Skorobogatykh, V. N.; Danyushevskiy, I. A.; Schenkova, I. A.; Prudnikov, D. A.
2015-04-01
Currently, grade X10CrMoVNb9-1 (T91, P91) and 10Kh9MFB (10Kh9MFB-Sh) chromium steels are widely applied in equipment manufacturing for thermal power plants in Russia and abroad. Compilation and comparison of tensile, impact, and long-term strength tests results accumulated for many years of investigations of foreign grade X10CrMoVNb9-1, T91, P91, and domestic grade 10Kh9MFB (10Kh9MFB-Sh) steels is carried out. The property identity of metals investigated is established. High strength and plastic properties of steels, from which pipes and other products are made, for operation under creep conditions are confirmed. Design characteristics of long-term strength on the basis of tests with more than one million of hour-samples are determined ( and at temperatures of 500-650°C). The table of recommended allowable stresses for grade 10Kh9MFB, 10Kh9MFB-SH, X10CrMoVNb9-1, T91, and P91 steels is developed. The long-time properties of pipe welded joints of grade 10Kh9MFB+10Kh9MFB, 10Kh9MFB-Sh+10Kh9MFB-Sh, X10CrMoVNb9-1+X10CrMoVNb9-1, P91+P91, T91+T91, 10Kh9MFB (10Kh9MFB-Sh)+X10CrMoVNb9-1(T/P91) steels is researched. The welded joint reduction factor is experimentally determined.
Energy Technology Data Exchange (ETDEWEB)
Łomozik, Mirosław, E-mail: miroslaw.lomozik@is.gliwice.pl [Instytut Spawalnictwa, Testing of Materials Weldability and Welded Constructions Department, 44-100 Gliwice, Bł. Czesława 16-18 (Poland); Hernas, Adam, E-mail: adam.hernas@polsl.pl [Silesian University of Technology, Faculty of Materials Engineering and Metallurgy, 40-019 Katowice, Krasińskiego 8 str. (Poland); Zeman, Marian L., E-mail: marian.zeman@is.gliwice.pl [Instytut Spawalnictwa, Testing of Materials Weldability and Welded Constructions Department, 44-100 Gliwice, Bł. Czesława 16-18 (Poland)
2015-06-18
The article presents results of structural tests (light, scanning electron and scanning transmission electron microscopy) of X10CrMoVNb9-1 (T91) creep-resisting steel after approximately 100,000 h of operation. It was ascertained that the parent metal of T91 steel is characterized by the microstructure of tempered martensite with M{sub 23}C{sub 6} carbide precipitates and few dispersive precipitates of MX-type niobium and vanadium carbonitrides. The most inconvenient change in T91 steel precipitate morphology due to long-term operation is the appearance of the Laves Fe{sub 2}Mo phase which along with M{sub 23}C{sub 6} carbide particles forms elongated blocks and conglomerates on grain boundaries. The article also presents results of tests related to the effect of simulated welding thermal cycles on selected properties of X10CrMoVNb9-1 (T91) grade steel at a state after approximately 100,000 h of operation. The tests involved the determination of the chemical composition of the steel tested as well as impact tests, hardness measurements and microscopic metallographic examination (based on light microscopy) of simulated heat-affected zone (HAZ) areas for a cooling time (t{sub 8/5}) restricted within a range between 3 s and 120 s, with and without heat treatment. The tests revealed that, among other results, hardness values of simulated HAZ areas in X10CrMoVNb9-1 (T91) steel do not guarantee cold crack safety of the steel at the state without additional heat treatment. It was also observed that simulated welding thermal cycles of cooling times t{sub 8/5}=3, 12, 60 and 120 s do not significantly affect the toughness and hardness of simulated HAZ areas of the steel tested.
International Nuclear Information System (INIS)
Rodak, Kinga; Hernas, Adam; Vodarek, Vlastimil
2015-01-01
Microstructural changes in high alloy (9-12% Cr) creep resistant martensitic X10CrMoVNb9-1 and 12CrMoW . CuVNb steels after 100 000 h of steam exposure at 550 C have been studied using scanning transmission electron microscopy. Precipitates were identified using electron diffraction patterns and energy dispersive X-ray spectroscopy analysis. After long time exposure, a significant coarsening of M 23 C 6 carbides, and intensive precipitation of the coarse Laves phase were observed. Moreover, in the 12CrMoW . CuVNb steel, a low amount of the modified Z-phase particles was detected. The microstructures of the X10Cr . MoVNb9-1 and 12CrMoWCuVNb steels after 100 000 h of exposure differ in several aspects.
Energy Technology Data Exchange (ETDEWEB)
Rodak, Kinga; Hernas, Adam [Silesian Univ. of Technology, Inst. of Materials Science, Katowice (Poland); Vodarek, Vlastimil [VSB-Technical Univ. of Ostrava (Czech Republic)
2015-07-15
Microstructural changes in high alloy (9-12% Cr) creep resistant martensitic X10CrMoVNb9-1 and 12CrMoW . CuVNb steels after 100 000 h of steam exposure at 550 C have been studied using scanning transmission electron microscopy. Precipitates were identified using electron diffraction patterns and energy dispersive X-ray spectroscopy analysis. After long time exposure, a significant coarsening of M{sub 23}C{sub 6} carbides, and intensive precipitation of the coarse Laves phase were observed. Moreover, in the 12CrMoW . CuVNb steel, a low amount of the modified Z-phase particles was detected. The microstructures of the X10Cr . MoVNb9-1 and 12CrMoWCuVNb steels after 100 000 h of exposure differ in several aspects.
Energy Technology Data Exchange (ETDEWEB)
Kohlar, Stefanie
2017-07-01
The heat-resistant chromium steel X10CrMoVNb9-1 specified as P91 is based on its good properties at high temperatures and high mechanical Stresses as a potential material for use as reactor pressure vessel material in fourth generation nuclear reactors. Subject of this work was the characterization of the microstructure and mechanical properties of this material. For this purpose it was metallographically examined and technically important characteristic values were determined. Different etching methods and imaging techniques were used, with the method of oxalic acid etching newly applied to this material providing meaningful results. Tensile tests, hardness tests and notched bar impact tests provided mechanical-technological characteristics. The fracture mechanical behavior was determined by means of fracture mechanics tests on bending and compact tensile tests. The main focus was on the investigation of the applicability of the evaluation methods described in standards ASTM 1921 and ASTM 1820 for low alloy steels. The investigations showed that the P91 is expected to have a homogeneous martensitic structure consisting of annealed martensite with embedded carbides and carbonitrides. The location and size of the found carbides could be represented by the process of oxalic acid etching newly applied to this material. The mechanical-technological tests showed a good strength and toughness behavior typical for tempered steel. The application of the linear-elastic fracture mechanics and the yielding fracture mechanics made it possible to determine a reference temperature according to ASTM 1921-08a, but also showed that the evaluation methods and geometries described for this high-alloy steel in ASTM 1820-08 do not lead to valid material characteristics. In order to determine the suitability of this material for nuclear applications, the irradiation and creep behavior of the P91 should be characterized more precisely in further investigations. [German] Der als P91
1 CFR 9.1 - Publication required.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Publication required. 9.1 Section 9.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER SPECIAL EDITIONS OF THE FEDERAL REGISTER THE UNITED STATES GOVERNMENT MANUAL § 9.1 Publication required. The Director of the Federal Register shall...
Directory of Open Access Journals (Sweden)
Zhenchao Wang
2015-03-01
Full Text Available ern rice black streaked dwarf virus (SRBSDV causes severe harm to rice production. Unfortunately, studies on effective antiviral drugs against SRBSDV and interaction mechanism of antiviral molecule targeting on SRBSDV have not been reported. This study found dufulin (DFL, an ideal anti-SRBSDV molecule, and investigated the interactions of DFL targeting on the nonstructural protein P9-1. The biological sequence information and bonding characterization of DFL to four kinds of P9-1 protein were described with fluorescence titration (FT and microscale thermophoresis (MST assays. The sequence analysis indicated that P9-1 had highly-conserved C- and N-terminal amino acid residues and a hypervariable region that differed from 131 aa to 160 aa. Consequently, wild-type (WT-His-P9-1, 23 C-terminal residues truncated (TR-ΔC23-His-P9-1, 6 N-terminal residues truncated (TR-ΔN6-His-P9-1, and Ser138 site-directed (MU-138-His-P9-1 mutant proteins were expressed. The FT and MST assay results indicated that DFL bounded to WT-His-P9-1 with micromole affinity and the 23 C-terminal amino acids were the potential targeting site. This system, which combines a complete sequence analysis, mutant protein expression, and binding action evaluating system, could further advance the understanding of the interaction abilities between antiviral drugs and their targets.
Directory of Open Access Journals (Sweden)
Gutiérrez-Urrutia, L.
2001-04-01
Full Text Available The aim of the present work is to determine the influence of austenitizing temperature holding time and heating velocity on grain size of ferritic-martensitic type 9CrlMoVNb steels developed for Oak Ridge National Laboratories & Combustion Engineering, T91/P91[1] Steels (USA and X10CrMoVNb 9.1 (Europe. The potential benefits of this material, in term of high resistance, good ductily and oxidation resistance, weldability and in particular good high temperature creep strength, are now widely acknowledged, particulary by supercritical boilers (P = 300 bar, T = 550±50 °C. The studied steels have been produced in, high frecuency induction vacum furnaces and hot-rolled.
Se estudia la influencia de la temperatura de austenización, tiempo de permanencia a esta temperatura y velocidad de calentamiento sobre el tamaño de grano de varios aceros ferrítico-martensíticos de última generación del tipo 9CrlMoVNb, desarrollados por Oak Ridge National Laboratories (ORNL conjuntamente con Combustion Enginering en USA, conocidos por ASME/ASTM por las designaciones T91/P91[1] y en Europa como X10CrMoVNb9.1. Son aceros ductiles y tenaces que presentan muy buenas propiedades de resistencia a fluencia, soldabilidad y conductividad térmica. Son cada vez más utilizados como tubos de alta temperatura (550±50 °C y presión (300 bar en calderas supercríticas para centrales térmicas avanzadas. Los aceros estudiados se han fabricado en hornos de inducción de alta frecuencia al vacío y laminados en caliente.
Directory of Open Access Journals (Sweden)
Yu Jialin
2011-01-01
Full Text Available Abstract Background Rice black-streaked dwarf virus (RBSDV, a member of the genus Fijivirus within the family Reoviridae, can infect several graminaceous plant species including rice, maize and wheat, and is transmitted by planthoppers. Although several RBSDV proteins have been studied in detail, functions of the nonstructural protein P6 are still largely unknown. Results In the current study, we employed yeast two-hybrid assays, bimolecular fluorescence complementation and subcellular localization experiments to show that P6 can self-interact to form punctate, cytoplasmic viroplasm-like structures (VLS when expressed alone in plant cells. The region from residues 395 to 659 is necessary for P6 self-interaction, whereas two polypeptides (residues 580-620 and 615-655 are involved in the subcellular localization of P6. Furthermore, P6 strongly interacts with the viroplasm-associated protein P9-1 and recruits P9-1 to localize in VLS. The P6 395-659 region is also important for the P6-P9-1 interaction, and deleting any region of P9-1 abolishes this heterologous interaction. Conclusions RBSDV P6 protein has an intrinsic ability to self-interact and forms VLS without other RBSDV proteins or RNAs. P6 recruits P9-1 to VLS by direct protein-protein interaction. This is the first report on the functionality of RBSDV P6 protein. P6 may be involved in the process of viroplasm nucleation and virus morphogenesis.
Microchemistry of neutron irradiated 12%CrMoVNb martensitic steel
International Nuclear Information System (INIS)
Little, E.A.; Morgan, T.S.; Faulkner, R.G.
1992-01-01
Non-equilibrium solute segregation has been studied in a 12%CrMoVNb martensitic steel following fast reactor irradiation at 465 C and correlated with the development of M 6 X η-phase. Cr, Ni, Si, Mo, P and Mn are all shown to exhibit positive segregation to lath boundaries and are subsequently incorporated into M 6 X precipitates. The co-segregation of a combination of these elements which include P and Si, and possibly Cr or Mo, appears to promote M 6 X formation
26 CFR 1.381(c)(9)-1 - Amortization of bond discount or premium.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Amortization of bond discount or premium. 1.381(c)(9)-1 Section 1.381(c)(9)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(9)-1 Amortization of...
International Nuclear Information System (INIS)
Lee, Seung Mu
2000-02-01
This book gives descriptions of Or CAD 9.1 with before drawing plan such as gaining Or CAD Demo CD, capture tools, making new design file, drawing structure, and setting design template, Drawings like making new drawing, finding parts, drawing lines, connecting line among the pages, and connecting parts using drawing structure, unstable multivibrator circle such as management of design file, power and ground connection, utility, beginning layout, single drawing, flat drawing, latch circuit, making a library, making a footprint, smart route and flash window.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Swine. 91.9 Section 91.9 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS INSPECTION AND HANDLING OF LIVESTOCK FOR...
Pantoea vagans strain C9-1 is an effective biological control agent for fire blight of pear and apple. C9-1 carries three circular plasmids: pPag1 (168 kb), pPag2 (166 kb), and pPag3 (530 kb). Of these, pPag3, a member of the large Pantoea plasmid family, was proposed to contribute to epiphytic fitn...
SO(9,1) invariant matrix formulation of a supermembrane
International Nuclear Information System (INIS)
Fujikawa, K.; Okuyama, K.
1998-01-01
An SO(9,1) invariant formulation of an 11-dimensional supermembrane is presented by combining an SO(10,1) invariant treatment of reparametrization symmetry with an SO(9,1) invariant θ R = 0 gauge of κ-symmetry. The Lagrangian thus defined consists of polynomials in dynamical variables (up to quartic terms in X μ and up to the eighth power in θ), and reparametrization BRST symmetry is manifest. The area preserving diffeomorphism is consistently incorporated and the area preserving gauge symmetry is made explicit. The SO(9,1) invariant theory contains terms which cannot be induced by a naive dimensional reduction of higher-dimensional supersymmetric Yang-Mills theory. The SO(9,1) invariant Hamiltonian and the generator of area preserving diffeomorphism together with the supercharge are matrix regularized by applying the standard procedure. As an application of the present formulation, we evaluate the possible central charges in superalgebra both in the path integral and in the canonical (Dirac) formalism, and we find only the two-form charge [ X μ , X ν ]. (orig.)
Aqueous sample from B-Plant, Tank 9-1. Revision 1
International Nuclear Information System (INIS)
Bell, K.E.
1995-01-01
Eight liquid samples were received from B-Plant Tank 9-1 in four lots of two samples each, for inorganic and organic analysis. This is the final report for the sampling and analysis effort; included are summary tables of the analytical and quality control data as well as all raw data. The analyses include pH, OH, inductively coupled plasma spectrography, ion chromatograph, total organic carbon, total inorganic carbon, and differential scanning calorimetry. Included are copies of the chain of custody and request for special analysis forms
Directory of Open Access Journals (Sweden)
Zieliński A.
2016-06-01
Full Text Available This paper presents the characteristics of the performance of P91 (X10CrMoVNb9-1, P92 (X10CrWMoVNb9-2 and VM12 (X12CrCoWVNb12-2-2 steels used for condition assessment of the pressure components of boilers with supercritical steam parameters. Studies on the mechanical properties, microstructure tests using scanning and transmission electron microscopy, and X-ray analysis of the phase composition of precipitates were performed for selected steels in the as-received condition and after long-term annealing. These steel characteristics are used for the evaluation of the microstructural changes and mechanical properties of the material of components after long-term service. The result of this study is the database of material characteristics representing the mechanical properties related to the microstructure analysis and it can be used for diagnosis of the components of pressure parts of power boilers.
DEFF Research Database (Denmark)
Franceschini, A.; Simonovic, M.; Roth, A.
2013-01-01
for certain model organisms and functional systems. Currently, protein interactions and associations are annotated at various levels of detail in online resources, ranging from raw data repositories to highly formalized pathway databases. For many applications, a global view of all the available interaction...... data is desirable, including lower-quality data and/or computational predictions. The STRING database (http://string-db.org/) aims to provide such a global perspective for as many organisms as feasible. Known and predicted associations are scored and integrated, resulting in comprehensive protein...... networks covering >1100 organisms. Here, we describe the update to version 9.1 of STRING, introducing several improvements: (i) we extend the automated mining of scientific texts for interaction information, to now also include full-text articles; (ii) we entirely re-designed the algorithm for transferring...
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
An International Multidisciplinary Journal, Ethiopia. Vol. 9(1), Serial No ... The methodology used in the study is content analysis method. The literature ... Introduction. A budget is a financial/and or quantitative statement prepared and approved.
Light-induced translocation of RGS9-1 and Gβ5L in mouse rod photoreceptors.
Directory of Open Access Journals (Sweden)
Mei Tian
Full Text Available The transducin GTPase-accelerating protein complex, which determines the photoresponse duration of photoreceptors, is composed of RGS9-1, Gβ5L and R9AP. Here we report that RGS9-1 and Gβ5L change their distribution in rods during light/dark adaptation. Upon prolonged dark adaptation, RGS9-1 and Gβ5L are primarily located in rod inner segments. But very dim-light exposure quickly translocates them to the outer segments. In contrast, their anchor protein R9AP remains in the outer segment at all times. In the dark, Gβ5L's interaction with R9AP decreases significantly and RGS9-1 is phosphorylated at S(475 to a significant degree. Dim light exposure leads to quick de-phosphorylation of RGS9-1. Furthermore, after prolonged dark adaptation, RGS9-1 and transducin Gα are located in different cellular compartments. These results suggest a previously unappreciated mechanism by which prolonged dark adaptation leads to increased light sensitivity in rods by dissociating RGS9-1 from R9AP and redistributing it to rod inner segments.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Goats. 91.6 Section 91.6 Animals and... EXPORTATION Diagnostic Tests, Treatments § 91.6 Goats. (a) In order to be eligible for export, goats shall be...) Tuberculosis. All goats over 1 month of age shall be negative to a caudal intradermal tuberculin test using 0.1...
Aqueous samples from B-Plant, Tank 9-1
International Nuclear Information System (INIS)
Bell, K.E.
1995-01-01
This document is the final report for the B-Plant Tank 9-1 sampling and analysis program. This report is divided into three parts: first, a narrative about the history, sampling effort, quality control, sample tracking/laboratory identification, and a summary of the analysis; second, sampling and custody data; and lastly, a set of compiled data from the laboratory analysis
25 CFR 91.9 - Inheritance of improvements.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Inheritance of improvements. 91.9 Section 91.9 Indians..., OSAGE RESERVATION, OKLAHOMA § 91.9 Inheritance of improvements. (a) Upon the death of the owner of... of the county courts, State of Oklahoma, and shall be subject to inheritance or bequest in accordance...
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Sheep. 91.8 Section 91.8 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS INSPECTION AND HANDLING OF LIVESTOCK FOR...
9 CFR 3.91 - Terminal facilities.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Terminal facilities. 3.91 Section 3.91... Primates 2 Transportation Standards § 3.91 Terminal facilities. (a) Placement. Any persons subject to the... with inanimate cargo or with other animals in animal holding areas of terminal facilities. Nonhuman...
9 CFR 91.26 - Concrete flooring.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Concrete flooring. 91.26 Section 91.26... LIVESTOCK FOR EXPORTATION Inspection of Vessels and Accommodations § 91.26 Concrete flooring. (a) Pens aboard an ocean vessel shall have a 3 inch concrete pavement, proportioned and mixed to give 2000 psi...
Understanding the application of OSC policy 9.1 during a takeover transaction
International Nuclear Information System (INIS)
Hayduk, M.F.; Rasmuson, M.A.
1998-01-01
Legal aspects of ownership of publicly traded companies in Canada are explored, with particular emphasis on transactions involving 'related parties'. In this context, Policy 9.1 of the Ontario Securities Commission is examined. The policy seeks to enhance minority shareholder protection by providing for independent valuation, majority of minority approval, enhanced disclosure and review of substantial transactions by independent directors. This paper focuses on four types of transactions governed by Policy 9.1, i.e. insider bids, issuer bids, going private transactions, related party transactions and the recent proposed rule reformulation proposed by the Ontario Securities Commission (OSC)
Ethiop. J. Sci. & Technol. 9(1) 31-44, 2016 31 Investigation of 1, 10 ...
African Journals Online (AJOL)
9(1) 31-44, 2016. 31. Investigation of 1, 10-Phenanthroline based Ionic Liquids using X-ray photoelectron spectroscopy ... 1, 10-Phenanthrolinium based ionic liquids are among the new compounds ..... Chemical Reviews 102(10):3667-. 3692.
Overview of 9Cr steels properties for structural application in sodium fast reactors
International Nuclear Information System (INIS)
Cabet, Celine; Courouau, Jean-Louis; Dalle, France; Desgranges, Clara; Forest, Laurent; Martinelli, Laure; Sauzay, Maxime
2015-01-01
A research and development programme has been launched by CEA, EDF and AREVA for the choice and qualification of material for sodium fast reactor (SFR) structural components. The requirements on steam generator (SG) are demanding, with operating temperatures ranging from 240 deg. C to 530 deg. C in water/steam and in sodium for an extended design life of several decades. The selection of the SG materials is based on many characteristics: fabrication, welding, thermal properties, mechanical strength at low and high temperature, environmental resistance. 9%Cr steels which are relevant candidate alloys for different designs of SGs have been extensively studied in the past decade. The objective of this paper is to review some advances made at CEA on determining properties of the X10CrMoVNb9-1 steel (hereafter named 'grade 91'): welding, modelling of cyclic softening, modelling of long-term creep, compatibility with liquid sodium, corrosion in steam. (authors)
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Captive cervids. 91.7 Section 91.7 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS INSPECTION AND HANDLING OF...
9 CFR 91.3 - General export requirements.
2010-01-01
... finds such tests are not necessary to prevent the exportation of diseased animals from the United States. (c) Testing. All samples for tests required by §§ 91.5 through 91.13 for exportation of animals under... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false General export requirements. 91.3...
9 CFR 91.20 - General construction.
2010-01-01
... of construction materials such as wood, metal plate, or pipe may be used for stalls, crates, or pens... accessible to animals. A combination of wood and steel pipe or other steel profile construction may be... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false General construction. 91.20 Section 91...
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Contamination. 381.91 Section 381.91... § 381.91 Contamination. (a) Carcasses of poultry contaminated by volatile oils, paints, poisons, gases... station away from the main processing line, by any method that will remove the contamination, such as...
Kawahara, Tomohiro; Makizaki, Yutaka; Oikawa, Yosuke; Tanaka, Yoshiki; Maeda, Ayako; Shimakawa, Masaki; Komoto, Satoshi; Moriguchi, Kyoko; Ohno, Hiroshi; Taniguchi, Koki
2017-01-01
Human rotavirus (RV) infection is a leading cause of dehydrating diarrhea in infants and young children worldwide. Since therapeutic approaches to RV gastroenteritis are limited to alleviation of dehydration with oral rehydration solutions, more direct approaches to palliate symptoms of RV gastroenteritis are required. Treatments with probiotics have been increasingly recognized as alternative safe and low cost treatments for moderate infectious diarrhea. In this study, Bifidobacterium bifidum G9-1 (BBG9-1), which has been used as an intestinal drug for several decades, was shown to have a remarkable protective effect against RV gastroenteritis in a suckling mice model. As well as prophylactic oral administration of BBG9-1 from 2 days before RV infection, therapeutic oral administration of BBG9-1 from 1 day after RV infection significantly alleviated RV-induced diarrhea. Therapeutic administration of BBG9-1 reduced various types of damage in the small intestine, such as epithelial vacuolization and villous shortening, and significantly diminished the infectious RV titer in mixtures of cecal contents and feces. It was also shown that therapeutic administration of BBG9-1 significantly increased the number of acidic mucin-positive goblet cells and the gene expression of mucosal protective factors including MUC2, MUC3, MUC4, TGFβ1 and TFF3 in the small intestine. This led to alleviation of low gut permeability shown as decreased gene expression levels of occludin, claudin-1 and villin-1 after RV infection. Furthermore, in the small intestine, therapeutic administration of BBG9-1 significantly palliated the decreased gene expression of SGLT-1, which plays an important role in water absorption. In the large intestine, administered BBG9-1 was shown to replicate to assimilate undigested nutrients, resulting in normalization of the abnormally high osmotic pressure. These results suggested that water malabsorption caused by RV infection was alleviated in mice administered
Directory of Open Access Journals (Sweden)
Tomohiro Kawahara
Full Text Available Human rotavirus (RV infection is a leading cause of dehydrating diarrhea in infants and young children worldwide. Since therapeutic approaches to RV gastroenteritis are limited to alleviation of dehydration with oral rehydration solutions, more direct approaches to palliate symptoms of RV gastroenteritis are required. Treatments with probiotics have been increasingly recognized as alternative safe and low cost treatments for moderate infectious diarrhea. In this study, Bifidobacterium bifidum G9-1 (BBG9-1, which has been used as an intestinal drug for several decades, was shown to have a remarkable protective effect against RV gastroenteritis in a suckling mice model. As well as prophylactic oral administration of BBG9-1 from 2 days before RV infection, therapeutic oral administration of BBG9-1 from 1 day after RV infection significantly alleviated RV-induced diarrhea. Therapeutic administration of BBG9-1 reduced various types of damage in the small intestine, such as epithelial vacuolization and villous shortening, and significantly diminished the infectious RV titer in mixtures of cecal contents and feces. It was also shown that therapeutic administration of BBG9-1 significantly increased the number of acidic mucin-positive goblet cells and the gene expression of mucosal protective factors including MUC2, MUC3, MUC4, TGFβ1 and TFF3 in the small intestine. This led to alleviation of low gut permeability shown as decreased gene expression levels of occludin, claudin-1 and villin-1 after RV infection. Furthermore, in the small intestine, therapeutic administration of BBG9-1 significantly palliated the decreased gene expression of SGLT-1, which plays an important role in water absorption. In the large intestine, administered BBG9-1 was shown to replicate to assimilate undigested nutrients, resulting in normalization of the abnormally high osmotic pressure. These results suggested that water malabsorption caused by RV infection was alleviated in
Microstructural evolution during creep deformation of an 11CrMoVNb ferritic heat resistant steel
Energy Technology Data Exchange (ETDEWEB)
Lee, Kyu-Ho; Park, Dae-Bum [Korea Institute of Science and Technology, Seoul (Korea, Republic of). Materials and Devices Div.; Korea Univ., Seoul (Korea, Republic of). Dept. of Materials Science; Kwun, S.I. [Korea Univ., Seoul (Korea, Republic of). Dept. of Materials Science; Suh, Jin-Yoo; Jung, Woo-Sang [Korea Institute of Science and Technology, Seoul (Korea, Republic of). Materials and Devices Div.
2010-07-01
The effect of creep deformation on the microstructural development of an 11CrMoVNb ferritic heat resistant steel during high temperature creep test is investigated. Coarsening behavior of the precipitates, M{sub 23}C{sub 6} and MX, and growth behavior of martensite laths of crept specimens are carefully observed from both gage and grip parts of the specimens in order to discuss the effect of deformation. Particle coarsening and martensite lath widening are pronounced in the gage part due to the creep deformation. (orig.)
TRAC-PF1 analysis of LOFT steam-generator feedwater transient test L9-1
International Nuclear Information System (INIS)
Meier, J.K.
