarani Cross culture neuropsychology: guarany indian group

    Directory of Open Access Journals (Sweden)

    Vivian Maria Andrade

    2007-12-01

    Full Text Available Para investigar a influência da cultura sobre o desempenho cognitivo foram estudados processos intelectuais em indivíduos de populações etnicamente diferentes. Avaliamos 12 índios e 12 pessoas não indígenas, ambos os grupos constituídos por moradores da periferia de São Paulo, pareados de acordo com idade e nível educacional. Os seguintes testes foram utilizados: Dígitos, Blocos de Corsi, Desenho com Cubos e Nomeação de Figuras. A memória verbal imediata e tardia foi avaliada por meio de estórias relacionadas ao contexto ecológico de ambos os grupos, e a memória visual, pela apresentação e recuperação de figuras. Os resultados quantitativos não demonstraram diferenças significativas entre os grupos, porém, houve uma tendência estatística dos índios mostrarem maior domínio das tarefas visuais e motoras, e os não índios das tarefas verbais. Em conclusão, é possível que o grupo indígena use a cognição de forma mais concreta e intuitiva, em função do estilo peculiar de vida, das habilidades desenvolvidas, associado à baixa escolaridade.Intellectual processes were investigated in two different populations to study the influence of culture in cognitive performance. Twelve people of an indian population of the Guarany ethnic nation were compared to 12 people ("non-indians" paired according to age and education level, both groups residing in the periphery of the city of São Paulo. The following tests were used: Digit Span; Corsi Block-Tapping Test; Block Design and Naming Figure Test. The immediate and delayed verbal memory was assessed through a short story-task with a specific ecological context and the visual memory through animal figures retrieval. No statistical differences were observed between the two groups, but a statistic tendency was observed in the sense of the indigenous group apparently encountering more facility in visual and motors tasks and the "non-indians" in verbal tasks. The results suggest

  12. Jovens de Santo André, SP, Brasil: Um estudo sobre valores em diferentes grupos sociais

    OpenAIRE

    Sheila Aparecida Ferreira Lachtim

    2010-01-01

    Esta dissertação se propõe a: apreender valores sociais contemporâneos, notadamente aqueles referidos ao consumo de drogas, discutir diferenças entre esses valores nos diferentes grupos sociais; e analisar possíveis relações entre esses valores. Trata-se de um estudo qualitativo de caráter exploratório, descritivo e analítico que utilizou um roteiro de entrevista semi-estruturada para apreensão do objeto. Um total de 86 jovens participou, de diferentes regiões do município de Santo André, SP,...

  13. Procedimiento de formación de grupos de trabajo en el proceso software

    OpenAIRE

    Digión, Leda

    2005-01-01

    Para conseguir calidad en el trabajo de un equipo de proyecto informático, no es suficiente con determinar el rol funcional del individuo (analista, programador, etc.) es decir, formar el equipo en función de las tareas a desempeñar. También es necesario identificar el estilo de trabajo de cada integrante, y según este estilo definir grupos de trabajo a cargo de cada subproceso de gestión, dentro del equipo de proyecto informático. A partir de una diferenciación entre los conceptos de grup...

  14. Conocimientos, actitudes y comportamiento sexual en un grupo de adolescentes chilenos

    OpenAIRE

    PÉREZ V, RUTH; CID AR, MARCELA; LEPE O, YAZNA; CARRASCO C, CAROLINA

    2004-01-01

    Introducción: La sexualidad es una de las mayores preocupaciones para el adolescente, su familia y la sociedad. Objetivo: Determinar conocimientos, actitudes y conducta sexuales en un grupo de adolescentes chilenos. Material y métodos: Estudio descriptivo y cuantitativo realizado en la Octava Región de Chile en el año 2003. Se seleccionó una muestra de 398 alumnos de liceos municipales. Se analizaron variables como comportamiento sexual, conocimientos y actitudes sobre sexualidad. Para el aná...

  15. Indicadores de aprendizaje organizacional en grupos de investigación universitaria

    OpenAIRE

    Yenni Angélica Conde C.; Delio Ignacio Castañeda Z.

    2014-01-01

    Una preocupación de las instituciones universitarias que asignan recursos para la investigación es cómo medir su resultado, más allá de los productos académicos. El presente trabajo propone el aprendizaje organizacional como un resultado importante del proceso investigativo. A partir de los resultados de la investigación, se proponen indicadores e índices para medir el proceso de aprendizaje y las condiciones facilitadoras de grupos de investigación. El trabajo fue realizado con investi...

  16. Frecuencia de grupos sanguíneos y factor Rh en donantes de sangre, Colombia ,1996

    OpenAIRE

    Mauricio Beltrán; Maribel Ayala; Jorge Jara

    1999-01-01

    El establecer un patrón nacional de distribución de los grupos sanguíneos por seccionales de salud con base en los datos de donantes de banco de sangre, permite la localización e intercambio de sangre y componentes con fines de transfusión de una manera oportuna, mejora la disponibilidad de sangre y ofrece, además, información útil para áreas como las de genética para identificación personal y pruebas de paternidad, y en el campo antropológico para hallar diferencias raciales según su distrib...

  17. Bloqueo y ensombrecimiento en un grupo de vertebrados filogenéticamente antiguo: los anfibios

    OpenAIRE

    Daneri, M. Florencia; Muzio, Rubén N

    2013-01-01

    En este artículo se describe el estudio de los fenómenos de bloqueo y ensombrecimiento en una tarea de aprendizaje espacial en un anfibio, el sapo terrestre Rhinella arenarum. Ambos fenómenos de aprendizaje, ampliamente observados en otras clases de vertebrados, se describen por primera vez en un grupo con un cerebro flogenéticamente antiguo, como es el caso de los anfibios. Específicamente, se observó durante el aprendizaje espacial: (1) bloqueo entre claves visuales asociadas a una meta, y ...

  18. Bloqueo y ensombrecimiento en un grupo de vertebrados filogenéticamente antiguo: los anfibios

    OpenAIRE

    M. Florencia Daneri; Rubén N. Muzio

    2013-01-01

    En este artículo se describe el estudio de los fenómenos de bloqueo y ensombrecimiento en una tarea de aprendizaje espacial en un anfibio, el sapo terrestre Rhinella arenarum. Ambos fenómenos de aprendizaje, ampliamente observados en otras clases de vertebrados, se describen por primera vez en un grupo con un cerebro filogenéticamente antiguo, como es el caso de los anfibios. Específicamente, se observó durante el aprendizaje espacial: (1) bloqueo entre claves visuales asociadas a una meta,...

  19. Grupos empresariales para fomentar el crecimiento económico de México

    OpenAIRE

    Espinoza Priego, Eva Luz; Ricárdez Jiménez, Jerónimo Domingo

    2016-01-01

    Una de las estrategias que se han empleado en México para fomentar el crecimiento económico ha sido la creación de condiciones favorables para la integración de grupos empresariales como las unidades de fomento y las empresas integradoras. Las primeras están destinadas a impulsar el desarrollo industrial y turístico del país, mientras que las segundas, a elevar la competitividad y mejorar el posicionamiento de las micro, pequeñas y medianas empresas. Por otra parte, como una herramienta de la...

  20. Resultados do Grupo de Trabalho de Tecnologias Avançadas IDE do Projecto OTALEX C

    OpenAIRE

    Vivas, Pedro; Álvarez, Rafael; Mateus, Júlio; Pavo, Marcos; Rubio, J.M.; González, Julián; Soriano, Marcos; Caballero, Carmen; Aparício, Alberto; Batista, T.; Carriço, Cristina; Cabezas, José; Fernández, Luis; Jiménez, Alberto; Gamero, Ulises

    2013-01-01

    Apresentam-se os resultado do Grupo de Trabalho de Tecnologias Avançadas IDE do projeto OTALEX-C, sendo estes: a geração de dados interligados de elementos geográficos do território OTALEX-C para a publicação de uma Web Semântica, e a captura e publicação de dados ambientais através de serviços padronizados de registo de observações com recurso a sensores, aplicando a standard SOS definida pela OGC. POCTEP 2007-2013

  1. Tolerancia al calor y humedad atmosférica de diferentes grupos raciales de ganado bovino

    Directory of Open Access Journals (Sweden)

    Ariel Guillén T

    2011-04-01

    Full Text Available Objetivo. Comparar algunas respuestas fisiológicas al calor y humedad atmosférica entre bovinos Chinampos (Bos taurus; Ch, ½ Charolais ½ Brahman (CB, Holstein (H y Jersey (J. Materiales y métodos. Se realizó un estudio en La Paz, México. Se utilizaron 12 vacas H, 10 J, 15 Ch y 8 CB. Durante el verano se midieron cada semana (a las 0600 y 1600 horas la frecuencia respiratoria (FR y temperatura rectal (TR. Se registraron las variables climáticas para calcular el índice de temperatura-humedad (ITH. Resultados. Durante todo el verano, la FR en los cuatro grupos estuvo por encima de los valores fisiológicos para el ganado bovino, siendo superior en H y J que en Ch y CB (p<0.01. En todos los grupos, la TR estuvo dentro de los límites fisiológicos de la especie estudiada. El grupo racial más afectado fue H (p<0.05. Cuando las constantes fisiológicas fueron analizadas dentro de cada una de tres categorías de ITH (<72, ≥72<78, y ≥78, las vacas H y J mostraron FR superior a las Ch y CB (p<0.01. La TR aumentó conforme se elevó el ITH siendo más marcado en J y H. El incremento de la FR entre la mañana y la tarde de cada día de medición fue mayor en H y J que en Ch y CB (p<0.05. La TR se incrementó más en H que en Ch (p<0.05. Conclusiones. Los grupos raciales más tolerantes al estrés por calor, determinado con base en FR y TR fueron Ch y CB.

  2. Determinación de anticuerpos contra Cryptococcus neoformans en un grupo de colombófilos

    Directory of Open Access Journals (Sweden)

    Carmen Sofía Corrales

    1987-12-01

    Full Text Available Se evaluó la respuesta humoral, medida como anticuerpos específicos anti-Criptococcus neoformans, en 69 sueros de un grupo de colombófilos de Bogotá; grupo considerado como de alto riesgo dado el frecuente contacto con el material contaminado con el microorganismo. Además se estudiaron 65 sueros de un grupo control constituído por personas dedicadas a actividades diferentes. En las pruebas de inmunofluorescencia indirecta y aglutinación en tubo, no se evidenció diferencia entre los niveles de anticuerpos de ambos grupos. Se estudiaron adicionalmente 15 palomares con el objeto de aislar el microorganismo lo que se logró en el 66,7% de ellos. En 8 de los aislamientos se hizo serotipificación del hongo encontrándose que la totalidad correspondía a C. neoformans var. neoformans.

  3. CONDIÇÃO AUDITIVA DE FREQUENTADORES DE GRUPOS DE APOIO A EXUSUÁRIOS DE DROGAS

    OpenAIRE

    Tainara Milbradt Weich

    2012-01-01

    O presente trabalho tem como objetivo verificar a condição auditiva de frequentadores de grupos de apoio a ex-usuários de drogas. Foram avaliados 17 indivíduos ex-usuários de drogas, estando entre as mais usadas a maconha, o crack e a cocaína. Os indivíduos foram divididos em dois grupos, conforme o tipo de droga mais consumida: Grupo 1 (G1) 10 ex-usuários de maconha; Grupo 2 (G2) sete ex-usuários de crack/cocaína. Para a análise dos resultados, houve uma subdivisão confor...

  4. Plan estratégico de comunicación interna para la empresa Cartering Service del grupo Hanaska

    OpenAIRE

    Pinto Ayala, Paula María; Montenegro Galárraga, Pablo Mauricio

    2012-01-01

    The thesis presents an Strategic Internal Communications Plan for Catering Service, a company that belongs to Grupo Hanaska, emerged in 1972 and currently working with six business lines. Catering Service is the largest company of the consortium and, without a doubt, the most important because it represents 80% of the efforts that Grupo Hanaska invests. On the other hand, it employs the largest number of collaborators; over 1.500 employees are part of this company. Even though the administrat...

  5. FUNCIONALIDADE DOS GRUPOS DE PESQUISA DE ADMINISTRAÇÃO/GESTÃO/ GERÊNCIA DE ENFERMAGEM

    Directory of Open Access Journals (Sweden)

    Alacoque Lorenzini Erdmann

    2010-01-01

    Full Text Available El objetivo de ese estudio es entender los modos de organización y funcionamiento de los Grupos de Investigación (GI de Administración/Gestión/Gerencia (AGG de Enfermería, con catastro en el Consejo Nacional de Investigación Científica y Tecnológica – (CNPq. Se utilizó la referencia metodológica de la Teoría Fundamentada en los Datos, realizándose 12 entrevistas con líderes de grupos de investigación, distribuidos en 2 grupos de muestra. El funcionamiento del grupo es visto como el modo estructural de las actividades de los grupos de investigación, las contribuciones teórico-metodológicas más usadas, las vivencias en el ambiente de la investigación, las relaciones intergrupales, las actitudes del líder del G I, las dificultades enfrentadas, así como las estrategias de supervivencia que garantizan la longevidad y productividad del GI. El funcionamiento de los grupos de investigación es el reflejo del calificar, legitimar, aumentar y congregar potencias para la productividad en líneas de investigación y liderazgo de los investigadores en esa área.

  6. Comparative physico-chemical and proximate analysis of oils of ...

    African Journals Online (AJOL)

    shyn

    2015-08-05

    Aug 5, 2015 ... of oils of Shea nut, Sesamum indicum, Cucurbita pepo,. Cucumis melo ..... 1.62 mgKOH/g) which is lower than that of olive oil 17. mgKOH/g (Oyedele ..... Oyedele AO (2002). The Skin Tolerance of Shea Fat Employed as.

  7. African Journal of Biotechnology - Vol 14, No 31 (2015)

    African Journals Online (AJOL)

    Comparative physico-chemical and proximate analysis of oils of Shea nut, Sesamum indicum, Cucurbita pepo, Cucumis melo seeds commonly cultivated in West Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CAT Ouattara, MK Somda, R Moyen, AS Traore ...

  8. Phenotypic and molecular evaluation of genetic diversity of rapeseed

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-05

    Oct 5, 2009 ... seed yield per plant, 1000-seed weight, oil content and protein content) were analyzed in a three-year ... regard to many characters of value for breeding process. (Cowling ..... tances determined by molecular markers and heterosis ..... Comparative analysis of cultivated melon groups (Cucumis melo L.).

  9. Metabolomic and elemental profiling of melon fruit quality as affected by genotype and environment

    DEFF Research Database (Denmark)

    Bernillon, Stéphane; Biais, Benoit; Deborde, Catherine

    2013-01-01

    Melon (Cucumis melo L.) is a global crop in terms of economic importance and nutritional quality. The aim of this study was to explore the variability in metabolite and elemental composition of several commercial varieties of melon in various environmental conditions. Volatile and non...

  10. Postharvest firmness behaviour of near-isogenic lines of melon

    NARCIS (Netherlands)

    Tijskens, L.M.M.; Dos-Santos, N.; Jowkar, M.M.; Obando-Ulloa, J.M.; Moreno, E.; Schouten, R.E.; Monforte, A.J.; Fernández-Trujillo, J.P.

    2009-01-01

    In two consecutive seasons the firmness of 13¿15 near-isogenic lines (NILs) of melons (Cucumis melo L.) was followed during storage at 21 °C. Firmness was measured using non-destructive compression of whole melon fruit to a predefined compression distance of 2 mm. The same individuals (about 6 per

  11. Metabolomic and elemental profiling of melon fruit quality as affected by genotype and environment

    NARCIS (Netherlands)

    Bernillon, S.; Biais, B.; Deborde, C.; Maucort, M.; Cabasson, C.; Gibon, Y.; Hansen, T.; Husted, S.; Vos, de R.C.H.; Mumm, R.; Jonker, H.; Ward, J.L.; Miller, S.J.; Baker, J.M.; Burger, J.; Tadmor, Y.; Beale, M.H.; Schjoerring, J.K.; Schaffer, A.; Rolin, D.; Hall, R.D.; Moing, A.

    2013-01-01

    Melon (Cucumis melo L.) is a global crop in terms of economic importance and nutritional quality. The aim of this study was to explore the variability in metabolite and elemental composition of several commercial varieties of melon in various environmental conditions. Volatile and non-volatile

  12. Metabolomics in melon: A new opportunity for aroma analysis

    NARCIS (Netherlands)

    Allwood, J.W.; Cheung, W.W.L.; Xu, Y.; Mumm, R.; Vos, de C.H.; Deborde, C.; Biais, B.; Maucourt, M.; Berger, Y.; Schaffer, A.; Rolin, D.; Moing, A.; Hall, R.D.; Goodacre, R.

    2014-01-01

    Cucumis melo fruit is highly valued for its sweet and refreshing flesh, however the flavour and value are also highly influenced by aroma as dictated by volatile organic compounds (VOCs). A simple and robust method of sampling VOCs on polydimethylsiloxane (PDMS) has been developed. Contrasting

  13. Comparative physico-chemical and proximate analysis of oils of ...

    African Journals Online (AJOL)

    In rural areas of developing countries like Burkina Faso, nutritive elements are mainly composed of vegetable source. Shea nut, seeds of Sesamum indicum, Cucumis melo and Cucurbita pepo, four species widely consumed were studied. The proximate parameters: moisture, proteins and fat were analysed. Saponification ...

  14. Plectosphaerella species associated with root and collar rots of horticultural crops in southern Italy

    NARCIS (Netherlands)

    Carlucci, A.; Raimondo, M.L.; Santos, J.; Phillips, A.J.L.

    2012-01-01

    Plectosphaerella cucumerina, most frequently encountered in its Plectosporium state, is well known as a pathogen of several plant species causing fruit, root and collar rot, and collapse. It is considered to pose a serious threat to melon (Cucumis melo) production in Italy. In the present study, an

  15. An insight into the sequential, structural and phylogenetic properties ...

    Indian Academy of Sciences (India)

    Prakash

    composition bias between sequences. Plant name. Musa acuminate. Diospyros kaki. 0.463. Malus domestica. 0.333. Momordica charantia. 0.383. Medicago truncatula. 0.263. Glycine max. 0.223. Populas canadensis. 0.450. Pyrus communis. 0.223. Cucumis melo. 0.497. Lycopersicon esculentum. 0.327. Persea americana.

  16. African Journal of Biotechnology - Vol 10, No 34 (2011)

    African Journals Online (AJOL)

    ... microcephaly associated (ASPM) gene mutation is a major cause of primary ... Optimization of somatic embryogenesis induction in Iranian melon (Cucumis melo cv. ... related gene expression in response to enhanced UV-B radiation in Arabidopsis ... Exobiopolymer from polyhydroxyalkanoate-producing transgenic yeast ...

  17. Protection of melon plants against Cucumber mosaic virus infection ...

    African Journals Online (AJOL)

    This study was carried out to characterize a virus causing severe mosaic, yellowing, stunting and leaf deformation on melon (Cucumis melo L.), and evaluate the capacity of Pseudomonas fluorescens as biofertilizer to improve plant growth and restrict the accumulation of the virus in the plant. The virus was identified as an ...

  18. 7 CFR 319.56-26 - Melon and watermelon from certain countries in South America.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Melon and watermelon from certain countries in South... and Vegetables § 319.56-26 Melon and watermelon from certain countries in South America. (a) Cantaloupe and watermelon from Ecuador. Cantaloupe (Cucumis melo) and watermelon (fruit) (Citrullus lanatus...

  19. Serological and molecular detection and prevalence of Cucurbit ...

    African Journals Online (AJOL)

    During the 2009 growing seasons, virus-like symptoms were noticed on cucurbit crops (melons (Cucumis melo L.) and watermelons [Citrullus lanatus (Thunb.) Matsum and Nakai)] grown in the Sistan region. The symptoms were widespread and included initial chlorotic lesions followed by yellowing of whole leaves and ...

  20. Effects of foliar potassium fertilization on muskmelon fruit quality and yield

    Science.gov (United States)

    Consumer preference of many fruits and vegetables such as muskmelon [Cucumis melo L. (Reticulatus Group)] is determined by a few key quality traits such as sugar content, aroma and texture. These quality traits are directly related to adequate potassium (K) content in plant tissues. However, soil-...

  1. From Multilatina to Global Latina: Unveiling the corporate-level international strategy choices of Grupo Nutresa

    Directory of Open Access Journals (Sweden)

    MARIA A DE VILLA

    Full Text Available Research on Multilatinas has underexplored multinationals from Colombia and their corporate-level international strategy choices to develop into Global Latinas. Building on interviews, documents, and archival data about Grupo Nutresa -Colombia's most international firm in manufactured goods-, this study unveils and discusses this firm's corporate-level international strategy choices between 1960 and 2014. A prevailing notion is that most multinationals from Latin America continue to target international operations to focus mainly on their home region through an export, multidomestic or transnational corporate-level international strategy. In contrast, data show that Grupo Nutresa chose to evolve through a sequential approach from an export to a transnational corporate-level international strategy while its international operations were able to transcend its home region to reach North America, Asia, Europe, Africa, and Oceania. These results add to international business research on emergent market multinational companies (EMNCs from Latin America by unveiling the corporate-level international strategy choices of a Colombian origin Multilatina that transformed into a Global Latina.

  2. REPRESENTAÇÕES DE UM GRUPO DE DOCENTES SOBRE DROGAS: ALGUNS ASPECTOS

    Directory of Open Access Journals (Sweden)

    Cláudia Virginia Galindo Cavalcante

    Full Text Available O abuso de drogas é atualmente um grave problema de saúde pública e a escola básica deve contribuir com a sua prevenção. O objetivo do trabalho foi identificar as representações sociais dos professores de um grupo de professores de educação básica sobre drogas. Utilizamos como instrumento de coleta de dados um formulário que continha a seguinte sentença: Para você, drogas são... , aplicado a um grupo de 75 docentes. Utilizando procedimentos da análise de conteúdo buscamos identificar alguns aspectos das representações destes profissionais. Verificamos que estes entendem drogas como algo extremamente maléfico, que produz danos muitas vezes irreversíveis. Programas de formação inicial e continuada devem levar em consideração estas representações e colaborar na ampliação destas.

  3. O ensino em grupo do processo de aplicação de insulina

    Directory of Open Access Journals (Sweden)

    Jéssica Magalhães Felipe Batista

    2013-03-01

    Full Text Available O presente estudo teve por objetivo analisar a habilidade da pessoa com diabetes mellitus (DM em realizar o processo de aplicação de insulina antes e após o ensino em grupo desse procedimento. A coleta de dados se deu pela aplicação de um instrumento em forma de check list, que avaliou a habilidade inicial da pessoa com DM em relação ao processo. Posteriormente, foi realizada uma intervenção educativa em grupo, sendo aplicado novamente o mesmo instrumento para avaliação da habilidade final. Os dados obtidos foram armazenados em um banco de dados e submetidos à análise estatística. Os resultados mostraram que a maioria das pessoas apresentou dúvidas em quase todas as etapas do processo de aplicação de insulina, não realizando algumas etapas essenciais ou executando-as de forma errada. Após a intervenção educativa houve aumento dos acertos, evidenciando que a atividade contribui para o autocuidado no tratamento insulinoterápico.

  4. O papel de coordenador de grupos The role of group coordinators

    Directory of Open Access Journals (Sweden)

    Carmen Silvia de Arruda Andaló

    2001-01-01

    Full Text Available Os trabalhos com grupos, instrumental valioso nos espaços institucionais, vêm sofrendo um processo de banalização de cunho tecnicista. Este artigo pretende ser uma contribuição à reflexão sobre a coordenação de grupos. Afasta-se dos estudos sobre a personalidade dos coordenadores, propondo seu entendimento como o de mediadores entre o nível vivencial e a compreensão crítica. Isso aponta seu caráter constitutivo nos processos grupais.The work with groups, a valuable tool in institutional spaces, is becoming more and more vulgarized because of a tendency toward a mere technical approach. This article is intended to be a contribution to group coordination. It keeps away from the study of the coordinators personality, suggesting that they be understood as mediators between experiencing and critical understanding. Thus pointing out their constructive role in group processes.