1983-01-01
The Transient Reactor Analysis Code (TRAC-PF1) calculations were compared to test data from Loss-of-Fluid Test (LOFT) L9-1, which was a loss-of-feedwater transient. This paper includes descriptions of the test and the TRAC input and compares the TRAC-calculated results with the test data. We conclude that the code predicted the experiment well, given the uncertainties in the boundary conditions. The analysis indicates the need to model all the flow paths and heat structures, and to improve the TRAC wall condensation heat-transfer model
9 CFR 91.15 - Inspection of animals for export.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Inspection of animals for export. 91.15 Section 91.15 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS...
9 CFR 91.16 - Certification of animals for export.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Certification of animals for export. 91.16 Section 91.16 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS...
Energy Technology Data Exchange (ETDEWEB)
Dobrzanski, Janusz; Zielinski, Adam [Institute for Ferrous Metallurgy, Gliwice (Poland); Pasternak, Jerzy [Boiler Engineering Company RAFAKO S.A., Raciborz (Poland)
2010-07-01
The continuously developing power generation sector, including boilers with supercritical parameters, requires applications of new creep-resistant steel grades for construction of boilers steam superheater components. This paper presents selected information, experience within the field of research and implementation of a new group of creep-resistant as X10CrMoVNb9-1(P91), X10CrWMoVNb9-2(P92) and X12CrCoWVNb12-2-2(VM12) grades, containing 9-12%Cr. During welding and examination process the results of mechanical properties, requested level for base material and welded joints, as well as: tensile strength, impact strength and technological properties have been evaluated. Additional destructive examinations, with evaluation of structure stability, hardness distribution, for base material and welded joints after welding, heat treatment, again process have been determined. Recommendations due to the implementation influence of operating parameters of the main boiler components are part of this paper. (orig.)
’n Retoriese analise van Romeine 9:1–10:4
Directory of Open Access Journals (Sweden)
A.H. (Andries Snyman
2015-06-01
Full Text Available Die artikel is ’n poging om Paulus se retoriese strategie uit die teks self te rekonstrueer, eerder as om ’n klassieke of moderne retoriese model op die teks toe te pas. ’n Voorstel virso ’n teksgesentreerde benadering word kortliks opgesom, gevolg deur ’n beskrywing van die retoriese situasie wat Paulus in die brief wil ondersoek. Daar word geargumenteer dat Romeine 9:1–10:4 ’n integrale deel van Paulus se retoriese strategie vorm met die doel om sy gehoor te oortuig om sy siening van God se verlossingsplan, asook sy beoogde sending na Spanje te steun. In die proses van oorreding gebruik hy verskillende soorte argumente en retoriese tegnieke om die trefkrag van sy kommunikasie te verhoog. Die gevolgtrekkingis dat ’n teksgesentreerde benadering (met fokus op die funksionele aspekte van die teks ’n beter alternatief as die bestaande benaderings (met fokus op die formele aspekte van die teks bied. A rhetorical analysis of Romans 9:1-10:4. This article is an attempt to reconstruct Paul’s rhetorical strategy from the text itself, rather than applying ancient or modern rhetorical models to his letters. A proposal for such a text-centred approach is briefly summarised, followed by a discussion of the rhetorical situation that Paul wants to address in this letter. It is argued that Romans 9:1–10:4 forms an integral part of his rhetorical strategy, aimed at persuading his audience in Rome to support his view on God’s plan of salvationas well as his forthcoming mission to Spain. In the process of persuasion Paul uses various types of argument and rhetorical techniques to enhance the impact of his communication.The conclusion is that a text-centred approach (with its focus on the functional aspects of the text provides a better alternative to existing approaches (which focus on the formal aspects of the text.
BETHSY 9.1b Test Calculation with TRACE Using 3D Vessel Component
International Nuclear Information System (INIS)
Berar, O.; Prosek, A.
2012-01-01
Recently, several advanced multidimensional computational tools for simulating reactor system behaviour during real and hypothetical transient scenarios were developed. One of such advanced, best-estimate reactor systems codes is TRAC/RELAP Advanced Computational Engine (TRACE), developed by the U.S. Nuclear Regulatory Commission. The advanced TRACE comes with a graphical user interface called SNAP (Symbolic Nuclear Analysis Package). It is intended for pre- and post-processing, running codes, RELAP5 to TRACE input deck conversion, input deck database generation etc. The TRACE code is still not fully development and it will have all the capabilities of RELAP5. The purpose of the present study was therefore to assess the 3D capability of the TRACE on BETHSY 9.1b test. The TRACE input deck was semi-converted (using SNAP and manual corrections) from the RELAP5 input deck. The 3D fluid dynamics within reactor vessel was modelled and compared to 1D fluid dynamics. The 3D calculation was compared both to TRACE 1D calculation and RELAP5 calculation. Namely, the geometry used in TRACE is basically the same, what gives very good basis for the comparison of the codes. The only exception is 3D reactor vessel model in case of TRACE 3D calculation. The TRACE V5.0 Patch 1 and RELAP5/MOD3.3 Patch 4 were used for calculations. The BETHSY 9.1b test (International Standard Problem no. 27 or ISP-27) was 5.08 cm equivalent diameter cold leg break without high pressure safety injection and with delayed ultimate procedure. BETHSY facility was a 3-loop replica of a 900 MWe FRAMATOME pressurized water reactor. For better presentation of the calculated physical phenomena and processes, an animation model using SNAP was developed. In general, the TRACE 3D code calculation is in good agreement with the BETHSY 9.1b test. The TRACE 3D calculation results are as good as or better than the RELAP5 calculated results. Also, the TRACE 3D calculation is not significantly different from TRACE 1D
Zhang, Bing; Cavallaro, Antonio S; Mody, Karishma T; Zhang, Jun; Deringer, James R; Brown, Wendy C; Mahony, Timothy J; Yu, Chengzhong; Mitter, Neena
2016-11-05
Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale . Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris . When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm), 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.
Search for the sources of the solar wind in the 9.1 cm brightness temperature
International Nuclear Information System (INIS)
George, R.G.
1975-01-01
The sources of solar wind streams have been the object of intensive research for many years, but the various ideas of where and how streams originate on the sun are still incomplete and contradictory. The present study is an attempt to find the solar wind sources by mathematically approximating the 9.1 cm brightness temperature which would be expected at the foot of spacecraft-measured solar wind streams and by then comparing it with actual radio brightness temperature measurements. Several significant results were found from an analysis of the correlation results. Most plasma emanating from the sun was found to come from high solar latitudes and to deviate significantly from the normally expected east-west path in the low corona. Magnetic channelng causes correlation studies to fail when the sun's magnetic configuration is unstable. The travel time of the plasma from the sun's 9.1 cm emission level to the earth is often more than a month
International Nuclear Information System (INIS)
Serna, J A; Afanador, W
2001-01-01
In ECOPETROL-ICP was carried out an evaluation of the mechanical and micro structural properties of modified 9 Cr-1 Mo alloy, ASTM A-335 Gr. P91, finding higher strength mechanical properties, allowable stresses and creep rupture strength, than the conventional 9 Cr-1 Mo alloy, ASTM A-335 Gr. P9, recommending the alloy P91 as substitute tube material in the radiation zone of the Visbreaking heater of Cartagena's refinery (furnace in revamping process). The results obtained permit a thickness reduction of radiation tubes of material P91 close to 25% and increase the internal volume tube over up 8%, which is a parameter to consider in improving productivity and efficiency process. Also would be obtained a significant savings cost in the material among 5 and 10%. Additionally, expectations of both design and remaining useful life would be seen extensively favored with this change of alloy
Proto-planetary nebulae. I. The extreme bipolar nebulae M2-9 and M1-91
International Nuclear Information System (INIS)
Goodrich, R.W.
1991-01-01
Results are presented on a long-slit optical spectroscopy measurements of the prototype bipolar planetary nebula M2-9 and the M1-91 bipolar nebula, performed in order to determine the nature of the morphology of the wings of these two nebulae. It is concluded that the overall bipolar morphologies of these nebulae might be due to the orbital motions of binaries, with the orbital angular momentum vector defining the axis of the nebula. Secondary symmetries in the nebulae, such as the point-symmetric knots in M1-91, could be due to other symmetries, such as the rotation axis of one of the individual stars or the polar axis of the accretion disk. 39 refs
Directory of Open Access Journals (Sweden)
Bing Zhang
2016-11-01
Full Text Available Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale. Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris. When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm, 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.
Metabolism of 7-ethoxycoumarin, flavanone and steroids by cytochrome P450 2C9 variants.
Uno, Tomohide; Nakano, Ryosuke; Kanamaru, Kengo; Takenaka, Shinji; Uno, Yuichi; Imaishi, Hiromasa
2017-11-01
CYP2C9 is a human microsomal cytochrome P450c (CYP). Much of the variation in CYP2C9 levels and activity can be attributed to polymorphisms of this gene. Wild-type CYP2C9 and mutants were coexpressed with NADPH-cytochrome P450 reductase in Escherichia coli. The hydroxylase activities toward 7-ethoxycoumarin, flavanone and steroids were examined. Six CYP2C9 variants showed Soret peaks (450 nm) typical of P450 in reduced CO-difference spectra. CYP2C9.38 had the highest 7-ethoxycoumarin de-ethylase activity. All the CYP2C9 variants showed lower flavanone 6-hydroxylation activities than CYP2C9.1 (the wild-type). CYP2C9.38 showed higher activities in testosterone 6β-hydroxylation, progesterone 6β-/16α-hydroxylation, estrone 11α-hydroxylation and estradiol 6α-hydroxylation than CYP2C9.1. CYP2C9.40 showed higher testosterone 17-oxidase activity than CYP2C9.1; CYP2C9.8 showed higher estrone 16α-hydroxylase activity and CYP2C9.12 showed higher estrone 11α-hydroxylase activity. CYP2C9.9 and CYP2C9.10 showed similar activities to CYP2C9.1. These results indicate that the substrate specificity of CYP2C9.9 and CYP2C9.10 was not changed, but CYP2C9.8, CYP2C9.12 and CYP2C9.40 showed different substrate specificity toward steroids compared with CYP2C9.1; and especially CYP2C9.38 displayed diverse substrate specificities towards 7-ethoxycoumarin and steroids. Copyright © 2017 John Wiley & Sons, Ltd.
Kim, Sang-Woo; Nishimura, Jun; Tsuchiya, Asato
2012-01-06
We reconsider the matrix model formulation of type IIB superstring theory in (9+1)-dimensional space-time. Unlike the previous works in which the Wick rotation was used to make the model well defined, we regularize the Lorentzian model by introducing infrared cutoffs in both the spatial and temporal directions. Monte Carlo studies reveal that the two cutoffs can be removed in the large-N limit and that the theory thus obtained has no parameters other than one scale parameter. Moreover, we find that three out of nine spatial directions start to expand at some "critical time," after which the space has SO(3) symmetry instead of SO(9).
2010-04-01
... relating to payment of tax by credit card and debit card. 301.6103(k)(9)-1 Section 301.6103(k)(9)-1... Disclosure of returns and return information relating to payment of tax by credit card and debit card... processing credit card and debit card transactions to effectuate payment of tax as authorized by § 301.6311-2...
Low temperature friction stir welding of P91 steel
Directory of Open Access Journals (Sweden)
Prasad Rao Kalvala
2016-08-01
Full Text Available Bead-on-plate friction stir welds were made on P91 alloy with low and high rotational speeds (100 and 1000 RPM to study their effects on weld microstructural changes and impression creep behavior. Temperatures experienced by the stir zone were recorded at the weld tool tip. Different zones of welds were characterized for their microstructural changes, hardness and creep behavior (by impression creep tests. The results were compared with submerged arc fusion weld. Studies revealed that the stir zone temperature with 100 RPM was well below Ac1 temperature of P91 steel while it was above Ac3 with 1000 RPM. The results suggest that the microstructural degradation in P91 welds can be controlled by low temperature friction stir welding technique.
Recommendations for joint fatigue coefficients for welded P91 junctions at 550 °C
Energy Technology Data Exchange (ETDEWEB)
Matheron, P., E-mail: philippe.matheron@cea.fr; Aiello, G.; Ancelet, O.; Forest, L.
2016-04-15
Modified 9Cr1Mo steels are potential candidates as structural materials of GEN-IV nuclear reactors. Since the design of structural components is influenced by the presence of the welds, their mechanical properties are also included in the design codes. In the European code RCC-MRx, a weld is considered as a homogeneous (base metal) component with a margin coefficient, called weld coefficient. Currently no values of joint fatigue coefficients for P91 junctions are given in RCC-MRx. After a recall of the weld design rules contained in the code, this work presents the experimental activities carried out to characterize the fatigue behaviour of TIG welded P91 junctions at high temperatures. Finite elements calculations were performed on the basis of the characterization of the base and weld metal. The results of the tests validate the numerical results. Values of the weld joint fatigue coefficients for P91 are proposed for possible inclusion in RCC-MRx.
Creep and creep fatigue crack behavior of 1Cr- and 9Cr-steels
International Nuclear Information System (INIS)
Maile, K.; Klenk, A.; Schellenberg, G.; Granacher, J.; Tramer, M.
2000-01-01
A large database for creep crack initiation and propagation under constant load conditions is available on conventional power plant steels of types 1%Cr and 12%Cr. Modern plants are often used in the medium and peak load regime, thus the dominant loading situation in high temperature components is creep fatigue. For life assessment data about crack initiation and growth under creep fatigue loading are required. These characteristics can not be substituted by pure fatigue or creep crack data. Therefore, a comprehensive test programme was started to investigate the creep fatigue crack behaviour of a 1%CrMoNiV turbine rotor steel (30CrMoNiV 4 11) at 550 C and a new 9%CrMoVNb pipe steel (type P 9 1) at 600 C. DENT-specimen with 15 and 60 mm thickness as well as side grooved CT-specimen with 25 and 50 mm thickness have been tested to determine possible influences of geometry and thus to check the transferability of the data to components. The creep fatigue crack growth results of tests with dwell times between t H = 0,32h and 10 h lie in the scatterbands given by creep crack growth results. Nevertheless a higher crack growth rate under creep fatigue conditions can be stated. An increase in crack growth rate due to creep fatigue is clearly visible. Loading situations with frequencies higher than 1.10 -4 Hz should be not assessed with pure creep crack results or sufficient safety margins have to be applied. (orig.)
Influence of heat treatment on microstructure and properties of GX12CrMoVNbN9-1 cast steel
Directory of Open Access Journals (Sweden)
G. Golański
2010-07-01
Full Text Available The paper presents results of research on the influence of multistage heat treatment on microstructure and properties of high-chromiummartensitic GX12CrMoVNbN9 – 1 (GP91 steel. The material under investigation were samples taken out from a test coupon. Heattreatment of GP91 cast steel was performed at the parameters of temperature and time typical of treatment for multi-ton steel casts. The research has proved that in the as-received condition (as-cast state GP91 cast steel was characterized by a coarse grain, martensitic microstructure which provided the required standard mechanical properties. The heat treatment of GP91 cast steel contributed to obtainment of a fine grain microstructure of high tempered martensite with numerous precipitations of carbides of diverse size. The GP91 cast steel structure received through heat treatment made it possible to obtain high plastic properties, particularly impact strength, maintaining strength properties on the level of the required minimum.
Fatigue Resistance of GX12CrMoVNbN9-1 Cast Steel after Ageing Process
Directory of Open Access Journals (Sweden)
Stanisław MROZIŃSKI
2014-12-01
Full Text Available In the present paper, low cycle fatigue behaviour of GX12CrMoVNbN9-1 (GP91 cast steel is presented. Fatigue tests were performed under isothermal conditions at room temperature and at 550 and 600oC, on five levels of total strain amplitude value ɛac = 0.25÷0.60%. The cast steel subject to investigation was in the as-received condition (after heat treatment and after 8000 hours of ageing at the temperature of 600oC. Performed research has shown an insignificant influence of the ageing process on mechanical properties of GP91 cast steel, determined with the static test of tension. Analysis of the performed tests has proved that GP91 cast steel in the as-received condition and after ageing process was characterized by strong cyclic softening without a clear period of stabilization of the hysteresis loop parameters. The fatigue lifetime curves at each temperature were obtained based on Basquin and Coffin – Manson equations. The process of ageing of GP91 cast steel contributed to a decrease in its fatigue life Nf from a few to a few dozen percent, and the level of fatigue life was dependent on the value of strain amplitude ɛac. It has also been stated that the fatigue life Nf of GP91 cast steel is determined by its plastic properties, and the degree of changes in fatigue life Nf was dependent not only on the temperature of testing, but also on the value of strain amplitude ɛac. DOI: http://dx.doi.org/10.5755/j01.ms.20.4.6077
9 %-chromium steel P91 and P92 in German power plants. From 1991 to the present day
Energy Technology Data Exchange (ETDEWEB)
Bader, Mirko; Thuemer, Joerg Rainer; Glasenapp, Klaus [E.ON Anlagenservice GmbH, Gelsenkirchen (Germany)
2013-09-01
P91 and P92 are the top players in the field of high-pressure piping in modern coal-fired and CCGT power plants. A long-term testing phase and a step-by-step introductory phase since the nineties had preceded current application. For this reason, a review and overview of the first installation in German power plants and the experience acquired from almost 20 years' operating time of USC boilers in medium-load operation mode will be presented. With a view to the newly built power plants, the focal point changes to P92 for high-temperature pressure tubing. In this context the technical experiences were used in the material qualification process and the design of new component. (orig.)
International Nuclear Information System (INIS)
Grundmann, M.; Borgstedt, H.U.; Schirra, M.
1988-01-01
One of the candidate structural materials for the NET blanket is the martensitic steel X18 CrMoVNb 12 1 (no.1.4914). Its compatibility with the molten eutectic Pb-17Li, which might be used as liquid breeder and coolant in a self-cooled liquid metal blanket, should be satisfying even under superimposed mechanical stress. The mechanical high-temperature strength of the steel should not be significantly reduced by the interaction with the liquid metal which is in close contact with the surface of the components of such a blanket. The corrosion behaviour of this steel in flowing Pb-17Li eutectic is also studied, results will be presented at this conference. A certain influence of a liquid metal environment on the creep-rupture behaviour of steels was observed earlier in a study on the mechanical properties of austenitic stainless steel in liquid sodium. Therefore, a test programme was initiated to evaluate the effects of liquid Pb-17Li alloy on the creep strength of the steel no. 1.4914. Liquid lithium environment showed an influence on the fracture of this material in short time tests at moderate temperature
9.1-T iron-free Nb-Ti dipole magnet with pancake windings
International Nuclear Information System (INIS)
Gilbert, W.; Caspi, S.; Hassenzahl, W.; Meuser, R.; Peters, C.; Rechen, J.; Schafer, R.; Taylor, C.; Wolgast, R.
1983-03-01
An eight-pancake Nb-Ti dipole magnet, with bent up ends, called D-108B has been built and tested. This magnet is a Nb-Ti version of a Nb 3 Sn magnet designed to produce a 10-tesla dipole field in a 40 mm diameter aperture. The pancack design is used for the heavy 12,000 ampere Nb 3 Sn cable because of the mechanical difficulty in winding such a heavy cable into the conventional nested cylindrical shell configuration with a 2'' inner winding diameter. The Nb-Ti version operates at 1.8K, in He II, has superconducting cable half as thick as the Nb 3 Sn cable, and operates at half the operating current: 6000 A rather than 12,000 A at 10 tesla. Both magnets are approximately one meter long. D-10B was tested from January 26 to February 2, 1983 and reached short-sample performance in both He I and He II after moderate training. The central field at 4.3K is 7.0 (+- 0.1) tesla, and at 1.8K is 9.1 (+- 0.2) tesla. Ramp rate sensitivity and cyclic heating data were also measured
Transcription factors Asg1p and Hal9p regulate pH homeostasis in Candida glabrata
Directory of Open Access Journals (Sweden)
Jing eWu
2015-08-01
Full Text Available Candida glabrata is an important microorganism used in commercial fermentation to produce pyruvate, but very little is known about its mechanisms for surviving acid stress in culture. In this study, it was shown that transcription factors Asg1p and Hal9p play essential roles in C. glabrata in the tolerance of acid stress, as the deletion of CgASG1 or CgHAL9 resulted in the inability to survive in an acidic environment. Cgasg1 and Cghal9 mutant strains are unable to maintain pH homeostasis, as evidenced by a decrease in intracellular pH and an increase in reactive oxygen species production, which results in metabolic disorders. The results showed that intracellular acidification was partly due to the diminished activity of the plasma membrane proton pump, CgPma1p. In addition, transcriptome sequencing revealed that Cgasg1 and Cghal9 mutant strains displayed a variety of changes in gene expression under acidic conditions, including genes in the MAPK signaling pathway, plasma membrane or cell wall organization, trehalose accumulation, and the RIM101 signaling pathway. Lastly, quantitative reverse-transcribed PCR and cellular localization showed that CgAsg1p and CgHal9p played independent roles in response to acid stress.
Energy Technology Data Exchange (ETDEWEB)
Pandey, Chandan [Department of Mechanical and Industrial Engineering Indian Institute of Technology Roorkee, Uttarakhand 247667 (India); Mahapatra, M.M. [School of Mechanical Sciences, Indian Institute of Technology Bhubaneswar, Odisha 751013 (India); Kumar, Pradeep; Saini, N. [Department of Mechanical and Industrial Engineering Indian Institute of Technology Roorkee, Uttarakhand 247667 (India)
2017-02-08
In Very High Temperature Reactor (VHTR), The Nb-V modified 9Cr-1Mo (P91) creep strength enhanced ferritic (CSEF) steel is currently considered as a candidate material for reactor internals and reactor pressure vessels (RPVs). After the welding of P91 steel, the inhomogeneous microstructure of weldment is a serious issue because it promotes the well-known Type IV cracking in P91 weldments. The present research work is focused on how the microstructure evolve in various zone of P91 pipe weldment during the sub-critical post weld heat treatment (PWHT) and normalized and tempered (N&T) heat treatment. The effect of PWHT and N&T heat treatment are also considered on tensile properties and hardness variation of P91 weldments. To characterize the sample scanning electron microscope (SEM), X-ray diffraction (XRD) and optical micrograph was used. It was observed that the N&T heat treatment provides the homogeneous microstructure compared to PWHT. The superior mechanical properties was also measured in N&T condition compared to PWHT. Study of fracture surface morphology of tensile tested specimen in different heat treatment condition is also presented.
International Nuclear Information System (INIS)
Pandey, Chandan; Mahapatra, M.M.; Kumar, Pradeep; Saini, N.
2017-01-01
In Very High Temperature Reactor (VHTR), The Nb-V modified 9Cr-1Mo (P91) creep strength enhanced ferritic (CSEF) steel is currently considered as a candidate material for reactor internals and reactor pressure vessels (RPVs). After the welding of P91 steel, the inhomogeneous microstructure of weldment is a serious issue because it promotes the well-known Type IV cracking in P91 weldments. The present research work is focused on how the microstructure evolve in various zone of P91 pipe weldment during the sub-critical post weld heat treatment (PWHT) and normalized and tempered (N&T) heat treatment. The effect of PWHT and N&T heat treatment are also considered on tensile properties and hardness variation of P91 weldments. To characterize the sample scanning electron microscope (SEM), X-ray diffraction (XRD) and optical micrograph was used. It was observed that the N&T heat treatment provides the homogeneous microstructure compared to PWHT. The superior mechanical properties was also measured in N&T condition compared to PWHT. Study of fracture surface morphology of tensile tested specimen in different heat treatment condition is also presented.
Prediction of residual stresses induced by TIG welding of a martensitic steel (X10CrMoVNb9-1)
International Nuclear Information System (INIS)
Roux, G.M.
2007-11-01
Within the frame of the development of very high temperature nuclear reactors (VHTR) with gas as heat transfer fluid, some technological challenges are to be faced because of these high temperatures, notably the selection of the material used for the reactor vessel and its welding process. This research thesis aims at developing and validating numerical tools and behaviour models for the thermal-metallurgical-mechanical simulation of the multi-pass TIG welding process. The first part describes the development of simple welding tests (Disk-Spot and Disk-Cycle), the use of temperature and displacement measurement during these tests, and deep residual stress measurements, as well as the identification of the thermal limit conditions for the Disk-Spot test. It then discusses the choice and the identification of the thermal-metallurgical-mechanical behaviour model, with a particular attention to phase transformations and to their coupling with thermal and mechanical aspects. Experimental and simulation results are compared, notably in terms of residual stresses. The numerical implementation of the behaviour model and its integration into the CAST3M finite element software are also described
Directory of Open Access Journals (Sweden)
Kusmoko Alain
2016-01-01
Full Text Available Stellite 6 was deposited by laser cladding on a P91 substrate with energy inputs of 1 kW (P91-1 and 1.8 kW (P91–1.8. The chemical compositions, microstructures and surface roughnesses of these coatings were characterized by atomic absorption spectroscopy, scanning electron microscopy and atomic force microscopy. The microhardness of the coatings was measured and the wear mechanism of the coatings was evaluated using a pin-on-plate (reciprocating wear testing machine. The results showed less cracking and pore development for Stellite 6 coatings applied to the P91 steel substrate with the lower heat input (P91–1. Further, the Stellite coating for P91-1 was significantly harder than that obtained for P91–1.8. The wear test results indicated that the weight loss for P91–1 was much lower than for P91–1.8. The surface topography data indicated that the surface roughness for P91-1 was much lower than for P91–1.8. The measurements of dilution and carbon content showed that P91–1 has lower dilution and higher concentration of carbon than P91–1.8. It is concluded that the lower hardness of the coating for P91–1.8, together with the softer underlying substrate structure, markedly reduced the wear resistance of the Stellite 6 coating and the lower hardness of the coating for P91-1.8 was due to higher level of dilution and lower concentration of carbon.
{sup 91}Nb(p,γ) or there and back again
Energy Technology Data Exchange (ETDEWEB)
Thomas, Benedikt; Glorius, Jan; Reich, Markus; Reifarth, Rene; Sonnabend, Kerstin [Goethe University Frankfurt a.M. (Germany); Blazhev, Andrey; Zell, Karl-Oscar [University of Cologne (Germany); Dressler, Rugard; Schumann, Dorothea [Paul-Scherrer Institute, Villigen (Switzerland); Giesen, Ulrich [Physikalisch-Technische Bundesanstalt, Braunschweig (Germany); Kritcka, Milan [Charles University, Prague (Czech Republic)
2016-07-01
The cross section of the reaction {sup 91}Nb(p,γ){sup 92}Mo is of special interest to answer questions about the production of the most abundant p nucleus {sup 92}Mo. With {sup 91}Nb being a radioactive nucleus the measurement of this reaction in standard kinematics is a big challenge. To produce a sufficient number of {sup 91}Nb isotopes an enriched {sup 92}Mo target was activated by protons at E{sub p} = 19 MeV. Afterwards the produced {sup 91}Nb isotopes are separated chemically and applied onto a tungsten backing. This leads to approximately 10{sup 16} {sup 91}Nb isotopes. The high proton current delivered by the HF-linear-accelerator FRANZ currently built at Goethe University Frankfurt, Germany, enables the execution of measurement with such limited amount of target material. The goal of our investigation is the determination of the cross section of the {sup 91}Nb(p,γ){sup 92}Mo reaction at 2 MeV proton energy and thereby in the astrophysical relevant energy region. We present the current status and the next steps towards the measurement of this cross section.
A 9.1-T iron-free Nb- Ti dipole magnet with pancake windings
International Nuclear Information System (INIS)
Gilbert, W.; Caspi, S.; Hassenzahl, W.; Meuser, R.; Peters, C.; Rechen, J.; Schafer, R.; Taylor, C.; Wolgast, R.