  5. através de um grupo de convivência

    Directory of Open Access Journals (Sweden)

    Fabiane Ferreira Francioni

    2007-01-01

    Full Text Available El presente estudio trata de una investigación cualitativa, asistencial y convergente, cuyo objetivo es comprender los elementos que afectan el vivir de las personas con Diabetes Mellitus. En este estudio participaron 26 personas de una Unidad Básica de Salud de la ciudad de Florianópolis, Estado de Santa Catarina. Los datos obtenidos provienen de entrevistas parcialmente elaboradas, así como de las voces de las personas del grupo de convivencia. Han sido indicados como elementos que influencian en la vida de personas con Diabetes Mellitus: la aceptación de la enfermedad, el apoyo familiar, la integración de los cuidados en el cotidiano, la disposición en la superación de las dificultades y la manutención de la ocupación y el trabajo. El grupo de convivencia fue considerado como un elemento que colabora para una vida más saludable, a través de la promoción de un intercambio de experiencias y un compartir de saberes. El papel de la enfermera es el de facilitar y ofrecer soporte en la construcción de nuevas posibilidades y la calificación del vivir con una condición crónica de salud.

  6. O imaginário de um grupo de cuidadores de idosos institucionalizados no cotidiano asilar

    Directory of Open Access Journals (Sweden)

    Elman Moreira Coelho Grison

    2015-05-01

    Full Text Available Trata-se de estudo realizado com cuidadores de idosos institucioinalizados. Objetivou-se conhecer o imaginário de um grupo de cuidadores em relação a seu cotidiano. O imaginário é entendido  a partir da antropologia de Gilbert Durand focada nas imagens e nos símbolos culturais. Os dados foram coletados por meio do instrumento denominado Arquétipo Teste de Nove Elementos – o AT-9, de Yves Durand e por meio da “Pedagogia da Escuta”. As teorias gerontológicas do envelhecimento também fundamentaram a análise. Evidenciou-se nesse grupo a predominância de representações mítico-simbólicas com estrutura sintética, ou seja, que pretende harmonizar os contrários, com uma tendência mística que signifca busca de união.  

  7. Hipertensão e obesidade em um grupo populacional no Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    SABRY Maria Olganê Dantas

    2002-01-01

    Full Text Available O objetivo deste estudo foi identificar a prevalência de hipertensão arterial e obesidade, bem como sua inter-relação em funcionários de uma instituição de ensino superior da cidade de Fortaleza, Ceará. Foram entrevistados e avaliados, a partir de dados antropométricos e de pressão arterial, 317 funcionários. Para a aferição e classificação da pressão arterial, foram adotados os critérios do III Consenso Brasileiro de Hipertensão Arterial de 1998 e do Joint National Committee de 1997. Foi utilizado o Índice de Massa Corporal para a classificação nutricional, segundo critérios da Organização Mundial da Saúde de 1995. Encontrou-se uma prevalência de hipertensão arterial de 25,6% e de excesso de peso de 59,9%, ambas significativamente mais prevalentes no sexo masculino (p<0,05. A obesidade foi fator de risco para hipertensão arterial no grupo estudado (OR 7,53; IC95 3,08-18,92; p= 0,00. Os resultados encontrados enquadram a comunidade pesquisada como grupo alvo de ações de saúde destinadas ao controle das doenças crônicas.

  8. Desarrollo de un Taller de risaterapia con un grupo de personas mayores

    Directory of Open Access Journals (Sweden)

    Pablo Santos M.

    2018-01-01

    Full Text Available Introducción: Las personas mayores constituyen un grupo de edad que requiere especial atención. En este contexto, se hace necesario implementar actividades que fomenten el envejecimiento activo y su bienestar psicosocial. Objetivo: se investigan los beneficios de la participación en un taller de risaterapia sobre el bienestar subjetivo y psicológico de un grupo de personas mayores a partir de su experiencia. Metodología: Estudio con enfoque cualitativo mediante entrevistas semiestructuradas a 57 personas mayores no institucionalizadas, con edades comprendidas entre los 60 y 88 años, socias de tres Centros de Día para personas mayores de la Gerencia Territorial de Servicios Sociales de Salamanca (Junta de Castilla y León. El taller de risaterapia se desarrolló durante cuatro sesiones de tres horas de duración cada una, con una periodicidad semanal. Resultados: El análisis de contenido de los discursos de los participantes develan categorías vinculadas a crecimiento personal, mejora del estado de ánimo, valoración de la risa como actividad física y lúdica, incremento de la motivación y fortalecimiento de las relaciones interpersonales. Conclusiones: Los resultados muestran los efectos positivos de los talleres de risaterapia sobre el bienestar psicológico y subjetivo de las personas mayores.

  9. A TECNOLOGIA DE GRUPO OPERATIVO APLICADA NUM PROGRAMA DE CONTROLE DO TABAGISMO

    Directory of Open Access Journals (Sweden)

    Roselma Lucchese

    2013-01-01

    Full Text Available Estudio la natureza mista, exploratório y descriptivo, discucion el uso del grupo operativo como la tecnología en estrategia de afrontamiento del consumo de tabaco en programa de control del tabaco, en la atención primaria de salud de la ciudad interior de Goias, Brasil. Población de 20 personas que buscar tratamiento la Unidad Básica de Salud y una muestra de nueve personas que completaron el tratamiento. El proceso de análisis de contenido surgió categoría temática: el camino seguido durante el tratamiento: y trayectoria de un deseo de dejar de fumar; sintiendo los efectos de (desuso cigarrillos, los desafíos para el cambio. Por el test de Fagerström, mostró un patrón de dependencia de los tres sujetos para cada nivel. La tasa de abandono del tabaquismo fue de 78%, lo que se recomienda la adopción de tecnologías en la realización de las actividades del grupo operativo en la programa.

  10. Blood group genotyping Genotipagem de grupos sangüíneos

    Directory of Open Access Journals (Sweden)

    Lilian Castilho

    2004-01-01

    Full Text Available Accurate phenotyping of red blood cells (RBCs can be difficult in transfusion-dependent patients such as those with thalassemia and sickle cells anemia because of the presence of previously transfused RBCs in the patient's circulation. Recently, the molecular basis associated with the expression of many blood group antigens was established. This allowed the development of a plethora of polymerase chain reaction-based tests for identification of the blood group antigens by testing DNA. The determination of blood group polymorphism at the genomic level facilitates the resolution of clinical problems that cannot be addressed by hemagglutination. They are useful to (a determine antigen types for which currently available antibodies are weakly reactive; (b type patients who have been recently transfused; (c identify fetuses at risk for hemolytic disease of the newborn; and (d to increase the reliability of repositories of antigen negative RBCs for transfusion. It is important to note that PCR based assays are prone to different types of errors that those observed with hemagglutination assays. For instance, contamination with amplified products may lead to false positive test results. In addition, the identification of a particular genotype does not necessarily mean that the antigen will be expressed on the RBC membrane.Os antígenos eritrocitários são herdados geneticamente e definidos por seqüências de aminoácidos específicos constituindo uma proteína ou por carboidratos ligados a estas proteínas ou à lipídios. A diversidade dos antígenos de grupos sangüíneos, como para qualquer outro traço biológico, encontra-se ao nível do gene. Existem atualmente mais de 250 antígenos eritrocitários que se encontram distribuídos em 29 sistemas de grupos sangüíneos, de acordo com a Nomenclatura da Sociedade Internacional de Transfusão Sangüínea (ISBT. Os genes que codificam 28 dos 29 sistemas de grupos sangüíneos já foram clonados e seq

  11. Morfología de las especies de Hyphessobrycon (Characiformes: Characidae, grupo heterorhabdus, en Colombia

    Directory of Open Access Journals (Sweden)

    Carlos A. García-Alzate

    2011-06-01

    Full Text Available El género Hyphessobrycon incluye dieciocho especies reportadas para Colombia de las cuales 13 son miembros del grupo heterorhabdus; con las mismas, se realizó un análisis morfogeométrico por medio del Método de Cerchas (Box Truss y Láminas Delgadas (TPS. Se usaron 13 hitos homólogos tipo I y tres tipo II. El resultado del análisis cluster, llevado a cabo con cada una de las metodologías indicó que estas especies están representadas en dos grandes grupos: robustas y delgadas. Las deformaciones parciales, los componentes uniformes, no uniformes, Warps principales y Warps parciales describieron cambios de la forma relacionados con la profundidad del cuerpo e involucraron desplazamientos relativos del esqueleto apendicular y de la región cefálica. Todas las especies se caracterizan por presentar crecimiento alométrico excepto Hyphessobrycon mavro con isometría entre los hitos 6-7. Se plantean dos nuevas medidas discriminantes (hocico-supraoccipital y supraoccipital-aleta pélvica para las especies del grupo.Morphology of the species Hyphessobrycon, heterorhabdus group (Characiformes: Characidae in Colombia. Hyphessobrycon is the most numerous and morphologically complex genus of Characidae, and includes 18 species reported for Colombia, from which thirteen belong to the heterorhabdus-group different methods have been proposed for species identification within this genus. This study used these species to undertake a morphogeometric analysis by the Box Truss and Thin Plate Splin (TPS methods; 13 homologous landmarks type I and three type II were used. The result of cluster analysis indicated that these species are represented by two big groups: robust and thin. The uniform and non uniform components, and the principal warps (WP and partial warps (Wparc, described the shape changes related to body depth, involving relative displacements of the appendicular skeleton and the cephalic region. All species were characterized by allometric

  12. Derivados del Nylon 3 con grupos laterales alcoxicarbonilos ramificados y cíclicos

    OpenAIRE

    García Álvarez, Montserrat

    1997-01-01

    El presente trabajo se ha centrado en la síntesis, caracterización y estudio estructural de poli(alfa-alquil-beta-L-aspartato)s con grupos laterales ramificados y cíclicos. Se han sintetizado los monómero: (S)-4-alcoxicarbonil-2-azetidinonas cuya síntesis se basa en la transesterificación de la beta-lactama del éster bencílico del ácido L-aspártico con el correspondiente alcohol. Se han establecido las condiciones óptimas de la polimerización aniónica por apertura del anillo de lactama, hacie...

  13. Representaciones sociales hacia la cultura del metal de un grupo de "metaleros" de Bogotá

    Directory of Open Access Journals (Sweden)

    Lady Vanessa Maldonado

    2009-01-01

    Full Text Available Esta es una investigación empírico-analítica de tipo descriptivo, con un diseño transversal, cuyo propósito es determinar las representaciones sociales hacia la cultura del metal de un grupo de metaleros de Bogotá. Para ello se trabajó con una muestra de 111 metaleros con edades comprendidas entre los 18 y los 30 años, de Bogotá, a los cuales se les aplicó una prueba de asociación libre de palabras. Los resultados obtenidos en la investigación mostraron que las representaciones sociales que tienen los metaleros con respecto a su propia cultura se relacionan con una posición de inconformidad ante las normas de la sociedad, así como con la energía y poder, generado por la música metal.

  14. El concepto “política” en un grupo de jóvenes universitarios

    Directory of Open Access Journals (Sweden)

    ANDREA SOTELO CARREÑO

    2009-01-01

    Full Text Available Este artículo es una parte de la investigación que se desarrollo dentro de la Maestría en Lingüística. Se ocupa, fundamentalmente, del estudio de la variación sociosemántica del término "política" en un grupo de estudiantes de la Universidad Santo Tomás, Seccional Tunja, específicamente, de las facultades de derecho, arquitectura, ingeniería electrónica, ingeniería civil, ingeniería mecánica, ingeniería informática, administración de empresas y contaduría pública.

  15. LOS GRUPOS DE SOCIALIZACION COMO FACTOR PROTECTOR CONTRA LA DEPRESION EN PERSONAS ANCIANAS. BARANQUILLA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Rafael Tuesca-Molina

    2003-01-01

    Full Text Available Fundamento: La depresión en personas ancianas es un problema de salud pública dada su prevalencia y comorbilidad. Los objetivos de este trabajo son determinar el papel de los grupos de socialización como factor protector para depresión; determinar otros factores socioculturales asociados; estimar la prevalencia y determinar la concordancia de las pruebas de cribado para depresión - criterios de la Asociación Americana de Psiquiatría y el test de Hamilton. Método: Estudio descriptivo transversal. Participaron 602 personas ancianas de entre 60 y 94 años (223 varones y 379 mujeres, muestra representativa para la población residente del sur-occidente de Barranquilla, Colombia. Previo consentimiento, se aplicó una encuesta de administración directa. Se estudiaron las variables demográficas, socioeconómicas, limitación física, enfermedades degenerativas, disfunción familiar y dos tests de depresión para determinar la concordancia. Se realizó análisis bivariado entre la depresión y la pertinencia a grupos de socialización al igual que la depresión y otras variables. Se determinó análisis de cribado e índice de Kappa para la concordancia de pruebas. Resultados: La participación en grupos de socialización fue un factor protector de presentar depresión. (OR: 0,5, IC 95%: 0,34- 0,73. La prevalencia de depresión fue de 29,9% (IC95%: 21,4%- 39,4%, siendo en los varones 32,7%. La concordancia con el test de Kappa fue 0,63. (moderada a buena La sensibilidad fue del 56,1%, (48,5% a 63,4%; la especificidad de 99,3%, (IC95%: 97,8%-99,8% y el valor predictivo positivo del 97,1% ( IC95%: 97,2%-99,3%. Conclusiones: Esta investigación determina factores de riesgo para padecer depresión en ancianos potencialmente modificables. La participación en grupos de socialización es un factor protector. La disfunción familiar de tipo moderado y severo, las limitaciones sensoriales como ceguera y sordera, la soledad, ausencia de vivienda y

  16. Modo de Vida de un grupo de trabajadores informales, Bogotá D.C., 2014

    Directory of Open Access Journals (Sweden)

    Ana H. Puerto G

    2016-02-01

    Full Text Available Resumen Objetivo: Comprender el modo de vida de un grupo de trabajadores informales vendedores de productos agrícolas en carreta, en el territorio de Corabastos, Bogotá D.C., como aproximación al perfil epidemiológico del grupo. Metodología: Estudio cualitativo con participación de 29 trabajadores informales. La recolección de la información se realizó por medio de cuatro técnicas cualitativas y fue analizada por medio del método de análisis de contenido temático. Resultados: El MV se describió a partir del reconocimiento del territorio, las condiciones grupales de trabajo, la calidad y disfrute de bienes de consumo del grupo, capacidad para crear y reproducir valores culturales e identidad, capacidad para empoderamiento, organización y soporte en beneficios del grupo y calidad de las relaciones ecológicas de estos trabajadores informales Discusión y conclusiones: El concepto de MV que se describió es amplio y recoge categorías que no han sido evaluadas en otras investigaciones, específicamente en relación a los trabajadores informales y la inserción en un espacio social, un espacio ambiental, en la relación con instituciones estatales, valores culturales y su capacidad organizativa. Abstract Objective: To understand the mode of life of a group of informal work sellers of agricultural products, who use, as a working tool, a wooden cart. The place for this economical activity is a place named Corabastos, a gathering place of agricultural products. It is located in Bogotá D.C. This is an approximation to the epidemiological profile of the group. Methodology: Qualitative, 29 informal workers participated, Data collection was conducted through four qualitative techniques and it was analyzed using the method of analysis of thematic content. Results: The mode of life of this group, was described taking a as a starting point some specific aspects: The recognition of the territory (Corabastos, the group working conditions, the

  17. Estudios de la identidad femenina en Cuba: resultados del trabajo con grupos de mujeres

    Directory of Open Access Journals (Sweden)

    Dra. C. Rosa María Reyes Bravo

    2015-10-01

    Full Text Available Se reflexiona sobre las identidades femeninas en el contextocubano, particularmente en la región oriental, a partir de lasexperiencias obtenidas en la realización de grupos de mujerescomo propuesta metodológica para el estudio de sus identidades, tomando como ejes las contradicciones y desarrollos de la autonomía, la corporalidad y el climaterio en profesionales y sobre las vivencias, malestares y emergentes de cambio en la condición de género en campesinas; emergiendo en todos los casos el carácter transicional y contradictorio de sus identidades y las significaciones imaginarias sociales en que ellas se soportan, lo que se explica por las posibilidades del Proyecto Social Cubano, y la supervivencia de mitos, creencias, costumbres y prácticas arcaicas, instituidas como códigos implícitos que regulan el deber ser y circulan casi de modo inconsciente en las sociedades.

  18. LEI, MORAL E OPRESSÃO DOS GRUPOS CIGANOS NOS OITOCENTOS

    Directory of Open Access Journals (Sweden)

    Camila Similhana Oliveira Sousa

    2013-10-01

    Full Text Available RESUMO:Estudo dos relatórios da Chefia de Polícia disponíveis no Arquivo Público Mineiro no que se refere à repressão dos grupos ciganos entre 1890 e 1908, nos primeiros anos da república brasileira, contexto esse em que as elites republicanas buscavam a modernização econômica e urbana, sem dedicar-se à inserção das camadas menos favorecidas. PALAVRAS-CHAVE: Ciganos – Lei – Repressão ABSTRACT: Study reports of the Chief of Police on the Public Archives Miner regarding the repression of Roma groups between 1890 and 1908, in this context that the republican elites sought economic modernization and urban, without devoting themselves to the insertion of the less affluent. KEYWORDS: Gypsies. Law Repression.Recebido: 14/08/2013    Aceito: 20/08/2013

  19. Polimorfismos de grupos sanguíneos en Cachi, Valle Calchaqui, Salta

    OpenAIRE

    Acreche, Noemí; Albeza, María V.; Caruso, Graciela; Acosta, Rebeca; Felix, Sebastián

    2001-01-01

    El Departamento de Cachi, en la Provincia de Salta pertenece a los Valles Calchaquíes, los que se extienden además por Catamarca y Tucumán, constituyéndose en una región importante en la comunicación entre el Valle de Lerma y la Puna. Hasta el momento no se conocen datos de la genética de estas poblaciones, salvo los publicados por Matson en 1968 registrados en otra región de la provincia. A partir de la determinación de los grupos: ABO, MN, Ss, Cc, Dd, Ee, P, Diego y Kell-Cellano, Duffy y...

  20. Complexo agroindustrial, grupos de interesses e politicas publicas : o caso do trigo no Brasil

    OpenAIRE

    Alvaro Ramalho Junior

    1994-01-01

    Resumo:Esta tese procura demonstrar que apesar de ter sido definida por um instrumento de força, em plena vigência de um regime autoritário, a política tritícola desencadeada pela promulgação do Decreto-Lei 210, de 1967, não pode ser caracterizada como uma imposição unilateral do Estado, mas, sim, como resultado de um intercâmbio que pretendeu conciliar interesses públicos e de grupos privados. Evidenciou-se ainda que a política tritícola definida por aquele decreto-lei resultou de um process...

  1. Indias urbanas en el Buenos Aires tardocolonial. Familia y grupos domésticos

    Directory of Open Access Journals (Sweden)

    Jacqueline Sarmiento

    2011-11-01

    Full Text Available Nos proponemos analizar la integración de las indias a la vida urbana de Buenos Aires en el período colonial tardío. Este estudio se circunscribe al análisis de la conformación de los grupos domésticos. Consideramos que ellos son de una importancia fundamental ya que constituyeron los ámbitos en los cuales se transmitió y transformó el orden social. Para introducirnos a esta cuestión tomaremos en primera instancia los empadronamientos de la ciudad de Buenos Aires de los años 1744 y 1778. Dejamos para más adelante el abordaje de esta cuestión a partir de otras fuentes y con una escala de análisis reducida

  2. MOTIVACIóN, GRUPO DE DEPORTE, NIVEL COMPETITIVO y EDAD DEPORTIVA EN DEPORTISTAS CALDENSES

    Directory of Open Access Journals (Sweden)

    Héctor Haney Aguirre–Loaiza

    2015-11-01

    Full Text Available Se estudian las diferencias entre los factores de motivación en relación con el género, grupos de deportes, edad deportiva y nivel competitivo en 205 deportistas caldenses (M= 18,9, DE= 5,2, que diligenciaron la Escala de Motivación Deportiva. Los 139 hombres y 66 mujeres, practicantes de 20 modalidades deportivas, fueron seleccionados a través de una muestra no probabilística en un diseño no experimental. Los datos demuestran que los deportistas puntuaron valores superior medio en motivación extrínseca, motivación intrínseca por el conocimiento y la autosuperación, mientras en la amotivación y motivación integral del deportista la valoración es inferior. Las hipótesis de diferencias en el comportamiento de la motivación fueron rechazadas  en variables de género, nivel competitivo y edad deportiva, sin que se encontraran promedios significativos. La variable grupo de deportes discriminó diferencias en motivación intrínseca por la autosuperación y motivación integral del deportista, favorable para los deportes de resistencia. Se concluye que los presentes datos apoyan la multidimensionalidad de la teoría de autodeterminación y el modelo jerárquico de la motivación. Se discute y se alienta nuevos resultados.

  3. Estratégia Educacional Baseada em Problemas para Grandes Grupos: Relato de Experiência

    Directory of Open Access Journals (Sweden)

    Sonia Leite da Silva

    Full Text Available RESUMO Nos últimos anos, o olhar sobre a formação dos profissionais de saúde tem se intensificado, particularmente sobre aquela que possa impactar a resolução dos problemas de saúde da população. Um dos aspectos para o alcance desta demanda refere-se a uma formação que incorpore metodologias ativas no processo ensino-aprendizagem de estudantes da saúde. Neste entendimento, tomando como referência metodologias de aprendizagem baseada em problemas, as quais utilizam certos passos para a resolução de problemas, e diante dos desafios de trabalhar com grandes grupos, desenvolveu-se a estratégia educacional denominada Ciclo de Discussão de Problemas (CDP. Este artigo tem por objetivo descrever o CDP como uma estratégia educacional utilizada em grandes grupos no ensino da graduação em saúde. Esta estratégia ancora-se nos princípios de metodologia ativa, pois utiliza problemas com temáticas comuns aos cursos da área da saúde, para desenvolver nos alunos o aprendizado autodirigido, a habilidade de solucionar problemas, o pensamento crítico e o estudo colaborativo, além da visão integrada das ciências básicas. Esta estratégia envolve dois momentos em sala de aula para cada problema: análise e resolução, englobando 12 passos.

  4. Prevalência de anticorpos para chlamydia trachomatis em grupos populacionais do Brasil, Inglaterra e Portugal

    Directory of Open Access Journals (Sweden)

    Marluísa de Oliveira Guimarães Ishak

    1988-02-01

    Full Text Available A prevalência de anticorpos IgG, grupo-específico para Chlamydia, em populações do Brasil, Inglaterra e Portugal foi determinada através do teste de imunofluorescência indireta, tendo-se como antígeno a cepa SA2 (f. Foram considerados positivos os soros com títulos de IgG >1:32. Dentre as populações brasileiras, a prevalência de anticorpos para Chlamydia foi maior em Serra Norte (76,2%, p < 0,01 do que nas das populações de Belém (53,6% e dos Índios Xicrins (51,3%. Entre os pacientes do Departamento de Medicina Genito-Urinária do University College Hospital (UCH e do quadro do mesmo Hospital, a prevalência de anticorpos anti-Chlamydia foi de 62% e 53,1%, respectivamente. Anticorpos anti-Chlamydia foram detectados em 54% e 66% na Inglaterra e em 56% e 68% em Portugal, nas pacientes do sexo feminino que freqüentavam Clínicas de Pré-Natal e de Infertilidade, respectivamente, Os resultados encontrados mostram uma alta exposição das populações testadas, à Chlamydia, principalmente do grupo de baixo nível sócio-econômico de Serra Norte, Brasil. A evidência de infecção por Chlamydia é da mesma ordem, tanto no Brasil, quanto na Inglaterra e Portugal.

  5. Las huellas de tortuga del Grupo Oncala (Berriasiense, Cuenca de Cameros, España

    Directory of Open Access Journals (Sweden)

    Pascual-Arribas, C.

    2015-06-01

    Full Text Available Although the dinosaur footprints are very frequent in the Oncala Group (Cameros Basin, it does not happen with the tracks of other reptiles, especially in the case of crocodiles and turtles. Up to now, only one ichnogenus freshwater turtle track morphotype (Emydhipus is known in this group, and it is possible the existence of other terrestrial tortoises tracks. The finding of new tracks and the general review of the known material, suggest that the turtle tracks are more variable and widespread than we previously thought, which corresponds with the existence of a large representation of a recently recognized turtle genus from the Lower Cretaceous of Cameros Basin and also from the whole the Iberian Peninsula.Aunque las huellas de dinosaurios son muy frecuentes en el Grupo Oncala (Berriasiense, Cuenca de Cameros, España, no sucede lo mismo con las de otros reptiles, sobre todo en el caso de cocodrilos y tortugas. Hasta ahora, en este Grupo, solo se conoce un icnogénero de tortuga de medios dulceacuícolas (Emydhipus y se ha planteado la posibilidad de la existencia de otro ocasionado por tortugas terrestres. El hallazgo de nuevas huellas y la revisión general de las ya conocidas ha permitido saber que la variedad de este tipo de icnitas es mucho más amplia de lo que se creía, lo cual concuerda con la existencia de una extensa representación de géneros de tortugas, reconocidos últimamente en el Cretácico inferior de la Cuenca de Cameros y en el resto de la Península Ibérica.

  6. Actividades prácticas del grupo GEIO automatizadas en la Celda Manufactura Flexible

    Directory of Open Access Journals (Sweden)

    Carlos Mauricio Zuluaga-Ramírez

    2014-01-01

    Full Text Available El artículo expone los resultados de un proyecto que buscó la articulación de las investigaciones realizadas por el Laboratorio de Manufactura Flexible y el Grupo en la Enseñanza de la Investigación de Operaciones GEIO, pertenecientes a la Facultad de Ingeniería Industria de la Universidad Tecnológica de Pereira. Su objetivo principal consistió en permitir a los estudiantes la utilización de espacios de investigación en donde se pudieran generar trabajos para facilitar la interrelación y aplicación de conceptos vistos en diversas materias. Para alcanzar el objetivo, se hizo una adaptación de las lúdicas generadas desde el grupo GEIO, a través de la utilización de los centros automatizados y el software especializado del laboratorio de manufactura flexible, creando así prácticas en donde se unieron de forma sistémica los beneficios brindados desde la lúdica, como son aplicación, contextualización, vivencia de conceptos y los ofrecidos por la celda de manufactura flexible como la automatización de procesos, manejo del lenguaje de programación y uso de tecnologías para mejorar los sistemas productivos. La integración de estos espacios generadores de conocimiento aportó a la formación de competencias técnicas en los estudiantes de Ingeniería Industrial, ya que pudieron tomar un proceso productivo básico poco automatizado, proveniente de un micromundo generado a través de la lúdica y llevarlo a un plano profesional y tecnológico, mecanizándolo con el uso de maquinaria y herramienta especializada empleada en las industrias reales.

  7. Emprendimientos productivos en grupos de mujeres indígenas: el caso de Talamanca

    Directory of Open Access Journals (Sweden)

    Ana Rosa Ruiz Fernández

    2009-01-01

    Full Text Available La pobreza es una condición que debe ser tratada desde la generación de capacidades y en especial, en lo productivo. El Programa de Equidad de Género del Instituto Tecnológico de Costa Rica, con una alianza estratégica con el Centro de Información Tecnológica, el Instituto de Estudios de la Mujer de la Universidad Nacional y Fundecooperación, está desarrollando una estrategia de generación de capacidades productivas en grupos de mujeres indígenas en Talamanca. Esta región y en general, los ocho pueblos indígenas que allí viven se han considerado de extrema pobreza y las mujeres tienen las más bajas posibilidades de educación por sus fuertes roles de reproducción y cuido. El proyecto inicia con tres grupos organizados de mujeres indígenas que están gestando proyectos productivos de turismo sostenible, una finca orgánica y reciclaje de desechos sólidos. Estos temas responden a una realidad de la zona: el desempleo y subempleo principalmente de las mujeres, deforestación, contaminación, problemas de salud y falta de oportunidades educativas. El objetivo final es crear una capacidad instalada y organizativa que promueva emprendimientos sostenibles y exitosos, especialmente entre las mujeres y su integración a redes nacionales de micro y pequeña empresas.

  8. Fatores terapêuticos identificados em um grupo de Promoção da Saúde de Idosos

    Directory of Open Access Journals (Sweden)

    Alyne Leite Gomes Nogueira

    2013-12-01

    Full Text Available O objetivo do estudo foi identificar fatores terapêuticos presentes em grupo de promoção da saúde de idosos. Estudo descritivo exploratório com abordagem qualitativa, cujos dados foram coletados por meio de grupos focais realizados com participantes do grupo e suas coordenadoras, entre dezembro de 2010 e abril de 2011. Os dados foram submetidos a análise de conteúdo, modalidade temática. Os achados mostraram convergência de respostas entre os participantes da pesquisa, indicando ressonância e complementaridade na identificação dos fatores terapêuticos coesão, instilação de esperança, socialização, compartilhamento de informações, fatores existenciais, altruísmo, aprendizagem interpessoal e universalidade. A identificação desses vários fatores no grupo estudado comprova seu potencial terapêutico, especialmente por atender as necessidades dos idosos, mantê-los saudáveis, fortalecer o sentimento de amor pela vida e pertença a um grupo social.

  9. Psicodinâmica da violência de grandes grupos e da violência de massas

    Directory of Open Access Journals (Sweden)

    Vamik D. Volkan

    Full Text Available A partir de Freud, as teorias psicanalistas sobre grandes grupos focalizam, principalmente, as percepções e os significados que, psicologicamente, os indivíduos atribuem a eles. Este texto analisa alguns aspectos sobre a psicologia dos grandes grupos e sua psicodinâmica interna e específica. Toma como referência grupos étnicos, nacionais, religiosos e ideológicos cujo pertencimento dos sujeitos iniciou-se na infância. O autor faz uma comparação entre o processo de luto em indivíduos e o processo de luto em grandes grupos para ilustrar por que é necessário investir no conhecimento da psicologia destes últimos como um objeto específico. O autor descreve, ainda, sinais e sintomas de regressão em grandes grupos. Quando há ameaça à identidade coletiva, pode ocorrer um processo de violência de massas que obviamente influencia a saúde pública.

  10. Grupo de autoajuda como modalidade de tratamento para pessoas com dependência de álcool

    Directory of Open Access Journals (Sweden)

    Helder de Pádua Lima

    2012-01-01

    Full Text Available Grupos de autoayuda se están convirtiendo cada vez más comunes, a medida que sus miembros se organizan con el fin de vivir y resolver sus propios problemas relacionados con el alcohol. Este estudio tuvo como objetivo aprender de la experiencia de manejo con los alcohólicos como un grupo de autoayuda se desarrolla como tratamiento para las personas con dependencia del alcohol. Estudio descriptivo, cualitativo con 20 miembros de un grupo de autoayuda. Los datos fueron recolectados a través de una entrevista semi-estructurada y analizados según el método de análisis de contenido. Los resultados muestran que la acogida del intercambio de experiencias y la reintegración social, promueven la participación en el grupo y contribuyen al bienestar físico, mental y social. Se hace hincapié en la necesidad de crear alianzas con grupos de auto-ayuda, en vista de la dependencia de los conocimientos producidos en estas organizaciones, que se puede colocar en la necesidad daquelesque a favor de la diligencia debida.

  11. UM ESTUDO SOBRE A OBRA “FUNDAMENTOS DA POLÍTICA JURÍDICA” DE OSVALDO FERREIRA DE MELO, ATRAVÉS DOS ELEMENTOS DE PERCEPÇÃO JURÍDICA DA “TEORIA TRIDIMENSIONAL DO DIREITO” DE MIGUEL REALE

    OpenAIRE

    Lehmkuhl, Mílard Zhaf Alves

    2012-01-01

    O presente trabalho apresenta uma visão da obra “Fundamentos da Política Jurídica” de Osvaldo Ferreira de Melo a partir dos elementos de Percepção Jurídica, fato – valor – norma, colhidos da obra “Teoria Tridimensional do Direito” de Miguel Reale. O artigo se inicia com uma breve apresentação da obra “Fundamentos da Política Jurídica” e sobre os elementos de percepção jurídica da “Teoria Tridimensional do Direito”. Partindo dessa contextualização e dessa tridimensionalidade como ferramenta de...

  12. O manejo da identificação imaginária em grupos de psicóticos

    Directory of Open Access Journals (Sweden)

    Adriana Renna de Vitta

    2007-12-01

    Full Text Available Este artigo tem como cerne a identificação imaginária na abordagem psicanalítica de psicóticos reunidos em dispositivo de pequeno grupo. O estudo das teorias psicanalíticas no funcionamento e no manejo terapêutico dos grupos monossintomáticos forneceu o ponto de partida de nossa investigação. A especificidade da identificação na psicose e a possibilidade de estimular a criação de laços sociais entre psicóticos em pequenos grupos através do processo identificatório foi o tema principal deste trabalho.

  13. Parámetros a seguir de los grupos empresariales. Sistemas anglosajón y continental.

    Directory of Open Access Journals (Sweden)

    Línea de investigación De La Crisis

    2007-01-01

    Full Text Available En los últimos años se ha venido presentando un fenómeno acelerado de agrupamiento, el cual se ha traducido en la existencia de grandes grupos empresariales con trascendencia internacional. La mayoría de ellos con su sede principal en Estados Unidos, razón por la cual se hace imprescindible y útil el estudio del régimen de los grupos empresariales en Norteamérica, mas aún ahora que estamos ad portas de un TLC con Estados Unidos. El presente articulo pretende analizar los presupuestos de la existencia del grupo empresarial y las diferentes dificultades que pueden presentarse en torno al mismo haciendo una análisis comparativo con la regulación al respecto en los Estados Unidos.

  14. Análisis de grupo de las empresas productoras de frutales caducifolios del departamento de Boyacá

    Directory of Open Access Journals (Sweden)

    Puentes Gloria Acened

    2008-04-01

    Full Text Available

    El estudio se hizo en las provincias de Centro, Márquez, Sugamuxi, y Tundama, del departamento de Boyacá, con el objeto de realizar un Análisis de Grupo de las agroempresas productoras de frutales caducifolios de la región. El levantamiento de la información se hizo con base en el diseño de una ficha técnica, la cual se aplicó a las 28 unidades productivas de estas especies en los municipios más representativos de tales provincias. El trabajo de campo se desarrolló con visitas a las agroempresas del estudio y entrevistas directas a los productores, operarios y expertos, quienes suministraron la información requerida y actualizada sobre los aspectos técnicos, económicos, administrativos y financieros de dichas unidades productivas. Posteriormente se organizó, tabuló y analizó la información, con el fin de establecer la rentabilidad de cada una de las 28 agroempresas estudiadas durante el período 2003–2004. Con el uso del paquete estadístico, se agruparon las explotaciones objeto de estudio en los grupos de cabeza, media y cola, de acuerdo con la metodología propuesta por Chombart de Lawe. A partir de este agrupamiento se identificaron las características de cada uno de los grupos de empresas productoras, destacándose sus principales variables empresariales y los indicadores financieros. Igualmente, se hicieron las comparaciones de los indicadores obtenidos en cada grupo de explotaciones y se propusieron alternativas para que las unidades con menor rentabilidad, o del grupo de cola, adopten las tecnologías y el sistema de producción de las agroempresas más rentables de la región, o del grupo de Cabeza.

  15. CARACTERIZACIÓN DE LAS ENDOMICORRIZAS Y SIETE GRUPOS DE MICROORGANISMOS EN AGROSISTEMAS DEL PIEDEMONTE AMAZÓNICO

    OpenAIRE

    Franco Castro Luis Antonio; Garcia Conde Mary Ruth

    2012-01-01

    Este trabajo caracterizó la estructura funcional, la diversidad de la comunidad de endomicorrizas y el tamaño poblacional de siete grupos funcionales de microorganismos bajo cuatro diferentes coberturas vegetales o usos del suelo; bosque, cultivo de caña, pastura, y cultivo de café en la zona rural de Florencia-Caquetá. En los agrosistemas se determinó las características fisicoquímicas del suelo, el tamaño de las poblaciones de siete grupos funcionales de microorganismos, la estructura funci...

  16. SOBRE FISIOTERAPIA E SEUS RECURSOS TERAPÊUTICOS: O GRUPO COMO ESTRATÉGIA COMPLEMENTAR À REABILITAÇÃO

    OpenAIRE

    Recco, Rosani Aparecida Chaves; Lopes, Stella Maris Brum

    2016-01-01

    Resumo O trabalho com grupos constitui uma estratégia privilegiada pelos profissionais de saúde que envolve um processo de subjetivação e estabelecimento de vínculos comunitários. Desenvolveu-se um grupo de mulheres em tratamento pós-operatório de ombro no ambulatório de fisioterapia de um hospital instalado na cidade de Curitiba, com o objetivo de potencializar os efeitos da fisioterapia convencional, oferecendo a essas mulheres condições para melhor lidar com suas dores e limitações funcion...

  17. Manual para la gestión del relacionamiento con los grupos de interés

    OpenAIRE

    Castaño Quintero, Carlos Andrés; Díaz Cáceres, Nelson; Lozano Correa, Janeth

    2013-01-01

    Actualmente se entiende que los cinco grandes grupos de interés son: los clientes, empleados, proveedores, propietarios o accionistas y la sociedad. Con este manual se pretende asesorar a las empresas en el conocimiento de escenarios y acciones con los grupos de interés, planteadas en el desarrollo organizacional, con el propósito de mejorar su rendimiento y alcance de objetivos, contribuyendo así, a la construcción de una sociedad más sostenible.

  18. III. Grandes proyectos de inversión y grupos indígenas. Algunas experiencias en México

    OpenAIRE

    Hiernaux-Nicolas, Daniel

    2014-01-01

    Si bien el tema de los derechos indígenas se ha puesto nuevamente de moda por las reivindicaciones de grupos étnicos en México, particularmente en el contexto de los recientes eventos de Chiapas, numerosas cuentas faltan por saldar. Una de éstas, y no de las menores, es la relación entre los grupos indígenas en particular y campesinos en forma más general, y los llamados “grandes proyectos de desarrollo” cuyo mayor auge se dio entre los años sesenta y ochenta. Desde una perspectiva geográfica...

  19. Grupos geracionais e o comprometimento organizacional : um estudo em uma empresa metalúrgica de Caxias do Sul

    OpenAIRE

    Batista, Francisco Honório Araújo

    2011-01-01

    A proposta deste trabalho é de analisar o comprometimento organizacional dos funcionários de uma empresa metalúrgica de Caxias do sul. Esta empresa em análise é a Cemar Legrand empresa pertencente ao Grupo Legrand (Grupo Multinacional Francês). Foi utilizado para a análise um instrumento de pesquisa com reconhecimento pela comunidade científica chamado de modelo dos três componentes de Allen e Meyer (1997) , modelo que caracteriza o comprometimento organizacional em suas dimensões afetivo, i...

  20. Streptococo del grupo B en mujeres embarazadas atendidas en el Centro de Salud Primero de Mayo. Abril-Agosto 2007

    OpenAIRE

    Dubón Méndez, Nancy; Altamirano González, Marjorie del Socorro; Alemán Rivera, Teresa de Jesús

    2008-01-01

    Streptococos del grupo B (SGB) es una de las principales causas de muertes neonatales en todo el mundo y esta directamente relacionada con la colonización materna al momento del parto. Se realizó un estudio descriptivo de corte transversal que incluyó un total de 120 mujeres embarazadas atendidas en el Centro de Salud 1ro. de mayo-León, con el objetivo de identificar la frecuencia de streptococo del grupo B, debido a que la identificación de esta bacteria influye positivamente en la prevenció...

  1. Acumulación de Grados-Día en un Cultivo de Pepino (Cucumis sativus L. en un Modelo de Producción Aeropónico Growing Degree Days Accumulation in a Cucumber (Cucumis sativus L. Crop Grown in an Aeroponic Production Model

    Directory of Open Access Journals (Sweden)

    Dubián Hoyos García

    2012-06-01

    Full Text Available Resumen. La temperatura tiene gran influencia sobre los cultivos y es clave en la determinación de la fecha de siembra, cosecha y las variables de producción. Los grados-día (GDD o unidades térmicas (HU son uno de los índices más comúnmente utilizados para estimar el desarrollo de las plantas y para predecir la fecha de cosecha. En el cultivo de pepino (Cucumis sativus L., el número de días desde la siembra hasta la cosecha depende del genotipo y su interacción con la temperatura ambiental. En este trabajo se estudiaron variables fenométricas que inciden sobre la eficiencia y producción de cultivos bajo un sistema aeropónico. Se determinó que se requirieron 726 y 660 grados-día, correspondientes a 73 y 64 días para los materiales comerciales Dasher II y Poinsset 76, respectivamente. Se analizó el efecto de dos periodos de riego 30 y 60 s, con un intervalo de aplicación de cuatro min durante el día, sobre las variables área foliar y peso seco de tallos y hojas en el híbrido Dasher II. No se encontraron diferencias significativas para los parámetros evaluados lo que indicó que el tiempo de 30 s representó una ventaja económica por el ahorro de energía. Se usaron tres soluciones nutritivas: Hoagland y Arnon, Aeropónicos 100% y Aeropónicos 50%, para determinar el efecto sobre el peso seco y el área foliar. Se encontró una reducción de las variables área foliar, materia seca acumulada en el tallo y las hojas, peso promedio de frutos (hasta 44,3% y número promedio de frutos, con la solución Aeropónicos al 50% de la concentración comercial. Los resultados permiten implementar variables de eficiencia en el cultivo aeropónico de pepino, las cuales inciden en el rendimiento, viabilidad económica y ambiental de la tecnología.Abstract. Plant growth and development is determined largely by weather which is composed by several factors. Temperature is one of such key factors which is very important for deciding sowing and

  2. Criminalidad, grupos armados y reinserción: perfiles y motivaciones

    Directory of Open Access Journals (Sweden)

    Melina Ocampo

    2014-06-01

    Full Text Available Con el fin de determinar las causas por las cuales una persona ingresa a un grupo armado ilegal en Antioquia, se revisó la literatura existente tanto en el ámbito internacional como en el nacional. La misma se contrastó con la información cuantitativa existente de los victimarios y exvictimarios en los órdenes nacional y departamental, y la información cualitativa encontrada en entrevistas a miembros de bandas criminales y en grupos focales con expertos. Un sujeto puede tener motivaciones para delinquir basadas en la coerción, los deseos individuales, los incentivos selectivos, los entornos sociales y familiares, los agravios, la falta de control social, y en unas características o rasgos personales que lo pueden hacer más propenso a realizar actividades delictivas. Su continuidad en un grupo armado dependerá de las estrategias de enganche que pueden consistir en la incriminación, las prebendas económicas, el discurso ideoló- gico, o en amenazas. Luego de un proceso de desmovilización, otros factores como la inseguridad personal, la falta de influencia política, la ausencia de prestigio social, la inseguridad económica y otras fallas específicas del proceso de reintegración a la sociedad pueden influir en la reincidencia en actividades criminales. En Antioquia, la coerción como estrategia de reclutamiento continúa siendo utilizada; las motivaciones fundamentadas en los entornos sociales se observaron cómo esenciales y comunes para bandas criminales y guerrilla; los deseos individuales enfocados en el interés por una vida militar estuvieron más relacionados con la guerrilla, y los sentimientos codiciosos se asociaron más con las bandas criminales; los incentivos selectivos a través de las promesas de salario fueron propios de las bandas criminales; y por último, los agravios, que son soporte ideológico propio de la guerrilla, son también usados por las bandas criminales como estrategia de reclutamiento y de b

  3. COMPARACIÓN DE LA ACTIVIDAD ELÉCTRICA CEREBRAL ENTRE PACIENTES BRUXÓMANOS Y GRUPO CONTROL

    Directory of Open Access Journals (Sweden)

    Beatriz Cepeda de Romero

    2012-09-01

    Full Text Available Introducción: La etiología del bruxismo es controvertida, aunque se asocia con un origen central debido al incremento de la excitabilidad nerviosa. Objetivo: Comparar la frecuencia de los ritmos alfa, beta y la descarga de ondas lentas entre un grupo de bruxómanos y un grupo control mediante el electroencefalograma. Método: Estudio clínico, analítico, controlado. La evaluación odontológica (2007-2009 permitió seleccionar veinte pacientes con bruxismo y veinte sanos (o no bruxómanos. A todos los individuos de la muestra se les hizo evaluación médica y electroencefalográfica para medición de frecuencia y amplitud de los ritmos alfa y beta, en reposo mental y físico y durante la fotoestimulación e hiperventilación por tres minutos. Las pruebas estadísticas utilizadas fueron pruebas F, T de Student homocedástica o heterocedástica y X2 de Pearsons, con determinación de riesgo relativo indirecto y estimación de intervalo de confianza de 95%. Resultados. La frecuencia basal del ritmo alfa fue significativamente mayor en el grupo de bruxómanos que en el grupo control (p=8.6×10-6. Igual efecto se vio en el ritmo beta (p=2.7×10-12. La hiperventilación desencadenó en dieciocho pacientes bruxómanos (90% descargas de ondas lentas comparado con sólo cinco individuos del grupo control (25% con una diferencia altamente significativa según la prueba estadística de Pearsons (p=3.21×10-5. En este caso, el riesgo relativo indirecto según la prueba X2 fue de 27.00 (IC 95%: 4.57-159.66. Discusión: La actividad cerebral es significativamente mayor en el grupo de pacientes con bruxismo que en el grupo control. Las descargas anormales de ondas lentas se presentan con frecuencia significativamente mayor en el grupo caso que en el grupo control. Los informes de estrés, insomnio de permanencia y dificultad para concentrarse son significativamente mayores en el grupo caso que en el grupo control. Las alteraciones en la excitabilidad de los

  4. El plan de cuatro grupos de Solomon : evaluación educativa transhispanoamericana

    Directory of Open Access Journals (Sweden)

    Klaus-Dieter Gorenc

    2013-09-01

    Full Text Available Se aplicaron dos modalidades de talleres de investigación -corta y larga- para habilitar por espacio de diez años a 658 investigadores hispanoamericanos, divididos en 30 grupos. La eficiencia terminal de los talleres fue medida con un diseño de pre y post-test y las diferencias con una prueba t-Student -para muestras dependientes-. Los resultados mostraron que los valores del post-test eran más elevados -p ≤ 0.001- que los del pretest. Contrastando las dos versiones del taller, el promedio del largo fue significantemente mayor -p ≤ 0.001- que el del corto; esto, bajo la tutela de un diseño múltiple de pre y post-test y la prueba t-Student, pero para muestras independientes. Con el diseño de cuatro grupos de Solomon se estableció que el incremento significativo en el conocimiento sobre diseños de investigación no fue intervenido por los factores tratamiento y pretest -interacción- y no se observaron diferencias significativas entre ambas versiones. Two modalities of research design's workshops -long and short- were developed to qualify 658 Hispanamerican research workers, whom were divided into 30 groups, and were applyied along ten years. The terminal efficiency of the workshops was measured with a pre-post-test design and the differences were assessed with a t-test -for dependent samples-. The results showed that the values of the post-test were higher -p ≤ 0.001- than the pretest averages. Contrasting the two workshop versions, the average of the long workshop was significantly higher -p ≤ 0.001- than the short one, by means of a multiple pre-post-test design and the t-test for independent samples. Using Solomon four-group design it was feasible to establish that the significant increase of knowledge about research designs was not influenced by the interaction of the pretest and treatment factors and there was not observed any significant difference between both versions.