1983-01-01
An eight-pancake Nb-Ti dipole magnet with bent-up ends and called D-10B has been built and tested. This magnet is a Nb-Ti version of a Nb 3 Sn magnet designed to produce a 10-tesla dipole field in a 40 mm diameter aperture. The pancake design is used for the heavy 12,000 ampere Nb 3 Sn cable because of the mechanical difficulty in winding such a heavy cable into the conventional nested cylindrical shell configuration with a 2'' inner winding diameter. The Nb-Ti version operates at 1.8 K in helium II, has superconducting cable half as thick as the Nb 3 Sn cable, and operates at half the current (6,000 amperes) at 10 tesla. Both magnets are approximately one meter long. D-10B was tested from January 26 to February 2, 1983, and reached short-sample performance in both helium I and helium II after moderate training. The central field at 4.3 K is 7.0 tesla and at 1.8 K is 9.1 tesla. Ramp rate sensitivity and cyclic heating data were also measured
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Authority. 91.1 Section 91.1 Money... THE BUREAU OF THE MINT BUILDINGS AND GROUNDS § 91.1 Authority. The regulations in this part governing....S. Bullion Depository, West Point, New York; are promulgated pursuant to the authority vested in the...
Thermodynamics of complexes formation by ITC in methanol/water = 9/1 (v/v) solution: A case study
Energy Technology Data Exchange (ETDEWEB)
Fisicaro, Emilia, E-mail: emilia.fisicaro@unipr.it [University of Parma, Department of Pharmacy, Parco Area delle Scienze, 27/A, 43124 Parma (Italy); Compari, Carlotta; Bacciottini, Franco; Contardi, Laura [University of Parma, Department of Pharmacy, Parco Area delle Scienze, 27/A, 43124 Parma (Italy); Carcelli, Mauro; Rispoli, Gabriele; Rogolino, Dominga [University of Parma, Department of Chemistry, Parco Area delle Scienze, 17/A, 43124 Parma (Italy)
2014-06-01
Graphical abstract: Integrase strand transfert inhibitors chelate the metal ions in the active site of HIV integrase. - Highlights: • Development of inhibitors acting against those viral enzymes operating via a cooperative two-metal ion mechanism, such as HIV integrase (IN), requires optimizing the binding affinity to the target. • We have defined an experimental procedure for obtaining reliable thermodynamic data by ITC in methanol/water = 9/1 (v/v) as solvent. • Formation heats in mixed solvent of the complexes formed by a ligand, model of Raltegravir, with Mg(II), Mn(II), Co(II) and Zn(II) are here reported. - Abstract: Most enzymes that participate in the biochemistry of nucleic acids require divalent metal ion cofactors to promote activity. Development of potent inhibitors, acting against those viral enzymes operating via a cooperative two-metal ion mechanism, such as HIV integrase (IN) and RNase H, hepatitis C virus polymerase and influenza endonuclease, requires optimizing the binding affinity to the target, which is dictated by the binding free energy composed of both enthalpic and entropic contributions. They can be obtained by using isothermal titration microcalorimetry. We have defined an experimental procedure for obtaining reliable thermodynamic data in methanol/water = 9/1 0.1 M KCl as solvent, used to overcome solubility problems. In this way we have measured the heats of formation of the complexes formed by N-(4-fluorobenzyl)-5-hydroxy-2-isopropyl-1-methyl-6-oxo-1, 6-dihydroxypyrimidine-4-carboxylate (HL, a model of Raltegravir, the antiretroviral drug produced by Merck and Co.), and a series of divalent metal ions of biological interest (Mg(II), Mn(II), Co(II) and Zn(II)), whose speciation was previously determined by potentiometry.
Internal friction studies on dynamic strain aging in P91 ferritic steel
International Nuclear Information System (INIS)
Zhou, Hongwei; Fang, Junfei; Chen, Yan; Yang, Lei; Zhang, Hui; Lu, Yun; He, Yizhu
2016-01-01
The temperature of dynamic strain aging (DSA) regime in P91 steel is between 523 K and 773 K. The activation energy (Q) for onset of DSA is 73 kJ/mol, while that for finale of DSA is 202 kJ/mol. Two main Internal friction (IF) speaks were observed, Snoek and SKK with the activation energy of 67.9 kJ/mol and 121 kJ/mol, respectively. IF shows that activation energy of 73 kJ/mol is equal to that of C atom body diffusion in α-Fe, and 202 kJ/mol is equal to binding energy between C atoms and moving dislocations. These results confirm that the mechanism of DSA can be explained by the diffusion of C atoms and pinning between C and moving dislocation. These investigations indicate that DSA in P91 steel is resulted from C atom diffusion, instead of Cr or Mo atoms.
Creep damage development in welded X20 and P91
Energy Technology Data Exchange (ETDEWEB)
Brett, Steve; Holmstrom, Stefan; Hald, John; Borg, Ulrik; Aakjaer Jensen, Soeren; Vulpen, Rijk Van; Degnan, Craig; Vinter Dahl, Kristian; Vilhelmsen, Tommy
2011-03-15
The Martensitic steel X20CrMoV121 (hereinafter called X20) and the modified 9Cr1Mo steel (hereinafter called P91) have been used for a number of years in high temperature applications since they posses superior creep strength compared to low alloyed steels. Due to the simple fact that very few failures were observed, almost no knowledge as to the evolution of creep damage in welds were available despite long operation times exceeding well over 100.000 hours. It has been suggested that X20 will develop creep damage in a different manner compared to low alloyed steel, i.e damage initiation should be slow followed by accelerated growth. The research work presented in this report included systematic investigations of the first components of X20, which has developed creep during long-term operation. All of the investigated components showed creep damage evolution similar to low alloy steels
International Nuclear Information System (INIS)
Chellapandi, P.; Ramesh, R.; Chetal, S.C.; Bhoje, S.B.
1997-01-01
Modified 9Cr 1Mo (grade 91) is the structural material for the SG of 500 MWe Prototype Fast Breeder Reactor. This material is codified in RCC-MR (1993). SG top tubesheet and its connecting shell see the hot sodium temperature of about 800 K. The steam temperature is about 770 K at 17 MPa. It is envisaged that this component can meet the creep fatigue damage rules of RCC-MR with 'elastic route' itself. One of the important material data needed to use the simplified rules given in RCC-MR (1993) is 'symmetrization coefficient' (Ks) which is not yet included in RCC-MR. Ks values are established from numerous stress strain cyclic data generated theoretically by using Chaboche viscoplastic model and recommended for the inclusion in the RCC-MR. The Chaboche model for grade 91 material has 20 material parameters which are identified based on the uniaxial monotonic and cyclic data available in RCC-MR (1993) as well as the published data and many uniaxial monotonic, cyclic, creep data are compared well with the predictions. (author). 4 refs, 21 figs, 2 tabs
Weldability investigation steel P 91 by weld thermal cycle simulation
Directory of Open Access Journals (Sweden)
M. Dunđer
2015-07-01
Full Text Available This paper elaborates results of hardness and impact energy of thermal cycle simulated specimens of high-alloy steel P 91 and their dependence on cooling time from 800 to 500 °C. Results were obtained by measuring hardness HV 1 and by experimental testing of Charpy notched specimens. Metallographic analysis of samples was performed on scanning electronic microscope.
pH-dependent inhibition of K2P3.1 prolongs atrial refractoriness in whole hearts
DEFF Research Database (Denmark)
Skarsfeldt, Mark A; Jepps, Thomas A; Bomholtz, Sofia H
2016-01-01
In isolated human atrial cardiomyocytes, inhibition of K2P3.1 K(+) channels results in action potential (action potential duration (APD)) prolongation. It has therefore been postulated that K2P3.1 (KCNK3), together with K2P9.1 (KCNK9), could represent novel drug targets for the treatment of atrial...... fibrillation (AF). However, it is unknown whether these findings in isolated cells translate to the whole heart. The purposes of this study were to investigate the expression levels of KCNK3 and KCNK9 in human hearts and two relevant rodent models and determine the antiarrhythmic potential of K2P3.1 inhibition...... displayed a more uniform expression of KCNK3 between atria and ventricle. In voltage-clamp experiments, ML365 and A293 were found to be potent and selective inhibitors of K2P3.1, but at pH 7.4, they failed to prolong atrial APD and refractory period (effective refractory period (ERP)) in isolated perfused...
Directory of Open Access Journals (Sweden)
Theo H M Smits
Full Text Available BACKGROUND: Pantoea vagans is a commercialized biological control agent used against the pome fruit bacterial disease fire blight, caused by Erwinia amylovora. Compared to other biocontrol agents, relatively little is currently known regarding Pantoea genetics. Better understanding of antagonist mechanisms of action and ecological fitness is critical to improving efficacy. PRINCIPAL FINDINGS: Genome analysis indicated two major factors Contribute to biocontrol activity: competition for limiting substrates and antibacterial metabolite production. Pathways for utilization of a broad diversity of sugars and acquisition of iron were identified. Metabolism of sorbitol by P. vagans C9-1 may be a major metabolic feature in biocontrol of fire blight. Biosynthetic genes for the antibacterial peptide pantocin A were found on a chromosomal 28-kb genomic island, and for dapdiamide E on the plasmid pPag2. There was no evidence of potential virulence factors that could enable an animal or phytopathogenic lifestyle and no indication of any genetic-based biosafety risk in the antagonist. CONCLUSIONS: Identifying key determinants contributing to disease suppression allows the development of procedures to follow their expression in planta and the genome sequence contributes to rationale risk assessment regarding the use of the biocontrol strain in agricultural systems.
International Nuclear Information System (INIS)
Foroozani, N.; Lim, J.; Li, L.; Cao, G.; Schilling, J.S.
2013-01-01
Non-Fermi-liquid behavior and close proximity to a quantum critical point in the 5d transition metal iridate SrIrO 3 at ambient pressure motivate our search for possible anomalous behavior in its transport properties under pressure. The electrical resistivity in the ab-plane of a single crystal of SrIrO 3 has been measured over the temperature range 1.35–285 K at both ambient and 9.1 kbar hydrostatic pressure. The resistivity decreases slightly over the entire temperature range, but no superconducting transition or changes in the non-Fermi-liquid behavior are observed under pressure. It is estimated that significantly higher pressures are likely required before sizable changes in the properties of SrIrO 3 will occur.
Baron, N.; Leonard, R. F.; Stewart, W. M.; Fink, C. L.; Christensen, P. R.; Nickles, J.; Thorsteinsen, T. F.
1972-01-01
Deuterons of 13-MeV incident energy were scattered from Zr-92(d,p)Zr-93. The Zr-92(d,p)Zr-93 data analysis resulted in the location of 47 levels up to an excitation energy of 4.84 MeV, and the spins of 43 of these levels were identified. Essentially all the strength of the 2d5/2, 3s1/2, 2d3/2, and 1g7/2 shells was observed; and the excitation energy of their centroids was computed to be 0.00, 1.21, 2.23, and 2.37 MeV, respectively. Also, 43 percent of the 1h11/2 strength, 21 percent of the 2f7/2 strength, and 3 percent of the 3p3/2 strength were observed. In addition, the Zr-92(d,t)Zr-91 data analysis resulted in the location of 26 levels up to an excitation energy of 4.01 MeV, and the spins of 21 of these levels were identified. Most of the expected strength of the 2d5/2 and 1g9/2 shells was obtained, and the excitation energy of their centroids was computed to be 0.31 and 3.19 MeV, respectively. In addition, six l=1 states are populated belonging to either the 2p1/2 or 2p3/2 shells.
Singh, Akhilesh Kumar; Debnath, Tapas; Dey, Vidyut; Rai, Ram Naresh
2017-10-01
P-91 is modified 9Cr-1Mo steel. Fabricated structures and components of P-91 has a lot of application in power and chemical industry owing to its excellent properties like high temperature stress corrosion resistance, less susceptibility to thermal fatigue at high operating temperatures. The weld quality and surface finish of fabricated structure of P91 is very good when welded by Tungsten Inert Gas welding (TIG). However, the process has its limitation regarding weld penetration. The success of a welding process lies in fabricating with such a combination of parameters that gives maximum weld penetration and minimum weld width. To carry out an investigation on the effect of the autogenous TIG welding parameters on weld penetration and weld width, bead-on-plate welds were carried on P91 plates of thickness 6 mm in accordance to a Taguchi L9 design. Welding current, welding speed and gas flow rate were the three control variables in the investigation. After autogenous (TIG) welding, the dimension of the weld width, weld penetration and weld area were successfully measured by an image analysis technique developed for the study. The maximum error for the measured dimensions of the weld width, penetration and area with the developed image analysis technique was only 2 % compared to the measurements of Leica-Q-Win-V3 software installed in optical microscope. The measurements with the developed software, unlike the measurements under a microscope, required least human intervention. An Analysis of Variance (ANOVA) confirms the significance of the selected parameters. Thereafter, Taguchi's method was successfully used to trade-off between maximum penetration and minimum weld width while keeping the weld area at a minimum.
File list: InP.Bld.20.AllAg.M0-91 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Bld.20.AllAg.M0-91 hg19 Input control Blood M0-91 SRX262147,SRX262153,SRX262150...,SRX262144 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Bld.20.AllAg.M0-91.bed ...
File list: InP.Bld.10.AllAg.M0-91 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Bld.10.AllAg.M0-91 hg19 Input control Blood M0-91 SRX262150,SRX262147,SRX262153...,SRX262144 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Bld.10.AllAg.M0-91.bed ...
File list: InP.Bld.05.AllAg.M0-91 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Bld.05.AllAg.M0-91 hg19 Input control Blood M0-91 SRX262150,SRX262153,SRX262144...,SRX262147 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Bld.05.AllAg.M0-91.bed ...
MMP2 and MMP9 participate in S1P-induced invasion of follicular ML-1 thyroid cancer cells.
Kalhori, Veronica; Törnquist, Kid
2015-03-15
The bioactive lipid sphingosine-1-phosphate (S1P) has emerged as a potent inducer of cancer cell migration and invasion. Previously, we have shown that S1P induces invasion of ML-1 follicular thyroid cancer cells via S1P receptors 1 and 3 (S1P1,3). Matrix metalloproteinases (MMPs) are zinc-dependent proteolytic enzymes used by cells for degradation of the extracellular matrix during invasion and migration. In the present study, we examined the role of MMP2 and MMP9 for S1P-induced invasion of ML-1 cells, and found that S1P regulates the secretion and activity of MMP2 and MMP9 via S1P1,3. Both pharmacological inhibitors and siRNA knockdown of MMP2 and MMP9 could attenuate S1P-induced invasion. Additionally, we show that calpains and Rac1 mediate S1P-induced secretion of MMP2 and MMP9. In conclusion, MMP2 and MMP9 participate in S1P-evoked follicular ML-1 thyroid cancer cell invasion. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Karine Michaud
Full Text Available To study the presence of 9p deletion and p16, cyclin D1 and Myc expression and their respective diagnostic and prognostic interest in oligodendrogliomas.We analyzed a retrospective series of 40 consecutive anaplastic oligodendrogliomas (OIII from a single institution and compared them to a control series of 10 low grade oligodendrogliomas (OII. Automated FISH analysis of chromosome 9p status and immunohistochemistry for p16, cyclin D1 and Myc was performed for all cases and correlated with clinical and histological data, event free survival (EFS and overall survival (OS.Chromosome 9p deletion was observed in 55% of OIII (22/40 but not in OII. Deletion was highly correlated to EFS (median = 29 versus 53 months, p<0.0001 and OS (median = 48 versus 83 months, p<0.0001 in both the total cohort and the OIII population. In 9p non-deleted oligodendrogliomas, p16 hyperexpression correlated with a shorter OS (p = 0.02 in OII and p = 0.0001 in OIII whereas lack of p16 expression was correlated to a shorter EFS and OS in 9p deleted OIII (p = 0.001 and p = 0.0002 respectively. Expression of Cyclin D1 was significantly higher in OIII (median expression 45% versus 14% for OII, p = 0.0006 and was correlated with MIB-1 expression (p<0.0001, vascular proliferation (p = 0.002, tumor necrosis (p = 0.04 and a shorter EFS in the total cohort (p = 0.05. Hyperexpression of Myc was correlated to grade (median expression 27% in OII versus 35% in OIII, p = 0.03, and to a shorter EFS in 9p non-deleted OIII (p = 0.01.Chromosome 9p deletion identifies a subset of OIII with significantly worse prognosis. The combination of 9p status and p16 expression level identifies two distinct OIII populations with divergent prognosis. Hyperexpression of Bcl1 and Myc appears highly linked to anaplasia but the prognostic value is unclear and should be investigated further.
Parks, Scott K; Cormerais, Yann; Durivault, Jerome; Pouyssegur, Jacques
2017-02-07
Hypoxia and extracellular acidosis are pathophysiological hallmarks of aggressive solid tumors. Regulation of intracellular pH (pHi) is essential for the maintenance of tumor cell metabolism and proliferation in this microenvironment and key proteins involved in pHi regulation are of interest for therapeutic development. Carbonic anhydrase 9 (CA9) is one of the most robustly regulated proteins by the hypoxia inducible factor (HIF) and contributes to pHi regulation. Here, we have investigated for the first time, the role of CA9 via complete genomic knockout (ko) and compared its impact on tumor cell physiology with the essential pHi regulator Na+/H+ exchanger 1 (NHE1). Initially, we established NHE1-ko LS174 cells with inducible CA9 knockdown. While increased sensitivity to acidosis for cell survival in 2-dimensions was not observed, clonogenic proliferation and 3-dimensional spheroid growth in particular were greatly reduced. To avoid potential confounding variables with use of tetracycline-inducible CA9 knockdown, we established CA9-ko and NHE1/CA9-dko cells. NHE1-ko abolished recovery from NH4Cl pre-pulse cellular acid loading while both NHE1 and CA9 knockout reduced resting pHi. NHE1-ko significantly reduced tumor cell proliferation both in normoxia and hypoxia while CA9-ko dramatically reduced growth in hypoxic conditions. Tumor xenografts revealed substantial reductions in tumor growth for both NHE1-ko and CA9-ko. A notable induction of CA12 occurred in NHE1/CA9-dko tumors indicating a potential means to compensate for loss of pH regulating proteins to maintain growth. Overall, these genomic knockout results strengthen the pursuit of targeting tumor cell pH regulation as an effective anti-cancer strategy.
Direct interaction between CD91 and C1q
DEFF Research Database (Denmark)
Duus, Karen; Hansen, Erik W; Tacnet, Pascale
2010-01-01
. C1q binding to monocytes was shown to be correlated with CD91 expression and could be inhibited by the CD91 chaperone, receptor-associated protein. We also report data showing a direct interaction between CD91 and C1q. The interaction was investigated using various protein interaction assays....... A direct interaction between purified C1q and CD91 was observed both by ELISA and a surface plasmon resonance assay, with either C1q or CD91 immobilized. The interaction showed characteristics of specificity because it was time-dependent, saturable and could be inhibited by known ligands of both CD91 and C...
mPW1PW91 Calculated Conformational Study of Calix[n]arene (n = 4,5,6): Hydrogen Bond
International Nuclear Information System (INIS)
Kim, Kwang Ho; Choe, Jong In
2009-01-01
We have performed mPW1PW91 calculations to investigate the conformational characteristics and hydrogen bonds of p-tert-butylcalix[4]arene, p-tert-butylcalix[5]arene, calix[6]arene and p-tertbutylcalix[ 6]arene. The structures of the different conformers of 1-3 were optimized by using mPW1PW91/ 6-31+G(d,p) method. The relative stability of the four conformers of 1 is in the following order: cone (most stable) > partial-cone > 1,2-alternate > 1,3-alternate. The relative stability of the conformers of 2 is in the following order: cone (most stable) > 1,2-alternate > partial-cone > 1,3-alternate. The relative stability of the various conformers of 3 is in the following order: cone (pinched: most stable) > partial-cone > cone (winged) ∼ 1,2-alternate ∼ 1,2,3-alternate > 1,4-alternate > 1,3-alternate > 1,3,5-alternate. The structures of the various conformers of 4 were optimized by using the mPW1PW91/6-31G(d,p) method followed by single point calculation of mPW1PW91/6-31+G(d,p). The relative stability of the conformers of 4 is in the following order: cone (pinched) > 1,2-alternate > cone (winged) > 1,4-alternate ∼ partial-cone > 1,2,3-alternate > 1,3,5-alternate > 1,3-alternate
African Journals Online (AJOL)
African Journal of Drug & Alcohol Studies, 9(1), 2010. Copyright .... predictors of drug use factors associated with increased ..... consumption of cannabis among women re- gardless of ...... of the factors contributing to high use of il- licit drugs.
2010-07-01
... voice and whisper, through the normal organs of speech if such loss is caused by organic changes in such organs. Where such loss exists, the fact that some speech can be produced through the use of an artificial appliance or other organs of the body will be disregarded. (k)(1) The term member's stillborn...
Pandey, Chandan; Mahapatra, M. M.; Kumar, Pradeep; Saini, N.
2018-01-01
Creep strength enhanced ferritic (CSEF) P91 steel were subjected to room temperature tensile test for quasi-static (less than 10-1/s) strain rate by using the Instron Vertical Tensile Testing Machine. Effect of different type of notch geometry, notch depth and angle on mechanical properties were also considered for different strain rate. In quasi-static rates, the P91 steel showed a positive strain rate sensitivity. On the basis of tensile data, fracture toughness of P91 steel was also calculated numerically. For 1 mm notch depth (constant strain rate), notch strength and fracture toughness were found to be increased with increase in notch angle from 45° to 60° while the maximum value attained in U-type notch. Notch angle and notch depth has found a minute effect on P91 steel strength and fracture toughness. The fracture surface morphology was studied by field emission scanning electron microscopy (FESEM).
Factors influencing creep model equation selection
International Nuclear Information System (INIS)
Holdsworth, S.R.; Askins, M.; Baker, A.; Gariboldi, E.; Holmstroem, S.; Klenk, A.; Ringel, M.; Merckling, G.; Sandstrom, R.; Schwienheer, M.; Spigarelli, S.
2008-01-01
During the course of the EU-funded Advanced-Creep Thematic Network, ECCC-WG1 reviewed the applicability and effectiveness of a range of model equations to represent the accumulation of creep strain in various engineering alloys. In addition to considering the experience of network members, the ability of several models to describe the deformation characteristics of large single and multi-cast collations of ε(t,T,σ) creep curves have been evaluated in an intensive assessment inter-comparison activity involving three steels, 21/4 CrMo (P22), 9CrMoVNb (Steel-91) and 18Cr13NiMo (Type-316). The choice of the most appropriate creep model equation for a given application depends not only on the high-temperature deformation characteristics of the material under consideration, but also on the characteristics of the dataset, the number of casts for which creep curves are available and on the strain regime for which an analytical representation is required. The paper focuses on the factors which can influence creep model selection and model-fitting approach for multi-source, multi-cast datasets
Microstructure and mechanical analysis of W/P91 steel HIP-joint with Ti interlayer
Energy Technology Data Exchange (ETDEWEB)
Wang, Ji-chao [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Wang, Wanjing, E-mail: wjwang@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Sun, Zhaoxuan; Wang, Xingli; Wei, Ran [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Xie, Chunyi; Li, Qiang [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Luo, Guang-nan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Hefei Center for Physical Science and Technology, Hefei, 230022 (China); Hefei Science Center of Chinese Academy of Sciences, Hefei, 230027 (China)
2016-11-15
Highlights: • W and P91 steel can be joined successfully using the Hot Isostatic Pressing (HIP) method with Ti interlayer. • The experiment was conducted at 760 °C below the P91 steel austenitizing temperature with the pressure 150 MPa for 4 h. • The residual stress concentration is responsible for the fracture of HIP joints under low joining temperature. • Low temperature can reduce the reaction products and improve the mechanical properties of W/Ti/P91 steel joints. - Abstract: W and P91 steel were joined by using the Hot Isostatic Pressing method with Ti interlayer, and the experiments were conducted at 760 °C. The mechanical property, bonding quality and interface microstructure were tested by the Torsion test, Non-Destructive Test, Scanning Electron Microscope and Nano-indentation test. The minimum shear strength of joints was 225 MPa and the failure occurred at the W/Ti interfaces. Metallographic analysis revealed good bonding quality across bonding lines. Almost no reaction products were found in the diffusion region and the Nano-indentation test demonstrated that the solid solution strengthening was caused by inter-diffusion in the diffusion zone. The effect of low joining temperature on reducing reaction products and improving mechanical properties of W/Ti/Steel diffusion bonding were investigated in this paper.
Microstructure and mechanical analysis of W/P91 steel HIP-joint with Ti interlayer
International Nuclear Information System (INIS)
Wang, Ji-chao; Wang, Wanjing; Sun, Zhaoxuan; Wang, Xingli; Wei, Ran; Xie, Chunyi; Li, Qiang; Luo, Guang-nan
2016-01-01
Highlights: • W and P91 steel can be joined successfully using the Hot Isostatic Pressing (HIP) method with Ti interlayer. • The experiment was conducted at 760 °C below the P91 steel austenitizing temperature with the pressure 150 MPa for 4 h. • The residual stress concentration is responsible for the fracture of HIP joints under low joining temperature. • Low temperature can reduce the reaction products and improve the mechanical properties of W/Ti/P91 steel joints. - Abstract: W and P91 steel were joined by using the Hot Isostatic Pressing method with Ti interlayer, and the experiments were conducted at 760 °C. The mechanical property, bonding quality and interface microstructure were tested by the Torsion test, Non-Destructive Test, Scanning Electron Microscope and Nano-indentation test. The minimum shear strength of joints was 225 MPa and the failure occurred at the W/Ti interfaces. Metallographic analysis revealed good bonding quality across bonding lines. Almost no reaction products were found in the diffusion region and the Nano-indentation test demonstrated that the solid solution strengthening was caused by inter-diffusion in the diffusion zone. The effect of low joining temperature on reducing reaction products and improving mechanical properties of W/Ti/Steel diffusion bonding were investigated in this paper.
International Nuclear Information System (INIS)
1992-11-01
This report is the final comparison report for ISP-27, a blind problem which is based on the BETHSY test 9.1b performed in december 1989 at the Nuclear Research Center in Grenoble (France). The BETHSY integral test facility is a scaled down model of a 3 loop 900 e MW FRAMATOME PWR; the overall scaling factor applied to every volume, mass flowrate and power level is close to 1/100, while elevations are 1/1 in order to preserve the gravitational heads. The cold leg break is combined with the High Pressure Injection System (HPIS) failure. In that case, the state oriented approach requires operators to start an Ultimate Procedure, which consists in fully opening the Steam Generator (SG) atmospheric dumps as soon as they are informed of the unavailability of the HPIS. The presently studied scenario assumes a delayed application of this procedure, which is started only when the core outlet temperature rises significantly higher than the saturation temperature. The BETHSY Test 9.1b addresses, besides typical problems relevant to Small Break Loss Of Coolant Accidents (SBLOCA) such as critical 2-phase flow, loop seal clearing, heat-transfer during boil-off or accumulator injection, specific aspects related to the fast depressurization (primary to secondary and structural heat transfer), uncovered core behavior when intense condensation takes place in the SG, and primary side refilling by the Low Pressure Injection System (LPIS)
Magnetic-entropy change in Mn1.1Fe0.9P0.7As0.3-xGe x
International Nuclear Information System (INIS)
Tegus, O.; Fuquan, B.; Dagula, W.; Zhang, L.; Brueck, E.; Si, P.Z.; Boer, F.R. de; Buschow, K.H.J.