  5. Grupos interactivos en educación infantil: Primer paso para el éxito educativo

    Directory of Open Access Journals (Sweden)

    Patricia Melgar Alcantud

    2015-09-01

    Full Text Available Objeto: La fractura educativa entre los que tienen éxito en el sistema educativo y los que fracasan puede empezar en los años previos a la escolarización obligatoria, por ello la reducción de los altos índices de fracaso escolar requiere de la intervención en las edades más tempranas. El presente artículo, siguiendo las recomendaciones de Comisión Europea así como de los resultados de diferentes investigaciones, analiza algunas de las características que debe tener esta educación infantil para contribuir a la mejora del éxito educativo. Metodología: Los resultados que aquí se presentan son fruto de la revisión de la literatura científica previa y los resultados obtenidos en la investigación europea Includ-ed (2006-2011, cuya metodología fue de orientación comunicativa. Concretamente, hemos recogido los resultados de uno de los estudios de caso realizados en España durante el período 2007 - 2010. Las técnicas de recogida de información fueron tanto cuantitativas como cualitativas: cuestionarios, relatos comunicativos, entrevistas semiestructuradas, grupos de discusión y observaciones comunicativas. Aportaciones y resultados: El fomento de la interacción y la implicación de la familia, son dos de los componentes identificados que pueden favorecer el desarrollo de una educación infantil de calidad. Una de las formas de organización de aula que contempla ambos elementos es grupos interactivos. Los resultados del estudio de caso muestran que esta actuación ha contribuido a reducir el abandono escolar y aumentar la motivación, aumentar la solidaridad y mejorar los resultados educativos de los niños y niñas. Valor añadido: La escasez de trabajos científicos en Europa que analicen las actuaciones en educación infantil que contribuyen al éxito y, específicamente, aquellos elementos organizativos que inciden, hace de especial interés este artículo para la comunidad científica, así como para el resto de

  6. Modelo de decisão em grupo para gerenciar perdas de água

    Directory of Open Access Journals (Sweden)

    Danielle Costa Morais

    2006-12-01

    Full Text Available O planejamento de ações em sistemas de abastecimento, especialmente quanto à redução de perdas e desperdícios de água, normalmente envolve grupos ou instituições com diferentes objetivos, responsabilidades e interesses. Inclui também uma grande variedade de alternativas para minimização do problema, principalmente em termos de custo e desempenho, fazendo com que a escolha se torne uma tarefa bastante complexa, requerendo uma metodologia específica para tratamento dos conflitos. Com o intuito de contribuir para resolução do problema, este artigo apresenta uma abordagem multicritério fundamentada no emprego do Método PROMÉTHÉE, sendo proposto um modelo para tomada de decisão em grupo. Através de um experimento ilustrativo, busca-se investigar o emprego desta abordagem com quatro decisores, representando aspectos financeiro, técnico, ambiental e social. Assim, os responsáveis por este setor terão uma nova postura frente ao processo decisório, em relação à ação a ser desenvolvida, para uma melhor eficiência operacional e manutenção do sistema, administrando perdas.The planning of actions in supply systems, especially related to loss reduction and water wastage, usually involves groups or institutions with different objectives, responsibilities and interests. It also includes several alternatives to minimize the problem, mainly in terms of cost and performance, making the selection of the alternatives a complex task, requiring a specific methodology for treatment of conflicts. To contribute solve the problem, this study presents a multicriteria approach based on PROMÉTHÉE method, proposing a model for group decision-making. Through an illustrative experiment, the employment of this approach is investigated with four decision-makers, representing financial, technical, environmental and social aspects. Thus, people responsible for sanitation division will have a different slant of the decision process, in relation to

  7. Intervención educativa sobre ETS en un grupo poblacional de riesgo

    Directory of Open Access Journals (Sweden)

    Jorge J Pérez Assef

    2000-06-01

    Full Text Available Se estudia el conocimiento de las enfermedades de transmisión sexual (ETS en 117 sancionados militares de la Disciplinaria Provincial del MININT del municipio Baraguá, provincia de Ciego de Ávila, en el período de febrero a junio de 1998. A través de una encuesta se evidenció falta de información inicial sobre esta temática en casi todos los participantes a pesar de que la tercera parte de ellos padeció alguna de esas enfermedades. Se efectuó un juego de mesa que facilitó e hizo amena la enseñanza, desarrollándose situaciones problémicas y paralelamente charlas y dinámicas de grupos sobre ETS. Luego de varios meses de trabajo educativo se alcanzó una gran mejoría en el nivel cognoscitivo del tema. Demostramos la importancia y la asequibilidad de métodos prácticos, didácticos y participativos para mejorar la comprensión de este fenómeno tan frecuente en grupos de riesgoThe knowledge about sexually transmited diseases (STD was studied among 117 military men confined at the Provincial Disciplinary Center of the MININT (Ministry of the Interior, in the Baraguá municipality, province of Ciego de Ávila, from February to June, 1998. Through a survey it was proved the initial lack of information on this topic of almost all the participants, in spite of the fact that the third part of them had suffered from some of these diseases. A table game was used that allowed learning and made it pleasant. Different situations were developed together with chats and group dynamics on STD. After some months of educative work, a considerable improvement of the knowledge about this topic was attained. We demonstrated the importance and the availability of practical, didactic and participative methods to increase the understanding of this phenomenon so frequent in risk groups

  8. Considerações sobre grupos em ambientes virtuais de aprendizagem como sistemas complexos

    Directory of Open Access Journals (Sweden)

    Rafael Vetromille-Castro

    2008-01-01

    Full Text Available A inserção de tecnologias digitais na Educação - neste texto, em especial no âmbito da formação de professores de línguas - tem gerado reflexão em pesquisadores de Lingüística Aplicada a partir do momento em que as teorias que compõem a "Lingüística Aplicada dominante" (LARSEN-FREEMAN, 2000 se mostram insuficientes para abarcar o fenômeno das relações sociais que fundamentam a aprendizagem. Na busca de uma abordagem teórica que dê conta dos movimentos complexos típicos da experiência pedagógica - na qual incluem-se, indissociavelmente, docentes e discentes - optamos pelo suporte no Pensamento Complexo (MORIN, 1995, na Teoria do Caos (GLEICK, 1989, na Emergência (JOHNSON, 2003 e na Teoria dos Valores Qualitativos (PIAGET, 1973 e relatamos reflexões resultantes de pesquisa sobre grupos de professores (em serviço e pré-serviço em um curso a distância, em ambiente virtual de aprendizagem (AVA. Percebemos que entender os grupos como sistemas complexos nos permite identificar elementos que fomentam sua manutenção e atuam na emergência de comportamentos interativos os quais são essenciais para a aprendizagem sob uma perspectiva sócio-construtivista.The integration of digital technologies in Education - in this paper, especially in the language teachers' training - has aroused discussion among Applied Linguistics researchers, mainly when theories which are part of the "mainstream Applied Linguistics" (LARSEN-FREEMAN, 2000 cannot embrace the phenomenon of social relationships on which learning is based. In search of a theoretical approach that can deal thoroughly with the complex behaviors in the educational experience - in which teachers and students are inseparably included - support has been found on the Complex Thought Theory (MORIN, 1995, Chaos Theory (GLEICK, 1989 , the Emergence (JOHNSON, 2003 and the Qualitative Values Theory (PIAGET, 1973. Also, reflections resulting from research on groups of (in-service and pre

  9. Ecologia e Doenças Infecciosas: Um Perfil Nacional dos Grupos de Pesquisa do CNPQ

    Directory of Open Access Journals (Sweden)

    Rafaela Rodrigues Ramos

    2013-12-01

    Full Text Available Procurando entender se incorporação da abordagem ecológica em pesquisas sobre meio ambiente-animal-doença-saúde vem ocorrendo na construção do conhecimento no campo da saúde ambiental, voltado para a investigação sobre doenças resultantes das relações e inter-relações entre seres humanos, animais, ecossistemas e ações antrópicas, o presente artigo traz uma discussão acerca da ecologia das doenças infecciosas, apresentando, em seguida, um quadro nacional da pesquisa voltada para esta temática, construído a partir de um levantamento realizado no Diretório de Grupos de Pesquisa do CNPQ. Por meio deste procuramos descrever e analisar o perfil  dos grupos de pesquisa que trabalham com doenças resultantes das relações e inter-relações entre seres humanos, animais, ecossistemas e ações antrópicas, de modo a visualizar como tem se dado a participação da ciência ecológica nesta área. Pouco sabemos sobre a cultura epistêmica de construção do conhecimento no campo da saúde ambiental, voltado para a investigação sobre doenças resultantes das relações e inter-relações entre seres humanos, animais, ecossistemas e ações antrópicas. Dado o nível de complexidade desta realidade, entendemos que tal cultura de produção do conhecimento deva ser permeada por uma mentalidade de cooperação acadêmico–científico, tomando a ciência ecológica como parceira categórica. Como podemos observar na analise dos dados, ainda é baixa a participação da ciência ecológica em pesquisas empreendidas no campo da saúde ambiental, voltadas para doenças infecciosas, ao mesmo tempo em que se verifica uma concentração espacial desta produção, não se observando uma relação direta desta e as necessidades socioambientais territorialmente estabelecidas no país.

  10. Los grupos étnicos en la cuenca del Chuquimayo, siglos 15 y 16

    Directory of Open Access Journals (Sweden)

    1973-01-01

    obligatoire dans les laveries d'or, l'imposition du tribut, la rougeole et la variole ont peu a peu décimé ces groupes. Si, en 1549, on comptait 20,000 tributaires, i1 n'y en avait pas plus de 1500 en 1606 au dix-neuvième siècle, ils avaient presque tous disparu. Les deux derniers huambucos sont morts dans le village de Santa Rosa il y a approximativement douze ans. 13. La documentation ethno historique existante ne nous permet pas de nous avancer davantage sur d'autres détails de la culture spirituelle et matérielle des ethnies du bassin du Chuquimayo. En conséquence, nous ne pouvons pas dire plus de la structure familiale, de la vie sociale des individus, de leur organisation politique, de leur économie, de leurs rituels et croyances, de leurs connaissances et traditions. Il n'y a que par analogie avec d'autres groupes de même niveau culturel que l'on pourrait arriver a une meilleure connaissance de ceux-ci. 1. En las actuales provincias peruanas de San Ignacio y Jaén -departamento de Cajamarca- vivieron numerosos grupos étnicos, de los cuales no existe ya ningún representante, motivo que imposibilita estudiarlos etnológicamente. El único medio que nos queda para saber algo de ellos son las fuentes escritas de los siglos XVI y XVII. 2. Erróneamente se ha creído que uno de los grupos étnicos más representativos de la provincia de Jaén, fue el llamado Pacamuros o Bracamoros, al cual se ha pretendido ubicarlo en el ángulo formado entre los ríos Chinchipe y Marañón. La documentación histórica demuestra y aclara que dicho grupo tuvo por hábitat la cuenca del río Zamora, en la parte central de la moderna provincia ecuatoriana de Santiago-Zamora. 3. Los grupos étnicos en las provincias de San Ignacio y Jaén, estuvieron concentrados preferentemente en las cuencas de los ríos Chuquimayo o Chinchipe, Chirinos, Tabaconas y al oeste del Marañón. Comprendieron tierras de cordilleras frígidas, y otras de selva alta y cálida, donde la humedad constante y

  11. Seguimiento a la dinámica competitiva de dos grupos económicos colombianos

    Directory of Open Access Journals (Sweden)

    Carlos Rodríguez Romero

    2007-06-01

    Full Text Available Diferentes tipos de trabajos describen la importancia de la dinámica de multimercados para explicar cómo compiten las empresas que coinciden en diferentes sectores de su actividad. En este artículo se busca presentar inicialmente el cuerpo teórico que soporta la dinámica competitiva, para luego ejemplificar su aplicación en un estudio analítico que identifique las acciones competitivas, no sólo de los dos conglomerados colombianos más importantes, sino también de los individuos que se encuentran al mando de estas organizaciones. La investigación utiliza el análisis estructurado de contenido a través fuentes secundarias para identificar las acciones competitivas de las organizaciones estudiadas en el periodo de 1986-2002. De tal manera, se expondrá la lógica que utilizaron durante los últimos años esos dos grupos económicos en diversos mercados y cómo han aplicado sus estrategias competitivas, para rivalizar en sectores tan heterogéneos como la radio, la televisión, las gaseosas, las cervezas e incluso en el patrocinio de estrellas del deporte y la farándula nacional.

  12. Posibles argumentos para un debate sobre el multiculturalismo y los derechos especiales de grupo

    Directory of Open Access Journals (Sweden)

    José Antonio García Pereáñez

    2010-07-01

    Full Text Available ResumenEs necesario el fortalecimiento de unos derechos especiales de grupo para las culturas minoritarias,argumentando la idea del individuo libre e igual, en una sociedad justa, donde se respeten las libertadespolíticas, la justa igualdad de oportunidades y el principio por la diferencia; con la aceptación de unapluralidad de conceptos de bien, que reconozcan al “otro”, en los valores de tolerancia y de cooperación,ejerciendo la libertad civil desde una concepción pública de justicia y equidad.Abstractt is necessary the invigoration of some special rights of group for the minority cultures, arguing the freeindividual’s idea and equally, in a fair society, where the political freedoms, the fair one are respectedequality of opportunities and the principle for the difference; with the acceptance of a plurality of conceptsof well that recognize to the “other” one, in the values of tolerance and of cooperation, exercising the civilfreedom from a public conception of justice and justness.Palabras ClavesMulticulturalismo, Derechos, Microcultura, Democracia, Equidad, Justicia.

  13. Familias en el trabajo: Estrategias de afrontamiento de grupos microempresarios familiares

    Directory of Open Access Journals (Sweden)

    María Amarís

    2015-01-01

    Full Text Available Las microempresas colombianas ocupan un segmento importante de la economía del país, siendo fundamentalmente de tipo familiar. En estas microempresas se manifiesta una dinámica caracterizada por ser punto de encuentro entre el ámbito laboral y el familiar, lo que permite diferenciarlas de otro tipo de negocios no parentales. Este estudio, de tipo cualitativo, tuvo como propósito comprender cómo se enfrentan las situaciones adversas en el contexto familiar y organizacional de las familias microempresarias. Por esta razón, se analizan las estrategias de afrontamiento de dos grupos microempresarios familiares ubicados en la ciudad de Barranquilla (Caribe colombiano por medio del método de estudio de casos, usando la entrevista abierta y a profundidad como instrumento de recolección de datos. Para analizar la experiencia subjetiva de la persona se empleó el método del análisis de discurso de Giorgi y Giorgi (2003, donde ésta se analiza desde una perspectiva gadameriana (Gadamer, 1960;1989. Como principal resultado se destaca que, ante situaciones adversas en los ámbitos familiar y empresarial, las estrategias de afrontamiento familiares mayormente empleadas por ambas familias microempresarias son el apoyo social y la reestructuración.

  14. Salud bucal de un grupo de cazadores recolectores prehistóricos

    Directory of Open Access Journals (Sweden)

    Solomita Banfi, Fátima

    2001-01-01

    Full Text Available La patología dental es particularmente interesante por su asociación con la ingesta de alimentos, brinda valiosa información para la reconstrucción de dietas, modos de preparación de alimentos y la utilización de la boca como instrumento. Como parte de las investigaciones realizadas sobre la colección esqueletal procedente del sitio Isla Barranquita I (Dpto. Garay, Santa Fe se relevaron macroscópicamente las patologías dentales más frecuentes: perdida de piezas dentales antemortem, absceso dental, caries, periodontitis, hipoplasia y cálculo. La muestra está compuesta por los restos de 17 individuos de entre 0 y 55 años de edad que fueron exhumados de un enterratorio de tipo secundario. Se observó un elevado índice de caries por boca, especialmente entre individuos juveniles, y calculo dental en grado medio a avanzado entre juveniles y adultos. No se detectó la presencia de periodontitis ni abscesos. La presencia de hipoplasia no fue relevante para la muestra analizada. Se puede concluir un estado de salud bucal regular por la presencia de caries, sin embargo no se hallaron enfermedades infecciosas ni nutricionales para el grupo de cazadores recolectores que habitó el sitio hace unos 1200 años.

  15. Diabetes Mellitus: desafios relacionados ao autocuidado abordados em Grupo de Apoio Psicológico

    Directory of Open Access Journals (Sweden)

    Nunila Ferreira de Oliveira

    2011-04-01

    Full Text Available O objetivo foi identificar os sentimentos dos usuários associados ao diagnóstico do Diabetes Mellitus (DM, as dificuldades inerentes ao controle glicêmico e estratégias de enfrentamento adotadas diante das demandas impostas pela doença. Estudo qualitativo realizado com grupo de pessoas acompanhadas por equipe multiprofissional de um centro de pesquisa e extensão universitária de Ribeirão Preto, SP, Brasil. Quatro sessões grupais que constituíram o corpus da pesquisa, foram audiogravadas e transcritas. A análise temática originou as categorias: sentimentos despertados a partir do diagnóstico do DM; dificuldades no controle da doença e estratégias de enfrentamento. Os resultados evidenciaram diferentes modos de lidar com os desafios suscitados pela doença no cotidiano, que influenciam diretamente na adesão ao tratamento e constituem elementos relevantes para o planejamento de intervenções mais efetivas.

  16. Una nueva especie del grupo Hyloscirtus larinopygion (Amphibia: Anura: Hylidae del suroccidente de Colombia

    Directory of Open Access Journals (Sweden)

    Jonh Jairo Mueses-Cisneros

    2008-01-01

    Full Text Available Se describe una nueva especie del grupo Hyloscirtus larinopygion del Nudo de los Pastos en el departamento de Nariño, Colombia. Hyloscirtus tigrinus sp. nov. puede ser distinguida fácilmente de sus especies similares por la presencia de un tubérculo calcar carnoso y prominente, además de su distintivo patrón de coloración. Se realizan algunos comentarios sobre la coloración de la garganta y coloración ventral en Hyloscirtus caucanus, H. larinopygion, H. lindae y H. tigrinus. La coloración de la garganta es altamente variable, por lo tanto no puede ser utilizada para diagnosticar a estas especies.A new species of the Hyloscirtus larinopygion group from Nudo de los Pastos, Nariño department, Colombia is described. Hyloscirtus tigrinus sp. nov. can be distinguished easily from similar species by the presence of a fleshy and prominent calcar tubercle and by its distinctive color pattern. Some remarks on throat and ventral coloration in Hyloscirtus caucanus, H. larinopygion, H. lindae and H. tigrinus are presented. The throat coloration is highly variable and cannot be used to diagnose any of these species.

  17. Grupos de interés y reforma comercial en México

    Directory of Open Access Journals (Sweden)

    Luis Sánchez Mier

    2006-01-01

    Full Text Available En los pasados dos decenios México transitó de una economía proteccionista a otra abierta y orientada a la exportación. ¿Por qué fue el proteccionismo una política estable y cómo fue sustituido por una reforma que actuó contra intereses creados? Para contestar estas preguntas utilizo un modelo de teoría de juegos en que la influencia de los grupos de interés influye en las decisiones de política. Al ajustar los parámetros del modelo a los datos, el juego cooperativo subyacente tiene un núcleo vacío y predice que una coalición de empresas que sustituyen importaciones y el gobierno es “estable” hasta los años ochenta. Para tomar en cuenta los cambios en las opciones de financiación del gobierno a fines de esos años y principios de los noventa, se ajustan los parámetros del modelo. De ahí surge un nuevo equilibrio único que predice la adopción de una política de libre comercio.

  18. Uso de TIC: posibles relaciones con habilidades cognitivas e interpersonales en un grupo de adolescentes

    Directory of Open Access Journals (Sweden)

    Gabriela Raynaudo

    2016-01-01

    Full Text Available Grandes cambios han acontecido en la vida cotidiana por la introducción de las tecnologías de la información y la comunicación (tic, aventurándonos en la Sociedad de la Información. En este artículo se describen hábitos de uso de tecnologías y habilidades cognoscitivas e interpersonales en un grupo de adolescentes con la finalidad de encontrar posibles relaciones entre los temas estudiados. De este estudio exploratorio y transversal, participaron 19 jóvenes entre 15 y 17 años. Se administraron cuestionarios sobre uso de tic y habilidades interpersonales y seis subtests de la batería wisc-iii. A nivel descriptivo, encontramos relaciones entre los puntajes obtenidos en las pruebas y la exposición a pantallas. Si bien estas diferencias no fueron estadísticamente significativas, en general los sujetos más expuestos tuvieron un mejor desempeño en las pruebas cognoscitivas y los menos expuestos en habilidades interpersonales. Se discuten posibles estudios posteriores e implicancias educativas.

  19. IDENTIFICANDO OS MODELOS DIDÁTICOS DE UM GRUPO DE PROFESSORES DE QUÍMICA

    Directory of Open Access Journals (Sweden)

    João Batista Santos Junior

    Full Text Available Esta investigação visa a identificar os modelos didáticos de um grupo de professores de Química de escolas públicas e propõe uma meto dologia para a sua utilização como instrumento de reflexão do docente em relação às suas concepções acerca do processo de ensino e aprendiza gem. Para tal, foi solicitado aos professores que respondessem a um ques tionário baseado nas ideias de Garcia Pérez (2000. Os resultados obtidos apontam que os professores combinam características diferentes dos modelos didáticos para formar um modelo didático eclético (GUIMARÃES, ECHEVERRÍA & MORAES, 2006. Esses modelos ecléticos encerram características antagônicas e podem indicar a necessi dade de aprofundamento da reflexão dos docentes sobre as suas concep ções. É proposta uma metodologia para a utilização do instrumento de investigação do pensamento do professor.

  20. EVALUACIÓN DE LA CALIDAD DE SERVICIO EN UN GRUPO FARMACÉUTICO EN VENEZUELA

    Directory of Open Access Journals (Sweden)

    Agustín Mejías

    2016-12-01

    Full Text Available En este artículo se reportan los resultados de un estudio cuyo objetivo fue evaluar la calidad de servicio prestado por un grupo farmacéutico en Venezuela, para ayudar al diseño de un plan estratégico, a fin de mantener los clientes actuales e incrementar la participación en el mercado del rubro farmacéutico. A partir de una revisión de literatura de tema, se diseñó y aplicó un instrumento basado en los modelos SERVQUAL, SERVPERF, RSQS y de constructos multidimensionales como: valor percibido, satisfacción y lealtad, conteniendo ítems relacionados con la gestión de una farmacia, los cuales, fueron valorados por los clientes mediante una escala tipo Likert. Previa evaluación de la adecuación muestral, se identificaron mediante el Análisis de Factores tres dimensiones, siendo: Empatía, Aspectos Tangibles y Capacidad de respuesta, en las cuales se agruparon dieciséis variables para medir la calidad de servicio. Dicho instrumento presenta evidencia de fiabilidad y validez de contenido, criterio y constructo, ya que, los resultados de las pruebas estadísticas realizadas, fueron significativas al 5%. Los resultados de la evaluación, permiten el diseño de un plan estratégico para aumentar el nivel de servicio actual.

  1. Empatía: diferencias entre abusadores sexuales, delincuentes violentos y un grupo control

    Directory of Open Access Journals (Sweden)

    Zulma Yadira Cepeda Rodríguez

    2015-08-01

    Full Text Available El objetivo fue explorar, describir y comparar la variable empatía en tres grupos: agresores sexuales de menores de edad, delincuentes violentos no sexuales y personas sin historia de reclusión en establecimientos carcelarios, por medio de una investigación transeccional de tipo descriptivo- comparativo. Para evaluar la variable de estudio se tradujo y adaptó al español el instrumento de medición The Child Molester Empathy Measure. Posteriormente esta escala se aplicó a una muestra de conveniencia de 149 hombres, en edades entre los 18 y 57 años. Los principales resultados obtenidos ponen de manifiesto que existen diferencias significativas en el factor afectivo y cognitivo de la empatía entre agresores sexuales y delincuentes violentos, y que los primeros reportan menor empatía cuando la situación evalúa a sus propias víctimas. Finalmente, se resalta la importancia de evaluar en futuros estudios otras variables psicológicas asociadas a la empatía, como las distorsiones cognitivas, la autoestima, entre otras.

  2. Mudança do comportamento de fumar em participantes de grupos de tabagismo

    Directory of Open Access Journals (Sweden)

    Karla Cristina Martins

    Full Text Available Este estudo descritivo-exploratório buscou identificar características do comportamento tabagista e fatores associados à sua mudança. Participaram 63 pessoas, de 30 a 73 anos (M=49,63, egressas de grupos de tabagismo. A coleta de dados incluiu roteiro de entrevista semi-estruturado e escalas validadas para a população brasileira. Procedeu-se às análises estatística e de conteúdo. Trinta e seis pessoas não estavam fumando (57,1%. Fumantes e não fumantes não se diferenciaram quanto às variáveis sociodemográficas; ansiedade, depressão e tempo de uso de tabaco na vida foram as variáveis que mais se aproximaram da significância estatística, atingindo valores limítrofes. O conhecimento de fatores envolvidos no tabagismo e sua cessação podem ser úteis às ações de apoio à mudança comportamental do fumante.

  3. Brote de faringo-amigdalítis por estreptococo ?-hemolítico grupo A

    Directory of Open Access Journals (Sweden)

    Dante R Culqui

    2014-04-01

    Full Text Available El objetivo fue describir un brote de faringo-amigdalitis causado por estreptococos β-hemolíticos del grupo A (EGA en profesionales de la salud. El estudio que se transmite de persona-persona o por vía alimentaria. El estudio transversal descriptivo se realizó en 17 clientes, localizados en la misma mesa, que participaron de una cena en restaurante de Barcelona, España, en julio de 2012. Se analizaron, la frecuencia de síntomas de los afectados, el tiempo y la severidad de los síntomas, variables demográficas y alimentos ingeridos, entre otros factores. La tasa de ataque (TA en los comensales fue del 58,8% (10/17. El 60,0% (6/10 de los comensales fueron positivos para EGA. El 46,2% (6/13 de los manipuladores de alimentos suministrados en la cena presentaron síntomas. No se identificó asociación con los alimentos ingeridos. Existen evidencias epidemiológicas de la transmisión alimentaria del EGA, pero no podría descartarse la transmisión respiratoria.

  4. Complejidad y contradicciones de las relaciones entre los grupos islamistas: el caso de Siria

    Directory of Open Access Journals (Sweden)

    Naomí Ramírez Díaz

    2012-12-01

    Full Text Available Con una realidad cambiante en Oriente Medio, el régimen sirio se encuentra en una difícil coyuntura. De caer el régimen y viendo la tendencia en otros países, el islam político podría jugar un papel clave en la formación del nuevo gobierno, lo que podría reconfigurar las otrora complejas relaciones entre los grupos islamistas de la zona. Este artículo profundiza en las contradicciones de estas relaciones partiendo de las negociaciones entre el régimen sirio y los Hermanos Musulmanes con vistas a garantizar la vuelta de estos a Siria y las mediaciones que han llevado a cabo sus homólogos en otros países. In a changing context in the Middle East, the Syrian regime is in a difficult situation. Should the regime fall, and considering the trend of other Arab countries, political Islam will play a key role in the formation of the new government. This, in turn, could result in a redefinition of the formerly complex relationships between Islamist groups in the area. This article focuses on the contradictions inherent to these relationships through the study of the negotiations between the Syrian regime and the Muslim Brotherhood whose aim was the return of the latter to Syria, and the study of the mediation that their counterparts in other countries have carried out.

  5. La centralidad en las comunicaciones y la influencia percibida en los pequeños grupos

    Directory of Open Access Journals (Sweden)

    Nancy Noemi Terroni

    Full Text Available Este trabajo reporta los resultados de medidas del análisis de redes en la comunicación de pequeños grupos que resuelven una tarea de recuperación de memoria y su asociación con la influencia percibida. El reactivo empleado es una historia y los 65 participantes, alumnos de la Universidad Nacional de Mar del Plata, debieron reconstruir la misma primero en forma individual, luego grupal colaborativa y nuevamente en forma individual. Se registraron las interacciones grupales con comunicación cara a cara y mediada por computadora; se analizaron las medidas de prominencia, la centralidad y el prestigio de la comunicación y el tipo de alocución, orientado a la gestión grupal o hacia la tarea. Se observaron asociaciones significativas entre las medidas reticulares y la influencia percibida para ambos medios de comunicación y se hallaron diferencias en la comunicación de gestión grupal. Se discuten estos resultados con relación a las restricciones que imponen los canales de comunicación mediados.

  6. Terapia y modificación de la conducta en el grupo familiar

    Directory of Open Access Journals (Sweden)

    Rafael Navarro Cueva

    1983-12-01

    Full Text Available Se hace una breve reseña de la evolución de la terapia comportamental. Se enfatiza el paso de un interés exclusivo por el organismo individual a grupos de organismos. Se analiza la aplicación de los principios conductuales al tratamiento del niño y cómo lo anterior llevó a utilizar, primero, a los miembros de la familia como agentes de cambio y, luego, a conceptuar la familia como un sistema complejo de contingencias. Se revisa la concepción conductual de la familia y sus aplicaciones terapéuticas.   A brief account of the development of Behavior Therapy is done with special emphasis on the evolution from an interest centered upon one organism to a concern for groups of organisms. An analysis is made about how the application of Behavior Therapy to the treatment of children made possible the utilization of the family as a change agent and a conceptualisation of the family as a complex system of contingencies. A revision is made of this view of the family and its applications.

  7. DESARROLLO DEL PENSAMIENTO CIENTÍFICO POR MEDIO DE LA METODOLOGÍA DE GRUPOS INTERACTIVOS

    Directory of Open Access Journals (Sweden)

    Katherine Lavín Arteaga

    2014-01-01

    Full Text Available Este artículo presenta los principales hallazgos de una investigación que tiene por objeto de estudio el desarrollo de habilidades cognitivas en la asignatura de Ciencias Naturales en estudiantes con alta vulnerabilidad socio - económica, a través del proyecto de transformación social y educativa “Enlazando mundos”. La metodología utilizada fue la comunicativa (Gómez y otros, 2006, con un diseño cualitativo, lo cual permite reconocer que la realidad es una construcción mediada por la intersubjetividad. El estudio contempló la construcción de cuatro estudios de caso y, para la recolección de la información, se utilizaron las técnicas de entrevista comunicativa y el grupo de discusión comunicativo. Luego, el análisis se realizó en base a dos dimensiones, la dimensión transformadora y la exclusora. Entre los principales resultados, se encontró un conjunto de habilidades científicas de Orden superior, asociadas al pensamiento científico, las cuales dan cuenta de la presencia de dimensiones transformadoras en todos los estudiantes.

  8. Psicoterapia em grupo de pacientes com transtorno afetivo bipolar Group psychotherapy for bipolar disorder patients

    Directory of Open Access Journals (Sweden)

    Bernardo Carramão Gomes

    2007-01-01

    Full Text Available CONTEXTO: Vem crescendo nos últimos anos o número de estudos com abordagens psicoterápicas no tratamento de pacientes com transtorno afetivo bipolar. Contudo, pouco ainda se sabe sobre o efeito que tem estas abordagens nestes pacientes. OBJETIVO: Avaliar a efetividade da terapia de grupo no tratamento do transtorno afetivo bipolar. MÉTODO: Levantamento bibliográfico no Medline, Lilacs, PubMed e ISI de artigos publicados em língua inglesa no período de 1975 a 2005 e busca manual com base na bibliografia dos artigos selecionados. Foram incluídos apenas os estudos que utilizaram grupo controle, randomizados, com casuística superior a 20 pacientes. RESULTADOS: Foram encontrados somente cinco trabalhos, três deles publicados nos últimos cinco anos. Três utilizaram modelos de psicoeducação, encontrando aumento na adesão ao tratamento farmacológico. Um destes verificou redução no número de hospitalizações e recaídas. Dois estudos combinaram psicoeducação e abordagens psicoterápicas variadas. Destes, um mostrou aumento no período de remissão e redução de sintomas para episódios maníacos. CONCLUSÕES: O interesse por intervenções psicoterápicas baseadas em evidência, no tratamento do TAB, vem aumentando nos últimos anos. Este fato contrasta com o baixo número de estudos dedicados à modalidade de atendimento em grupo, que poderia ser muito útil em instituições onde grande número de pacientes é atendido. A complexidade clínica dessa doença, a presença de diversas comorbidades e os diferentes graus de adesão à farmacoterapia demandam a criação de opções terapêuticas variadas que atendam às necessidades de cada indivíduo. Os estudos indicam que a terapia de grupo pode ser uma opção eficaz de tratamento que merece ser mais bem investigado para permitir sua aplicação na prática clínica.BACKGROUND: In the last years there has been a growing number of studies using psychotherapy approaches in the

  9. Grupo multifamiliar com adolescentes ofensores sexuais = Multifamiliar group with sexual offender adolescents

    Directory of Open Access Journals (Sweden)

    Costa, Liana Fortunato

    2011-01-01

    Full Text Available O texto apresenta a proposta interventiva do Grupo Multifamiliar com adolescentes ofensores sexuais realizada no Centro de Orientação Médico Psico-pedagógico no DF. O público alvo foram os adolescentes ofensores sexuais, seus familiares bem como seus pares. O GM ocorreu em cinco encontros onde foram desenvolvidos temas específicos comuns a todas as famílias: Proteção; Sexualidade; Violência sexual é um crime; Transgeracionalidade; Projeto de namoro. Os recursos humanos incluíram a equipe do COMPP (2 psicólogos, 1 assistente social, 1 psicopedagoga/psicóloga e a equipe da universidade (1 professor/supervisor/pesquisador, 3 alunos de graduação e 2 alunos de pós-graduação. Estiveram presentes 28 pessoas: 12 adultos, 7 adolescentes e 9 crianças. O GM totaliza 15 horas de intervenção com objetivo e foco definidos. As etapas da proposta são: Articulação com a Rede; Nivelamento de conhecimento teórico e metodológico do GM; Entrevistas familiares com cada família participante; GM com adolescentes ofensores sexuais; Avaliação da efetividade

  10. AVALIAÇÃO DE INDICADORES SOCIO-ECONÔMICOS EM GRUPOS DE MUNICÍPIOS PAULISTAS

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Gouvêa

    2007-08-01

    Full Text Available Este trabalho faz parte de um amplo estudo que combina diversos grupos de municípios paulistas, os quais são analisados mediante técnicas estatísticas multivariadas. Este trabalho objetivou indicar se os municípios paulistas, caracterizados pelo Índice de Responsabilidade Social Paulista (IPRS como municípios com alto índice de riqueza e baixos índices sociais (grupo 2 e municípios desfavorecidos em ambos os índices (grupo 5, são diferenciados pelos valores per capita de transferência do Fundo de Participação dos Municípios (FPM, quota-parte do Imposto sobre Circulação de Mercadorias e Serviços (ICMS e receita tributária arrecadada, com base na regressão logística. A análise sinalizou que a variável Receita Tributária per capita é a que mais discrimina os dois grupos de municípios. É possível dizer que os critérios de distribuição do FPM também são aplicados de forma diferenciada, contribuindo de forma efetiva para a eqüidade das receitas disponíveis, apoiando os governos municipais no desenvolvimento de suas políticas públicas.

  11. Cultura organizacional, satisfação profissional e atmosfera de grupo = Organizational culture, job satisfaction and group atmosphere

    Directory of Open Access Journals (Sweden)

    Santos, Joana Vieira

    2011-01-01

    Full Text Available No presente estudo, transversal, procurou-se destacar a influência da cultura organizacional sobre a satisfação no trabalho dos colaboradores e sobre a atmosfera de grupo. Estas variáveis têm repercussões na realização pessoal dos colaboradores e na produtividade da empresa. Foi nosso objectivo, analisar a influência da percepção da cultura organizacional na satisfação profissional e na atmosfera de grupo numa amostra, de conveniência, de 210 participantes (enfermeiros; professores. Os dados, de natureza quantitativa, foram recolhidos através dum instrumento constituído por três escalas: FOCUS (First Organizational Culture Unified Search (Neves, 2000; Satisfação Profissional (Lima, Vala e Monteiro, 1994 e a Escala de Atmosfera de Grupo (Jesuíno, 1987. Foram também registadas variáveis demográficas dos inquiridos. Os resultados sugerem que a cultura é percepcionada como uma cultura de regras. A cultura organizacional apresenta um elevado valor preditivo da satisfação profissional e da atmosfera de grupo. Estas duas últimas variáveis se correlacionam significativamente

  12. Grupo terapêutico: sistematização da assistência de enfermagem em saúde mental

    Directory of Open Access Journals (Sweden)

    Ângela Maria Souza Alves e

    2004-01-01

    Full Text Available Objetivamos proceder al relato de la sistematización de un grupo terapéutico con recurso en la asistencia de enfermería en la salud mental a las mujeres acompañadas en un Centro de Atención Psicosocial (CAPS con trastornos neuróticos, relacionados al estrés y a la somatización de enfermedades. Coordinamos un grupo de forma sistemática durante cuatro meses con mujeres afectadas por los trastornos ya dichos y que logró a los resultados satisfactorios. Se disponibilizo de enfermeros y demás profesionales de salud que realizan grupos terapéuticos y las estrategias que adoptamos en la investigación para proseguir en la sistematización. Concluimos que la realización de grupos terapéuticos es una iniciativa compleja y importante por los resultados efectivos que trae para la clientela asistida, por la creciente madurez humana y teórica que proporciona a los profesionales, y la oportunidad de ejercer la autocrítica, lo cual debe ser propagada para los que actúan en el área de la salud mental.

  13. Cuando la comunidad entra en la escuela: un estudio de casos sobre los grupos interactivos, valorados por sus protagonistas

    Directory of Open Access Journals (Sweden)

    Carmen Álvarez Álvarez

    2014-01-01

    Full Text Available El artículo analiza el efecto de los grupos interactivos en los procesos de enseñanza y aprendizaje de alumnos y alumnas de educación primaria, analizados a través del grado de satisfacción de las personas implicadas en esta forma de trabajo. Se trata de una de las prácticas de organización del aula más destacadas en los centros educativos que se transforman en Comunidades de Aprendizaje. El artículo sintetiza un estudio de casos llevado a cabo en una escuela española de un entorno urbano, dando voz a los protagonistas de los grupos interactivos: alumnado, profesorado y voluntariado, que incluye las familias que participan en dichos grupos. Se utilizó una encuesta para los estudiantes de tercer ciclo y una entrevista grupal en el caso de los de primer ciclo. Con dichos procedimientos se recogieron las valoraciones realizadas por 148 estudiantes, 24 voluntarios/as y 6 profesores/as. Los resultados permiten constatar que los grupos interactivos constituyen una práctica muy bien acogida por toda la comunidad educativa. Además promueven tanto el éxito escolar como el desarrollo de valores que van más allá de lo instrumental, al implicar directamente a la comunidad en la actividad docente. Todo ello se somete a discusión.

  14. Formación del grupo Gestión de datos e Información (GGDI)

    OpenAIRE

    Cabanillas, Katherine

    2014-01-01

    Es una introducción, para dar a conocer los objetivos que se quiere alcanzar con la formación del grupo del GGDI, el mismo que esta integrado con instituciones dimensionadas a los indicadores nacionales y regionales que se desea tener datos e información, los cuales serán incluidos en la plataforma del proyecto SPINCAM.

  15. Emergencia y desarrollo del trabajo social de grupo: una aproximación histórica

    Directory of Open Access Journals (Sweden)

    Lady Peralta

    2006-01-01

    Full Text Available En el ejercicio profesional del trabajo social se identifican tres métodos de intervención: caso o individuo, grupo y comunidad. El registro de la emergencia y evolución de cada uno de estos métodos constituye parte de la historia del trabajo social como

  16. profesionales que laboran en el Grupo de Acción Unificada por la Libertad Personal, GAULA, Cundinamarca

    Directory of Open Access Journals (Sweden)

    Martha G. Duarte Mendoza

    2006-01-01

    Full Text Available El presente estudio tiene por objetivo conocer las características del sometimiento en el secuestro extorsivo cometido por grupos al margen de la ley, a partir de encuestas aplicadas a los profesionales que laboran en los grupos de acción unificada por la libertad personal, GAULA, militar y de la Policía Nacional. Se utilizó un diseño descriptivo de tipo no experimental, transaccional. La hipótesis del estudio busca comprobar la existencia de diferencias en las estrategias empleadas por los diferentes grupos ilegales para someter a sus víctimas. Los resultados permitieron establecer que la existencia de diferencias en las características del sometimiento presentes en secuestros extorsivos no depende de la organización a la que pertenece el grupo captor, sino del lugar de operaciones de éste, independientemente de su pertenencia a una organización para el caso de la subversión y las autodefensas.

  17. Jornada de presentación del IFCA: Grupo de Astronomía de Rayos X

    OpenAIRE

    Carrera, Francisco J.

    2004-01-01

    Presentación general de la estructura y actividades del Grupo de Astronomía de Rayos X del Instituto de Física de Cantabria (IFCA), como parte de la Jornada de presentación del IFCA celebrada el 27 de febrero de 2004.

  18. Reflexiones sobre un grupo de adolescentes no pacientes. Comparación con pacientes anoréxicas y deprimidas

    Directory of Open Access Journals (Sweden)

    CARMEN GARCÍA ALBA

    2004-01-01

    Full Text Available Este artículo presenta los hallazgos relativos a un grupo de no pacientes que participó como grupo de control en una Tesis Doctoral sobre Anorexia Nerviosa y Depresión. La hipótesis sometida a verificación postulaba que la Depresión es, frecuentemente, una patología comórbida con la Anorexia Nerviosa. A tal fin se diseñó un estudio comparativo con 50 pacientes anoréxicas, tipo restrictivo (PAN, 50 deprimidas (DP y 50 no pacientes (NP, de 13 a 16 años. Se utilizó el Test de Rorschach y el Minnesota Multiphasic Personality Inventory (MMPI, comparándose sus resultados con las observaciones de los padres, recogidas de forma estandarizada a través del Child Behavior Checklist (CBCL. Estos resultados ya han sido publicados (García Alba, 2003 a, b; 2004; en prensa. En el grupo de no pacientes, como era de esperar, se constata la ausencia de psicopatología depresiva. No obstante, los datos obtenidos permiten reflexionar sobre el alto grado de vulnerabilidad psicológica detectado en este grupo y sus posibles repercusiones, aunque para poder generalizar estos resultados sería necesario ampliar la muestra. Se subraya la importancia de lograr diagnósticos diferenciales para evitar intervenciones iatrogénicas. Finalmente se enfatiza la necesidad de utilizar en investigación diversos tests y grupos de control para minimizar sesgos en resultados y conclusiones.

  19. Educación emocional y satisfacción con la vida percibida en un grupo de adultos mayores

    Directory of Open Access Journals (Sweden)

    Adriana del Pilar Perugache Rodríguez

    2016-07-01

    Full Text Available La investigación tuvo como objetivo determinar el efecto de un Programa en Educación Emocional sobre la percepción de la satisfacción con la vida en un grupo de Adultos Mayores. Materiales y método: el trabajo realizado fue de tipo explicativo y empleó un diseño experimental. Se evaluó inicialmente el nivel de la variable dependiente, en los grupos experimental y control a través de la prueba Índice de Satisfacción Vital (ISV –A adaptación de la escala original validada por Zegers, Rojas y Förstein (2009; con una consistencia interna de 0, 80, y una validez de 0.84. Posteriormente se implementó el Programa de Educación Emocional en el grupo experimental y finalmente, se aplicó el pos-test en los dos grupos. El análisis de los datos se realizó con el paquete estadístico SPSS versión 0.20. Debido a que no se cumplió con el supuesto de normalidad se aplicó la prueba de Wilcoxon para muestras relacionadas y la U de Mann Whitney para las muestras independientes. Resultados: el programa mejoró los niveles de satisfacción con la vida percibida en el grupo experimental, obteniendo un p0,05. Conclusiones: El programa incrementa los niveles de satisfacción con la vida percibida en adultos mayores.

  20. Comunicación vocal de dos grupos de Tití gris (Saguinus leucopus en Mariquita, Colombia

    Directory of Open Access Journals (Sweden)

    Luz Elena Rueda-C.

    2004-07-01

    Full Text Available Se presenta un estudio del repertorio vocal y su significado, de dos grupos de tití gris (Saguinus leucopus en San Sebastián de Mariquita, departamento del Tolima. Uno de los grupos habita una zona urbana, la casa de la Fundación Segunda Expedición Botánica (Funbotánica y el otro se encuentra en el Bosque del Municipio (José Celestino Mutis. Se identificaron 27 tipos de sonidos, de los cuales se registraron 21 en el grupo Funbotánica y 13 en el grupo Bosque. Se caracterizaron cada una de las señales y en particular se hizo énfasis en la asociación entre las vocalizaciones y los patrones de comportamiento que exhibe la especie. Los titíes emitieron señales específicas en contextos como alimentación, alarma, amenaza y establecimiento de contacto con individuos que se encuentran fuera de vista (señales de llamada. Igualmente, se encontró relación entre las señales y algunos mensajes no conductuales (sexo, edad y posición jerárquica; esto demuestra que las vocalizaciones brindan gran cantidad de información sobre la identidad del emisor, acontecimientos en el ambiente y conductas específicas de los individuos. No se logró establecer diferencias estadísticas entre las señales emitidas en cada grupo, sin embargo, los titíes produjeron vocalizaciones similares en los dos ambientes, con algunas variaciones en frecuencia y duración; aspectos que podrían estar influenciados por las características propias del hábitat.

  1. Cucumis sativus L-type lectin receptor kinase (CsLecRK) gene family response to Phytophthora melonis, Phytophthora capsici and water immersion in disease resistant and susceptible cucumber cultivars.

    Science.gov (United States)

    Wu, Tingquan; Wang, Rui; Xu, Xiaomei; He, Xiaoming; Sun, Baojuan; Zhong, Yujuan; Liang, Zhaojuan; Luo, Shaobo; Lin, Yu'e

    2014-10-10

    L-type lectin receptor kinase (LecRK) proteins are an important family involved in diverse biological processes such as pollen development, senescence, wounding, salinity and especially in innate immunity in model plants such as Arabidopsis and tobacco. Till date, LecRK proteins or genes of cucumber have not been reported. In this study, a total of 25 LecRK genes were identified in the cucumber genome, unequally distributed across its seven chromosomes. According to similarity comparison of their encoded proteins, the Cucumis sativus LecRK (CsLecRK) genes were classified into six major clades (from Clade I to CladeVI). Expression of CsLecRK genes were tested using QRT-PCR method and the results showed that 25 CsLecRK genes exhibited different responses to abiotic (water immersion) and biotic (Phytophthora melonis and Phytophthora capsici inoculation) stresses, as well as that between disease resistant cultivar (JSH) and disease susceptible cultivar (B80). Among the 25 CsLecRK genes, we found CsLecRK6.1 was especially induced by P. melonis and P. capsici in JSH plants. All these results suggested that CsLecRK genes may play important roles in biotic and abiotic stresses. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. Grupo escolar «Les Eguerets». Ciudad nueva de Cergy Pontoise. Francia

    Directory of Open Access Journals (Sweden)

    Baranger, Alain Philippe

    1984-03-01

    Full Text Available On a terrain of 9,500 m2, situated on the plateau occupied by the district of Versants de l'Hautil, of the new city of Cergy-Pontolse, this scholastic group has been constructed, consisting of ten classes for primaries, five for infants and five dwellings of 4 rooms, apart from the usual annexes of a construction of these characteristics: library multi-purpose hall, restaurant with kitchen, workshops for manual activities, sports zones, courtyards and playgrounds. Its dominant situation has been reinforced with the type of construction employed, on the basis of a modular metal structure which supports a series of roofs at two water of distinct rythms.En un terreno de 9,500 m2, situado en la meseta ocupada por el barrio de los Versants de l'Hautil de la nueva ciudad de Cergy Pontoise, se ha levantado este grupo escolar constituido por diez clases destinadas a primaria, cinco a párvulos y cinco a viviendas de 4 habitaciones, amén de los anexos propios de una construcción de estas características: biblioteca, sala polivalente, restaurante con cocina, talleres de actividades manuales, zonas deportivas, patios y jardines de recreo. Su situación dominante se ha reforzado con el tipo de construcción empleado, a base de una estructura modular metálica que soporta una serie de tejados a dos aguas de distintos ritmos. Se pretendía que las actividades de la escuela participaran en la animación de la calle peatonal de acceso, lo que se ha conseguido mediante fachadas fuertemente acristaladas que dejan ver gran parte del interior. En esta escuela se ha querido salir al paso de las sucesivas alternativas pedagógicas, procurando espacios de muy variada índole, acordes con las distintas tendencias.