2005-01-01
We have studied the magnetic properties and magnetic-entropy changes of Mn 1.1 Fe 0.9 P 0.7 As 0.3-x Ge x compounds with x = 0, 0.05, 0.1, 0.15 and 0.3. X-ray diffraction (XRD) study shows all the compounds crystallize in the Fe 2 P-type structure. Magnetic measurements show that the Curie temperature increases from 150 K for Mn 1.1 Fe 0.9 P 0.7 As 0.3 to 380 K for Mn 1.1 Fe 0.9 P 0.7 Ge 0.3 . A field-induced first-order magnetic phase transition is observed above the Curie temperature for the compounds with x up to 0.15. There exists an optimal composition in which the first-order phase transition is the sharpest. The optimal composition for this system is x = 0.1. The maximal magnetic-entropy change derived from the magnetization data is about 40 J/(kg K) for a field change from 0 to 3 T
Mcdonald Observatory 9P/TEMPEL 1 Data V1.0
Cochran, A. L.; Barker, E. S.; Caballero, M. D.; Gyorgey-Ries, J.
2010-01-01
We report on low-spectral resolution observations of comet 9P/Tempel 1 from 1983, 1989, 1994 and 2005 using the 2.7m Harlan J. Smith telescope of McDonald Observatory. This comet was the target of NASA's Deep Impact mission and our observations allowed us to characterize the comet prior to the impact. In the published paper, we showed that the comet decreased in gas production from 1983 to 2005, with the decrease being different factors for different species. OH decreased by a factor 2.7, NH by 1.7, CN by 1.6, C3 by 1.8, CH by 1.4 and C2 by 1.3. Despite the decrease in overall gas production and these slightly different decrease factors, we found that the ratios of the gas production rates of OH, NH, C3, CH and C2 that of CN were constant over all of the apparitions. We saw no change in the production rate ratios after the impact. We found that the peak gas production occurred about two months prior to perihelion. This data set represents the integrated fluxes and column densities, mentioned in the published paper, which were used to derive the production rates in the paper.
Long-term Stability of 9- to 12 % Cr Steels
DEFF Research Database (Denmark)
Hald, John
2004-01-01
In the recent 25 years creep rupture strength of 9- to 12 %Cr steels for steam pipes and turbines has been doubled by development of new alloys. This development has formed a basis for improved efficiency of fossil fired steam power plants by introduction of advanced steam temperatures...... and pressures. Newly developed steam pipe steels are based on modifications of well-established steels like the X 20CrMoV12 1. Balanced addition of V, Nb and N to a 9Cr 1 Mo steel led to the Modified 9 Cr steel P 91. Addition of 1% W to a 9Cr 1 MoVNbN base composition led to steel E 911 and partial replacement...... of Mo with 1.8 % W combined with a slight amount of Boron led to steel P 92. The creep rupture strength of these new alloys are now secured with long-term tests up to 100,000 hours, which demonstrate improvements of 50% (P 91), 75 % (E 911) and 100 % (P 92) in strength compared to X 20CrMoV12 1....
International Nuclear Information System (INIS)
Zakharkin, L.I.; Zhigareva, G.G.
1996-01-01
Dianions 1,4 and 1,3-C 6 H 4 (CH 2 -9-C 2 H 2 B 9 H 9 -7,8-nido) 2 2- obtained from nido 7,8-dicarbollide-ion and 1,4-bis(bromomethyl) and 1,3-bis(bromomethyl)benzenes react with (Ph 3 P) 3 RhCl to give binuclear rhodacarboranes, 1,4- and 1,3-[3,3-(Ph 3 P) 2 -3-H-3,1,2-RhC 2 B 9 H 10 -4-CH 2 ] 2 C 6 H 6 with chemical reaction yield 85% and 87% respectively. 7 refs., 1 fig., 1 tab
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
The study investigated the effect of teachers' personality profile on students' academic ... learning involving changing ones concept of oneself. .... with teachers of high profile personality. Groups. N. _. X. SD df t-cal t-crit. Decision at P<.05. Male.
G9a stimulates CRC growth by inducing p53 Lys373 dimethylation-dependent activation of Plk1.
Zhang, Jie; Wang, Yafang; Shen, Yanyan; He, Pengxing; Ding, Jian; Chen, Yi
2018-01-01
Rationale: G9a is genetically deregulated in various tumor types and is important for cell proliferation; however, the mechanism underlying G9a-induced carcinogenesis, especially in colorectal cancer (CRC), is unclear. Here, we investigated if G9a exerts oncogenic effects in CRC by increasing polo-like kinase 1 (Plk1) expression. Thus, we further characterized the detailed molecular mechanisms. Methods: The role of Plk1 in G9a aberrant CRC was determined by performing different in vitro and in vivo assays, including assessment of cell growth by performing cell viability assay and assessment of signaling transduction profiles by performing immunoblotting, in the cases of pharmacological inhibition or short RNA interference-mediated suppression of G9a. Detailed molecular mechanisms underlying the effect of G9a on Plk1 expression were determined by performing point mutation analysis, chromatin immunoprecipitation analysis, and luciferase reporter assay. Correlation between G9a and Plk1 expression was determined by analyzing clinical samples of patients with CRC by performing immunohistochemistry. Results: Our study is the first to report a significant positive correlation between G9a and Plk1 levels in 89 clinical samples of patients with CRC. Moreover, G9a depletion decreased Plk1 expression and suppressed CRC cell growth both in vitro and in vivo , thus confirming the significant correlation between G9a and Plk1 levels. Further, we observed that G9a-induced Plk1 regulation depended on p53 inhibition. G9a dimethylated p53 at lysine 373, which in turn increased Plk1 expression and promoted CRC cell growth. Conclusions: These results indicate that G9a-induced and p53-dependent epigenetic programing stimulates the growth of colon cancer, which also suggests that G9a inhibitors that restore p53 activity are promising therapeutic agents for treating colon cancer, especially for CRC expressing wild-type p53.
Fiorelli, Alfonso; Ricci, Serena; Feola, Antonia; Mazzella, Antonio; D'Angelo, Luigi; Santini, Mario; Di Domenico, Marina; Di Carlo, Angelina
2016-04-01
The aim of the present study was to evaluate the diagnostic accuracy of matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 in differentiating benign from malignant exudative pleural effusions. This is a unicentre observational study including 97 consecutive patients with exudative pleural effusions. Metalloproteinase-9, tissue inhibitor of metalloproteinase-1, lactate dehydrogenase, ferritin, carcinoembryonic antigen and carbohydrate antigen 15-3 were measured in pleural effusion and serum by enzyme-linked immunosorbent assay. The activity of metalloproteinase-9 was also evaluated by substrate zymography. The data were correlated with final diagnosis of pleural effusions to evaluate the diagnostic accuracy. Of the 97 eligible patients, 6 were excluded. Of the 91 patients included in the study, 70 had malignant pleural effusions and 21 had benign pleural effusions. Both in sera and pleural effusions, matrix metalloproteinase-9 (P effusion (P effusion metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 levels showed higher value of sensitivity (97 and 91%, respectively) and specificity (90 and 95%, respectively) compared with other standard markers. Serum metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 levels showed similar results. Among 70 neoplastic patients, 29 had negative pleural cytology. Of these, 25 presented elevated levels of metalloproteinase-9 and tissue inhibitor of metalloproteinase-1, whereas 4 patients had elevated levels of one of the two markers. Our results showed that metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 might be valuable markers in differentiating benign from malignant pleural effusions. Their levels are neither influenced by the histology and tumour origin nor by the presence of tumour cells in pleural effusions. Thus, their use in clinical practice could help in the selection of patients needing more invasive procedures, such as thoracoscopic biopsy. © The Author 2016
Jansen, Mona Dverdal; Knudsen, Gun Peggy; Myhre, Ronny; Høiseth, Gudrun; Mørland, Jørg; Næss, Øyvind; Tambs, Kristian; Magnus, Per
2014-05-01
Single nucleotide polymorphisms (SNPs) in loci 1p13 and 9p21 have previously been found to be associated with incident coronary heart disease (CHD). This study aimed to investigate whether these SNPs show associations with fatal CHD in a population-based cohort study after adjustment for socioeconomic- and lifestyle-related CHD risk factors not commonly included in genetic association studies. Using the population-based Cohort of Norway (CONOR), a nested case-cohort study was set up and DNA from 2,953 subjects (829 cases and 2,124 non-cases) were genotyped. The association with fatal CHD was estimated for four SNPs, three from locus 1p13 and one from locus 9p21. Multivariable Cox regression was used to estimate unstratified and gender-stratified hazard ratios while adjusting for major CHD risk factors. The associations between three SNPs from locus 1p13 and non-HDL cholesterol levels were also estimated. Men homozygous for the risk alleles on rs1333049 (9p21) and rs14000 (1p13) were found to have significantly increased hazard ratios in crude and adjusted models, and the hazard ratios remained statistically significant when both genders were analyzed together. Adjustment for additional socioeconomic- and lifestyle-related CHD risk factors influenced the association estimates only slightly. No significant associations were observed between the other two SNPs in loci 1p13 (rs599839 and rs646776) and CHD mortality in either gender. Both rs599839 and rs646776 showed significant, gradual increases in non-HDL cholesterol levels with increasing number of risk alleles. This study confirms the association between 9p21 (rs1333049) and fatal CHD in a Norwegian population-based cohort. The effect was not influenced by several socioeconomic- and lifestyle-related risk factors. Our results show that 1p13 (rs14000) may also be associated with fatal CHD. SNPs at 1p13 (rs599839 and rs646776) were associated with non-HDL cholesterol levels.
Zr-92(d,p)Zr-93 and Zr-92(d,t)Zr-91
Baron, N.; Fink, C. L.; Christensen, P. R.; Nickels, J.; Torsteinsen, T.
1972-01-01
The structures of Zr-93 and Zr-91 were studied by the stripping reaction Zr-92(d,p)Zr-93 and the pick-up reaction Zr-92(d,t)Zr-91 using 13 MeV incident deuterons. The reaction product particles were detected by counter telescope. Typical spectra from the reactions were analyzed by a nonlinear least squares peak fitting program which included a background search. Spin and parity assignments to observed excited levels were made by comparing experimental angular distributions with distorted wave Born approximation calculations.
Husin, Shuib; Afiq Pauzi, Ahmad; Yunus, Salmi Mohd; Ghafar, Mohd Hafiz Abdul; Adilin Sekari, Saiful
2017-10-01
This technical paper demonstrates the successful of the application of self-magnetic leakage field (SMLF) technique in detecting anomalies in weldment of a thick P91 materials joint (1 inch thickness). Boiler components such as boiler tubes, stub boiler at penthouse and energy piping such as hot reheat pipe (HRP) and H-balance energy piping to turbine are made of P91 material. P91 is ferromagnetic material, therefore the technique of self-magnetic leakage field (SMLF) is applicable for P91 in detecting anomalies within material (internal defects). The technique is categorized under non-destructive technique (NDT). It is the second passive method after acoustic emission (AE), at which the information on structures radiation (magnetic field and energy waves) is used. The measured magnetic leakage field of a product or component is a magnetic leakage field occurring on the component’s surface in the zone of dislocation stable slipbands under the influence of operational (in-service) or residual stresses or in zones of maximum inhomogeneity of metal structure in new products or components. Inter-granular and trans-granular cracks, inclusion, void, cavity and corrosion are considered types of inhomogeneity and discontinuity in material where obviously the output of magnetic leakage field will be shown when using this technique. The technique does not required surface preparation for the component to be inspected. This technique is contact-type inspection, which means the sensor has to touch or in-contact to the component’s surface during inspection. The results of application of SMLF technique on the developed P91 reference blocks have demonstrated that the technique is practical to be used for anomaly inspection and detection as well as identification of anomalies’ location. The evaluation of this passive self-magnetic leakage field (SMLF) technique has been verified by other conventional non-destructive tests (NDTs) on the reference blocks where simulated
van Leeuwen, Jolanda S; Orij, Rick; Luttik, Marijke A H; Smits, Gertien J; Vermeulen, Nico P E; Vos, J Chris
2011-03-01
The widely used drug diclofenac can cause serious heart, liver and kidney injury, which may be related to its ability to cause mitochondrial dysfunction. Using Saccharomyces cerevisiae as a model system, we studied the mechanisms of diclofenac toxicity and the role of mitochondria therein. We found that diclofenac reduced cell growth and viability and increased levels of reactive oxygen species (ROS). Strains increasingly relying on respiration for their energy production showed enhanced sensitivity to diclofenac. Furthermore, oxygen consumption was inhibited by diclofenac, suggesting that the drug inhibits respiration. To identify the site of respiratory inhibition, we investigated the effects of deletion of respiratory chain subunits on diclofenac toxicity. Whereas deletion of most subunits had no effect, loss of either Rip1p of complex III or Cox9p of complex IV resulted in enhanced resistance to diclofenac. In these deletion strains, diclofenac did not increase ROS formation as severely as in the wild-type. Our data are consistent with a mechanism of toxicity in which diclofenac inhibits respiration by interfering with Rip1p and Cox9p in the respiratory chain, resulting in ROS production that causes cell death.
Allal, Djamel
2009-01-01
A bilateral comparison subsequent to key comparison CCEM.RF-K9 was decided between VNIIFTRI and PTB. It was registered into the BIPM KCDB under the identifier CCEM.RF-K9.1. The results of this comparison were gathered by the pilot laboratory of comparison CCEM.RF-K9, the LNE, and a very good agreement was found between the two participants. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCEM, according to the provisions of the CIPM Mutual Recognition Arrangement (MRA).
A review of the rupture characteristics of the 2011 Tohoku-oki Mw 9.1 earthquake
Lay, Thorne
2018-05-01
The 2011 March 11 Tohoku-oki great (Mw 9.1) earthquake ruptured the plate boundary megathrust fault offshore of northern Honshu with estimates of shallow slip of 50 m and more near the trench. Non-uniform slip extended 220 km across the width and 400 km along strike of the subduction zone. Extensive data provided by regional networks of seismic and geodetic stations in Japan and global networks of broadband seismic stations, regional and global ocean bottom pressure sensors and sea level measurement stations, seafloor GPS/Acoustic displacement sites, repeated multi-channel reflection images, extensive coastal runup and inundation observations, and in situ sampling of the shallow fault zone materials and temperature perturbation, make the event the best-recorded and most extensively studied great earthquake to date. An effort is made here to identify the more robust attributes of the rupture as well as less well constrained, but likely features. Other issues involve the degree to which the rupture corresponded to geodetically-defined preceding slip-deficit regions, the influence of re-rupture of slip regions for large events in the past few centuries, and relationships of coseismic slip to precursory slow slip, foreshocks, aftershocks, afterslip, and relocking of the megathrust. Frictional properties associated with the slip heterogeneity and in situ measurements of frictional heating of the shallow fault zone support low stress during shallow sliding and near-total shear stress drop of 10-30 MPa in large-slip regions in the shallow megathrust. The roles of fault morphology, sediments, fluids, and dynamical processes in the rupture behavior continue to be examined; consensus has not yet been achieved. The possibility of secondary sources of tsunami excitation such as inelastic deformation of the sedimentary wedge or submarine slumping remains undemonstrated; dislocation models in an elastic continuum appear to sufficiently account for most mainshock observations
Impression creep behaviour of Mod. 9Cr-1Mo steel weld joints
International Nuclear Information System (INIS)
Ridhin Raj, V.R.; Kottda, Ravi Sankar; Kamaraj, M.; Maduraimuthu, V.M.; Vasudevan, M.
2016-01-01
P91 steel (9Cr-1Mo) steel is extensively used in power plants for super heater coils, headers and steam piping. The aim of the present work is to study the creep behaviour of different zones of A-TIG weld joint using impression creep technique and compare it with that of the TIG weld joint. P91 steel weld joints were made by A-TIG welding without using any filler material and multi-pass TIG welding is done using ER90S-B9 filler rods. Welds were subjected to post-weld heat treatment (PWHT). Impression creep tests were carried out at 650 °C on the base metal, weld metal and HAZ regions. Optical Microscope and TEM were used to correlate microstructures with observed creep rates. The FGHAZ showed significantly higher impression creep rate compared to that of the base metal and weld metal. Fine grain size and relatively coarser M 23 C 6 carbide particles are responsible for higher creep rate. The impression creep rate of A-TIG weld metal and coarse grain HAZ was found to be lower than that of base metal. This is attributed to the higher grain size in weld metal and coarse HAZ attributed to the higher grain size in weld metal and to the higher peak temperature observed during A-TIG welding. (author)
Experimental investigation of particle-hole excitations in 91Nb
International Nuclear Information System (INIS)
Singh, Purnima; Palit, R.; Choudhury, D.
2014-01-01
Investigation of high-spin states in nuclei near N = 50 shell closure have attracted considerable attention in recent years. These nuclei provide a suitable laboratory for testing the residual interactions of the spherical shell model. Studies of N = 50, Z ∼ 40 nuclei, revealed that the low-lying states in these nuclei arise from proton excitations within the f 5/2 , p 3/2 , p 1/2 , and g 9/2 orbits. The higher angular momentum states were observed to have dominant contribution of 1p - 1h configurations involving a single g 9/2 neutron excitation across the N = 50 shell gap into the d 5/2 orbit. A comprehensive study of multiparticle-multihole (mp-mh) excitations in these nuclei may provide necessary insight into the evolution of shell structure above N = 50 shell gap. However, till date there is no experimental evidence of states involving two or more neutron excitations across the N = 50 shell gap in N = 50, Z ∼ 40 nuclei. The present work investigates high-spin states in the N = 50 nucleus, 91 Nb, with the purpose to search for states involving 2p - 2h excitations across the N = 50 shell closure
46 CFR 91.40-1 - Definitions relating to hull examinations.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Definitions relating to hull examinations. 91.40-1... VESSELS INSPECTION AND CERTIFICATION Drydocking § 91.40-1 Definitions relating to hull examinations. As...-hull fittings. (b) Internal structural examination means an examination of the vessel while afloat or...
International Nuclear Information System (INIS)
Sougrati, Moulay T; Hermann, Raphael P; Grandjean, Fernande; Long, Gary J; Brueck, E; Tegus, O; Trung, N T; Buschow, K H J
2008-01-01
The structural, magnetic and Moessbauer spectral properties of the magnetocaloric Mn 1.1 Fe 0.9 P 1-x Ge x compounds, with 0.19 1.1 Fe 0.9 P 0.74 Ge 0.26 . The temperature dependence of the magnetization reveals a ferromagnetic to paramagnetic transition with a Curie temperature between approximately 250 and 330 K and hysteresis width of 10 to 4 K, for 0.19 1.1 Fe 0.9 P 0.78 Ge 0.22 shows the largest isothermal entropy change of approximately 10 J/(kgKT) at 290 K. The Moessbauer spectra have been analysed with a binomial distribution of hyperfine fields correlated with a change in isomer shift and quadrupole shift, a distribution that results from the distribution of phosphorus and germanium among the near neighbours of the iron. The coexistence of paramagnetic and magnetically ordered phases in ranges of temperature of up to 50 K around the Curie temperature is observed in the Moessbauer spectra and is associated with the first-order character of the ferromagnetic to paramagnetic transition. The temperature dependence of the weighted average hyperfine field is well fitted within the magnetostrictive model of Bean and Rodbell. Good fits of the Moessbauer spectra could only be achieved by introducing a difference between the isomer shifts in the paramagnetic and ferromagnetic phases, a difference that is related to the magnetostriction and electronic structure change.
Performance of different metrics proposed to CIE TC 1-91
Bhusal, P.; Dangol, R.
2017-01-01
The main aim of the article is to find out the performance of different metrics proposed to CIE TC 1-91. Currently, six different indexes have been proposed to CIE TC 1-91: Colour Quality Scale (CQS), Feeling of Contrast Index (FCI), Memory colour rendering index (MCRI), Preference of skin (PS),
International Nuclear Information System (INIS)
Li Xiaohong; Wang Yingqiu; Sun Gaofeng; Zhang Anyu; Zuo Changjing
2012-01-01
Objective: To investigate the value of 99 Tc m -HL91 hypoxia imaging combined the detection of serum neuron-specific enolase (NSE), carcinoembryonic antigen(CEA) and cytokeratin 19 fragment (CYFRA21-1) in the diagnosis of lung cancer. Methods: 63 patients with lung neoplasm were carried out 99 Tc m -Hail hypoxia imaging, and the serum tumor markers levels of Nose, Cea and CYFRA21-1 were detected. The sensitivity, specificity and accuracy of each and combined method were calculated respectively and compared with each other. Results: The sensitivity,specificity and accuracy in diagnosis of lung cancer with 99 Tc m -HL91 hypoxia imaging were 85.4%, 100% and 88.9% respectively; and with serum tumor markers NSE, CEA and CYFRA21-1 detection were 72.9%, 86.7% and 76.1% respectively. Compared with the detection of serum tumor marker levels of NSE, CEA and CYFRA21-1, 99 Tc m -HL91 hypoxia imaging had the higher sensitivity and specificity,and similar accuracy. The sensitivity, specificity and accuracy of combined two methods in diagnosis of lung cancer were 95.8%, 86.7% and 93.6% respectively. The sensitivity and accuracy of the combined method were significantly increased than single method (P 0.05). Conclusion: 99 Tc m -HL91 hypoxia imaging and the detection of serum level of NSE, CEA and CYFRA21-1 have an important diagnostic value, and their combination could improve the sensitivity and accuracy in the diagnosis of lung cancer. (authors)
Chou, Wen-Wen; Guh, Jinn-Yuh; Tsai, Jung-Fa; Hwang, Chi-Ching; Chiou, Shean-Jaw; Chuang, Lea-Yea
2009-06-01
Betel-quid use is associated with liver cancer whereas its constituent arecoline is cytotoxic, genotoxic, and induces p53-dependent p21(WAF1) protein expression in Clone-9 cells (rat hepatocytes). The ataxia telangiectasia mutated (ATM)/rad3-related (ATR)-p53-p21(WAF1) and the phosphatidylinositol-3-kinase (PI3K)-mammalian target of rapamycin (mTOR) pathways are involved in the DNA damage response and the pathogenesis of cancers. Thus, we studied the role of ATM/ATR and PI3K in arecoline-induced p53 and p21(WAF1) protein expression in Clone-9 cells. We found that arecoline (0.5 mM) activated the ATM/ATR kinase at 30 min. The arecoline-activated ATM/ATR substrate contained p-p53Ser15. Moreover, arecoline only increased the levels of the p-p53Ser6, p-p53Ser15, and p-p53Ser392 phosphorylated p53 isoforms among the known isoforms. ATM shRNA attenuated arecoline-induced p-p53Ser15 and p21(WAF1) at 24 h. Arecoline (0.5 mM) increased phosphorylation levels of p-AktSer473 and p-mTORSer2448 at 30-60 min. Dominant-negative PI3K plasmids attenuated arecoline-induced p21(WAF1), but not p-p53Ser15, at 24 h. Rapamycin attenuated arecoline-induced phosphrylated p-p53Ser15, but not p21(WAF1), at 24 h. ATM shRNA, but not dominant-negative PI3K plasmids, attenuated arecoline-induced p21(WAF1) gene transcription. We conclude that arecoline activates the ATM/ATR-p53-p21(WAF1) and the PI3K/Akt-mTOR-p53 pathways in Clone-9 cells. Arecoline-induced phosphorylated p-p53Ser15 expression is dependent on ATM whereas arecoline-induced p21(WAF1) protein expression is dependent on ATM and PI3K. Moreover, p21(WAF1) gene is transcriptionally induced by arecoline-activated ATM. (c) 2009 Wiley-Liss, Inc.
Equilibrium geometries, electronic and magnetic properties of small AunNi- (n = 1-9) clusters
Tang, Cui-Ming; Chen, Xiao-Xu; Yang, Xiang-Dong
2014-05-01
Geometrical, electronic and magnetic properties of small AunNi- (n = 1-9) clusters have been investigated based on density functional theory (DFT) at PW91P86 level. An extensive structural search shows that the relative stable structures of AunNi- (n = 1-9) clusters adopt 2D structure for n = 1-5, 7 and 3D structure for n = 6, 8-9. And the substitution of a Ni atom for an Au atom in the Au-n+1 cluster obviously changes the structure of the host cluster. Moreover, an odd-even alternation phenomenon has been found for HOMO-LUMO energy gaps, indicating that the relative stable structures of the AunNi- clusters with odd-numbered gold atoms have a higher relative stability. Finally, the natural population analysis (NPA) and the vertical detachment energies (VDE) are studied, respectively. The theoretical values of VDE are reported for the first time to our best knowledge.
International Nuclear Information System (INIS)
Lenk, P.; Proft, D.; Kussmaul, A.; Fischer, R.
2000-01-01
The influence of multiaxial stress on creep pore formation in the steels 14MoV6-3 10CrMo9-10 and X10CrMoVNb9-1 was investigated on the basis of internal pressure experiments on smooth and notched hollow cylinders. In some cases, additional axial forces were applied in order to reproduce component-relevant multiaxial stresses. Local elongation during loading was investigated and analyzed using applied HT-DMS. When different strain levels had been reached, the samples were removed, analyzed, and characterized with regard to different damage parameters. It was found that no interdependence between the surface damage pattern and the deep damage pattern can be derived across the wall thickness if no information on the load state is available. Parallel to the experiments, inelastic FEA were carried out using the ABAQUS program system. The creep law of Graham and Walles was used for calculating flow and creep via a user-defined subroutine CREEP. The parameters of the creep law could be identified by adaptation to monoaxial creep tests [de
DEFF Research Database (Denmark)
Kaur-Knudsen, Diljit; Bojesen, Stig E; Nordestgaard, Børge G
2012-01-01
The aim of this review is to summarize present knowledge of genetic variation in cytochrome P450 1B1 (CYP1B1) and 2C9 (CYP2C9) genes and risk of tobacco-related cancer, female cancer, chronic obstructive pulmonary disease and ischemic vascular disease. The CYP1B1 and CYP2C9 enzymes metabolize pol...
Energy Technology Data Exchange (ETDEWEB)
Wiedermann, J. [Instytut Metalurgii Zelaza, Gliwice (Poland); Bieniek, K. [Huta Jednosc, Siemianowice Slaskie (Poland); Pogoda, K. [Huta Batory, Chorzow (Poland)
1996-12-31
The results of primary investigations and attempt of ferritic steel H9AMFNb production in domestic steel-works have been reported. The prototype series of tubes for energetic boilers have been tested and their mechanical properties determined. It has been found the applicability of the material for use in energetics. 9 refs, 4 figs, 3 tabs.
Directory of Open Access Journals (Sweden)
Satoshi Hori
2016-12-01
Full Text Available Lithium superionic conductors with the Li10GeP2S12 (LGPS-type structure are promising materials for use as solid electrolytes in next-generation lithium batteries. A novel member of the LGPS family, Li9.42Si1.02P2.1S9.96O2.04, and its solid solutions were synthesised by quenching from 1273 K in the Li2S–P2S5–SiO2 pseudoternary system. The material exhibited an ionic conductivity as high as 3.2×10−4 S cm−1 at 298 K, as well as the high electrochemical stability to lithium metal, which was improved by the introduction of oxygen into the LGPS-type structure. An all-solid-state cell with a lithium metal anode and Li9.42Si1.02P2.1S9.96O2.04 as the separator showed excellent performance with a high coulomb efficiency of 100%. Thus, oxygen doping is an effective way of improving the electrochemical stability of LGPS-type structure.