  3. Lomo de macho: Cuerpo, masculinidad y violencia de un grupo de simpatizantes del fútbol

    Directory of Open Access Journals (Sweden)

    José Antonio Garriga Zucal

    2005-12-01

    Full Text Available En este trabajo analizaremos usos y representaciones corporales de los integrantes de una "hinchada" de fútbol, buscando reconstruir el modelo corporal de estos actores. Pelearse en un estadio contra parcialidades rivales, beber o consumir drogas prohibidas y concebir de forma positiva la gordura son prácticas y representaciones que constituyen a los hinchas y que conforman una particular idea de cuerpo. Estos parámetros forman y delinean una corporalidad que tiene vínculos directos con la masculinidad. Ésta se sustenta en usos y representaciones corporales; la prueba final de ser comprendido como un "verdadero hombre", un "macho", según los estándares del grupo, se concreta por intermedio del rol testimonial del cuerpo. Corporalidad y hombría son vehículos que posibilitan identificar a estos actores con determinados espacios sociales, distinguiéndose de aquellos cuyos usos y prácticas los ubican en las antípodas del mapa socialIn this work we will analyze the uses and corporal representations of a gang hooligans, seeking to reconstruct the corporal pattern of these actors. To fight in a stadium against rival gangs, to drink or to consume forbidden drugs and to conceive the obesity in a positive way are practices and representations that configure the hooligans and that form a particular idea of the body. These parameters outline a corporality that has direct links with the masculine identity. This is based on uses and corporal representations; the final test for being identified as a "true man", as a "male", according to the group standards, is by means of the body's testimonial role. Corporality and manliness are means that facilitate the identification of these actors with certain social spaces, being distinguished of those whose uses and practices locate them in the antipodes of the social map.

  4. Indicadores de malestar psicológico en un grupo de adolescentes mexicanos

    Directory of Open Access Journals (Sweden)

    Blanca Barcelata

    2004-01-01

    Full Text Available El índice de población adolescente en México es elevado. De acuerdo al Conteo de Población y Vivienda de 2000, en nuestro país existen 10,122,774 adolescentes de entre 15 y 19 años de edad, representando el 10.4% de la población total (INEGI, 2000; sólo en el Distrito Federal se concentra un 9.4%. Se ha observado que las características personales del adolescente, la dinámica familiar, las relaciones extrafamiliares en general, en particular con amigos y compañeros, y el ambiente escolar, pueden ser identificadas como posibles factores de riesgo o bien de protección en el desarrollo de problemas de conducta. El objetivo de este estudio fue explorar áreas como la familiar, personal, escolar, salud, social, y sexual desde la perspectiva del propio adolescente. Con tal fin se utilizó el Inventario Autodescriptivo del Adolescente (Lucio, Barcelata & Durán 2002, el cual se aplicó a un grupo de 225 adolescentes estudiantes identificados con problemas de conducta que asistían a consulta psicológica privada o en instituciones públicas. Se detectaron algunos indicadores de problemas emocionales en todas las áreas en particular la familiar y la de salud, relacionados específicamente con la interacción con los padres, la autoimagen, y conductas de consumo de cigarro y alcohol; algunos de estos indicadores se presentaron con mayor frecuencia en hombres que en mujeres y viceversa.

  5. Grupos Políticos Romanos (150-133 a.C.

    Directory of Open Access Journals (Sweden)

    Enrique GARCÍA RIAZA

    2009-11-01

    Full Text Available RESUMEN: Este trabajo analiza el tejido político de la aristocracia romana en los años centrales del siglo II a.C, momento en el que los condicionantes socio-económicos derivados de la expansión mediterránea generan, a un tiempo, un aumento de las reivindicaciones de la plebe, y una importante acentuación de las rivalidades internas en el seno de la aristocracia. Con estas premisas, abordamos el estudio de los grupos de solidaridad política constituidos en torno a determinados individuos y familias. La significación de la figura de Escipión Emiliano no debe ocultar el papel de Mételo Macedónico, de los Calpurnios Pisones y, especialmente, de los Claudio-Fulvios, quienes ensayarán, de forma paralela a Emiliano, una nueva vía de protagonismo basada en la política social. ABSTRACT: This paper deals with the political organization of the Roman aristocracy during the central years of the Ilnd. Century b.C. The Roman conquest of the Mediterranean World, achieved by means of a considerable military effort, was responsible of the development in Italy of new social and economical factors. The growing popular claims and the acentuation of aristocratical competition are the main features of this trend. A prosopographical research makes it clear that some relevant political groups have been traditionaly hidden because of an excesive focus on Scipio Aemilianus. Thus, Metellus Macedonicus, the Calpurnii Pisones and, above all, the Claudii-Fulvii played a decisive paper in the context of political struggle, and some of their members even shared with Scipio an interest in pro-popular politics.

  6. INDICADORES DE MALESTAR PSICOLÓGICO EN UN GRUPO DE ADOLESCENTES MEXICANOS.

    Directory of Open Access Journals (Sweden)

    Consuelo Durán

    2004-06-01

    Full Text Available El índice de población adolescente en México es elevado. De acuerdo al Conteo de Población y Vivienda de 2000, en nuestro país existen 10,122,774 adolescentes de entre 15 y 19 años de edad, representando el 10.4% de la población total (INEGI, 2000; sólo en el Distrito Federal se concentra un 9.4%. Se ha observado que las características personales del adolescente, la dinámica familiar, las relaciones extrafamiliares en general, en particular con amigos y compañeros, y el ambiente escolar, pueden ser identificadas como posibles factores de riesgo o bien de protección en el desarrollo de problemas de conducta. El objetivo de este estudio fue explorar áreas como la familiar, personal, escolar, salud, social, y sexual desde la perspectiva del propio adolescente. Con tal fin se utilizó el Inventario Autodescriptivo del Adolescente (Lucio, Barcelata & Durán 2002, el cual se aplicó a un grupo de 225 adolescentes estudiantes identificados con problemas de conducta que asistían a consulta psicológica privada o en instituciones públicas. Se detectaron algunos indicadores de problemas emocionales en todas las áreas en particular la familiar y la de salud, relacionados específicamente con la interacción con los padres, la autoimagen, y conductas de consumo de cigarro y alcohol; algunos de estos indicadores se presentaron con mayor frecuencia en hombres que en mujeres y viceversa.

  7. Comparación de la agresión infantil en dos grupos culturales

    Directory of Open Access Journals (Sweden)

    María Luisa Roa

    2013-09-01

    Full Text Available En este trabajo se estudian distintas emociones y comportamientos: Inestabilidad Emocional, Agresividad Física y Verbal, y Conducta Prosocial. En primer lugar, se analizan las correlaciones entre las puntuaciones pertenecientes a las distintas fuentes informantes (jóvenes y profesores. Se comparan también las diferencias entre distintas culturas (española y peruana. La muestra está compuesta por 50 niños y adolescentes; 25 peruanos y 25 españoles. Los datos muestran que, en Agresividad, no hay diferencias significativas entre las puntuaciones de los jóvenes y los maestros. Sin embargo, aparece una mayor correlación entre jóvenes y profesores peruanos que entre jóvenes y profesores españoles. Por otro lado, los adolescentes peruanos tienen niveles más elevados en Inestabilidad Emocional, mientras que los españoles alcanzan puntuaciones medias más altas en Conducta Prosocial y Agresividad. Estas diferencias entre los grupos pueden estar motivadas por factores culturales. Different emotions and behaviors were examined in this study: Emotional Instability. Physical and Verbal Aggression, and Prosocial Behavior. First of all, we analyzed the correlation between ratings from different sources (children or teachers. Cultural differences were also discussed with regards to a sample of 50 children and adolescents, 25 Peruvians and 25 Spanish. Data showed non-significant differences in Aggressiveness between children and teachers' ratings. Nevertheless, the correlation is higher between Peruvian children and teachers than between Spanish ones. On the other hand, Peruvian teenagers showed higher levels of Emotional Instability whereas the Spanish got higher average ratings in Prosocial Behavior and Aggressiveness. These data could be due to cultural differences.

  8. Reprodutibilidade de um teste microbiológico para estreptococos do grupo mutans

    Directory of Open Access Journals (Sweden)

    PINELLI Camila

    2000-01-01

    Full Text Available Com o desenvolvimento de testes microbiológicos salivares simplificados tornou-se mais prático o diagnóstico de pacientes com baixa atividade, porém com alto risco de cárie. O propósito desta pesquisa foi avaliar a reprodutibilidade do CARITEST-SM®, um teste específico para estreptococos do grupo mutans. Catorze voluntários participaram do estudo. A produção de saliva foi estimulada com uma goma de mascar inerte e coletada até a obtenção do volume suficiente para a execução de dois testes - pertencentes a dois conjuntos de lotes diferentes de "kits" CARITEST-SM® (1 e 2 - aplicados para um mesmo indivíduo. Dois examinadores calibrados realizaram a leitura de forma independente e cega, classificando os resultados de duas maneiras: escores de 1 a 6, conforme recomenda o fabricante, e conforme a classificação quanto à contagem microbiológica, baixa e alta. Foi aplicada a estatística Kappa, segundo Light. Os resultados de concordância, conforme 6 escores, mostraram valores distintos para o conjunto dos "kits" 1 e para o conjunto dos "kits" 2, valendo, respectivamente, kapa = 0,57 e kapa = 0,21. Em relação à classificação conforme a contagem microbiológica, alta e baixa, os resultados foram kapa = 1,00, para o conjunto dos "kits" 1, ekapa = 0,55, para o conjunto dos "kits" 2. Assim, estes índices de concordância mostraram que a diferença no lote exerceu uma variabilidade no resultado. Além disso, houve maior concordância interexaminador quando se utilizou a classificação conforme a contagem microbiológica alta e baixa.

  9. Las palmas entre los grupos cazadores-recolectores de la Amazonia Colombiana

    Directory of Open Access Journals (Sweden)

    Morcote Ríos Gaspar

    1998-06-01

    Full Text Available We compare past and present systems of management of palms in the Colombian Amazon, based on archaeological studies of preceramic groups in the middle Caquetá region and ethnographic research on the nomadic Nukak people, who inhabit northeastern Guaviare department. Astrocaryum aculeatum, Attalea maripe, Mauritia flexuosa, Oenocarpus bataua, Oenocarpus bacaba y Oenocarpus mapora, have been used from the early Holocene through the present time. Among these, Oenocarpus bataua has remained the most important food species. We conclude that one of the mananging strategies of the tropical rain forest is the simultaneous improvement of ecological units, especially in the tertiary sedimentary plains, and that such management probably has a long history in the region.Se presenta una comparación sobre el manejo de las palmas en la Amazonia Colombiana, basado en los resultados de un estudio arqueológico de grupos precerámicos en la región del Medio Caquetá y uno etnográfico del pueblo nómada Nukak que habita la zona nororiental del departamento del Guaviare. Se encontró que Astrocaryum aculeatum, A ttalea maripa, Mauritia flexuosa, Oenocarpus bataua, Oenocarpus bacaba y Oenocarpus mapora son algunas de las palmas usadas desde el Holoceno temprano hasta el presente. Entre estas Oenocarpus bataua es la especie más importante como fuente de alimento. Así mismo, se concluye que una de las estrategias de manejo en el bosque húmedo tropical es el aprovechamiento simultáneo de diferentes unidades ecológicas, con predominio del plano sedimentario terciario. Es probable que este tipo de manejo tenga en la región una larga historia.

  10. Grupo de reflexão com profissionais do Programa Saúde da Família Grupo de reflexión con profesionales del Programa Salud de la Familia Reflection group with Family Health Program professionals

    Directory of Open Access Journals (Sweden)

    Karine Cambuy

    2008-09-01

    Full Text Available Este trabalho tem como objetivo descrever uma prática de grupo de reflexão, também denominado grupo de crescimento, dentro de um enfoque da abordagem humanista, e compreender em que sentido esta prática pode ajudar profissionais de saúde a rever suas experiências e se posicionarem de maneira mais atuante em seu contexto de trabalho. Participaram do grupo treze profissionais de uma equipe do Programa Saúde da Família inseridos em uma Unidade Básica de Saúde na região Sul do município de Campinas - SP. A descrição e a compreensão desta experiência partiram de narrativas da coordenadora do grupo sobre as vivências relatadas pelos profissionais e de versões de sentido escritas pelos participantes logo após cada encontro. A reflexão acerca de situações mobilizadoras do exercício profissional contribuiu para repensar aspectos importantes da prática e sugerir soluções criativas para os problemas enfrentados. Os participantes avaliaram ter obtido crescimento pessoal e coletivo, a partir da reflexão de suas experiências.Este trabajo tiene como objetivo describir una práctica de grupo de reflexión, también llamado grupo de crecimiento, dentro de un enfoque del abordaje humanista y comprender en qué sentido esta práctica puede ayudar profesionales de salud a que revean sus experiencias y que se posicionen de forma más actuante en su contexto de trabajo. Han participado del grupo trece profesionales de un equipo del Programa Salud de la Familia inseridos en una Unidad Básica de Salud en la región sur de la ciudad de Campinas-SP. La descripción y la comprensión de esta experiencia han partido de narraciones de la coordinadora del grupo sobre las vivencias referidas por los profesionales y de versiones de sentido escritas por los participantes inmediatamente después de cada encuentro. La reflexión sobre situaciones de movilización del ejercicio profesional ha contribuido para repensar aspectos importantes de la pr

  11. El Psicodiagnóstico de Rorschach como instrumento evaluador de grupos: un estudio de 1,200 casos

    Directory of Open Access Journals (Sweden)

    Matilde Ráez de Ramírez

    1986-06-01

    Full Text Available El presente trabajo intenta demostrar la utilidad del Psicodiagnóstico de Rorschach como instrumento que permite evaluar cuantitativamente y cualitativamente aspectos internos de la personalidad de grupos específicos. Para tal efecto se administró la prueba colectivamente a 1,200 sujetos de ambos sexos entre los 19 y 38 años que se encontraban postulando a un instituto superior o una promoción laboral. El análisis de los contenidos permite ubicar semejanzas y diferencias entre los grupos dentro de la normalidad, de acuerdo al sexo, edad y grado de instrucción, siendo este último el que parece identificar mayores diferencias.

  12. Modelo de gestión del conocimiento para medir la capacidad productiva en grupos de investigación

    Directory of Open Access Journals (Sweden)

    Fredy Eduardo Vásquez Rizo

    2010-01-01

    Full Text Available Las organizaciones actuales manejan y producen numerosos datos e información. Muchos de estos elementos son subutilizados o despreciados al carecer de mecanismos y/o procesos para transformarlos en conocimiento útil. El estudio que se expone se centra en datos e información relacionados con la capacidad productiva de los grupos de investigación de una universidad colombiana (Universidad Autónoma de Occidente- UAO, utilizándolos para la generación de conocimiento valioso, a través de la construcción de un modelo. Este modelo, basado en indicadores, permite medir dicha capacidad productiva y sugerir algunas opciones para potenciar sus posibilidades de éxito en las convocatorias colombianas de reconocimiento y medición de grupos de investigación, establecidas por el Departamento Administrativo de Ciencia, Tecnología e Innovación-Colciencias.

  13. Psicoterapia de grupo para parejas como modelo de intervención en un instituto de tercer nivel

    OpenAIRE

    Sánchez Bravo, Claudia; Carreño Meléndez, Jorge; Watty Martínez, Alejandra; Belmont Sánchez, Alba Ivette

    2013-01-01

    Una línea de investigación clínica de Psicología en el Instituto Nacional de Perinatología, es el estudio y atención a las pacientes con problema de pareja, para generar estrategias de intervención basadas en la investigación clínica. Objetivo Detectar indicadores de riesgo en un proceso de psicoterapia de grupo institucional. Material y método Se utilizó el método cualitativo-interpretativo. Las sesiones se llevan a cabo una vez a la semana, con dos horas de duración, en grupo abierto, con u...

  14. Los grupos de discusión como metodología adecuada para estudiar las cogniciones sociales

    Directory of Open Access Journals (Sweden)

    David Víquez-Calderón

    2009-01-01

    Full Text Available El presente artículo tiene por objetivo ofrecer propuestas metodológicas alternativas para el estudio de las cogniciones sociales, presentando los grupos de discusión como una estrategia válida para su estudio. Para ello se hace una revisión del concepto de cognición social, problematizando los enfoques tradicionales para dirigir la investigación a los enfoques que abogan por el estudio de las cogniciones socialmente distribuidas y situadas. Después se describe la estrategia de grupos de discusión, identificando especificaciones operativas y valorando las estrategias analíticas a emplear.

  15. Processos de aprendizagem, competências aprendidas, funcionamento, compartilhamento e armazenagem de conhecimentos em grupos de pesquisa

    Directory of Open Access Journals (Sweden)

    Catarina Cecília Odelius

    Full Text Available A finalidade deste artigo é descrever o funcionamento, os processos de aprendizagem, armazenagem e compartilhamento de informações em grupos de pesquisa. Para isso, pauta-se por referenciais teóricos oriundos de abordagens cognitivistas e construtivistas. Desenvolvida numa instituição pública de ensino superior, esta pesquisa valeu-se da coleta de dados obtidos por meio de análise documental e de entrevistas semiestruturadas com líderes de 10 grupos. As entrevistas foram registradas em diários de campo e gravadas em áudio. As categorias extraídas dos dados levantados balizaram não apenas as análises de conteúdo, mas também a apresentação de resultados. Foi verificado que os grupos de pesquisa diferem quanto ao objeto e aos métodos de pesquisa, ao tamanho, ao tempo de existência, aos recursos disponíveis, às técnicas e aos equipamentos, o que influencia o desenvolvimento de competências específicas ligadas à realização das pesquisas de cada área. Há semelhanças no que se refere aos processos de aprendizagem, aos conteúdos e às competências genéricas aprendidas por seus integrantes (entre os quais, estudantes de graduação e de pós-graduação. Entre essas competências intelectuais, típicas da produção de conhecimentos, estão: a elaboração de projetos e a coleta, registro e análise de dados. Os resultados indicam também que, quando perguntados sobre o que aprendiam nesses grupos, nove líderes referiram-se especialmente a habilidades relativas à gestão de pessoas, tais como: lidar com diferenças individuais, de ritmo de trabalho, de escolaridade, de experiência profissional, de valores, de crenças e de cultura. A aprendizagem nos grupos ocorre de maneira informal, por meio de conversas entre participantes, e formal, através de leitura dirigida, da participação em eventos científicos e pela realização de pesquisas, sob a supervisão do líder. O compartilhamento de conhecimentos ocorre

  16. Psicoterapia psicodinâmica em grupo para fobia social generalizada Psychodynamic group treatment for generalized social phobia

    Directory of Open Access Journals (Sweden)

    Daniela Zippin Knijnik

    2004-06-01

    Full Text Available OBJETIVOS: O objetivo deste estudo é verificar a efetividade do tratamento psicodinâmico em grupo de pacientes com fobia social generalizada. MÉTODOS: 30 pacientes foram incluídos em um estudo randomizado, simples-cego, comparando Terapia Psicodinâmica de Grupo (TPG com um Grupo de Controle Placebo com Credibilidade (CPC. A TPG foi conduzida em 12 sessões de terapia de orientação psicodinâmica em grupo. Os pacientes do grupo controle receberam um pacote de aulas-discussões e tratamento de apoio por 12 semanas, que foi comparado à TPG. Todos os participantes preencheram a Escala de Liebowitz para Ansiedade Social (LSAS, a Escala Hamilton de Ansiedade (HAM-A e a Escala de Impressão Clínica Global (CGI, na entrevista inicial e na 12ª semana de tratamento. Os dados foram analisados com uma ANOVA de medidas repetidas. Pacientes em vigência de tratamento farmacológico ou psicoterápico foram excluídos. RESULTADOS: Ambos os grupos apresentaram melhora na maioria das medidas. Na LSAS, os pacientes da TPG obtiveram melhora superior aos do grupo controle, ao cabo de 12 semanas (F1,28=4.84, p=0.036. Nas medidas basais dos sujeitos que completaram o estudo, não houve diferença entre os grupos em variáveis demográficas e de desfecho. CONCLUSÃO: Neste estudo, a TPG foi superior ao tratamento placebo com credibilidade no tratamento da fobia social generalizada, em um ensaio clínico randomizado, simples-cego, de 12 semanas.OBJECTIVES: The aim of this study is to assess the effectiveness of psychodynamic group therapy in patients with generalized social phobia. METHODS: Thirty patients were included in a randomized single-blind clinical trial comparing psychodynamic group treatment (PGT with a credible placebo control group (CPC. PGT was carried out within a 12-session psychodynamically-oriented group psychotherapy. Control patients received a treatment package of lecture-discussion and support group for 12 weeks which was compared to PGT

  17. O surgimento do câncer de mama na visão de um grupo de mulheres mastectomizadas

    Directory of Open Access Journals (Sweden)

    Ana Fátima Fernandes Carvalho

    2004-01-01

    Full Text Available El objetivo de este estudio fue identificar el surgimiento del cáncer de mama según la visión de un grupo de mujeres mastectomizadas. El estudio cualitativo fue desarrollado con 16 mujeres mastectomizadas, integrantes de un grupo de auto-ayuda, a través de observaciones y entrevistas. Las mujeres atribuyeron su cáncer a: sentimientos reprimidos, herencia familiar, estrés, trauma físico, hábitos alimentarios y la falta de cuidado con su propio cuerpo. Concluimos que las mujeres se mostraron más claras sobre la causa del surgimiento de su enfermedad, cuando indican los principales factores determinantes del cáncer de mama

  18. Grupos nos liminares do saber : casos da educação em bioquímica

    OpenAIRE

    Rochele de Quadros Loguercio

    2004-01-01

    Esta pesquisa desenvolve uma análise da formação de grupos educacionais que se estabeleceram fora do espaço instituído das faculdades de educação e passaram a ocupar um lugar nos institutos ou departamentos de bioquímica, configurando, desta forma, um novo lugar de saber que passou a ser chamado de Educação em Bioquímica. A proposta de análise é a busca de condições históricas para emergência desses grupos, bem como um entendimento de como essa formação se deu dentro das Sociedades que congre...

  19. Los grupos multimedia en España ante el reto de la convergencia de medios (2012-2013

    Directory of Open Access Journals (Sweden)

    José María Legorburu Hortelano

    2014-11-01

    Full Text Available Este artículo de investigación persigue confirmar si en España confluyen las condiciones necesarias para la convergencia de medios, además de describir y evaluar el grado de desarrollo de las diferentes estrategias que desarrollan los grupos multimedia al respecto. Así, la investigación se fundamentó en una metodología cualitativa basada en la realización de entrevistas en profundidad bajo cuestionario a una muestra de responsables de estos grupos. Los resultados desvelan que, aunque la convergencia es una realidad, su desarrollo es incipiente. Si bien las corporaciones son conscientes de su importancia, no la consideran una herramienta eficaz para renovar y adaptar sus modelos de negocio al nuevo escenario impuesto por la web y las tecnologías emergentes.

  20. Tratamiento Cognitivo-Conductual, Protocolizado y en Grupo, de la Fibromialgia

    Directory of Open Access Journals (Sweden)

    Mª Isabel Comeche Moreno

    2010-01-01

    Full Text Available El objetivo del presente trabajo es comprobar si un programa protocolizado de tratamiento cognitivo conductual, diseñado específicamente para ser aplicado en formato grupal a pacientes de fibromialgia, puede ayudar a mitigar los problemas emocionales y mejorar el afrontamiento de la enfermedad. En el estudio participaron un total de 34 pacientes diagnosticados de fibromialgia, todos ellos pertenecientes a la Asociación de Fibromialgia de la Comunidad de Madrid (AFIBROM. El programa fue estructurado en 10 sesiones de dos horas de duración con una periodicidad semanal. En la evaluación pre y post-tratamiento, así como en el seguimiento realizado a los 3 meses, los participantes cumplimentaron los cuestionarios: Inventario de Depresión de Beck (BDI, Escala de Ansiedad y Depresión en Hospital (HAD, Escala de Autoeficacia (SES, Escala de Catastrofismo (PCS y Auto-registro del Dolor. Los resultados mostraron una mejoría clínica y estadísticamente significativa entre el pre y el post-tratamiento, en la variable depresión medida tanto con el BDI como con el HAD-D, así como en la variable ansiedad según el HAD-A. Esta mejoría se mantiene en el seguimiento realizado a los 3 meses de finalizado el tratamiento. Asimismo, al final de la intervención se observa un incremento estadísticamente significativo en todas las medidas de Autoeficacia y una disminución significativa de los pensamientos de Rumiación y Magnificación, mejoría que no se mantiene uniformemente en el seguimiento. Finalmente señalar que aunque tras la intervención se produce una bajada en el dolor medio informado por los pacientes, esta disminución no resulta estadísticamente significativa. Por todo ello puede concluirse que este programa de tratamiento protocolizado y en grupo ha demostrado ser eficaz para mitigar los problemas emocionales asociados a la fibromialgia, disminuir los pensamientos rumiativos y mejorar su percepción de autoeficacia en el afrontamiento

  1. Grupos Focais de Intervenção no projeto Sexualidade e Reprodução

    Directory of Open Access Journals (Sweden)

    Maria de Nazareth Agra Hassen

    2002-06-01

    Full Text Available O projeto Sexualidade e Reprodução (1998-2001 criou uma sistemática de intervenção junto a grupos populares, abordando temas relativos à sexualidade e saúde reprodutiva. A coleta de dados foi feita por meio da metodologia de Grupos Focais de Intervenção (GFI, nos quais pessoas foram reunidas conforme afinidades e traços culturais e, sob orientação dos antropólogos-pesquisadores do nupacs, Núcleo de Pesquisa em Antropologia do Corpo e da Saúde, discutiram temas de seu interesse e, posteriormente, elaboraram materiais de divulgação de suas idéias. Esses materiais serviram como base para que outros grupos debatessem questões como gravidez na adolescência, primeira relação sexual, contracepção, DSTs e AIDS, violência sexual, e criassem outros materiais que se inserissem nesse continuum.The Sexuality and Reproduction project (1998-2001 created a method of intervention in low income social groups, dealing with themes related to sexuality and reproductive health. The data collection was carried out through the Focal Intervention Groups (Grupos Focais de Intervenção - GFI, where people were gathered into groups according to cultural affinity and traits and, under the guidance of anthropologist researchers from NUPACS/UFRGS (Núcleo de Pesquisa em Antropologia do Corpo e da Saúde/UFRGS, discussed themes that interested them and then elaborated materials to publicize their ideas. These materials were the basis for other groups to debate issues such as teenage pregnancy, the first sexual relation, contraception, STDs and AIDS, sexual violence, and to create other materials that would be part of this continuum.

  2. Percepción de comunicación, conflictos y cultura de paz en grupos de estudiantes universitarios

    OpenAIRE

    Luis Rodolfo Rojas Vera; Bladimir Díaz; Elizabeth Arapé Copello; Annabella Rojas; Rosanna Rojas

    2006-01-01

    El artículo recoge y analiza percepciones sobre comunicación, ciudadanía y cultura de paz de grupos de estudiantes universitarios a quienes se aplicó un programa de talleres de formación. Los estudiantes modificaron sus percepciones iniciales después del taller. La experiencia reveló que cortos adiestramientos pueden contribuir amejorar las actitudes y conductas comunicacionales ante el manejo de conflictos.

  3. A responsabilidade social do Grupo EPM: uma nova postura política no território

    OpenAIRE

    Polanco López de Mesa, Jorge Andrés; Profesor Universidad de Medellín

    2014-01-01

    The Grupo EPM is experiencing a remarkable change in its strategy of social responsibility. The aim of this paper is to analyses the relationship between the strategy change and the political stance of the company in the hydropower Río Grande II area of influence in Colombia. Social responsibility is  assumed theoretically as a corporate sustainability initiative. An exploratory case study is adopted. Results suggest that the corporation seeks a more central position in the relationship with ...

  4. Grupo para sujeitos com queixas de dificuldades de leitura e escrita: aspectos teórico-metodológicos

    Directory of Open Access Journals (Sweden)

    Ana Paula Santana

    2015-12-01

    Full Text Available RESUMO: Objetivo: apresentar, em conformidade à teoria enunciativo-discursiva, os pressupostos teórico-metodológicos que sustentam a terapia fonoaudiológica em grupo voltada ao desenvolvimento de competências em linguagem escrita e analisar sua eficácia. Métodos: apresentam-se neste artigo os critérios teórico-metodológicos relacionados à formação do grupo e à terapia centrada na noção bakhtiniana de gêneros do discurso. A fim de ilustrar os procedimentos, são analisados episódios dialógicos gerados em sessões terapêuticas destinadas a cinco adolescentes com queixas de dificuldades de leitura e de escrita, alunos entre 11 e 13 anos de idade da rede pública de Florianópolis, Santa Catarina, Brasil. Resultados: os resultados levam a entender que a prática embasada na perspectiva enunciativo-discursiva possibilita aos sujeitos se apropriarem da linguagem escrita em seus aspectos discursivos, formais e textuais. Adicionalmente, a constituição do grupo proporciona, além das trocas de conhecimentos, um sentimento de pertença que eleva a autoestima, favorecendo os processos de aprendizagem. Conclusão: este trabalho evidencia os ganhos do atendimento em grupo na perspectiva teórica assumida. Os sujeitos, que no início do atendimento fonoaudiológico rejeitavam as atividades de leitura e escrita, na medida em que participavam de práticas sociais de linguagem, foram ressignificando a queixa da dificuldade, constituindo-se, gradativamente, em autores e leitores proficientes.

  5. Perfeccionismo y nivel de cohesión de grupo de deportistas adultos de fútbol sala

    Directory of Open Access Journals (Sweden)

    Lenamar Fiorese Vieira

    2013-01-01

    Full Text Available El presente trabajo investigó las dimensiones del perfeccionismo y el nivel de cohesión de equipos de fútbol sala. La muestra consta de 58 deportistas adultos de una liga profesional brasileña. Entre los instrumentos utilizados se incluyen el Cuestionario de Entorno de Grupo y la Escala Multidimensional de Perfeccionismo. El análisis de los datos se realizó a partir de los test Kolmogorov-Smirnov, alfa de Cronbach, la correlación de Spearman y Mann-Whitney (p < .05. De los resultados se desprende que los deportistas presentaron un nivel moderado de cohesión y se mostraran altamente perfeccionistas en cuanto a las dimensiones “Estándares personales” y “Organización”, en las que se manifestaron las mayores puntuaciones. Se verificó una diferencia en las dimensiones “Integración del grupo hacia la tarea” (p = .005 y “Atracción individual hacia el grupo en la tarea” (p = .049 con relación a la tendencia al perfeccionismo adaptativo; no se detectó diferencia en la cohesión de grupo vinculada a la tendencia al perfeccionismo desadaptativo. El estudio demuestra que las dimensiones “Organización” (r = .41 y “Perfeccionismo adaptativo” (r = .39 pueden ser elementos que influyen en el desarrollo de la cohesión de los equipos hacia la tarea. Por lo tanto, las dimensiones del perfeccionismo demostraron ser factores determinantes de la cohesión de los equipos deportivos que formaron parte de la muestra.

  6. Subjetividade e segurança do trabalho: a experiência de um grupo de mútua ajuda

    Directory of Open Access Journals (Sweden)

    Gilbert Cardoso Bouyer

    2010-01-01

    Full Text Available Este trabalho investigou a relação entre subjetividade e segurança do trabalho no setor de manutenção de uma empresa demineração de grande porte. Verificou que a experiência com um grupo de mútua ajuda pode ser usada como instrumento demelhoria da segurança do trabalho. Foi estudado um grupo de mútua ajuda denominado Programa Hoje Não, composto por35 trabalhadores do setor de manutenção. Os métodos empregados foram entrevistas conforme os modelos da psicodinâmicado trabalho e da psicossociologia, além da clínica do trabalho e da análise ergonômica do trabalho. Com as técnicas do ProgramaHoje Não, aplicadas no grupo, o número de acidentes foi reduzido até atingir valores nunca alcançados em 11 anos.

  7. HORIZONTES DE GESTIÓN, VIDA Y DINÁMICA DE GRUPOS DE INVESTIGACIÓN EN LA USTA

    Directory of Open Access Journals (Sweden)

    Vidal Garzón Vanegas

    2005-01-01

    Full Text Available Desde la Unidad de Investigación y Posgrados (Centro de Investigaciones USTA, se han adoptado las acciones conducentes a desarrollar y fortalecer los procesos de investigación, entre los que se destacan la creación, organización y evaluación de los grupos de investigación. En el presente artículo, se analiza la importancia de la planeación estratégica de tales procesos que correspondan al compromiso como institución de educación superior. Igualmente, se profundiza en los elementos que constituyen la gestión de los grupos de investigación, su diseño, estructura organizativa, desarrollo, consolidación e indicadores que demuestran su capacidad de gestión. La participación en convocatorias, como la de grupos de investigación, debe asumirse a partir de una verificación de sus verdaderas capacidades, de manera que su reconocimiento sea muestra de sus productos, acciones y actividades investigativas que lo vinculen a la sociedad, gracias a la producción de nuevo conocimiento, reflexión que se propone a lo largo del artículo.

  8. Análisis del bienestar psicológico en grupos en riesgo de exclusión social

    Directory of Open Access Journals (Sweden)

    Andrés Escarbajal-Frutos

    2014-05-01

    Full Text Available En el presente artículo analizamos el bienestar psicológico, como un estado integral de salud psicológico, social y laboral, en los grupos con mayor riesgo de exclusión social, entendida ésta como la falta de participación social, económica, política y cultural. Para ello utilizamos una metodología descriptiva de corte transversal. Destacamos que, de un total de 157 participantes, la mayor parte de ellos presentaron un nivel medio de satisfacción en sus vidas; evidenciaron diferencias estadísticamente no significativas en función del sexo; y al comparar los grupos de edad, resultó que no encontramos diferencias significativas en bienestar psicológico en función del grupo de pertenencia. Con esta investigación pretendemos mejorar sus condiciones socioeconómicas, psicológicas y personales, así como proponer alternativas de actuación para construir una sociedad más equitativa e inclusiva.

  9. Sentidos de doença mental em um grupo terapêutico e suas implicações

    Directory of Open Access Journals (Sweden)

    Carla Guanaes

    Full Text Available Este estudo adota uma perspectiva construcionista social, que focaliza o modo como as pessoas constroem sentidos de si mesmas e de mundo em suas práticas discursivas. Enfatizando o caráter performático da linguagem, objetivou-se, nesta pesquisa, descrever alguns sentidos de doença mental produzidos em um grupo terapêutico realizado em um ambulatório de saúde mental, e as implicações do uso destes sentidos para as conversações grupais. Baseada na transcrição das 16 sessões do grupo, a análise da produção de sentidos permitiu a descrição de alguns sentidos de doença mental, bem como a construção de relações entre estes sentidos, a visão de mudança e os modos de interação por estes favorecidos. Através dessa análise, apontamos a utilidade de refletir sobre as implicações do uso de determinados sentidos de doença mental em terapia de grupo, como uma forma de potencializar as trocas dialógicas entre os participantes e a construção conversacional da mudança.

  10. CARACTERIZACIÓN DE LAS ENDOMICORRIZAS Y SIETE GRUPOS DE MICROORGANISMOS EN AGROSISTEMAS DEL PIEDEMONTE AMAZÓNICO, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Luis Antonio Franco Castro

    2012-05-01

    Full Text Available Este trabajo caracterizó la estructura funcional, la diversidad de la comunidad de endomicorrizas y el tamaño poblacional de siete grupos funcionales de microorganismos bajo cuatro diferentes coberturas vegetales o usos del suelo; bosque, cultivo de caña, pastura, y cultivo de café en la zona rural de Florencia-Caquetá. En los agrosistemas se determinó las características fisicoquímicas del suelo, el tamaño de las poblaciones de siete grupos funcionales de microorganismos, la estructura funcional de la comunidad de endomicorrizas (densidad de esporas, densidad de micelio total y su diversidad (índices de riqueza-dominancia-equidad. En el suelo superficial (0-20 cm del área de estudio se encontró que la estructura de la comunidad de endomicorrizas es particular a cada cobertura vegetal. El cambio de la cobertura natural tiene consecuencias en el tamaño de ciertos grupos bacterianos, la estructura y la diversidad de las endomicorrizas. Se encontró que las poblaciones de microorganismos y la comunidad de endomicorrizas están fuertemente relacionadas con los niveles de nutrientes del suelo.

  11. Estrategia de comunicación para la inserción laboral en Facebook. Grupos de empleo.

    Directory of Open Access Journals (Sweden)

    Silvia Alende Castro

    2015-01-01

    Full Text Available Este artículo pone en discusión resultados de la investigación Estrategia de comunicación para la inserción laboral en Facebook. Grupos de empleo. A nivel metodológico, este estudio se orientó hacia una perspectiva cuantitativa, a través del análisis de contenido y la realización de cuestionarios como técnicas de investigación. En el primer caso, el objeto de análisis fueron tres grupos vinculados al área del empleo en Facebook y correspondientes a otros tantos entornos territoriales de Galicia: autonómico, comarcal y municipal. En el segundo, fueron los usuarios de esas comunidades los destinatarios del citado cuestionario acerca de la utilidad de estos grupos y la propia red social para obtener un puesto de trabajo. Entre las conclusiones obtenidas, se puede afirmar que el funcionamiento de colectivos como los analizados se desarrolla a través de una estrategia de comunicación para la inserción laboral y articulada sobre una cultura colaborativa.

  12. Equipes de trabalho ou grupos de cooperativos na Semana Acadêmica Integrada do IFRS - Campus Osório

    Directory of Open Access Journals (Sweden)

    Aline Silva De Bona

    2016-11-01

    Full Text Available O trabalho é uma reflexão sobre a ação de uma comissão organizadora de um evento do tipo semana acadêmica integrada de ensino superior de três cursos do IFRS - Campus Osório, que aconteceu em maio de 2016. Tal reflexão tem o objetivo de discutir o que são equipes de trabalho ou grupos cooperativos segundo as teorias da administração que diferenciam grupos de equipes, e da educação que delineiam as ações de cooperar e colaborar como distintas, enquanto para a área da informática são similares. A metodologia é um estudo de caso ancorado em um relato de experiência sobre este evento, e que descreve como resultado a importância profissional de se distinguir termos conceituais tanto na teoria como na prática, pois tais podem se tornam um diferencial profissional para qualquer área atualmente, além das percepções e responsabilizações dos estudantes da comissão organizadora quanto as diferentes formas de atuar e trabalhar sejam em grupos ou equipes.

  13. Burnout e identificación con el grupo: el papel del apoyo social en un modelo de ecuaciones estructurales

    Directory of Open Access Journals (Sweden)

    Gabriela Topa-Cantisano

    2007-01-01

    Full Text Available El objetivo de este estudio descriptivo mediante encuestas consiste en establecer la influencia de la identificación con el grupo en el síndrome de burnout y el papel mediador del apoyo social en tal relación. La muestra está formada por 494 empleados dentro de 99 grupos de trabajo. Estos empleados pertenecían a una amplia variedad de organizaciones. Los análisis a nivel descriptivo mostraron una relación negativa (r = -0,35 entre falta de eficacia profesional e identificación grupal. A nivel predictivo los resultados mostraron que los participantes altamente identificados con su grupo muestran menores niveles de burnout y que el apoyo social media parcialmente las relaciones entre la identificación grupal y el cansancio emocional. Los resultados sugieren la intervención con aquellas organizaciones a las que pertenecen estos profesionales en orden a incrementar su identificación grupal y a proporcionarles apoyo social.

  14. ESTUDIO DEL PERFORMANCE DE LOS GRUPOS ESTRATÉGICOS EN EL SISTEMA DE FRANQUICIA ESPAÑOL

    Directory of Open Access Journals (Sweden)

    Rondán Cataluña, F.J.

    2010-01-01

    Full Text Available La preocupación por considerar la heterogeneidad en los comportamientos empresariales dentro de un sector de actividad, ha sido uno de los principales motivos para la búsqueda e identificación de grupos estratégicos, generando un debate inagotable en el ámbito de la estrategia empresarial. Sin embargo, esta preocupación no se ha limitado a identificar arquetipos o configuraciones empresariales, sino que también se ha extendido al estudio de posibles diferencias en el rendimiento entre los grupos identificados. En el presente trabajo, intentamos dar respuesta a esta doble preocupación y todo ello centrándonos en el ámbito de la franquicia. Para ello, se ha elaborado una base de datos con el total de cadenas franquiciadoras (664 que en el año 2005 operaban en España. Los resultados obtenidos revelan la existencia de cinco grupos estratégicos (tipos de franquiciadores perfectamente diferenciados, los cuales son descritos a partir de las variables estratégicas que los definen. Igualmente, se demuestra la existencia de diferencias en los resultados inter-grupales a partir de determinados indicadores de desempeño (ingresos, resultados ordinarios y rentabilidad.

  15. Grupo operativo como estratégia para acompanhamento do Projeto Pedagógico de Curso em Enfermagem

    Directory of Open Access Journals (Sweden)

    Gabriella Cristine Guerra de Carvalho

    2014-01-01

    Full Text Available El objetivo del estudio fue acompañar y describir el proceso de implantación del Proyecto Pedagógico del Curso de Graduación en Enfermería, en el Campus Catalão, Universidad Federal de Goiás, bajo la óptica de docentes y discentes. Estudio cualitativo y descriptivo, con trece participantes, realizado entre abril del 2010 y junio del 2011, en Catalão, GO, Brasil. Se utilizó el grupo operativo como tecnología para acompañamiento y obtención de datos. Al final de cada reunión, fue realizada una crónica, sometida al análisis del contenido temático, donde emergieron dos categorías que revelaron como potencialidad del proceso de enseñanza y aprendizaje la interdisciplinaridad de la matriz curricular, y como limitadores, la inmadurez de los estudiantes y relación interpersonal conflictiva entre discentes y docentes. El trabajo en pequeños grupos es importante herramienta pedagógica; el grupo operativo se mostró asertivo en la gestión de la enseñanza y en la conducción de la investigación.

  16. Genetic diversity of cucumber estimated by morpho-physiological and EST-SSR markers.

    Science.gov (United States)

    Pandey, Sudhakar; Ansari, Waquar Akhter; Pandey, Maneesh; Singh, Bijendra

    2018-02-01

    In the present study, genetic variation among 40 cucumber genotypes was analyzed by means of morpho-physiological traits and 21 EST-SSR markers. Diversity was observed for morpho-physiological characters like days to 50% female flowering (37-46.9, number of fruits/plant (1.33-5.80), average fruit weight (41-333), vine length (36-364), relative water content (58.5-92.7), electrolyte leakage (15.9-37.1), photosynthetic efficiency (0.40-0.75) and chlorophyll concentration index (11.1-28.6). The pair wise Jaccard similarity coefficient ranged from 0.00 to 0.27 for quantitative traits and 0.24 to 0.96 for EST-SSR markers indicating that the accessions represent genetically diverse populations. With twenty-one EST-SSR markers, polymorphism revealed among 40 cucumber genotypes, number of alleles varied 2-6 with an average 3.05. Polymorphism information content varied from 0.002 to 0.989 (mean = 0.308). The number of effective allele (Ne), expected heterozygosity (He) and unbiased expected heterozygosity (uHe) of these EST-SSRs were 1.079-1.753, 0.074-0.428 and 0.074-0.434, respectively. Same 21 EST-SSR markers transferability checked in four other Cucumis species: snapmelon ( Cucumis melo var. momordica ), muskmelon ( Cucumis melo L.), pickling melon ( Cucumis melo var. conomon ) and wild muskmelon ( Cucumis melo var. agrestis ) with frequency of 61.9, 95.2, 76.2, and 76.2%, respectively. Present study provides useful information on variability, which can assist geneticists with desirable traits for cucumber germplasm utilization. Observed physiological parameters may assists in selection of genotype for abiotic stress tolerance also, EST-SSR markers may be useful for genetic studies in related species.

  17. Aprendizagem em grupo operativo de diabetes: uma abordagem etnográfica Learning through diabetes operative groups: an ethnographical approach

    Directory of Open Access Journals (Sweden)

    Shirley Pereira de Almeida

    2010-06-01

    Full Text Available O presente trabalho, elaborado a partir da dissertação, aborda um dos núcleos temáticos que emergiu da pesquisa durante o curso de mestrado na Escola de Enfermagem da Universidade Federal de Minas Gerais. Para a compreensão da aprendizagem em grupo, utilizamos como referencial teórico Pichon-Riviére. Para esse autor, aprendizagem é um dos indicadores de fundamental importância no processo grupal. A partir do processo interacional, estabelece-se uma situação de aprendizagem, que permite aos integrantes apropriarem-se da realidade, mutuamente, e compartilhar pensamentos e conhecimentos. A concepção dos entrevistados de que o grupo proporciona o aprendizado no manejo do diabetes pode ser observado na maioria dos depoimentos. O núcleo temático "Grupo como espaço de aprendizagem e transformação" desvela concepções e significados que traduziram a experiência que as pessoas vivenciaram no grupo. Trata-se de um estudo etnográfico desenvolvido junto a treze pessoas diabéticas participantes de grupo de uma Unidade Básica de Saúde da Prefeitura Municipal de Belo Horizonte, Minas Gerais. Os dados foram coletados por meio de entrevista semi-estruturada, observação participante e análise documental. A análise dos dados foi orientada pela análise de conteúdo de Bardin.This work has emerged from one of the core themes of research undergone in my masters' course at the Federal University of Minas Gerais - School of Nursing. In order to understand group learning, we used the theoretical references of Pichon-Riviére. According to this author, learning is an indicator of uttermost importance in group processes. Through process interactions, a learning mechanism unfolds allowing participants to mutually appropriate reality, share thoughts and knowledge. In most statements, interviewees have highlighted that the group allows them to learn how to deal with diabetes. The core theme, "Group as a space for learning and transformation

  18. Divergência genética entre cinco genótipos de melão rendilhado Genetic divergence among five muskmelon cultivars

    Directory of Open Access Journals (Sweden)

    Adriana Antonieta do Nascimento Rizzo

    2002-06-01

    Full Text Available Estimou-se a divergência genética entre cinco genótipos de melão rendilhado (Cucumis melo var. reticulatus Naud. (JAB-20, JAB-21, JAB-22, JAB-23 e 'Bônus nº 2' e determinou-se qual a contribuição relativa das 16 características avaliadas [nº médio de flores masculinas, hermafroditas/planta; produção total de frutos/m², peso médio dos frutos comerciáveis; diâmetro médio transversal e longitudinal do fruto (DMTF e DMLF; diâmetro médio transversal da inserção do pedúculo (DMTP; espessura média do mesocarpo e epicarpo (EMM e EME; diâmetro médio longitudinal e transversal do lóculo (DMTL e DMLL; proporção da cavidade (PC; desprendimento de sementes (DS; teor de sólidos solúveis totais (SST, pH e acidez titulável (AT] na divergência gen��tica. Obtiveram-se dois grupos de similaridade: I- JAB-20, JAB-21 e 'Bônus nº2' e II- JAB-22 e JAB-23. As características DMLF, DMTP, DMLL, DS e SST foram as que mais contribuíram para a divergência genética entre os genótipos.The genetic divergence of five cultivars of muskmelon was estimated (Cucumis melo var. reticulatus Naud (JAB-20, JAB-21, JAB-22, JAB-23 and 'Bônus nº2' and the relative contribution of each 16 characteristics were determined (number of male flowers per plant; total production of fruit, weight of fruits; longitudinal and transversal diameters of fruits; thickness and color of flesh and skin; longitudinal and transversal loculos diameter of fruits; seed loosing; netting thickness; and % total solvers solids, pH and total acidity in genetic divergence. Two groups of similarity were formed between the genitors by the values of D², one of then was constituted of the JAB-20 and JAB-21 and 'Bônus nº 2' genotypes, and another of the JAB-22 and JAB-23. The characteristics of longitudinal loculos diameters, longitudinal diameter of fruits, transversal diameter of peduncle insertion, % total solvers solids and seed loosing contributed to for genetic

  19. Grupo residencial «Le Haut du Lièvre». Nancy

    Directory of Open Access Journals (Sweden)

    Hereng, J. M.