Constitutive modelling of sandvik 1RK91
Datta, K.; Datta, K.; Hommes, M.; Post, J.; Geijselaers, Hubertus J.M.; Huetink, Han; Beyer, J.; Onate, E; Owen, D.R.J
2003-01-01
A physically based constitutive equation is being developed for the maraging stainless steel Sandvik 1RK91. The steel is used to make precision parts. These parts are formed through multistage forming operations and heat treatments from cold rolled and annealed sheets. The specific alloy is designed
Keck i LWS Mid-Ir Images and Photometry of 9P/TEMPEL 1
Fernandez, Y. R.; Lisse, C. M.; A'Hearn, M. F.; Belton, M. J. S.
2010-01-01
This data set contains raw and reduced mid-infrared images and photometry of comet 9P/Tempel 1, the target of the Deep Impact mission. Images were acquired on the night of 21 August 2000, about 7.5 months after perihelion, by Y. Fernandez, C. Lisse, M. A'Hearn and M. Belton using the Long Wavelength Spectrometer instrument at the Keck I telescope.
2010-10-01
... litigants; (4) Avoid spending the time and money of the United States for private purposes; and (5) To... exception may be granted only when the deviation will not interfere with matters of operational or military...
7 CFR 1000.91-1000.92 - [Reserved
2010-01-01
... 7 Agriculture 9 2010-01-01 2009-01-01 true [Reserved] 1000.91-1000.92 Section 1000.91-1000.92 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Miscellaneous Provisions §§ 1000.91-1000.92 [Reserved] ...
International Nuclear Information System (INIS)
Thakor, S.; Parmar, P.; Patel, M.; Patel, R.
2008-01-01
2-chloro-6-methyl/methoxy-3-formylquinoline upon condensation with substituted 9-hydrazino-acridine afforded corresponding hydrazones which were cyclized under alkaline condition to give 9-(6-substituted-1H-pyrazolo [3, 4-b] quinolin-1-yl) acridine analoges. All of the synthesized compounds were characterized by their elemental analysis, IR and NMR spectral studies. Biological screenings of the prepared compounds have been screened on some strain of bacteria and fungus. (author)
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Definitions. 1316.91 Section 1316.91 Food and Drugs DRUG ENFORCEMENT ADMINISTRATION, DEPARTMENT OF JUSTICE ADMINISTRATIVE FUNCTIONS, PRACTICES, AND..., isomers, or salts of its isomers. (3) The possession of a narcotic, a depressant, a stimulant, a...
Weiler, Julian; Mohr, Marieke; Zänker, Kurt S; Dittmar, Thomas
2018-04-10
In addition to physiological events such as fertilisation, placentation, osteoclastogenesis, or tissue regeneration/wound healing, cell fusion is involved in pathophysiological conditions such as cancer. Cell fusion, which applies to both the proteins and conditions that induce the merging of two or more cells, is not a fully understood process. Inflammation/pro-inflammatory cytokines might be a positive trigger for cell fusion. Using a Cre-LoxP-based cell fusion assay we demonstrated that the fusion between human M13SV1-Cre breast epithelial cells and human MDA-MB-435-pFDR1 cancer cells was induced by the pro-inflammatory cytokine tumour necrosis factor-α (TNF-α). The gene expression profile of the cells in the presence of TNF-α and under normoxic and hypoxic conditions was analysed by cDNA microarray analysis. cDNA microarray data were verified by qPCR, PCR, Western blot and zymography. Quantification of cell fusion events was determined by flow cytometry. Proteins of interest were either blocked or knocked-down using a specific inhibitor, siRNA or a blocking antibody. The data showed an up-regulation of various genes, including claudin-1 (CLDN1), ICAM1, CCL2 and MMP9 in M13SV1-Cre and/or MDA-MB-435-pFDR1 cells. Inhibition of these proteins using a blocking ICAM1 antibody, CLDN1 siRNA or an MMP9 inhibitor showed that only the blockage of MMP9 was correlated with a decreased fusion rate of the cells. Likewise, the tetracycline-based antibiotic minocycline, which exhibits anti-inflammatory properties, was also effective in both inhibiting the TNF-α-induced MMP9 expression in M13SV1-Cre cells and blocking the TNF-α-induced fusion frequency of human M13SV1-Cre breast epithelial cells and human MDA-MB-435-pFDR1 cancer cells. The matrix metalloproteinase-9 (MMP9) is most likely involved in the TNF-α-mediated fusion of human M13SV1-Cre breast epithelial cells and human MDA-MB-435-pFDR1 cancer cells. Likewise, our data indicate that the tetracycline
Energy Technology Data Exchange (ETDEWEB)
Vidyarthy, R.S., E-mail: vidyashanker01@gmail.com; Kulkarni, A.; Dwivedi, D.K.
2017-05-17
The current work enunciated the effect of activating flux tungsten inert gas (A-TIG) welding on the microstructural, mechanical and corrosion behaviour of the 316L stainless steel (SS) and P91 steel weldment. The current study also demonstrated the comprehensive structure–property relationships of dissimilar joint weldment using the collective techniques of optical macro and microscopy, electron microscopy, and Energy-dispersive X-ray spectroscopy (EDS) techniques. Microstructure study reveals the presence of delta ferrite, austenite and martensite in different zones of the weldment. The dissimilar steel weldment failed from the 316L side fusion boundary during the tensile testing. Maximum impact energy was absorbed by the 316L SS side heat affected zone (HAZ) while minimum by P91 steel side HAZ during the Charpy toughness test. The potentiodynamic test result suggested that the P91 side fusion boundary had minimum corrosion and pitting potential in all the weldment.
Herpes simplex virus type 1 strain KOS carries a defective US9 and a mutated US8A gene.
Negatsch, Alexandra; Mettenleiter, Thomas C; Fuchs, Walter
2011-01-01
The membrane protein encoded by the US9 gene of alphaherpesviruses plays an important role during virion assembly and transport in neurons. Here, we demonstrate that in herpes simplex virus type 1 (HSV-1) strain KOS, due to base substitutions, the predicted TATA-box of US9 is mutated, and a premature stop is present at codon 58 of US9, which contains 91 codons in other HSV-1 strains. The TATA-box mutation also removes the native stop codon of the adjacent US8A gene, leading to extension of the coding region from 160 to 191 codons. Northern blot analyses revealed reduced transcription of US9 in cells infected with HSV-1 KOS. Moreover, a US9-specific antiserum did not detect any gene products in Western blot and immunofluorescence analyses of KOS-infected cells, indicating that the truncated protein is not stable. In contrast, Western blot reactions of a pUS8A-specific antiserum confirmed enlargement of this protein in HSV-1 KOS.
Preliminary clinical study of 99Tcm-HL91 imaging in bone metastasis
International Nuclear Information System (INIS)
Liu Baoping; Mao Ronghu; Han Xingmin
2008-01-01
Objective: 99 Tc m -4, 9-diaza-3, 3, 10, 10-tetramethyldodecan-2, 11-dione dioxime (HL91), a new type of hypoxic agents, accumulates in tumor hypoxic tissue specifically. The aim of this study was to evaluate the value of 99 Tc m -HL91 imaging in the diagnosis of bone metastasis. Methods: Nine- teen cases with bone metastasis (without any treatment) and 8 cases with benign lesions underwent SPECT imaging at 4 h after injection of 740 MBq of 99 Tc m -HL91 along with 99 Tc m -methylene diphosphonic acid (MDP) imaging. Regions of interest (ROIs) were drawn in tumor tissue and contralateral normal tissue respectively, and the radioactivity ratios of tumor-to-normal (T/N) were calculated. The t-test was used for data analysis with SPSS 11.0. Results: There were visible uptake of 99 Tc m -HL91 in 79 out of 85 focuses in 19 patients of bone metastasis; however, there was no obvious uptake of 99 Tc m -HL91 in 12 focuses of 8 patients of benign lesions. Significant difference existed between the T/N values of malignant (1.877 ± 0.288) and benign lesions [(0.735 ± 0.236); t=13.065, P 0.05). Conclusion: The results indicated that 99 Tc m -HL91 was useful in diagnosing the malignant and benign bone lesions. (authors)
A Study to Increase Weld Penetration in P91 Steel During TIG Welding by using Activating Fluxes
Singh, Akhilesh Kumar; Kumar, Mayank; Dey, Vidyut; Naresh Rai, Ram
2017-08-01
Activated Flux TIG (ATIG) welding is a unique joining process, invented at Paton Institute of electric welding in 1960. ATIG welding process is also known as flux zoned TIG (FZTIG). In this process, a thin layer of activating flux is applied along the line on the surface of the material where the welding is to be carries out. The ATIG process aids to increase the weld penetration in thick materials. Activating fluxes used in the literature show the use of oxides like TiO2, SiO2, Cr2O3, ZnO, CaO, Fe2O3, and MnO2 during welding of steels. In the present study, ATIG was carried out on P-91 steel. Though, Tungsten Inert Gas welding gives excellent quality welds, but the penetration obtained in such welding is still demanding. P91 steel which is ferritic steel is used in high temperature applications. As this steel is, generally, used in thick sections, fabrication of such structures with TIG welding is limited, due to its low depth of penetration. To increase the depth of penetration in P91while welding with ATIG, the role of various oxides were investigated. Apart from the oxides mentioned above, in the present study the role of B2O3, V2O5 and MgO, during ATIG welding of P91 was investigated. It was seen that, compared to TIG welding, there was phenomenal increase in weld penetration during ATIG welding. Amongst all the oxides used in this study, maximum penetration was achieved in case of B2O3. The measurements of weld penetration, bead width and heat affected zone of the weldings were carried out using an image analysis technique.
Directory of Open Access Journals (Sweden)
Manjunath G. Sunagar
2018-03-01
Full Text Available P70-S6K1 & PI3K-δ kinases are identified to be involved in many physiological processes associated with cancer, therefore many of the inhibitors being designed to target these kinases are in clinical trials. In the current study we have exploited the N-9 substituted 6-(4-(4-propoxyphenyl piperazin-1-yl-9H-purine derivatives for their inhibitory properties with the above kinases. We have used an in silico docking study with seventeen purine derivatives for their binding affinity calculations. The binding affinities of these small molecules with P70-S6K1 & PI3K-δ were performed using AutoDock Vina. Among all the compounds, PP16 showed highest binding affinity of −14.7 kcal/mol with P70-S6K1 kinase & −17.2 kcal/mol with PI3K-δ kinases as compared to the molecules under clinical trials (PF-4708671 & IC-87114. Docking studies revealed that N-9 coumarine substituted purine derivative could be one of the potential ligands for the inhibition of P70-S6K1 & PI3K-δ kinases. Hence, this compound can be further investigated by in vitro and in vivo experiments for further validation.
Xie, Chu-Hai; Cao, Yan-Ming; Huang, Yan; Shi, Qun-Wei; Guo, Jian-Hong; Fan, Zi-Wen; Li, Ju-Gen; Chen, Bin-Wei; Wu, Bo-Yi
2016-11-01
Recent studies have shown that long non-coding RNAs (lncRNAs) have critical roles in tumorigenesis, including osteosarcoma. The lncRNA taurine-upregulated gene 1 (TUG1) was reported to be involved in the progression of osteosarcoma. Here, we investigated the role of TUG1 in osteosarcoma cells and the underlying mechanism. TUG1 expression was measured in osteosarcoma cell lines and human normal osteoblast cells by quantitative real-time PCR (qRT-PCR). The effects of TUG1 on osteosarcoma cells were studied by RNA interference in vitro and in vivo. The mechanism of competing endogenous RNA (ceRNA) was determined using bioinformatic analysis and luciferase assays. Our data showed that TUG1 knockdown inhibited cell proliferation and colony formation, and induced G0/G1 cell cycle arrest and apoptosis in vitro, and suppressed tumor growth in vivo. Besides, we found that TUG1 acted as an endogenous sponge to directly bind to miR-9-5p and downregulated miR-9-5p expression. Moreover, TUG1 overturned the effect of miR-9-5p on the proliferation, colony formation, cell cycle arrest, and apoptosis in osteosarcoma cells, which involved the derepression of POU class 2 homeobox 1 (POU2F1) expression. In conclusion, our study elucidated a novel TUG1/miR-9-5p/POU2F1 pathway, in which TUG1 acted as a ceRNA by sponging miR-9-5p, leading to downregulation of POU2F1 and facilitating the tumorigenesis of osteosarcoma. These findings may contribute to the lncRNA-targeted therapy for human osteosarcoma.
An analysis of a set of creep data for a 9Cr-1Mo-0.2V (P91 type) steel
International Nuclear Information System (INIS)
Cadek, J.; Sustek, V.; Pahutova, M.
1997-01-01
Recently published creep data for a 9Cr-1Mo-0.2V steel are analysed and an attempt is made to interpret them applying the concept of thermally activated detachment of dislocations from carbide particles as the rate controlling process. For the data, very high and stress dependent apparent activation energy of creep, Q c , and very high and temperature dependent apparent stress exponent, m c , are characteristic. The modelling of creep behavior applying the above mentioned concept is shown to fail to account for this temperature and applied stress dependence of minimum creep strain rate and/or the values of Q c and m c following from the data analysis. It is suggested that the behavior of the dislocation substructure, which is affected by the presence of carbide particles, must be introduced into any model to adequately describe the unusual creep behavior of the steel of interest. (orig.)
Effect of welding on creep damage evolution in P91B steel
Energy Technology Data Exchange (ETDEWEB)
Baral, J., E-mail: jayshree2k4@gmail.com [Metallurgical and Materials Engineering, Indian Institute of Kharagpur, WB 721302 (India); Swaminathan, J. [CSIR–National Metallurgical Laboratory, Jamshedpur 831007 (India); Chakrabarti, D.; Ghosh, R.N. [Metallurgical and Materials Engineering, Indian Institute of Kharagpur, WB 721302 (India)
2017-07-15
Study of creep behavior of base metal (without weld) and welded specimens of P91B steel over a range of temperatures (600–650 °C) and stresses (50–180 MPa) showed similar values of minimum creep-rates for both specimens at higher stress regime (>100 MPa) whilst, significantly higher creep rates in the case of welded specimens at lower stress regime. Considering that welded specimen is comprised of two distinct structural regimes, i.e. weld affected zone and base metal, a method has been proposed for estimating the material parameters describing creep behavior of those regimes. Stress–strain distribution across welded specimen predicted from finite element analysis based on material parameters revealed preferential accumulation of stress and creep strain at the interface between weld zone and base metal. This is in-line with the experimental finding that creep rupture preferentially occurs at inter-critical heat affected zone in welded specimens owing to ferrite-martensite structure with coarse Cr{sub 23}C{sub 6} particles. - Highlights: •Comparison of creep properties of welded and virgin specimens of P91B steel. •At lower stresses (<100 MPa) welded samples show higher minimum creep-rate. •Creep rupture at inter-critical heat affected zone (IC-HAZ) in welded specimens. •FEA showing accumulation of creep strain in weld/base metal interface. •Precipitate free soft ferrite matrix accumulates strain and weakens IC-HAZ.
Word Criticality Analysis. MOS: 16B. Skill Levels 1 & 2
1981-09-01
43* 2 UI3L, 29.1 2 §CT;:It’:iLL 1.12 2 ACCA 97.1 55.1 43.1 2 2 4,CITUI L 1.1 521 21l 9i 9 P ~ 1.2 2 hA~T)U h 24.1 10-.2 58.1 2.1. 2 A.;aifl U95. 2591...02#3 05.1 3 ’,I 73 # 7.1,I 65,1 6501 .,] 4?,0. .S,I 3 f), , 32, Z 3C91 ;*,t. 1.4, 2. 1 ) 9,,- 9..1 10,o. 44 09- 141 P2 4 Ar.v’%ss 9091 57 9. 4 C .7.2...9801! 72,1 419! 5 COMSJ ITrq 86. 1 21.1 5 C- 2.L1 ±. 691 5.3 Is$1 !49? !. ., 1. C9. t,4 79 9,* ie,7 17,4 16,2 Z2) Z #7 2U .2 1;l i64.8 62. p2 71#1 1
The structures of P{sub 8} and P{sub 9} clusters
Energy Technology Data Exchange (ETDEWEB)
Song Bin; Cao Peilin; Zhao Wei; Li Baoxing [Zhejiang Univ., Hangzhou, ZJ (China). Dept. of Physics
2001-08-01
Full-potential linear-muffin-tin-orbital molecular-dynamics (FP-LMTO MD) calculations have been performed to investigate the structures and energies of P{sub 8} and P{sub 9} clusters. We get fourteen stable structures for P{sub 8} and fifteen stable structures for P{sub 9}. The results confirm that ''cuneane'' structure is the most stable isomer of P{sub 8} clusters. However, the distortion of a D{sub 3h} prism, which has not been reported so far, is the most stable among the fifteen P{sub 9} isomers. (orig.)
Analysis of internal crack in a six-ton P91 ingot
Directory of Open Access Journals (Sweden)
Jing-an Yang
2016-05-01
Full Text Available P91 is a new kind of heat-resistant and high-tensile steel. It can be extruded after ingot casting and can be widely used for different pipes in power plants. However, due to its mushy freezing characteristics, a lack of feeding in the ingot center often generates many defects, such as porosity and crack. A six-ton P91 ingot was cast and sliced, and a representative part of the longitudinal section was inspected in more detail. The morphology of crack-like defects was examined by X-ray high energy industrial CT and reconstructed by 3D software. There are five main portions of defects larger than 200 mm3, four of which are interconnected. These initiated from continuous liquid film, and then were torn apart by excessive tensile stress within the brittle temperature range (BTR. The 3D FEM analysis of thermo-mechanical simulation was carried out to analyze the formation of porosity and internal crack defects. The results of shrinkage porosity and Niyama values revealed that the center of the ingot suffers from inadequate feeding. Several criteria based on thermal and mechanical models were used to evaluate the susceptibility of hot crack formation. The Clyne and Davies’ criterion and Katgerman’s criterion successfully predicted the high hot crack susceptibility in the ingot center. Six typical locations in the longitudinal section had been chosen for analysis of the stresses and strains evolution during the BTR. Locations in the defects region showed the highest tensile stresses and relative high strain values, while other locations showed either low tensile stresses or low strain values. In conclusion, hot crack develops only when stress and strain exceed a threshold value at the same time during the BTR.
12 CFR 9.1 - Authority, purpose, and scope.
2010-01-01
... Comptroller of the Currency (OCC) issues this part pursuant to its authority under 12 U.S.C. 24 (Seventh), 92a, and 93a, and 15 U.S.C. 78q, 78q-1, and 78w. (b) Purpose. The purpose of this part is to set forth the... Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY FIDUCIARY ACTIVITIES OF...
An experimental study of 99Tcm-PnAO-nitroimidazole and 99Tcm-HL91 in detection of myocardial hypoxia
International Nuclear Information System (INIS)
Yao Zhiming; Liu Xiujie; Shi Rongfang; Guo Feng; Liu Yunzhong; Wang Qi; Wei Hongxing; Zhu Lin
1999-01-01
Objective: To investigate the biological characteristics of two hypoxic-avid imaging agents, 99 Tc m -PnAO-nitroimidazole and 99 Tc m -HL91, and the experimental myocardial hypoxia, low perfusion and ischemic reperfusion were performed. Methods: Isolated rat hearts were retrograde perfused with Kerbs-Henscleit buffer (KH) in four phantoms: control, low perfusion, ischemic reperfusion and hypoxia. Control hearts were perfused with 95% O 2 and 5% CO 2 balanced KH at 9∼10 mL/min rate. Low perfusion hearts were perfused with the same KH at 1 mL/min rate, and ischemic reperfusion rat hearts were discontinued perfusion for 20 min then reperfused with the same KH. Hypoxic hearts were perfused with 100% N 2 balanced KH. Results: 1) At 30 and 60 min, the radioactivity ratio of liver to heart (L/H) was 11.6 and 6.9 ( 99 Tc m -PnAO-nitroimidazole), and 5.7 and 6.2 ( 99 Tc m -HL91), respectively. The lung to heart ratios at 60 min of 99 Tc m -PnAO-nitroimidazole and 99 Tc m -HL91 were 1.8 and 2.1, respectively 2) The accumulation of 99 Tc m -PnAo-nitroimidazole in the hypoxic, low perfusion and ischemic hearts was 4.8, 3.7 and 2.8 times that in the control hearts. At 60 min after starting washout, the retentions of 99 Tc m -PnAO-nitroimidazole in hypoxic, low flow and ischemic reperfusion myocardium were much higher than that of control hearts [(23.7 +- 9.1)%]. The accumulation of 99 Tc m -HL91 in the hypoxic and low perfusion hearts was also significantly higher than that in the control and ischemic reperfusion hearts, P 99 Tc m -HL91 in the low perfusion heart was 5.34, 3.43 and 1.23 times those of control, ischemic reperfusion and hypoxic hearts, respectively. Conclusions: 99 Tc m -PnAO-nitroimidazole can be accumulated in low perfusion, ischemic reperfusion and hypoxic hearts, while 99 Tc m -HL91 is mainly accumulated in hypoxic, specially low perfusion hearts. Since there is a high L/H in perfusions with either agent, the detecting of inferoposterior wall may be
Wang, Jianye; Huang, Yu; Zhou, Mingxu; Hardwidge, Philip R; Zhu, Guoqiang
2016-06-21
Muscovy duck parvovirus (MDPV) is the etiological agent of Muscovy duckling parvoviral disease, which is characterized by diarrhea, locomotive dysfunction, stunting, and death in young ducklings, and causes substantial economic losses in the Muscovy duck industry worldwide. FZ91-30 is an attenuated vaccine strain that is safe and immunogenic to ducklings, but the genomic information and molecular mechanism underlining the attenuation are not understood. The FZ91-30 strain was propagated in 11-day-old embryonated goose eggs, and viral particles were purified from the pooled allantoic fluid by differential centrifugation and ultracentrifugation. Single-stranded genomic DNA was extracted and annealed to form double-stranded DNA. The dsDNA digested with NcoI resulted two sub-genomic fragments, which were then cloned into the modified plasmid pBluescript II SK, respectively, generating plasmid pBSKNL and pBSKNR. The sub-genomic plasmid clones were sequenced and further combined to construct the plasmid pFZ that contained the entire genome of strain FZ91-30. The complete genome sequences of strain FM and YY and partial genome sequences of other strains were retrieved from GenBank for sequence comparison. The plasmid pFZ containing the entire genome of FZ91-30 was transfected in 11-day-old embryonated goose eggs via the chorioallantoic membranes route to rescue infectious virus. A genetic marker was introduced into the rescued virus to discriminate from its parental virus. The genome of FZ91-30 consists of 5,131 nucleotides and has 98.9 % similarity to the FM strain. The inverted terminal repeats (ITR) are 456 nucleotides in length, 14 nucleotides longer than that of Goose parvovirus (GPV). The exterior 415 nucleotides of the ITR form a hairpin structure, and the interior 41 nucleotides constitute the D sequence, a reverse complement of the D' sequence at the 3' ITR. Amino acid sequence alignment of the VP1 proteins between FZ91-30 and five pathogenic MDPV strains
Heat treated 9 Cr-1 Mo steel material for high temperature application
Jablonski, Paul D.; Alman, David; Dogan, Omer; Holcomb, Gordon; Cowen, Christopher
2012-08-21
The invention relates to a composition and heat treatment for a high-temperature, titanium alloyed, 9 Cr-1 Mo steel exhibiting improved creep strength and oxidation resistance at service temperatures up to 650.degree. C. The novel combination of composition and heat treatment produces a heat treated material containing both large primary titanium carbides and small secondary titanium carbides. The primary titanium carbides contribute to creep strength while the secondary titanium carbides act to maintain a higher level of chromium in the finished steel for increased oxidation resistance, and strengthen the steel by impeding the movement of dislocations through the crystal structure. The heat treated material provides improved performance at comparable cost to commonly used high-temperature steels such as ASTM P91 and ASTM P92, and requires heat treatment consisting solely of austenization, rapid cooling, tempering, and final cooling, avoiding the need for any hot-working in the austenite temperature range.
The Accelerating Spin Of 9P/Tempel 1
Belton, Michael J.; Drahus, M.
2007-10-01
Deep Impact approach photometry has been analyzed using the dynamical techniques introduced by Drahus and Waniak (2006). Clear indications of acceleration (0.70 +/- 0.24 x 10-7 h-2) in the spin rate are found together with a spin period of 40.850 +/- 0.017 h at the mid point of the data set (June 2.38304, 2005 UT). This measurement of acceleration in the spin is similar to that deduced independently from a combination of spin rate measurements derived from the Deep Impact Earth-based campaign (Meech et al. 2005), Spitzer observations (Lisse et al. 2005), and Deep Impact approach data (A'Hearn et al. 2005). Estimates of the spin rate from these sources (Belton et al. 2007) at epochs between 1999 and 2006 were coupled through the 2005 perihelion passage using a heuristic spin rate change model based on non-gravitational torques due to the outflow of H2O. This model yields a preliminary estimate of 1.15×10-7 h-2 for the acceleration of the spin at the mid point of the data set; it also suggests that the net torque is dominated by activity in the Northern hemisphere of the nucleus. Although non-constant periodicities have been reported for a few comets before, the evidence has never been detected as clearly and unambiguously as for 9P/Tempel 1. This discovery strongly impacts the preparations for the Stardust-NExT mission (http://stardust.jpl.nasa.gov/news/status/070703.html) scheduled to arrive at the comet in 2011. References: A'Hearn, M.F. and 32 colleagues, 2005. Science 310, 258-264. Belton, M.J.S. and 35 colleagues, 2007. In preparation. Drahus, M, and Waniak, W. 2006, Icarus 185, 544 Lisse, C.M and 8 colleagues 2005. Astrophys. J. 625, L139-L142. Meech, K.J. and 208 colleagues, 2005. Science 310, 265-269.
International Nuclear Information System (INIS)
Beauchamp, F.; Allou, A.; Nishimura, M.; Umeda, R.
2013-01-01
Conclusion: • 6 experiments were carried out in the SWAT-1R facility of JAEA Oarai R&D Center to study the wastage resistance of the Mod. 9Cr-1Mo steel (T91) straight tubes. • These experiments were performed under the cooperation between CEA and JAEA. • The experiments were conducted successfully: - all the tubes were punctured by the reaction jet, - wastage and steam/water leak rates were obtained, - experimental results brought some new determining sets of wastage data on T91. • This fruitful cooperation has contributed to: - expanding the wastage database on T91, - upgrading wastage rates prediction from modelling, - the safety demonstration of future steam generators units
African Heath Sciences Vol 8 No 1.p65
African Journals Online (AJOL)
Harriet
2008-03-01
Mar 1, 2008 ... 12: 59. 7. Ejele OA, Nwauche CA, Erhabor O. Seroprevalence of HIV infection among Blood donors in port Harcourt, Nigeria. Nigerian Journal of Medicine 2005; 14:287-89. 8. Zachariah et al. HIV prevalence and demographic risk fac- tors in blood donors. East African Medical Journal. 2002;. 79: 88-91. 9.
Duro, D; Bernard, O; Della Valle, V; Leblanc, T; Berger, R; Larsen, C J
1996-02-15
We have reported previously a preliminary study of a t(9;14)(p21-22; q11) in B-cell acute lymphoblastic leukemia. This translocation had rearranged the TCRA/D locus on chromosome band 14q11 and the locus encoding the tumor suppressor gene P16INK4/MTS1 (P16) on band 9p21 (D. Duro et al., Oncogene, 11: 21-29, 1995). In the present report, the breakpoints were precisely localized on each chromosome partner. On the 14q- derivative, the sequence derived from chromosome 9 was interrupted at 1.0 kb upstream of the first exon of P16, close to a consensus recombination heptamer, CACTGTG. In addition, the chromosome 14 breakpoint was localized at the end of the TCRD2 (delta 2) segment, and 22 residues with unknown origin were present at the translocation junction. On the 9p+ derivative, chromosome 9 sequences were in continuity with those displaced onto chromosome 14, and the 14q11 breakpoint was located within TCRJA29 segment. These features are consistent with aberrant activity of the TCR gene recombinase complex. Although all three coding exons of P16 were displaced onto the chromosome 14q-derivative, no P16 transcript was detected in the leukemic cells. Because the region spanning the P16 exon 1 was not inactivated by methylation and because the other P16 allele was deleted, the implication is that the chromosome breakpoint was likely to disrupt regulatory elements involved in the normal expression of the gene. As a whole, then, our results show that translocations affecting band 9p21 can participate to the inactivation of P16, thus justifying a systematic survey of translocations of the 9p21 band in acute lymphoblastic leukemia.
Directory of Open Access Journals (Sweden)
Yun Liu
Full Text Available An endo-β-1,4-glucanase gene, cel7A, was cloned from the thermophilic cellulase-producing fungus Neosartorya fischeri P1 and expressed in Pichia pastoris. The 1,410-bp full-length gene encodes a polypeptide of 469 amino acids consisting of a putative signal peptide at residues 1-20, a catalytic domain of glycoside hydrolase family 7 (GH7, a short Thr/Ser-rich linker and a family 1 carbohydrate-binding module (CBM 1. The purified recombinant Cel7A had pH and temperature optima of pH 5.0 and 60°C, respectively, and showed broad pH adaptability (pH 3.0-6.0 and excellent stability at pH3.0-8.0 and 60°C. Belonging to the group of nonspecific endoglucanases, Cel7A exhibited the highest activity on barley β-glucan (2020 ± 9 U mg-1, moderate on lichenan and CMC-Na, and weak on laminarin, locust bean galactomannan, Avicel, and filter paper. Under simulated mashing conditions, addition of Cel7A (99 μg reduced the mash viscosity by 9.1% and filtration time by 24.6%. These favorable enzymatic properties make Cel7A as a good candidate for applications in the brewing industry.
Performance of different metrics proposed to CIE TC 1-91
Directory of Open Access Journals (Sweden)
Pramod Bhusal
2017-12-01
Full Text Available The main aim of the article is to find out the performance of different metrics proposed to CIE TC 1-91. Currently, six different indexes have been proposed to CIE TC 1-91: Colour Quality Scale (CQS, Feeling of Contrast Index (FCI, Memory colour rendering index (MCRI, Preference of skin (PS, Relative gamut area index (RGAI and Illuminating Engineering society Method for evaluating light source colour rendition (IES TM-30. The evaluation and analysis are based on previously conducted experiment in lighting booth. The analysis showed the area based metric FCI was good subjective preference indicator. The subjective preference was measured in terms of naturalness of objects, colourfulness of colour checker chart, and the visual appearance of the lit scene in the booth.
An experimental study on cerebral ischemic penumbra imaging with 99Tcm-HL91
International Nuclear Information System (INIS)
Zhu Cansheng; Jiang Ningyi
2002-01-01
Objective: To investigate the biodistribution of 99 Tc m -4,9-diaza-3,3,10,10-tetramethyl dodecan-2,11-dione dioxime (HL91) in rat model of middle cerebral artery occlusion (MCAO). Methods: Thirty-one MCAO rats were established. Fourteen rats were used to study the biodistribution of 99 Tc m -HL91 and 15 rats were used to study the distribution of 99 Tc m -HL91 in the brain of MCAO model rats. Autoradiographic study of brain was also done in 16 MCAO model rats. Results: The liver and kidney retention were higher than that in other tissues. At 1 h after injection, small intestine retention was also high. But radioactivity in normal brain was low. Retention in target site was higher than that in non-target site. Difference between subgroups of operation and that of pseudo operation was significant (P 99 Tc m -HL91 at the target-ischemic area was shown in the autoradiograph. By using computer-enhanced image analysis, difference between target site and non-target site in the same autoradiograph and the differences between operation subgroups and that of pseudo-subgroups were all significant via Dunnett t-test and One-Way ANOVA. Conclusions: 99 Tc m -HL91 can be avidly taken up by ischemic penumbra and target/non-target ratio is high. 99 Tc m -HL91 is a potential agent for hypoxic tissue imaging, and 99 Tc m -HL91 SPECT is a promising modality in detecting the ischemic penumbra
African Journals Online (AJOL)
Dr. S.B. OLALEYE
Indian Institute of Chemical Technology,. Hyderabad 500 007, India. ABSTRACT. Different concentrations of Spilanthes acmella flower head extract were evaluated for .... this, non-volatile sesquiterpenoids and saponins are also reported.
Ethiop. J. Sci. & Technol. 9(1)
African Journals Online (AJOL)
applicability of the method, four model examples have been solved for ... Detailed discussions on the theory of asymptotical and numerical solutions of singular perturba- ... self-adjoint singularly perturbed two-point boundary value problems for small values of perturbation param- eterε . ...... with Initial and Boundary Layers.
African Journals Online (AJOL)
Dr. S.B. OLALEYE
increase in the activities of all the enzymes with a peak at the 8th hour. These values ... therapeutic or higher doses could result in an increase in enzyme activities and since ... treated through drug therapy (Peters, 1998, Olumese 1998) and over the ... in the diagnosis of halofantrine toxicity, and also assessed the changes ...
Slomiany, B L; Slomiany, A
2016-06-01
Matrix metalloproteinases (MMPs) are a family of endopeptidases implicated in a wide rage of degenerative and inflammatory diseases, including Helicobacter pylori-associated gastritis, and gastric and duodenal ulcer. As gastric mucosal inflammatory responses to H. pylori are characterized by the rise in MMP-9 production, as well as the induction in mitogen-activated protein kinase (MAPK) and Rac1 activation, we investigated the role of Rac1/MAPK in the processes associated with the release of MMP-9. We show that H. pylori LPS-elicited induction in gastric mucosal MMP-9 release is associated with MAPK, ERK and p38 activation, and occurs with the involvement of Rac1 and cytosolic phospholipase A2 (cPLA2). Further, we demonstrate that the LPS-induced MMP-9 release requires ERK-mediated phosphorylation of cPLA2 on Ser(505) that is essential for its membrane localization with Rac1, and that this process necessitates p38 participation. Moreover, we reveal that the activation and membrane translocation of p38 to the Rac1-GTP complex plays a pivotal role in cPLA2-dependent enhancement in MMP-9 release. Hence, our findings provide a strong evidence for the role of ERK/cPLA2 and Rac1/p38/cPLA2 cascade in H. pylori LPS-induced up-regulation in gastric mucosal MMP-9 release.
Performance of different colour quality metrics proposed to CIE TC 1-91
Bhusal, Pramod; Dangol, Rajendra
2017-01-01
The main aim of the article is to find out the performance of different metrics proposed to CIE TC 1-91. Currently, six different indexes have been proposed to CIE TC 1-91: Colour Quality Scale (CQS), Feeling of Contrast Index (FCI), Memory colour rendering index (MCRI), Preference of skin (PS), Relative gamut area index (RGAI) and Illuminating Engineering society Method for evaluating light source colour rendition (IES TM-30). The evaluation and analysis are based on previously conducted exp...
Minutes of the Tank Waste Science Panel meeting July 9--1, 1991
International Nuclear Information System (INIS)
Strachan, D.M.
1992-04-01
The fifth meeting of the Tank Waste Science Panel was held July 9--11, 1991, in Atlanta, Georgia. The subject areas included the generation, retention, and release of gases from Tank 241-SY-101 and the chemistry of ferrocyanide wastes
International Nuclear Information System (INIS)
Hori, Satoshi; Suzuki, Kota; Hirayama, Masaaki; Kato, Yuki; Kanno, Ryoji
2016-01-01
Lithium superionic conductors with the Li 10 GeP 2 S 12 (LGPS)-type structure are promising materials for use as solid electrolytes in the next-generation lithium batteries. A novel member of the LGPS family, Li 9.42 Si 1.02 P 2.1 S 9.96 O 2.04 (LSiPSO), and its solid solutions were synthesized by quenching from 1273 K in the Li 2 S–P 2 S 5 –SiO 2 pseudoternary system. The material exhibited an ionic conductivity as high as 3.2 × 10 −4 S cm −1 at 298 K, as well as the high electrochemical stability to lithium metal, which was improved by the introduction of oxygen into the LGPS-type structure. An all-solid-state cell with a lithium metal anode and LSiPSO as the separator showed excellent performance with a high reversibility of 100%. Thus, oxygen doping is an effective way of improving the electrochemical stability of LGPS-type structure.
Wang, Hui-Long; Liu, Ling-Yun; Dou, Yong; Zhang, Wen-Zhu; Jiang, Wen-Feng
2013-12-01
In this paper, the protective electroless Ni-P/SiC gradient coatings on AZ91D magnesium alloy substrate were successfully prepared. The prepared Ni-P/SiC gradient coatings were characterized for its microstructure, morphology, microhardness and adhesion to the substrate. The deposition reaction kinetics was investigated and an empirical rate equation for electroless Ni-P/SiC plating on AZ91D magnesium alloy was developed. The anticorrosion properties of the Ni-P/SiC gradient coatings in 3.5 wt.% NaCl solution were evaluated by potentiodynamic polarization and electrochemical impedance spectroscopy (EIS) studies. The potentiodynamic polarization measurements revealed that the SiC concentration in the bath and heat treatment can influence the corrosion protection performance of electroless deposited Ni-P/SiC gradient coatings. EIS studies indicated that higher charge transfer resistance and slightly lower capacitance values were obtained for Ni-P/SiC gradient coatings compared to Ni-P coatings. The corrosion resistance of the Ni-P/SiC gradient coatings increases initially and decreases afterwards with the sustained increasing of immersion time in the aggressive medium. The electroless Ni-P/SiC gradient coatings can afford better corrosion protection for magnesium alloy substrate compared with Ni-P coatings.
Assessment of BETHSY Test 9.1.b using RELAP5/MOD3
International Nuclear Information System (INIS)
Lee, S.; Chung, B.D.; Kim, H.J.
1993-06-01
The 2'' cold leg break test 9.l.b, conducted at the BETHSY facility was analyzed using the RELAP5/MOD3 Version 5m5 code. The test 9.l.b was conducted with the main objective being the investigation of the thermal-hydraulic mechanisms responsible for the large core uncovery and fuel heat-up, requiring the implementation of an ultimate procedure. The present analysis demonstrates the code's capability to predict, with sufficient accuracy, the main phenomena occurring in the depressurization transient, both from a qualitative and quantitative point of view. Nevertheless, several differences regarding the evolution of phenomena and affecting the timing order have to be pointed out in the base calculation. Three calculations were carried out to study the sensitivity to change of the nodalization in the components of the loop seal cross-over legs, and of the auxiliary feedwater control logics, and of the break discharge coefficient
2012-01-01
Introduction Several common alleles have been shown to be associated with breast and/or ovarian cancer risk for BRCA1 and BRCA2 mutation carriers. Recent genome-wide association studies of breast cancer have identified eight additional breast cancer susceptibility loci: rs1011970 (9p21, CDKN2A/B), rs10995190 (ZNF365), rs704010 (ZMIZ1), rs2380205 (10p15), rs614367 (11q13), rs1292011 (12q24), rs10771399 (12p11 near PTHLH) and rs865686 (9q31.2). Methods To evaluate whether these single nucleotide polymorphisms (SNPs) are associated with breast cancer risk for BRCA1 and BRCA2 carriers, we genotyped these SNPs in 12,599 BRCA1 and 7,132 BRCA2 mutation carriers and analysed the associations with breast cancer risk within a retrospective likelihood framework. Results Only SNP rs10771399 near PTHLH was associated with breast cancer risk for BRCA1 mutation carriers (per-allele hazard ratio (HR) = 0.87, 95% CI: 0.81 to 0.94, P-trend = 3 × 10-4). The association was restricted to mutations proven or predicted to lead to absence of protein expression (HR = 0.82, 95% CI: 0.74 to 0.90, P-trend = 3.1 × 10-5, P-difference = 0.03). Four SNPs were associated with the risk of breast cancer for BRCA2 mutation carriers: rs10995190, P-trend = 0.015; rs1011970, P-trend = 0.048; rs865686, 2df-P = 0.007; rs1292011 2df-P = 0.03. rs10771399 (PTHLH) was predominantly associated with estrogen receptor (ER)-negative breast cancer for BRCA1 mutation carriers (HR = 0.81, 95% CI: 0.74 to 0.90, P-trend = 4 × 10-5) and there was marginal evidence of association with ER-negative breast cancer for BRCA2 mutation carriers (HR = 0.78, 95% CI: 0.62 to 1.00, P-trend = 0.049). Conclusions The present findings, in combination with previously identified modifiers of risk, will ultimately lead to more accurate risk prediction and an improved understanding of the disease etiology in BRCA1 and BRCA2 mutation carriers. PMID:22348646
P.E.I. wood fuel survey, 1990-91
International Nuclear Information System (INIS)
1991-04-01
In 1991 a wood fuel survey of 450 randomly selected households, representing 1% of the total number of households in Prince Edward Island, was conducted. The survey indicated that 49.8% of the households burned wood, up from 42.1% of households in the 1988-1989 survey. The wood burning households consumed an average of 4.92 cords of wood, consistent with the 4.90 cords in the 1989 survey. The total residential wood consumption was estimated at ca 100,377 cords, an increase from the 89,000 cords used in 1988-89. Wood cutters represented 23.4% of respondents, with buyers representing 25.4% of respondents. The wood burning appliances used by the respondents were: airtight wood stove 39.9%, wood furnace 22.5%, kitchen wood stove 15.7%, combined wood/oil furnace 8.9%, Franklin/non-airtight 4.4%, Kemac unit 4.4%, fireplace insert 3.1%, and open fireplace 1%. The most frequent response among rural wood users cited price as an advantage of wood fuel, while the most frequent response of urban users cited the quality of the heat. 9 figs., 47 tabs
Glucose Control: non-insulin therapies* 9.1: Drug Summary ...
African Journals Online (AJOL)
Glucose Control: non-insulin therapies in 2017 SEMDSA Guideline for the Management of Type 2 Diabetes. Guideline ... Weight neutral or causes modest weight loss (-1.2kg). No weight ..... Older patients with multiple comorbidities. • Patients ...
26 CFR 31.3306(b)(9)-1 - Moving expenses.
2010-04-01
... expenses. (a) The term “wages” does not include remuneration paid on or after November 1, 1964, to or on... director or the courts finally to establish that a deduction is allowable under section 217. The reasonable...
Data of evolutionary structure change: 1ONAD-1H9PA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-1H9PA 1ONA 1H9P D A ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLK--TNALHFMFNQFSKDQKDLILQGDATTGTD...tryChain> 1ONA D 1ONAD
Partial trisomy 9p derivatived from a maternal reciprocal translocation 9;15. Case reports.
Directory of Open Access Journals (Sweden)
Elodia Torres
2015-12-01
Full Text Available Objectives: to highlight the importance of performing karyotype in children with congenital malformations in order to have a confirmatory diagnosis, in parents to exclude the possibility of being carriers of chromosomal abnormalities and perform the genetic counseling. Clinical cases description: Female patient with 3 years and 2 months old to whom karyotype was performed by global neurodevelopmental delay and microcephaly, and her mother with 34 years old without any clinical manifestations, to both patients, lymphocyte culture and chromosomal analysis with a High Resolution Banding techniques GTG and C were performed. The mother’s karyotype was 46,XX,t(9;15(q10;q10(p10;p10,add14p. The father’s karyotype was normal, 46,XY, and the girl’s karyotype resulted in a pure Trisomy 9p: 47,XX,+del(9(q11. Discussion: This chromosomal rearrangement in mother included a nonhomologous reciprocal translocation between the long arms of pair chromosomes 9 and 15 and between the short arms of the same chromosomes, additional to it, an unknown origin material was also observed in short arm from one chromosome of the 14 pair. In meiosis of this type of rearrangement, the father’s normal homologous chromosomes are paired with the mother’s translocated chromosomes and as a result of 3:1 segregation a gamete with one chromosome else was originated that after fertilization resulted in an unbalanced translocation confirming the pure trisomy in the patient.
Cold-Sprayed AZ91D Coating and SiC/AZ91D Composite Coatings
Directory of Open Access Journals (Sweden)
Yingying Wang
2018-03-01
Full Text Available As an emerging coating building technique, cold spraying has many advantages to elaborate Mg alloy workpieces. In this study, AZ91D coatings and AZ91D-based composite coatings were deposited using cold spraying. Coatings were prepared using different gas temperatures to obtain the available main gas temperature. Compressed air was used as the accelerating gas, and although magnesium alloy is oxidation-sensitive, AZ91D coatings with good performance were obtained. The results show that dense coatings can be fabricated until the gas temperature is higher than 500 °C. The deposition efficiency increases greatly with the gas temperature, but it is lower than 10% for all coating specimens. To analyze the effects of compressed air on AZ91D powder particles and the effects of gas temperature on coatings, the phase composition, porosity, cross-sectional microstructure, and microhardness of coatings were characterized. X-ray diffraction and oxygen content analysis clarified that no phase transformation or oxidation occurred on AZ91D powder particles during cold spraying processes with compressed air. The porosity of AZ91D coatings remained between 3.6% and 3.9%. Impact melting was found on deformed AZ91D particles when the gas temperature increased to 550 °C. As-sprayed coatings exhibit much higher microhardness than as-casted bulk magnesium, demonstrating the dense structure of cold-sprayed coatings. To study the effects of ceramic particles on cold-sprayed AZ91D coatings, 15 vol % SiC powder particles were added into the feedstock powder. Lower SiC content in the coating than in the feedstock powder means that the deposition efficiency of the SiC powder particles is lower than the deposition efficiency of AZ91D particles. The addition of SiC particles reduces the porosity and increases the microhardness of cold-sprayed AZ91D coatings. The corrosion behavior of AZ91D coating and SiC reinforced AZ91D composite coating were examined. The Si
Seres, Enikoe; Seres, Jozsef; Namba, Shinichi; Afa, John; Serrat, Carles
2017-12-11
Applying extreme ultraviolet (XUV) transient absorption spectroscopy, the dynamics of the two laser dressed transitions 3d 5/2 -to-5p 3/2 and 3p 3/2 -to-5s 1/2 at photon energies of 91.3 eV and 210.4 eV were examined with attosecond temporal resolution. The dressing process was modeled with density matrix equations which are found to describe very accurately both the experimentally observed transmission dynamics and the linear and nonlinear dressing oscillations at 0.75 PHz and 1.5 PHz frequencies. Furthermore, using Fourier transform XUV spectroscopy, quantum beats from the 3d 5/2 -3d 3/2 and 3p 3/2 -3p 1/2 sublevels at 0.3 PHz and 2.0 PHz were experimentally identified and resolved.
Maeda, Toyonobu; Yuzawa, Satoshi; Suzuki, Atsuko; Baba, Yuh; Nishimura, Yukio; Kato, Yasumasa
2016-03-01
Solid tumors are characterized by acidic extracellular pH (pHe). The present study examined the contribution of small GTP-binding proteins to phospholipase D (PLD) activation of acidic pHe-induced matrix metalloproteinase-9 (MMP-9) production. Acidic pHe-induced MMP-9 production was reduced by C3 exoenzyme, which inhibits the Rho family of GTPases; cytochalasin D, which inhibits actin reorganization; and simvastatin, which inhibits geranylgeranylation of Rho. Small interfering RNA (siRNA) against RhoA, but not against Rac1 or Cdc42, significantly inhibited acidic pHe induction of MMP-9. Pull-down assays showed that acidic pHe increased the activated form of RhoA. Forced expression of constitutively active RhoA induced MMP-9 production, even at neutral pHe. RhoA siRNA also reduced acidic pHe induced PLD activity. Specific inhibition of PLD1 and Pld1 gene knockout significantly reduced acidic pHe-induced MMP-9 expression. In contrast, PLD2 inhibition or knockout had no effect on MMP-9 expression. These findings suggested that RhoA-PLD1 signaling is involved in acidic pHe induction of MMP-9.
32P uptake by wheat from sources under various moisture regimes
International Nuclear Information System (INIS)
Chalwade, P.B.; Ghonsikar, C.P.
1983-01-01
P fertilizers containing varying amounts of water soluble and citrate soluble P were evaluated under two (100 and 50 per cent field capacity) moisture regimes on wheat in a pot culture experiment using 32 P technique. It was found that inorganic P sources if combined or complexed with organic matters greatly help P availability in black soils having pH 8.0 and 9.1. However, reduced moisture considerably decreased total P uptake. (author)
Directory of Open Access Journals (Sweden)
Lukasz Markiewicz
2015-01-01
Full Text Available The aim of presented work was to analyze the impact of particular polymorphic changes in the promoter regions of the -1607 1G/2G MMP1, -1562 C/T MMP9, -82 A/G MMP12, -511 C/T IL-1β, and 372 T/C TIMP1 genes on their expression level in POAG patients. Blood and aqueous humor samples acquired from 50 patients with POAG and 50 control subjects were used for QPCR and protein levels analysis by ELISA. In vivo promoter activity assays were carried on HTM cells using dual luciferase assay. All studied subjects underwent ophthalmic examination, including BCVA, intraocular pressure, slit-lamp examination, gonioscopy, HRT, and OCT scans. Patients with POAG are characterized by an increased mRNA expression of MMP1, MMP9, MMP12, and IL-1β genes as compared to the control group (P<0.001. Aqueous humor acquired from patients with POAG displayed increased protein expression of MMP1, MMP9, MMP12, and IL-1β compared to the control group (P<0.001. Allele -1607 1G of MMP1 gene possesses only 42,91% of the -1607 2G allele transcriptional activity and allele -1562 C of MMP9 gene possesses only 21,86% of the -1562 T allele. Increased expression levels of metalloproteinases can be considered as a risk factor for the development of POAG.
Spitzer, Petra; Giera, Janine; Fraga, Isabel C.; Tønnes Jakobsen, Pia; Jensen, Hans D.; Hyllested, Peter; Karpov, Oleg; Kutovoy, Viatcheslav; Nakamura, Susumu; Vospelova, Alena; Zvezdina, Valentina
2008-01-01
CCQM-K9.2 was performed supplementary to the key comparison CCQM-K9 on the pH determination of a phosphate buffer with nominal pH ~ 6.9 (at 25 °C). The sample composition was very similar in both comparisons. Only the source of the starting material used for sample preparation was different. The comparison was restricted to the use of the primary method for pH (Harned cell measurement) as defined in the IUPAC Recommendations [2]. The measurement temperatures were 15 °C, 25 °C, 37 °C. CCQM-K9.2, CCQM-K.9 and the first supplementary comparison CCQM-K9.1 [5] are activities of the Electrochemical Working Group (EAWG) of the CCQM. All three comparisons were coordinated by the PTB, Germany. The Danish Primary Laboratory (DPL) successfully took part in the CCQM-K9. Meanwhile the primary set-up for pH in Denmark moved from DPL affiliated to Radiometer Medical to DFM, Denmark. The subsequent comparison allows assessing the degree of equivalence for the measurement of pH at DFM after the move. Due to the interest of other laboratories in demonstrating their progress in pH measurements on the primary level the CCQM-K9.2 supplementary comparison was extended to other participants than DFM, namely NMIJ, VNIIFTRI, INMETRO and CMI. The reported quantity for CCQM-K9.2 was not the pH of the sample but the acidity function at zero chloride molality (see chapter 12). To calculate the pH value from the acidity function it is necessary to know the ionic strength of the sample buffer solution, which was undisclosed by the coordinator. With the exception of the Czech Metrology Institute, CMI, good agreement in the determined acidity function is found between the participants. The results reported by DFM and by PTB agree within their measurement uncertainty at all measurement temperatures. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report
Directory of Open Access Journals (Sweden)
Min Huang
2012-05-01
Full Text Available An apoptosis correlated molecule—protein Latcripin-1 of Lentinula edodes C91-3—was expressed and characterized in Pichia pastoris GS115. The total RNA was obtained from Lentinula edodes C91–3. According to the transcriptome, the full-length gene of Latcripin-1 was isolated with 3'-Full Rapid Amplification of cDNA Ends (RACE and 5'-Full RACE methods. The full-length gene was inserted into the secretory expression vector pPIC9K. The protein Latcripin-1 was expressed in Pichia pastoris GS115 and analyzed by Sodium Dodecylsulfonate Polyacrylate Gel Electrophoresis (SDS-PAGE and Western blot. The Western blot showed that the protein was expressed successfully. The biological function of protein Latcripin-1 on A549 cells was studied with flow cytometry and the 3-(4,5-Dimethylthiazol-2-yl-2,5-Diphenyl-tetrazolium Bromide (MTT method. The toxic effect of protein Latcripin-1 was detected with the MTT method by co-culturing the characterized protein with chick embryo fibroblasts. The MTT assay results showed that there was a great difference between protein Latcripin-1 groups and the control group (p < 0.05. There was no toxic effect of the characterized protein on chick embryo fibroblasts. The flow cytometry showed that there was a significant difference between the protein groups of interest and the control group according to apoptosis function (p < 0.05. At the same time, cell ultrastructure observed by transmission electron microscopy supported the results of flow cytometry. The work demonstrates that protein Latcripin-1 can induce apoptosis of human lung cancer cells A549 and brings new insights into and advantages to finding anti-tumor proteins.
CDC91L1 (PIG-U) is a newly discovered oncogene in human bladder cancer.
Guo, Z.; Linn, J.F.; Wu, G.; Anzick, S.L.; Eisenberger, C.F.; Halachmi, S.; Cohen, Y.; Fomenkov, A.; Hoque, M.O.; Okami, K.; Steiner, G.; Engles, J.M.; Osada, M.; Moon, C.; Ratovitski, E.; Trent, J.M.; Meltzer, P.S.; Westra, W.H.; Kiemeney, L.A.L.M.; Schoenberg, M.P.; Sidransky, D.; Trink, B.
2004-01-01
Genomic amplification at 20q11-13 is a common event in human cancers. We isolated a germline translocation breakpoint at 20q11 from a bladder cancer patient. We identified CDC91L1, the gene encoding CDC91L1 (also called phosphatidylinositol glycan class U (PIG-U), a transamidase complex unit in the
Lisse, Carey M.; Dennerl, K.; Wolk, S. J.; Christian, D. J.; Bodewits, D.; Zurbuchen, T. H.; Combi, M.