    1964-07-01

    ñalaremos que la cimentación fue realizada según procedimientos tradicionales, pero la estructura y cerramientos han sido ejecutados a base de un sistema de prefabricación pesada. Paralelamente al programa de viviendas, han sido planeados los servicios del núcleo residencial: dos centros comerciales, un cinematógrafo, un centro cultural, tres grupos escolares, edificios para el culto, campo de deportes, garajes, aparcamientos, etc. Tres edificios-torres en forma de estrella de tres brazos, con un total de 786 viviendas, se construirán en un futuro próximo.

  20. Occupational stress and work capacity of nurses of a hospital group Estrés laboral y capacidad para el trabajo de enfermeros de un grupo hospitalario Estresse laboral e capacidade para o trabalho de enfermeiros de um grupo hospitalar

    Directory of Open Access Journals (Sweden)

    Christian Negeliskii

    2011-06-01

    Full Text Available The study aimed to evaluate the relationship between occupational stress and the work capacity index of 368 nurses (82.1% of the population of a Hospital Group. A questionnaire with socio-occupational questions was used as well as two scales: the Job Stress Scale and the Work Capacity Index. The group of nurses was predominantly female (93.2%, worked in care activities (63.9%, had undertaken at least one Postgraduate course (76% and were satisfied with the unit where they worked (70.5%. Occupational stress was present in 23.6% of the nurses, of these 15.2% presented High Strain work and 8.4% Passive Work. Social Support exercised a significant positive influence on all groups - exposed or not to occupational stress. Regarding the Work Capacity, this was Moderate (28-36 points for 51.4% of the nurses and Good (37-43 points for 47.4%. There was no correlation between stress and work capacity.Se trata de un estudio con objetivo de evaluar la relación entre el estrés laboral y el índice de capacidad para el trabajo de 368 enfermeros (82,1% de la población de un Grupo Hospitalario. Se utilizó un cuestionario con cuestiones socio ocupacionales y dos escalas: la Job Stress Scale y el Índice de Capacidad para el Trabajo. El grupo de enfermeros es predominantemente femenino (93,2%, trabaja en actividades asistenciales (63,9%, posee por lo menos un curso de posgraduación (76% y está satisfecho con la unidad donde trabaja (70,5%. El estrés laboral está presente en 23,6% de los enfermeros, de estos 15,2% presentan Alta Exigencia en el trabajo y 8,4% Trabajo Pasivo. El Apoyo Social ejerce influencia positiva significativa sobre todos los grupos expuestos y no expuestos al estrés laboral. En cuanto a la Capacidad para el Trabajo, está es Moderada (28-36 puntos para 51,4% de los enfermeros y Buena (37-43 puntos para 47,4%. No se encontró correlación entre el estrés y la capacidad para el trabajo.Este estudo teve como objetivo avaliar a rela

  1. La reintegración social y económica de los grupos armados ilegales en Colombia: reflexiones a partir de la trayectoria de nueve excombatientes

    OpenAIRE

    Mejía Gómez, Luisa Fernanda

    2014-01-01

    Esta investigación toma como marco general la Política de Reintegración Social y económica de personas y grupos alzados en armas en Colombia, en donde tras el estudio de las trayectorias en el conflicto de un grupo de 9 excombatientes, se aborda la relación existente entre los beneficios otorgados por dicha política y aquello que facilitó y motivó el ingreso, la permanencia y desmovilización de los grupos armados. Se presenta una caracterización e interpretación conceptual de las denominadas ...

  2. Dinâmicas de grupo orientadas pelas atividades de estudo: desenvolvimento de habilidades e competências na educação profissional

    OpenAIRE

    Alberti,Taís Fim; Abegg,Ilse; Costa,Márcia Rejane Julio; Titton,Mauro

    2014-01-01

    Explicita resultados de pesquisa sobre dinâmicas de grupo e sua contribuição para aquisição de conhecimentos teórico-práticos. Realizamos ações em uma escola pública federal, envolvendo estudantes do terceiro semestre do Curso Técnico em Administração de Empresas. Para coleta de dados, planejamos, implementamos e avaliamos sequência didática centrada em dinâmicas de grupos tematizadas pelos conteúdos curriculares. Utilizaram-se questionários abertos para avaliar se as dinâmicas de grupo poder...

  3. Grupos de Convivência: contribuições para uma proposta educativa em Tuberculose Grupos de Convivencia: contribuciones para un propuesta educativa en Tuberculosis Living Groups: contributions for an educational proposal for Tuberculosis

    Directory of Open Access Journals (Sweden)

    Sabrina da Silva de Souza

    2007-10-01

    Full Text Available Trata-se de um relatório de prática assistencial que teve como objetivo desenvolver uma proposta de educação em saúde com grupo de pessoas com tuberculose, visando a efetivação do tratamento. Os dados foram obtidos através de uma proposta de educação em saúde, desenvolvida em um grupo de convivência. Decorrentes do processo de análise foram identificados dois temas que estavam interligados: a percepção da tuberculose e seus cuidados e tratamentos e o isolamento social ,que representam os elementos que influenciam na educação em saúde das pessoas com tuberculose e o significado que a mesma traz para essas pessoas.Se trata de um retatorio de practica asistencial que teivo como objetivo desenvolver uma propuesta de educación em salud com um grupo de personas com tuberculosis, visando que el tratamiento se a mas efectivo. Los datos fueram obtenidos atravéz de una propuesta de educación en salud, desenvolvida en un grupo de convivencia. Decorrentes del proceso de análisis fueram identificados dos temas que estavam interligados: la percepción de la tuberculosis, sus cuidados y tratamiento y el aislamiento social, que representam los elementos que influenciam en la educación in salud de las personas con tuberculosis e el significado que la misma trae para estas personas.This study is a report on care practice. Its objective was to develop a proposal for education in health care from a group of people with tuberculosis, seeking to increase the effectiveness of their treatment. The data was obtained through a proposal for education in health care, developed through a living group. Two interrelated themes resulted from the process of analyzing the data: the perception of tuberculosis and its care and treatment, and social isolation. These represent the elements that influence education in health care for people with tuberculosis, as well as the meaning that such a situation has to these people.

  4. Grupo psicoeducativo multifamiliar no tratamento dos transtornos alimentares na adolescência Grupo psicoeducativo multifamiliar y tratamiento de adolescentes con trastornos de la conducta alimentaria Multifamily psycho-educational group and treatment of adolescents with eating disorders

    Directory of Open Access Journals (Sweden)

    Manoela Nicoletti

    2010-03-01

    Full Text Available A proposta deste artigo é apresentar o grupo psicoeducativo multifamiliar do ambulatório do Programa de Atendimento, Ensino e Pesquisa em Transtornos Alimentares da Infância e Adolescência - PROTAD - do Instituto de Psiquiatria, do Hospital das Clínicas, da Faculdade de Medicina da Universidade de São Paulo, PROTAD-AMBULIM-HC-IPq-FMUSP, como uma das modalidades do tratamento multidisciplinar oferecidas a pacientes adolescentes com transtornos alimentares e a suas famílias. O artigo baseia-se na experiência dos encontros mensais da equipe, nos quais participam os familiares e cuidadores dos pacientes adolescentes com transtornos alimentares do ambulatório, e expõe o modelo de grupo psicoeducativo empregado, relacionando-o aos achados da literatura e à prática clínica.La propuesta de este artículo es presentar el grupo psicoeducativo multifamiliar del ambulatorio del Programa de Atención, Enseñanza e Investigación en Trastornos Alimentarios en la Infancia y en la Adolescencia - PROTAD - del Instituto de Psiquiatría del Hospital de las Clínicas de la Facultad de Medicina de la Universidad de São Paulo, PROTAD-AMBULIM-HC-IPq-FMUSP, como una de las modalidades de tratamiento multidisciplinario proporcionado por PROTAD a pacientes adolescentes con trastornos alimentarios y a sus familias. En especial, el artículo parte de la experiencia obtenida en los encuentros mensuales con la participación de familiares y cuidadores de los pacientes adolescentes con trastornos alimentarios del ambulatorio y expone el modelo de grupo psicoeducativo aplicado, relacionándolo a los modelos encontrados en la literatura médica y a la práctica clínica.The psycho-educational multifamily group is part of a multidisciplinary treatment offered to adolescents with eating disorders and their families, in the out-patient Program for Children and Adolescents with Eating Disorders - PROTAD - of the Institute of Psychiatry, of Hospital das Cl

  5. Identidad social de un grupo de altos ingresos económicos. Social identity of a group of high income

    Directory of Open Access Journals (Sweden)

    Gabriela Dujarric Bermúdez

    2015-12-01

    Full Text Available La investigación indaga la existencia de una relación entre los ingresos económicos y la identidad, para lo cual se trabajó con un grupo de altos ingresos de la provincia de La Habana. Desde el Enfoque de Identidades Sociales se intenta comprender la configuración subjetiva de este grupo, así como su proyección ante la situación actual del país. Utilizamos un enfoque mixto, procesando la información a partir del Statistical Packetfor Social Sciencies (SPSS y el análisis de contenido. Los resultados obtenidos evidencian que los ingresos modelan una identidad social y constituyen un referente sobre cómo se está moviendo la subjetividad de este grupo social, así como de su proyección ante la situación actual del país. The research investigates the existence of a relationship between economic income and social identity, for which we worked with a group of high incomes in the province of Havana. From the Social Identity Perspective we try to understand the subjectivity of this group and its projection to the current situation. We worked with a mixed methodology and processed the information using the Statistical Packet for Social Sciencies (SPSS and the content analysis. The results show that incomes shape an identity and give some hints about the movement ofthis group social subjectivity, in this period of reforms.

  6. Grupo com agentes comunitárias: a construção de novas possibilidades do cuidar

    Directory of Open Access Journals (Sweden)

    Mirna Yamazato Koda

    Full Text Available O Programa de Saúde da Família (PSF é uma estratégia política adotada pelo Ministério da Saúde para promover a transformação do modelo tradicional de cuidados com a saúde na atenção básica. A figura do agente comunitário de saúde (ACS tem papel fundamental no PSF por ser o principal elo entre a unidade de saúde e a comunidade. A partir do estágio supervisionado em Psicologia Comunitária do Curso de Psicologia da Universidade São Francisco, foi realizado um grupo com os ACSs de uma unidade de PSF de um Município do interior de São Paulo. A proposta do grupo era discutir o trabalho realizado na unidade de saúde, buscando fomentar uma postura protagonista no enfrentamento das dificuldades cotidianas. Para tanto, utilizou-se o referencial dos grupos operativos tal como postulado por Enrique Pichon-Rivière, tendo sido observada, ao longo do processo, uma vivência de grande desamparo por parte das agentes. Essa questão foi abordada a partir de diversas atividades e estratégias de modo a fortalecer os vínculos grupais. Ao final deste trabalho, os ACSs podiam ocupar um lugar de maior propriedade com relação ao trabalho realizado no território.

  7. Contaminación acústica por grupos electrógenos // Acoustic contamination by diesel driven electric plant.

    Directory of Open Access Journals (Sweden)

    Yanexy Cepero-Aguilera

    2009-05-01

    Full Text Available El trabajo tiene como tema el impacto ambiental por ruido de grupos electrógenos (GE. Semuestran diferentes definiciones y conceptos referidos a la explotación de los GE y lasconsecuencias que puede provocar a las personas que permanezcan cerca de ellos durante sufuncionamiento. Los grupos electrógenos son además de generadores de energía, generadores deruido y por tanto contribuyen a la contaminación acústica del lugar donde estén situados. En eldocumento se aborda la importancia del correcto uso y selección de los protectores auditivos paraaquellas personas que trabajen directamente en las baterías de grupos electrógenos, así comoalgunas formas de atenuar el ruido. También se caracteriza la emisión sonora de estos a partir deestudios realizados.Palabras claves: ruido, nivel sonoro, sonido.________________________________________________________________________AbstractThis paper concerns with the environmental damage due to noise emission introduced by EngineGenerator Sets. Definitions and concepts about Engine Generator operation are shown as well asthe consequences over the personnel who stand near the Engine Generators during theiroperation. Obviously, such kind of machines generates energy but they also generate noise whichcontaminates the environment around them. The paper states how important are the rightselection and use of noise protection devices for those whose main job is to operate enginegenerator sets. Some methods for noise damping are also shown. Finally, some case studies arepresented in order to describe the noise emission registered in the real world.Key words: noise, sound level, sound.

  8. Mortalidad en Susques (período 1903-1950: distribución sexual y por grupo de edad

    Directory of Open Access Journals (Sweden)

    Bejarano, Ignacio

    1999-01-01

    Full Text Available El estudio de la mortalidad constituye un indicador demográfico importante del estado sanitario de una población. A partir del mismo se pueden determinar las patologías más frecuentes que la afectan e inferir las condiciones de salud que la caracterizan como un conjunto. El objetivo de este trabajo fue evaluar la mortalidad en Susques a través del análisis de las causas de muerte por sexo y grupos de edad. A partir de los registros de defunciones se determinó el porcentaje de defunciones y de las causas de muerte por edad y sexo en el período 1903-1950. El patrón de morbimortalidad de la población en estudio se caracteriza por: a ausencia de diferencias sexuales; b un porcentaje elevado de defunciones en los niños de 0-9 años; c presentar como principal causa de muerte en este grupo de edad las enfermedades infecciosas y parasitarias y en los restantes grupos las enfermedades del aparato respiratorio. Este patrón de mortalidad se atribuiría preponderantemente a factores mesológicos propios de los ecosistemas de altura: condiciones sanitarias deficientes, menor nivel socioeconómico y limitado acceso a recursos energéticos y nutricionales. Los resultados de esta investigación proporcionan la primera evaluación del estado de salud de la población susqueña en el período analizado y permiten comprender, al compararlos con los datos actuales, los cambios que los sistemas sociales deben encarar en respuesta a los requerimientos planteados en el sector salud de la población.

  9. (GEHO Grupo español del hormigón

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1986-12-01

    ón responde el articulado de los presentes Estatutos. En cuanto a las Disposiciones Adicionales, constituyen un reconocimiento del papel fundamental que el Instituto Eduardo Torroja ha desempeñado en el tema y señalan, también, una vía de evolución hacia el futuro. El proceso de legalización del Grupo Español del Hormigón concluyó con su inscripción en el Registro Provincial de Asociaciones de Madrid, N.P. 6.771, el 4 de Julio de 1985.

  10. Eficacia de la vacuna meningocócica de polisacárido capsular del grupo C

    OpenAIRE

    González Enríquez Jesús; García Comas Luis; Alcaide Jiménez Juan Francisco; Sáenz Calvo Antonio; Conde Olasagasti José

    1997-01-01

    FUNDAMENTO: Este trabajo consiste esencialmente en una revisión sistemática de la literatura científica sobre los efectos, intensidad y duración de la respuesta serológica, así como sobre la eficacia, efectividad y seguridad de la vacuna meningocócica de polisacárido capsular del grupo C. MÉTODOS: Búsqueda en repertorio MEDLINE en el periodo 1970-1996. Búsqueda específica de ensayos clínicos aleatorizados y estudios de intervención prospectivos en humanos con vacunas de polisacáridos capsular...

  11. Análisis de grupo de las empresas productoras de frutales caducifolios del departamento de Boyacá

    OpenAIRE

    Puentes Gloria Acened; Rodríguez Luis Felipe; Bermúdez Lilia Teresa

    2008-01-01

    El estudio se hizo en las provincias de Centro, Márquez, Sugamuxi, y Tundama, del departamento de Boyacá, con el objeto de realizar un Análisis de Grupo de las agroempresas productoras de frutales caducifolios de la región. El levantamiento de la información se hizo con base en el diseño de una ficha técnica, la cual se aplicó a las 28 unidades productivas de estas especies en los municipios más representativos de tales provincias. El trabajo de campo se desarrolló co...

  12. Comportamiento electroquímico de carbones activados con presencia de grupos superficiales de fósforo

    OpenAIRE

    Gallardo-Fuentes, Aurora; Ruiz-Rosas, Ramiro; Berenguer-Betrian, Raul; Morallón, Emilia; Cazorla-Amorós, Diego; Nishihara, Hirotomo; Kyotani, Takashi; Rodríguez-Mirasol, José; Cordero, Tomás

    2013-01-01

    Debido a su elevada superficie específica y una combinación única de conductividad, estabilidad y gran versatilidad química-estructural, los carbones activados (CAs) se emplean como electrodos en diversas aplicaciones electroquímicas. En estas aplicaciones, los heteroátomos presentes en su superficie, tales como oxígeno y nitrógeno, juegan un papel muy importante. La presencia de grupos superficiales estables de fósforo ha sido menos estudiada, pero parece inducir efectos positivos en las pro...

  13. Passeio da tarde : um estudo sobre o "setting clínico ambulante" do acompanhamento terapêutico de grupo

    OpenAIRE

    França, Demétrius Alves de

    2009-01-01

    Esta dissertação visa articular e sistematizar diversos aspectos da teoria e da prática do acompanhante terapêutico dentro de um trabalho de grupo desenvolvido em um hospital-dia particular de Brasília – DF. O setting terapêutico ambulante proporciona situações e possibilidades terapêuticas auxiliares ou alternativas no tratamento em saúde mental ainda desconhecidas pelos profissionais da área, mostrando-se como campo aberto para o desenvolvimento de uma produção intelectual ainda incipiente ...

  14. Tipos de parafasias que presentan un grupo de pacientes afásicos fluentes que acuden a un centro hospitalario

    OpenAIRE

    Aguilar, Angelica; Panaifo, Erika; Paredes, José Alberto

    2013-01-01

    El objetivo de la investigación fue conocer los tipos de parafasias en un grupo de pacientes adultos afásicos fluentes que acuden a un Centro Hospitalario, a través del Test de Boston. La metodología que se utilizó fue descriptivo simple, y el estudio tuvo una duración de 5 meses contando con la participación de 6 pacientes. A través de la presente investigación se logró conocer el tipo de parafasia que presenta cada paciente, encontrando en los resultados que existe una relación entre ...

  15. ESTRÉS POSTRAUMÁTICO EN POLICÍAS Y MILITARES DE GRUPOS ESPECIALIZADOS EN SECUESTRO

    Directory of Open Access Journals (Sweden)

    Ángela Cristina Tapias Saldaña

    2006-01-01

    Full Text Available Esta investigación describe la existencia de estrés postraumático en policías y militares de grupos antisecuestro de Colombia. Se concluyó que el 31% de los participantes lo padece y el 8% lo ha desarrollado como consecuencia del trabajo y que hay mayor incidencia de esta psicopatología en los que tienen mayor tiempo de servicio y mayor rango, por lo cual se sugiere realizar actividades de prevención e intervención.

  16. Sintomas vocais auditivos e proprioceptivos pré e pós-terapia de grupo de pacientes com disfonia

    Directory of Open Access Journals (Sweden)

    Hamanda Rhayssa Medeiros Costa Vital

    Full Text Available RESUMO Objetivo: comparar os sintomas auditivos, proprioceptivos e os totais pré e pós-terapia de grupo de pacientes com disfonia, além de associar o número de sintomas vocais às variáveis sexo, faixa etária, uso profissional da voz e diagnóstico laríngeo. Métodos: participaram 27 pacientes inseridos em grupos terapêuticos. Todos responderam aos sintomas vocais auditivos, proprioceptivos e totais do Protocolo de Triagem Vocal (PTV pré e pós-terapia de grupo, que constou de oito encontros, sendo o primeiro e último para aplicação do PTV; do segundo ao sétimo foram realizadas sessões terapêuticas fonoaudiológicas de abordagem eclética. Resultados: os participantes eram adultos, maioria do sexo feminino e diagnóstico laríngeo predominante de lesão na porção membranosa das pregas vocais. Pôde-se perceber que houve redução significante dos sintomas vocais proprioceptivos e totais quando se comparou pré e pós-terapia. Minimizaram significantemente pós-terapia os sintomas vocais: fadiga vocal, garganta seca, bolo na garganta, esforço e desconforto ao falar. Houve associação entre sintomas vocais (proprioceptivos, auditivos e totais pós-terapia de grupo com as variáveis sexo feminino e diagnóstico laríngeo lesão de massa na porção membranosa das pregas vocais. Não houve associação dos sintomas vocais pós-terapia com faixa etária e nem uso profissional da voz. Conclusão: houve redução dos sintomas vocais totais e proprioceptivos relatados pelos pacientes ao comparar o pré e o pós-terapia. Houve associação entre sexo feminino e diagnóstico de lesão de massa na porção membranosa das pregas vocais com sintomas totais, proprioceptivos e auditivos pós-terapia de voz. A faixa etária e o uso profissional da voz não foram associados à redução dos sintomas vocais.

  17. Reflexiones sobre la atención en salud mental de desmovilizados de grupos armados en Colombia

    OpenAIRE

    de la Espriella, Ricardo; Falla, Josué Vladimir

    2009-01-01

    Introducción: La violencia política en Colombia y las formas de abordar el proceso de desmovilización de los grupos armados irregulares han implicado atender en salud mental a ex combatientes con exposición repetida a eventos estresantes, lo cual implica difcultades para la reincorporación a la vida civil, tanto por situaciones individuales como por la respuesta de la sociedad a ese proceso. Objetivos: Describir los hallazgos encontrados en la atención en clínica psiquiátrica de hombres ex co...

  18. Grupos en las organizaciones: herramienta básica para gestionar la incertidumbre y ambigüedad crecientes

    OpenAIRE

    Navarro Cid, José; Quijano de Arana, Santiago D. de; Berger, Rita, 1959-; Meneses, Rocío

    2011-01-01

    El mundo del trabajo y de las organizaciones ha sufrido una transformación fundamental en los últimos años: hay mucha más incertidumbre. La respuesta organizativa a dicha incertidumbre ha sido la de diseñar organizaciones más complejas fundamentadas en el trabajo en equipo. Pero no todas las tareas requieren del trabajo en equipo ni todos los grupos de trabajo son auténticos equipos. En este trabajo repasaremos las investigaciones que venimos realizando para clarificar cómo entender operativa...

  19. Impacto de la venta de acciones en la salud financiera y el riesgo en los grupos financieros

    OpenAIRE

    Bedoya Villota, Alejandra

    2015-01-01

    Esta investigación tiene como objetivo general el análisis del impacto de la venta de acciones sobre la salud financiera y el riesgo en el grupo Aval. La necesidad por este estudio nace del interés por conocer los costos y beneficios que tienen las empresas a la hora de emitir acciones, siendo ésta última una práctica común en las últimas décadas. Algunas de las motivaciones relevantes para emitir acciones, son la financiación de nuevos proyectos de la empresa, el status que le pueda dar a la...

  20. Reflexiones e interrogantes a partir del estudio psicológico de un grupo de condenados a muerte

    OpenAIRE

    Ráez de Ramírez, Matilde; Falvy de Zariquiey, Mayela

    1983-01-01

    Un grupo de condenados a muerte por haber asesinado a policías fue sometido a una evaluación psicológica exhaustiva incluyendo batería de pruebas, anamnesis y observaciones de conducta. Los resultados indican en los sujetos: inteligencia normal y características tales como agresividad, dependencia, egocentrismo, inafectividad. Con respecto a los esquemas defensivos y de relación se encontró: ausencia de metas y límites, desconfianza, alejamiento, proyección y negación. En términos de la histo...