2010-03-01
We present results from the extensive Chandra, SWIFT, Spitzer, and groundbased observing campaigns studying Comet 9P/Tempel 1 in support of NASA's Deep Impact (DI) mission as an indication of the results expected for the next DI flyby of comet 103P/Hartley 2 at 0.1 AU geocentric distance in November 2010. 9P/Tempel 1 was observed for 300 ksec between 30th June and 24th July 2005, and continuously for 60 ksec on July 4th during the impact event. X-ray emission qualitatively similar to that observed for the collisionally thin, cold wind comet 2P/Encke system (Lisse et al. 2005) was found, with emission morphology centered on the nucleus and emission lines due to C, N, O, and Ne solar wind minor ions. The comet was relatively faint on July 4th, and the total increase in x-ray flux due to the Deep Impact excavation was small, 20% of the immediate pre-impact value, consistent with estimates that the total coma neutral gas release due to the impact was 5 x 106 kg ( 10 hrs of normal coma outflow). Over time, other temporally variable spectral features due to changing solar wind flux densities and charge states were clearly seen. Good agreement between the Chandra and SWIFT x-ray photometry was found. Two flares, much stronger than the man-made increase due to Deep Impact, were found in the observed x-rays on June 30th and July 8th, 2005, and are coincident with increases in the solar wind flux arriving at the comet. Modeling of the Chandra data using observed Spitzer gas production rates and ACE solar wind ion fluxes with a SWCX mechanism for the emission was found to be consistent with the temporal- and spectral behavior expected for a slow, hot wind typical of low latitude emission from the solar corona interacting with the comet's neutral coma.
Chandra Observations of the Deep Impact Encounter with Comet 9P/Tempel 1
Lisse, C. M.; Christian, D. J.; Dennerl, K.; Wolk, S. J.; Bodewits, D.; Combi, M. R.; Hoekstra, R.; Makinen, T.; Schultz, P. H.; Weaver, H. A.
2005-08-01
On July 4, 2005 NASA's discovery mission Deep Impact (hereafter DI) will send a 375 kg impactor into the nucleus of comet 9P/Tempel 1 at 10.2 km/s relative velocity. In the x-ray, the DI experiment allows for a controlled test of the charge exchange (CXE) emission mechanism that drives cometary x-ray emission (Lisse et al. 2001, Kharchenko and Dalgarno 2001, Krasnopolsky et al.2002). Previous ROSAT and Chandra observations studied cometary x-ray emission as the solar wind changed but the cometary emission remained constant. Here, at a precise time, a fresh amount of neutral material will be injected into a finite volume of the extended atmosphere, or coma, of the comet. This new material will directly increase the emission measure for the comet, passing from the collisionally thick to the collisionally thin regions of emission over the course of days. The DI experiment also allows for a direct search for prompt x-rays created by hyper-velocity impact processes, such as was seen by ROSAT during the impact of the K-fragment of comet D/Shoemaker-Levy 9 on Jupiter (Waite et al. 1995). We report here on the first results of of the Chandra observations of the Deep Impact encounter.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Monitoring. 91.430 Section 91.430 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... Plan § 91.430 Monitoring. The consolidated plan must describe the standards and procedures that the...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Monitoring. 91.230 Section 91.230 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... Consolidated Plan § 91.230 Monitoring. The plan must describe the standards and procedures that the...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Monitoring. 91.330 Section 91.330 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... Consolidated Plan § 91.330 Monitoring. The consolidated plan must describe the standards and procedures that...
International Nuclear Information System (INIS)
Wu, Zheng; Zhang, Yihe; Fang, Cong; Ma, Ke; Lin, He; Jia, Yanmin; Chen, Jianrong; Wang, Yu; Chan, Helen Lai Wa
2014-01-01
High photovoltaic efficiency is a key index in the application of silicon (Si) solar cells. In this study, a composite of a photovoltaic Si p-n junction solar cell and a magnetostrictive Tb x Dy 1-x Fe 2 alloy was fabricated. By utilizing the magnetostrictive strain to modulate the energy bandgap of Si, the open-circuit voltage and the maximum photovoltaic output power of the Si p-n junction solar cell could be enhanced by ∝12% and 9.1% under a dc magnetic field of ∝250 mT, respectively. The significantly enhanced photovoltaic performance and the simple fabrication process make the Si-p-n/Tb x Dy 1-x Fe 2 composite a promising material for high-efficiency solar cell devices. The structure of the proposed Si-p-n/Tb x Dy 1-x Fe 2 laminated composite. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Phases Evolution of an ASTM 335 steel under continuous cooling P91
International Nuclear Information System (INIS)
Carrizo, D.A; Danon, C.A; Ramos, C.P
2012-01-01
This paper studies the influence of the cooling rate on phase transformations and the resulting microstructure in continuous cooling cycles for an ASTM A335 P91 steel, under fixed austenization conditions. The CCT (Continuous Cooling Transformation) diagram of this material is reported in the literature, so the main phase fields are known. The final structure of the samples depends on the austenitic grain size and the cooling rate. The studied samples were austenized at 1050 o C for 30 minutes and then cooled at different rates between 50 o C/h and 300 o C/h. The identification and characterization of the phases was carried out by using Scanning Electron Microscopy, X-ray Diffraction and Moessbauer Spectroscopy. From the results so obtained, additions to the CCT diagram of the material are proposed, providing new information to it
Vigorito, E.; Kuchenbaecker, K.B.; Beesley, J.; Adlard, J.; Agnarsson, B.A.; Andrulis, I.L.; Arun, B.K.; Barjhoux, L.; Belotti, M.; Benitez, J.; Berger, A.; Bojesen, A.; Bonanni, B.; Brewer, C.; Caldes, T.; Caligo, M.A.; Campbell, I.; Chan, S.B.; Claes, K.B.; Cohn, D.E.; Cook, J.; Daly, M.B.; Damiola, F.; Davidson, R.; Pauw, A. de; Delnatte, C.; Diez, O.; Domchek, S.M.; Dumont, M.; Durda, K.; Dworniczak, B.; Easton, D.F.; Eccles, D.; Edwinsdotter Ardnor, C.; Eeles, R.; Ejlertsen, B.; Ellis, S.; Evans, D.G.; Feliubadalo, L.; Fostira, F.; Foulkes, W.D.; Friedman, E.; Frost, D.; Gaddam, P.; Ganz, P.A.; Garber, J.; Garcia-Barberan, V.; Gauthier-Villars, M.; Gehrig, A.; Gerdes, A.M.; Giraud, S.; Godwin, A.K.; Goldgar, D.E.; Hake, C.R.; Hansen, T.V.; Healey, S.; Hodgson, S.; Hogervorst, F.B.; Houdayer, C.; Hulick, P.J.; Imyanitov, E.N.; Isaacs, C.; Izatt, L.; Izquierdo, A.; Jacobs, L; Jakubowska, A.; Janavicius, R.; Jaworska-Bieniek, K.; Jensen, U.B.; John, E.M.; Vijai, J.; Karlan, B.Y.; Kast, K.; Khan, S.; Kwong, A.; Laitman, Y.; Lester, J.; Lesueur, F.; Liljegren, A.; Lubinski, J.; Mai, P.L.; Manoukian, S.; Mazoyer, S.; Meindl, A.; Mensenkamp, A.R.; Montagna, M.; Nathanson, K.L.; Neuhausen, S.L.; Nevanlinna, H.; Niederacher, D.; Olah, E.; Olopade, O.I.; Ong, K.R.; Osorio, A.; Park, S.K.; Paulsson-Karlsson, Y.; Pedersen, I.S.; Peissel, B.; Peterlongo, P.; et al.,
2016-01-01
Population-based genome wide association studies have identified a locus at 9p22.2 associated with ovarian cancer risk, which also modifies ovarian cancer risk in BRCA1 and BRCA2 mutation carriers. We conducted fine-scale mapping at 9p22.2 to identify potential causal variants in BRCA1 and BRCA2
DEFF Research Database (Denmark)
Vigorito, Elena; Kuchenbaecker, Karoline B; Beesley, Jonathan
2016-01-01
Population-based genome wide association studies have identified a locus at 9p22.2 associated with ovarian cancer risk, which also modifies ovarian cancer risk in BRCA1 and BRCA2 mutation carriers. We conducted fine-scale mapping at 9p22.2 to identify potential causal variants in BRCA1 and BRCA2 ...
Dicty_cDB: Contig-U12496-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available E8.r CHORI-242 Sus scrofa genomic clone C... 44 9.1 1 ( FD687842 ) CBHY1281.fwd CBHY Mycosphaerella fijiensi...s MfEST5... 44 9.1 1 ( FD687633 ) CBHY1157.rev CBHY Mycosphaerella fijiensis MfEST5... 44 9.1 1 ( FD687295 )... CBHX6118.fwd CBHX Mycosphaerella fijiensis MfEST4... 44 9.1 1 ( FD682112 ) CBHX1...985.rev CBHX Mycosphaerella fijiensis MfEST4... 44 9.1 1 ( FD677743 ) CBHW1795.rev CBHW Mycosphaerella fijie...nsis MfEST4... 44 9.1 1 ( FD666344 ) CBHT1283.rev CBHT Mycosphaerella fijiensis MfEST3... 44 9.1 1 >( AC1155
VENUS-2 Benchmark Problem Analysis with HELIOS-1.9
International Nuclear Information System (INIS)
Jeong, Hyeon-Jun; Choe, Jiwon; Lee, Deokjung
2014-01-01
Since there are reliable results of benchmark data from the OECD/NEA report of the VENUS-2 MOX benchmark problem, by comparing benchmark results users can identify the credibility of code. In this paper, the solution of the VENUS-2 benchmark problem from HELIOS 1.9 using the ENDF/B-VI library(NJOY91.13) is compared with the result from HELIOS 1.7 with consideration of the MCNP-4B result as reference data. The comparison contains the results of pin cell calculation, assembly calculation, and core calculation. The eigenvalues from those are considered by comparing the results from other codes. In the case of UOX and MOX assemblies, the differences from the MCNP-4B results are about 10 pcm. However, there is some inaccuracy in baffle-reflector condition, and relatively large differences were found in the MOX-reflector assembly and core calculation. Although HELIOS 1.9 utilizes an inflow transport correction, it seems that it has a limited effect on the error in baffle-reflector condition
91Mo and 89Nb high-spin states
International Nuclear Information System (INIS)
Baktybaev, K.; Kojlyk, N.; Ramankulov, K.E.
2003-01-01
In the work the shell-model calculation for 91 Mo and 89 Nb nuclei high-spin states with several valente nucleons is worked out. The nucleons have been arranged in the {2p 1/2 1g 9 / 2 } configurations above the 88 Sr twice magic frame. Using of formalism of generalized quasi-spin with H=H 0 +H pp +H nn +H pn Hamiltonian in which H pp , H nn , H pn the residual nucleon interactions have being written through generalized quasi-spin operators. The obtained scheme well reproduces experimental data for examined nuclei up to 31/2 + , 33/2 - levels with seniority ν=3.5. Similarity of the spectroscopic structures of the nucleus levels with different protons and neutrons numbers above inert frame shows independence of nucleon-nucleon interactions from isotope spins of particles. There are analogous comparison of some negative yrast bands parity levels. The theory well transmits intensity values for electromagnet transitions between states. Besides the observed nuclei's properties does not give any indication on presence of valent nucleons collective motion in the both nuclei
Energy Technology Data Exchange (ETDEWEB)
Vinolin, Ada [Dept. of Physics, Madurai Kamaraj University College, Alagarkoil Road, Madurai-625002 (India); Peter, A. John, E-mail: a.john.peter@gmail.com [Dept. of Physics, Government Arts College, Melur-625106, Tamilnadu (India)
2014-04-24
Simultaneous effects of electric field and magnetic field on exciton binding energy as a function of dot radius in a cylindrical GaAs{sub 0.9}P{sub 0.1}/GaAs{sub 0.6}P{sub 0.4} strained quantum dot are investigated. The strain contribution includes the strong built-in electric field induced by the spontaneous and piezoelectric polarizations. Numerical calculations are performed using variational procedure within the single band effective mass approximation. Optical rectification in the GaAs{sub 0.9}P{sub 0.1}/GaAs{sub 0.6}P{sub 0.4} quantum dot is computed in the presence of electric and magnetic fields.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Photographs. 91.10 Section 91.10 Money and Finance: Treasury Regulations Relating to Money and Finance REGULATIONS GOVERNING CONDUCT IN OR ON THE BUREAU OF THE MINT BUILDINGS AND GROUNDS § 91.10 Photographs. The taking of photographs on...
Directory of Open Access Journals (Sweden)
Kentaro Tsukamoto
Full Text Available Botulinum neurotoxins produced by Clostridium botulinum cause flaccid paralysis by inhibiting neurotransmitter release at peripheral nerve terminals. Previously, we found that neurons derived from the murine P19 embryonal carcinoma cell line exhibited high sensitivity to botulinum neurotoxin type C. In order to prove the utility of P19 cells for the study of the intracellular mechanism of botulinum neurotoxins, ganglioside-knockout neurons were generated by deletion of the gene encoding beta-1,4 N-acetylgalactosaminyltransferase 1 in P19 cells using the clustered regularly interspaced short palindromic repeats combined with Cas9 (CRISPR/Cas9 system. By using this system, knockout cells could be generated more easily than with previous methods. The sensitivity of the generated beta-1,4 N-acetylgalactosaminyltransferase 1-depleted P19 neurons to botulinum neurotoxin type C was decreased considerably, and the exogenous addition of the gangliosides GD1a, GD1b, and GT1b restored the susceptibility of P19 cells to botulinum neurotoxin type C. In particular, addition of a mixture of these three ganglioside more effectively recovered the sensitivity of knockout cells compared to independent addition of GD1a, GD1b, or GT1b. Consequently, the genome-edited P19 cells generated by the CRISPR/Cas9 system were useful for identifying and defining the intracellular molecules involved in the toxic action of botulinum neurotoxins.
Florida State Dept. of Education, Tallahassee.
Summarized are 89 projects which served exceptional students in all 67 Florida school districts and were funded during the 1975-76 school year under P.L. 91-230 Title VI B (Education of the Handicapped Act) as ammended by P.L. 93-380 and P.L. 94-142. Projects are divided into the following major areas; Florida Learning Resources System,…
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Mediation. 91.43 Section 91.43 Public Welfare... Enforcement Procedures § 91.43 Mediation. (a) HHS will promptly refer to a mediation agency designated by the... mediation process to the extent necessary to reach an agreement or make an informed judgment that an...
The origin of pits on 9P/Tempel 1 and the geologic signature of outbursts in Stardust-NExT images
Belton, Michael J. S.; Thomas, Peter; Carcich, Brian; Quick, Andrew; Veverka, Joseph; Jay Melosh, H.; A'Hearn, Michael F.; Li, Jian-Yang; Brownlee, Donald; Schultz, Peter; Klaasen, Kenneth; Sarid, Gal
2013-02-01
We consider the origin of ˜380 quasi-circular depressions (pits) seen to be distributed in a broad band across the surface of 9P/Tempel 1 and show that possibly ˜96% may be due to outburst activity. Of the rest, Lisse, C.M., Holloway, M., Rho, J. [2010]. Icarus 208, 276-292) based on IR observations of 17P.
Directory of Open Access Journals (Sweden)
Alberto Murillo-Marrodán
2018-04-01
Full Text Available This paper is aimed at modelling the flow behaviour of P91 steel at high temperature and a wide range of strain rates for constant and also variable strain-rate deformation conditions, such as those in real hot-working processes. For this purpose, an incremental physically-based model is proposed for the P91 steel flow behavior. This formulation considers the effects of dynamic recovery (DRV and dynamic recrystallization (DRX on the mechanical properties of the material, using only the flow stress, strain rate and temperature as state variables and not the accumulated strain. Therefore, it reproduces accurately the flow stress, work hardening and work softening not only under constant, but also under transient deformation conditions. To accomplish this study, the material is characterised experimentally by means of uniaxial compression tests, conducted at a temperature range of 900–1270 °C and at strain rates in the range of 0.005–10 s−1. Finally, the proposed model is implemented in commercial finite element (FE software to provide evidence of the performance of the proposed formulation. The experimental compression tests are simulated using the novel model and the well-known Hansel–Spittel formulation. In conclusion, the incremental physically-based model shows accurate results when work softening is present, especially under variable strain-rate deformation conditions. Hence, the present formulation is appropriate for the simulation of the hot-working processes typically conducted at industrial scale.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Gambling. 91.7 Section 91.7 Money and... BUREAU OF THE MINT BUILDINGS AND GROUNDS § 91.7 Gambling. (a) Participating in games for money or other property, the operation of gambling devices, the conduct of a lottery or pool, the selling or purchasing of...
Tetraspanin CD9 regulates osteoclastogenesis via regulation of p44/42 MAPK activity
International Nuclear Information System (INIS)
Yi, TacGhee; Kim, Hye-Jin; Cho, Je-Yoel; Woo, Kyung Mi; Ryoo, Hyun-Mo; Kim, Gwan-Shik; Baek, Jeong-Hwa
2006-01-01
Tetraspanin CD9 has been shown to regulate cell-cell fusion in sperm-egg fusion and myotube formation. However, the role of CD9 in osteoclast, another multinucleated cell type, is not still clear. Therefore, we investigated the role of CD9 in osteoclast differentiation. CD9 was expressed in osteoclast lineage cells and its expression level increased during the progression of RANKL-induced osteoclastogenesis. KMC8, a neutralizing antibody specific to CD9, significantly suppressed RANKL-induced multinucleated osteoclast formation and the mRNA expression of osteoclast differentiation marker genes. To define CD9-regulated osteoclastogenic signaling pathway, MAPK pathways were examined. KMC8 induced long-term phosphorylation of p44/42 MAPK, but not of p38 MAPK. Constitutive activation of p44/42 MAPK by overexpressing constitutive-active mutant of MEK1 almost completely blocked osteoclast differentiation. Taken together, these results suggest that CD9 expressed on osteoclast lineage cells might positively regulate osteoclastogenesis via the regulation of p44/42 MAPK activity
Microstructure evolution of ASTM 335 P91 steel, subjected to continuous cooling
International Nuclear Information System (INIS)
Carrizo, D.A; Danon, C.A; Ramos, C.P
2012-01-01
This paper studies the influence of the cooling rate on an isothermal phase transformations in ASTM A335 P91 steel, by the analysis of the resulting microstructure after several continuous cooling cycles under fixed austenization conditions. The CCT (Continuous Cooling Transformation) diagram of this material has already been reported in the literature, so the main phase fields are known, and they depend on the austenitic grain size and the cooling rate. Five samples were tested in a dilatometer, they were austenized and then cooled at different rates between 50 o C/h and 300 o C/h. The identification and characterization of the resulting phases was carried out by using Scanning Electron Microscopy, X-ray Diffraction and Mossbauer Spectroscopy. The obtained results allowed to add information about the presence of retained austenite and (Fe,Cr) 3 C - type carbides to the CCT diagram of the material (author)
Closed expressions for $\\int_{0}^{1} t^{-1} log^{n-1}t log^{p}(1 - t) dt$
Kölbig, Kurt Siegfried
1982-01-01
Closed expressions for the integral integral /sub 0//sup 1/ t/sup -1/ log/sup n-1/t log/sup p/(1-t)dt, whose general form is given elsewhere, are listed for n=1(1)9, p=1(1)9. A formula is derived which allows an easy evaluation of these expressions by formula manipulation on a computer. The majority of the above expressions are given in a microfiche supplement to the paper.
Arjunan, Pachiappan; Gnanaprakasam, Jaya P; Ananth, Sudha; Romej, Michelle A; Rajalakshmi, Veeranan-Karmegam; Prasad, Puttur D; Martin, Pamela M; Gurusamy, Mariappan; Thangaraju, Muthusamy; Bhutia, Yangzom D; Ganapathy, Vadivel
2016-04-01
Hemochromatosis, an iron-overload disease, occurs as adult and juvenile types. Mutations in hemojuvelin (HJV), an iron-regulatory protein and a bone morphogenetic protein (BMP) coreceptor, underlie most of the juvenile type. Hjv(-/-) mice accumulate excess iron in retina and exhibit aberrant vascularization and angiomas. A succinate receptor, GPR91, is pro-angiogenic in retina. We hypothesized that Hjv(-/-) retinas have increased BMP signaling and increased GPR91 expression as the basis of angiomas. Expression of GPR91 was examined by qPCR, immunofluorescence, and Western blot in wild-type and Hjv(-/-) mouse retinas and pRPE cells. Influence of excess iron and BMP6 on GPR91 expression was investigated in ARPE-19 cells, and wild-type and Hjv(-/-) pRPE cells. Succinate was used to activate GPR91 and determine the effects of GPR91 signaling on VEGF expression. Signaling of BMP6 was studied by the expression of Smad1/5/8 and pSmad4, and the BMP-target gene Id1. The interaction of pSmad4 with GPR91 promoter was studied by ChIP. Expression of GPR91 was higher in Hjv(-/-) retinas and RPE than in wild-type counterparts. Unexpectedly, BMP signaling was increased, not decreased, in Hjv(-/-) retinas and RPE. Bone morphogenetic protein 6 induced GPR91 in RPE, suggesting that increased BMP signaling in Hjv(-/-) retinas was likely responsible for GPR91 upregulation. Exposure of RPE to excess iron and succinate as well as BMP6 and succinate increased VEGF expression. Bone morphogenetic protein 6 promoted the interaction of pSmad4 with GPR91 promoter in RPE. G-protein-coupled receptor 91 is a BMP6 target and Hjv deletion enhances BMP signaling in retina, thus underscoring a role for excess iron and hemochromatosis in abnormal retinal vascularization.
Corrosion and mechanical performance of AZ91 exposed to simulated inflammatory conditions.
Brooks, Emily K; Der, Stephanie; Ehrensberger, Mark T
2016-03-01
Magnesium (Mg) and its alloys, including Mg-9%Al-1%Zn (AZ91), are biodegradable metals with potential use as temporary orthopedic implants. Invasive orthopedic procedures can provoke an inflammatory response that produces hydrogen peroxide (H2O2) and an acidic environment near the implant. This study assessed the influence of inflammation on both the corrosion and mechanical properties of AZ91. The AZ91 samples in the inflammatory protocol were immersed for three days in a complex biologically relevant electrolyte (AMEM culture media) that contained serum proteins (FBS), 150 mM of H2O2, and was titrated to a pH of 5. The control protocol immersed AZ91 samples in the same biologically relevant electrolyte (AMEM & FBS) but without H2O2 and the acid titration. After 3 days all samples were switched into fresh AMEM & FBS for an additional 3-day immersion. During the initial immersion, inflammatory protocol samples showed increased corrosion rate determined by mass loss testing, increased Mg and Al ion released to solution, and a completely corroded surface morphology as compared to the control protocol. Although corrosion in both protocols slowed once the test electrolyte solution was replaced at 3 days, the samples originally exposed to the simulated inflammatory conditions continued to display enhanced corrosion rates as compared to the control protocol. These lingering effects may indicate the initial inflammatory corrosion processes modified components of the surface oxide and corrosion film or initiated aggressive localized processes that subsequently left the interface more vulnerable to continued enhanced corrosion. The electrochemical properties of the interfaces were also evaluated by EIS, which found that the corrosion characteristics of the AZ91 samples were potentially influenced by the role of intermediate adsorption layer processes. The increased corrosion observed for the inflammatory protocol did not affect the flexural mechanical properties of the AZ91
Asymptotic normalization coefficients for 10B→9Be+p
International Nuclear Information System (INIS)
Mukhamedzhanov, A.M.; Clark, H.L.; Gagliardi, C.A.; Lui, Y.; Trache, L.; Tribble, R.E.; Xu, H.M.; Zhou, X.G.; Burjan, V.; Cejpek, J.; Kroha, V.; Carstoiu, F.
1997-01-01
The differential cross sections for the reactions 9 Be( 10 B, 10 B) 9 Be and 9 Be( 10 B, 9 Be) 10 B have been measured at an incident energy of 100 MeV. The elastic scattering data have been used to determine the optical model parameters for the 9 Be+ 10 B system at this energy. These parameters are then used in distorted-wave Born approximation (DWBA) calculations to predict the cross sections of the 9 Be( 10 B, 9 Be) 10 B proton exchange reaction, populating the ground and low-lying states in 10 B. By normalizing the theoretical DWBA proton exchange cross sections to the experimental ones, the asymptotic normalization coefficients (ANC's), defining the normalization of the tail of the 10 B bound state wave functions in the two-particle channel 9 Be+p, have been found. The ANC for the virtual decay 10 B(g.s.)→ 9 Be+p will be used in an analysis of the 10 B( 7 Be, 8 B) 9 Be reaction to extract the ANC's for 8 B→ 7 Be +p. These ANC's determine the normalization of the 7 Be(p,γ) 8 B radiative capture cross section at very low energies, which is crucially important for nuclear astrophysics. copyright 1997 The American Physical Society
Protective role for miR-9-5p in the fibrogenic transformation of human dermal fibroblasts.
Miguel, Verónica; Busnadiego, Oscar; Fierro-Fernández, Marta; Lamas, Santiago
2016-01-01
Excessive accumulation of extracellular matrix (ECM) proteins is the hallmark of fibrotic diseases, including skin fibrosis. This response relies on the activation of dermal fibroblasts that evolve into a pro-fibrogenic phenotype. One of the major players in this process is the cytokine transforming growth factor-β (TGF-β). MicroRNAs (miRNAs) are small non-coding RNAs that post-transcriptionally regulate gene expression affecting a wide range of pathophysiological events including fibrogenesis. MicroRNA-9-5p (miR-9-5p) has been shown to exert a protective role in lung and peritoneal fibrosis. This study aimed to evaluate the role of miR-9-5p in skin fibrosis. miR-9-5p is up-regulated in TGF-β1-treated human dermal fibroblasts (HDFs). In silico identification of miR-9-5p targets spotted the type II TGF-β receptor (TGFBR2) as a potential TGF-β signaling-related effector for this miRNA. Consistently, over-expression of miR-9-5p in HDFs down-regulated TGFBR2 at both the mRNA and protein levels and reduced the phosphorylation of Smad2 and the translocation of Smad2/3 to the nucleus. In keeping, over-expression of miR-9-5p significantly delayed TGF-β1-dependent transformation of dermal fibroblasts, decreasing the expression of ECM protein collagen, type I, alpha 1 (Col1α1), and fibronectin (FN), the amount of secreted collagen proteins, and the expression of the archetypal myofibroblast marker alpha-smooth muscle actin (α-SMA). By contrast, specific inhibition of miR-9-5p resulted in enhanced presence of fibrosis markers. The expression of miR-9-5p was also detected in the skin and plasma in the mouse model of bleomycin-induced dermal fibrosis. Using lentiviral constructs, we demonstrated that miR-9-5p over-expression was also capable of deterring fibrogenesis in this same model. miR-9-5p significantly prevents fibrogenesis in skin fibrosis. This is mediated by an abrogation of TGF-β-mediated signaling through the down-regulation of TGFBR2 expression in HDFs
International Nuclear Information System (INIS)
Kim, Woo-Gon; Yin, Song-Nan; Koo, Gyeong-Hoi
2009-01-01
This study dealt with the construction of long-term isochronous stress-strain curves (ISSC) by a modeling of short-term creep curves for a Grade 9Cr-1Mo steel (G91) which is a candidate material for structural applications in the next generation nuclear reactors as well as in fusion reactors. To do this, tensile material data used in the inelastic constitutive equations was obtained by tensile tests at 550degC. Creep curves were obtained by a series of creep tests with different stress levels of 300MPa to 220MPa at an identical controlled temperature of 550degC. On the basis of these experimental data, the creep curves were characterized by Garofalo's creep model. Three parameters of P 1 , P 2 and P 3 in Garofalo's model were properly optimized by a nonlinear least square fitting (NLSF) analysis. The stress dependency of the three parameters was found to be a linear relationship. But, the P 3 parameter representing the steady state creep rate exhibited a two slope behavior with different stress exponents at a transient stress of about 250 MPa. The long-term creep curves of the G91 steel was modeled by Garofalo's model with only a few short-term creep data. Using the modeled creep curves, the long-term isochronous curves up to 10 5 hours were successfully constructed. (author)
Microstructural investigation of the heat-affected zone of simulated welded joint of P91 steel
Directory of Open Access Journals (Sweden)
T. Vuherer
2013-07-01
Full Text Available In the process of testing real components exposed to elevated temperature, it is not possible to neglect cracks. The most significant cracks can be induced by welding, which is applied for joining of structural components. Pressure equipment in service is also exposed to high pressure and high stresses. Materials for their manufacturing are designed to resist high stress at elevated temperature, and to meet requirements regarding creep resistance. The objective of this study is to investigate microstructure of different regions of the heat affected zone in T/P91 steels by using thermal simulation instead of welding.
International Nuclear Information System (INIS)
Du, Yantao; Liu, Zhaojun; Gu, Liankun; Zhou, Jing; Zhu, Bu-dong; Ji, Jiafu; Deng, Dajun
2012-01-01
Many miR genes are located within or around CpG islands. It is unclear whether methylation of these CpG islands represses miR transcription regularly. The aims of this study are to characterize gastric carcinoma (GC)-related methylation of miR CpG islands and its relationship with miRNA expression. Methylation status of 9 representative miR CpG islands in a panel of cell lines and human gastric samples (including 13 normal biopsies, 38 gastritis biopsies, 112 pairs of GCs and their surgical margin samples) was analyzed by bisulfite-DHPLC and sequencing. Mature miRNA levels were determined with quantitative RT-PCR. Relationships between miR methylation, transcription, GC development, and clinicopathological characteristics were statistically analyzed. Methylation frequency of 5 miR CpG islands (miR-9-1, miR-9-3, miR-137, miR-34b, and miR-210) gradually increased while the proportion of methylated miR-200b gradually decreased during gastric carcinogenesis (Ps < 0.01). More miR-9-1 methylation was detected in 62%-64% of the GC samples and 4% of the normal or gastritis samples (18/28 versus 2/48; Odds ratio, 41.4; P < 0.01). miR-210 methylation showed high correlation with H. pylori infection. miR-375, miR-203, and miR-193b methylation might be host adaptation to the development of GCs. Methylation of these miR CpG islands was consistently shown to significantly decrease the corresponding miRNA levels presented in human cell lines. The inverse relationship was also observed for miR-9-1, miR-9-3, miR-137, and miR-200b in gastric samples. Among 112 GC patients, miR-9-1 methylation was an independent favourable predictor of overall survival of GC patients in both univariate and multivariate analysis (P < 0.02). In conclusion, alteration of methylation status of 6 of 9 tested miR CpG islands was characterized in gastric carcinogenesis. miR-210 methylation correlated with H. pylori infection. miR-9-1 methylation may be a GC-specific event. Methylation of miR CpG islands may
Influence of cerium on passivity behavior of wrought AZ91 alloy
International Nuclear Information System (INIS)
Wang Henan; Li Ying; Wang Fuhui
2008-01-01
In this paper, more focus had been put on the passivity behavior of wrought AZ91 alloy with 1.5 mass% Ce. The passive current density of wrought AZ91 alloy increased with addition of Ce and the passive film became unstable. Structures and compositions of the passive films formed on wrought AZ91 alloy without and with Ce in 0.01 M NaOH aqueous solution were analyzed by potentiostatic polarization, potentiostatic-galvanostatic (P-G) transient technique and X-ray photoelectron spectroscopy (XPS). The results showed that Ce only accumulated in the inner layer of passive film in the form of CeO 2 . Further analysis revealed that there were two main effects of Ce on the passive process of wrought AZ91 alloy: first, the existence of CeO 2 in inner layer of passive film made mass transport through the passive film follow tangent hyperbolic (T) impedance instead of Warburg impedance (W); second, donor concentration (N d ) of the passive film increased by a factor 10 when 1.5 mass% Ce existed in wrought AZ91 alloy, which led to the higher passivity current density
p53 inhibits CRISPR-Cas9 engineering in human pluripotent stem cells.
Ihry, Robert J; Worringer, Kathleen A; Salick, Max R; Frias, Elizabeth; Ho, Daniel; Theriault, Kraig; Kommineni, Sravya; Chen, Julie; Sondey, Marie; Ye, Chaoyang; Randhawa, Ranjit; Kulkarni, Tripti; Yang, Zinger; McAllister, Gregory; Russ, Carsten; Reece-Hoyes, John; Forrester, William; Hoffman, Gregory R; Dolmetsch, Ricardo; Kaykas, Ajamete
2018-06-11
CRISPR/Cas9 has revolutionized our ability to engineer genomes and conduct genome-wide screens in human cells 1-3 . Whereas some cell types are amenable to genome engineering, genomes of human pluripotent stem cells (hPSCs) have been difficult to engineer, with reduced efficiencies relative to tumour cell lines or mouse embryonic stem cells 3-13 . Here, using hPSC lines with stable integration of Cas9 or transient delivery of Cas9-ribonucleoproteins (RNPs), we achieved an average insertion or deletion (indel) efficiency greater than 80%. This high efficiency of indel generation revealed that double-strand breaks (DSBs) induced by Cas9 are toxic and kill most hPSCs. In previous studies, the toxicity of Cas9 in hPSCs was less apparent because of low transfection efficiency and subsequently low DSB induction 3 . The toxic response to DSBs was P53/TP53-dependent, such that the efficiency of precise genome engineering in hPSCs with a wild-type P53 gene was severely reduced. Our results indicate that Cas9 toxicity creates an obstacle to the high-throughput use of CRISPR/Cas9 for genome engineering and screening in hPSCs. Moreover, as hPSCs can acquire P53 mutations 14 , cell replacement therapies using CRISPR/Cas9-enginereed hPSCs should proceed with caution, and such engineered hPSCs should be monitored for P53 function.
Understanding the influence of pH on uptake and accumulation of ionizable pharmaceuticals by fish was recently identified as a major research need. In the present study, fathead minnows were exposed to diphenhydramine (DPH), a weakly basic pharmaceutical (pKa = 9.1). Fish were ...
Deprez, Marie-Anne; Eskes, Elja; Wilms, Tobias; Ludovico, Paula; Winderickx, Joris
2018-01-12
The plasma membrane H + -ATPase Pma1 and the vacuolar V-ATPase act in close harmony to tightly control pH homeostasis, which is essential for a vast number of physiological processes. As these main two regulators of pH are responsive to the nutritional status of the cell, it seems evident that pH homeostasis acts in conjunction with nutrient-induced signalling pathways. Indeed, both PKA and the TORC1-Sch9 axis influence the proton pumping activity of the V-ATPase and possibly also of Pma1. In addition, it recently became clear that the proton acts as a second messenger to signal glucose availability via the V-ATPase to PKA and TORC1-Sch9. Given the prominent role of nutrient signalling in longevity, it is not surprising that pH homeostasis has been linked to ageing and longevity as well. A first indication is provided by acetic acid, whose uptake by the cell induces toxicity and affects longevity. Secondly, vacuolar acidity has been linked to autophagic processes, including mitophagy. In agreement with this, a decline in vacuolar acidity was shown to induce mitochondrial dysfunction and shorten lifespan. In addition, the asymmetric inheritance of Pma1 has been associated with replicative ageing and this again links to repercussions on vacuolar pH. Taken together, accumulating evidence indicates that pH homeostasis plays a prominent role in the determination of ageing and longevity, thereby providing new perspectives and avenues to explore the underlying molecular mechanisms.
24 CFR 91.415 - Strategic plan.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Strategic plan. 91.415 Section 91... CONSOLIDATED SUBMISSIONS FOR COMMUNITY PLANNING AND DEVELOPMENT PROGRAMS Consortia; Contents of Consolidated Plan § 91.415 Strategic plan. Strategies and priority needs must be described in the consolidated plan...
28 CFR 2.91 - Supervision responsibility.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Supervision responsibility. 2.91 Section 2.91 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS District of Columbia Code: Prisoners and Parolees § 2.91 Supervision responsibility. (a) Pursuan...
International Nuclear Information System (INIS)
Trache, L.; Mukhamedzhanov, A.M.; Tribble, R.E.; Carstoiu, F.
2002-06-01
We have used existing data on the one-proton-removal cross section of 9 C at 285 MeV/u and Glauber model calculations to extract the asymptotic normalization coefficient for the wave function of the last proton in the ground state of 9 C. The calculations are done first using folded potentials starting from two different effective nucleon-nucleon interactions and second in the optical limit using three nucleon-nucleon interactions, and the results are found to be consistent, with no new parameters adjusted. We find C 2 (p 3/2 ) + C 2 (p 1/2 ) = 1.22±0.13 fm -1 . From this result we obtain the astrophysical factor for the proton radiative capture reaction 8 B(p,γ) 9 C as S 18 (0) = 46 ± 6 eV.b. The calculated energy dependence of the astrophysical S-factor for the energy region E cm = 0 - 0.8 MeV and the reaction rates for T 9 = 0 - 1 are included. (authors)
3D network single-phase Ni0.9Zn0.1O as anode materials for lithium-ion batteries
DEFF Research Database (Denmark)
Huang, Guoyong; Guo, Xueyi; Cao, Xiao
2016-01-01
A novel 3D network single-phase Ni0.9Zn0.1O has been designed and synthesized by calcining a special metal-organic precursor (MOP) (MeO2C3H6, Me=Ni and Zn, the molar ratio of Ni: Zn=9:1) as the self-sacrificing template for the first time. Comparing with NiO or the mixture of NiO and ZnO, the new...
MiR-9-5p promotes MSC migration by activating β-catenin signaling pathway.
Li, Xianyang; He, Lihong; Yue, Qing; Lu, Junhou; Kang, Naixin; Xu, Xiaojing; Wang, Huihui; Zhang, Huanxiang
2017-07-01
Mesenchymal stem cells (MSCs) have the potential to treat various tissue damages, but the very limited number of cells that migrate to the damaged region strongly restricts their therapeutic applications. Full understanding of mechanisms regulating MSC migration will help to improve their migration ability and therapeutic effects. Increasing evidence shows that microRNAs play important roles in the regulation of MSC migration. In the present study, we reported that miR-9-5p was upregulated in hepatocyte growth factor -treated MSCs and in MSCs with high migration ability. Overexpression of miR-9-5p promoted MSC migration, whereas inhibition of endogenous miR-9-5p decreased MSC migration. To elucidate the underlying mechanism, we screened the target genes of miR-9-5p and report for the first time that CK1α and GSK3β, two inhibitors of β-catenin signaling pathway, were direct targets of miR-9-5p in MSCs and that overexpression of miR-9-5p upregulated β-catenin signaling pathway. In line with these data, inhibition of β-catenin signaling pathway by FH535 decreased the miR-9-5p-promoted migration of MSCs, while activation of β-catenin signaling pathway by LiCl rescued the impaired migration of MSCs triggered by miR-9-5p inhibitor. Furthermore, the formation and distribution of focal adhesions as well as the reorganization of F-actin were affected by the expression of miR-9-5p. Collectively, these results demonstrate that miR-9-5p promotes MSC migration by upregulating β-catenin signaling pathway, shedding light on the optimization of MSCs for cell replacement therapy through manipulating the expression level of miR-9-5p. Copyright © 2017 the American Physiological Society.
Wavelengths of the Ni-like 4d1S0 - 4p1P1 x-ray laser line
International Nuclear Information System (INIS)
Li, Y.; Nilsen, J.; Dunn, J.; Osterheld, A.L.; Ryabtsev, A.; Churilov, S.
1998-01-01
We measure the wavelengths of the Ni-like 3d 9 4d 1 S 0 - 3d 9 4p 1 P 1 x-ray laser line in several low-Z Ni-like ions ranging from Y (Z=39) to Cd (Z=48). These wavelengths are compared with optimized level calculations using a multiconfiguration Dirac-Fock code. With the help of these results, we identify this line to very high accuracy in nonlasing plasmas from As (Z=33) to Mo (Z=42). Accurate values of these wavelengths are essential for performing plasma imaging and interferometry experiments with multilayer optics that use the x-ray laser to backlight other plasmas. These results also provide important atomic data that are currently missing about the energy of the 4d 1 S 0 level in the NiI sequence. copyright 1998 The American Physical Society
International Nuclear Information System (INIS)
Li Ling; Yu Jinming; Xing Ligang; Zhu Hui; Li Guoliang; Fang Yongcun
2006-01-01
Objective: To evaluate relation between hypoxia, hypoxic changes detected by 99m Tc-HL91 SPECT and the response to radiotherapy. Methods: Thirty-five patients with pathologically proven non-small cell lung cancer (NSCLC) treated by three-dimensional conformal radiotherapy were entered into the study. All patients were examined by examined by 99m Tc-HL9l SPECT imaging one or two days before radiotherapy. Twenty patients were monitored during radiotherapy(30-40 Gy) and one or two days after radiotherapy. Anterior', posterior and lateral planar images were collected 2 hours, 4 hours and 6 hours after intravenous injection approximately 740 MBq 99m Tc-HL91. Regions of interest(ROIs) were ch awn in the tumor and contralateral position and the radioactivity ratios of tumor to normal(T/N) were calculated. The response to radiotherapy was evaluated by solid tumor' s effect evaluation criterion (WHO) 3-6 months after radiotherapy. The correlations between T/N before radiotherapy, the T/N changes during radiotherapy and the response to radiotherapy were analyzed. Results: The T/N value gradually decreased before, during and after radiotherapy. The average T/N value before, during and after radiotherapy was 1.56±0.19, 1.40±0.12 and 1.29±0.13, respectively (F=10.13, P=0.010). The lower T/N ratio be- fore radiotherapy, the higher the response rate of radiotherapy (P=0.040). The larger change of T/N ratio before and after radiotherapy resulted in higher radiotherapy response, but with no statistical significance (P>0.05). Conclusions: The hypoxia status and hypoxic changes can be observed by HL91 SPECT imaging during radiotherapy which can predict the response to radiotherapy. (authors)
Variants at the 9p21 locus and melanoma risk
International Nuclear Information System (INIS)
Maccioni, Livia; Rachakonda, Panduranga Sivaramakrishna; Bermejo, Justo Lorenzo; Planelles, Dolores; Requena, Celia; Hemminki, Kari; Nagore, Eduardo; Kumar, Rajiv
2013-01-01
The influence of variants at the 9p21 locus on melanoma risk has been reported through investigation of CDKN2A variants through candidate gene approach as well as by genome wide association studies (GWAS). In the present study we genotyped, 25 SNPs that tag 273 variants on chromosome 9p21 in 837 melanoma cases and 1154 controls from Spain. Ten SNPs were selected based on previous associations, reported in GWAS, with either melanocytic nevi or melanoma risk or both. The other 15 SNPs were selected to fine map the CDKN2A gene region. All the 10 variants selected from the GWAS showed statistically significant association with melanoma risk. Statistically significant association with melanoma risk was also observed for the carriers of the variant T-allele of rs3088440 (540 C>T) at the 3’ UTR of CDKN2A gene with an OR 1.52 (95% CI 1.14-2.04). Interaction analysis between risk associated polymorphisms and previously genotyped MC1R variants, in the present study, did not show any statistically significant association. Statistical significant association was observed for the interaction between phototypes and the rs10811629 (located in intron 5 of MTAP). The strongest association was observed between the homozygous carrier of the A–allele and phototype II with an OR of 15.93 (95% CI 5.34-47.54). Our data confirmed the association of different variants at chromosome 9p21 with melanoma risk and we also found an association of a variant with skin phototypes
Microstructure-based assessment of creep rupture strength in 9Cr steels
International Nuclear Information System (INIS)
Spigarelli, S.
2013-01-01
A microstructure-based model to assess the long-term creep strength in 9Cr steels is proposed. The model takes into account a number of different key issues, including the presence and evolution of the most important families of precipitates (M 23 C 6 , MX, Laves and Z phases), the subgrain recovery process, the different strengthening mechanisms (solid solution strengthening and particle strengthening), and is able to give realistic values of the long-term creep strength in P9, P91 and P911 steels. If properly tuned to describe the mid/long-term precipitation of the Z-phase, and the concurrent dissolution of MX precipitates, the model can also predict the sigmoidal behaviour which leads to the early rupture of single heats of P91 steel. Highlights: ► Creep response at 600 °C of 9% Cr steels. ► Important effect of the different families of precipitates. ► The effect is described by introducing the grain size term in a previously developed model. ► Degradation of particle strengthening effect is considered by calculating the coarsening of the particles.
Directory of Open Access Journals (Sweden)
Marie-Anne Deprez
2018-01-01
Full Text Available The plasma membrane H+-ATPase Pma1 and the vacuolar V-ATPase act in close harmony to tightly control pH homeostasis, which is essential for a vast number of physiological processes. As these main two regulators of pH are responsive to the nutritional status of the cell, it seems evident that pH homeostasis acts in conjunction with nutrient-induced signalling pathways. Indeed, both PKA and the TORC1-Sch9 axis influence the proton pumping activity of the V-ATPase and possibly also of Pma1. In addition, it recently became clear that the proton acts as a second messenger to signal glucose availability via the V-ATPase to PKA and TORC1-Sch9. Given the prominent role of nutrient signalling in longevity, it is not surprising that pH homeostasis has been linked to ageing and longevity as well. A first indication is provided by acetic acid, whose uptake by the cell induces toxicity and affects longevity. Secondly, vacuolar acidity has been linked to autophagic processes, including mitophagy. In agreement with this, a decline in vacuolar acidity was shown to induce mitochondrial dysfunction and shorten lifespan. In addition, the asymmetric inheritance of Pma1 has been associated with replicative ageing and this again links to repercussions on vacuolar pH. Taken together, accumulating evidence indicates that pH homeostasis plays a prominent role in the determination of ageing and longevity, thereby providing new perspectives and avenues to explore the underlying molecular mechanisms.
Influence of MC3T3-E1 preosteoblast culture on the corrosion of a T6-treated AZ91 alloy
Brooks, Emily K.; Tobias, Menachem E.; Yang, Shuying; Bone, Lawrence B.; Ehrensberger, Mark T.
2015-01-01
This study investigated the corrosion of artificially aged T6 heat-treated Mg-9%Al-1%Zn (AZ91) for biomedical applications. Corrosion tests and surface analysis were completed both with and without a monolayer of mouse preosteoblast MC3T3-E1 cells cultured on the sample. Electrochemical impedance spectroscopy (EIS) and inductively coupled plasma mass spectroscopy (ICPMS) were used to explore the corrosion processes after either 3 or 21 days of AZ91 incubation in cell culture medium (CCM). The EIS showed both the inner layer resistance (Rin) and outer layer resistance (Rout) were lower for samples without cells cultured on the surface at 3 days (Rin = 2.64 e4 Ω/cm2, Rout = 140 Ω/cm2) compared to 21 days (Rin = 3.60 e4 Ω/cm2, Rout = 287 Ω/cm2) due to precipitation of magnesium and calcium phosphates over time. Samples with preosteoblasts cultured on the surface had a slower initial corrosion (3 day, Rin = 1.88 e5 Ω/cm2, Rout = 1060 Ω/cm2) which was observed to increase over time (21 day, Rin = 2.99 e4 Ω/cm2, Rout = 287 Ω/cm2). Changes in the corrosion processes were thought to be related to changes in the coverage provided by the cell layer. Our results reveal that the presence of cells and biological processes are able to significantly influence the corrosion rate of AZ91. PMID:25715925
Evaluating high pH for control of dreissenid mussels
Directory of Open Access Journals (Sweden)
Dave Evans
2013-04-01
Full Text Available Two field experiments were carried out using a custom built flow-through laboratory to test the effect of elevated pH on dreissenid musselsas a potential control method. Both experiments tested the ability of dreissenid pediveligers to settle under conditions of elevated pH and thelong-term survival of adult dreissenids under the same conditions. The two experimental sites had different water quality and differentspecies of dreissenids present. The settlement of quagga mussel pediveligers at the lower Colorado River was inhibited with increasing pH.At the maximum achieved pH of 9.1, there was approximately 90% reduction compared to the maximum settlement observed in the controls.Since the settlement was almost as low in pH 8.9 as at pH 9.1, the inhibition in settlement may have been due to the presence of a precipitateformed under high pH conditions rather than the increase in background pH. No mortality of quagga mussel adults was observed in theexperimental pH levels at the lower Colorado River. At San Justo Reservoir, zebra mussel settlement decreased with increasing pH. Newsettlement was almost entirely absent at the highest pH tested (pH 9.6. The observed mortality of adult zebra mussels was low, but did tendto increase with increasing pH. We also tested the response of adult zebra mussels to short-term exposure to very high pH levels (i.e. pH 10,11, and 12. Adult mussels in poor physical condition experienced 90% mortality after 12 hours at pH 12. For unstressed adult zebra mussels,90% mortality was reached after 120 hours at pH 12. Significant mortalities were also observed both at pH 10 and pH 11. From this study,we conclude that pH elevation could be used both as a preventative treatment to eliminate settlement by dreissenid mussels and as an end ofseason treatment to eliminate adults. The high pH treatment would have to be tailored to the site water quality to prevent formation ofprecipitate during treatment and to minimize corrosive
Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-01-01
Dynamics and direct $CP$ violation in three-body charmless decays of charged $B$ mesons to a proton, an antiproton and a light meson (pion or kaon) are studied using data, corresponding to an integrated luminosity of 1.0$ {\\,fb}^{-1}$, collected by the ${LHCb}$ experiment in $pp$ collisions at a center-of-mass energy of 7 TeV. Production spectra are determined as a function of Dalitz-plot and helicity variables. The forward-backward asymmetry of the light meson in the $p\\bar p$ rest frame is measured. No significant $CP$ asymmetry in $B^+ \\to p \\bar p K^+$ decay is found in any region of the Dalitz plane. We present the first observation of the decay $B^+ \\to \\kern 0.1em\\bar{\\kern -0.1em\\Lambda}(1520)(\\to K^+\\bar p)p$ near the $K^+\\bar p$ threshold and measure $\\mathcal{B}(B^+ \\to \\kern 0.1em\\bar{\\kern -0.1em\\Lambda}(1520)p)=(3.9^{+1.0}_{-0.9} (\\mathrm{stat})\\pm0.1 (\\mathrm{syst})\\pm0.3 (\\mathrm{BF}))\\times 10^{-7}$, where BF denotes the uncertainty on secondary branching fractions.
DEEP IMPACT 9P/TEMPEL ENCOUNTER - REDUCED HRII SPECTRA V3.0
National Aeronautics and Space Administration — This dataset contains calibrated, 1.05- to 4.8-micron spectral images of comet 9P/Tempel 1 the acquired by the High Resolution Infrared Spectrometer (HRII) from 20...
Fathead minnows were exposed to diphenhydramine (DPH), a weakly basic pharmaceutical (pKa = 9.1), to examine pH effects on uptake and accumulation. Fish were exposed to 10 ìg/L DPH in water for up to 96 h at three nominal pH levels: 6.7, 7.7, and 8.7. In each case, an appa...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Nuisances. 91.6 Section 91.6 Money and Finance: Treasury Regulations Relating to Money and Finance REGULATIONS GOVERNING CONDUCT IN OR ON... language, unwarranted loitering, unauthorized assembly, the creation of any hazard to persons or things...
Comparison of polarization and analysing power for the 9Be(p,n)9B reaction
International Nuclear Information System (INIS)
Byrd, R.C.; Lisowski, P.W.; Tornow, W.; Walter, R.L.
1983-01-01
A recent Lane model of the 9 Be + nucleon system raised the question of differences between the polarization P(THETA) and the analyzing power A(THETA) in (p, n) reactions between mirror nuclei. Since these two observables are identical under exact charge symmetry, observation of a difference would indicate the breaking of this symmetry, probably by the Coulomb interaction. This paper describes the techniques for measurements of P(THETA) and A(THETA) in (p, n) reactions, with an emphasis on the elimination of systematic errors and the determination of background contributions. Measurements of both observables were made for the 9 Be(p, n 0 ) 9 B reaction at several angles for energies from 3 to 10 MeV. The results are combined with previous measurements to develop data sets for a comprehensive comparison of P(THETA) and A(THETA). Previous A(THETA) values agree well with the present measurements, while most of the earlier P(THETA) data are shown to be in error. Our data show that there do exist sizeable differences between P(THETA) and A(THETA) at energies from Esub(p) = 5-7 MeV. The existence of such differences in light nuclear systems is consistent with recent shell-model calculations for the 11 B(p, n 0 ) 11 C reaction. (orig.)
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander
2014-10-14
The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}
Baryon resonances - a primary ρ→l+l- source in p+p and p+d at 4.9GeV
International Nuclear Information System (INIS)
Winckelmann, L.A.; Sorge, H.; Stoecker, H.; Greiner, W.
1994-10-01
Dilepton spectra for p+p and p+d reactions at 4.9 GeV are calculated. We consider electromagnetic bremsstrahlung also in inealstic reactions. N* and Δ* decays present the major contributions to the q and ω meson yields. Pion annihilation yields only ∼1.5% of all ρ's in p+d. The ρ mass spectrum is strongly distorted due to phase space effects, populating dominantly dilepton masses below 770 MeV. It is found that inclusive production cross sections of ρ, ω and η mesons in p+p are 3-4 times higher than the (measured) exclusive cross sections for pp+meson. This prediction could be checked by measuring the decays of ρ, ω and η mesons into photons. (orig.)
Lysgaard, Maria L.; Eckford-Soper, Lisa; Daugbjerg, Niels
2018-05-01
Continued anthropogenic carbon emissions are expected to cause a decline in global average pH of the oceans to a projected value of 7.8 by the end of the century. Understanding how harmful algal bloom (HAB) species will respond to lowered pH levels will be important when predicting future HAB events and their ecological consequences. In this study, we examined how manipulated pH levels affected the growth rate of three strains of Prymnesium parvum from North America, Denmark and Japan. Triplicate strains were grown under pH conditions ranging from 6.6 to 9.1 to simulate plausible future levels. Different tolerances were evident for all strains. Significantly higher growth rates were observed at pH 6.6-8.1 compared to growth rates at pH 8.6-9.1 and a lower pH limit was not observed. The Japanese strain (NIES-1017) had the highest maximum growth rate of 0.39 divisions day-1 at pH 6.6 but a low tolerance (0.22 divisions day-1) to high levels (pH 9.1) with growth declining markedly after pH 7.6. The Danish (SCCAP K-0081) and North American (UTEX LB 2797) strains had maximum growth rates of 0.26 and 0.35 divisions day-1, respectively between pH 6.6-8.1. Compared to the other two strains the Danish strain had a statistically lower growth rate across all pH treatments. Strain differences were either attributed to their provenance or the length of time the strain had been in culture.
Energy Technology Data Exchange (ETDEWEB)
Wu, Zheng [School of Materials Science and Technology, China University of Geosciences, Beijing (China); Department of Physics and College of Geography and Environmental Sciences, Zhejiang Normal University, Jinhua (China); Zhang, Yihe [School of Materials Science and Technology, China University of Geosciences, Beijing (China); Fang, Cong; Ma, Ke; Lin, He; Jia, Yanmin; Chen, Jianrong [Department of Physics and College of Geography and Environmental Sciences, Zhejiang Normal University, Jinhua (China); Wang, Yu; Chan, Helen Lai Wa [Department of Applied Physics, The Hong Kong Polytechnic University (China)
2014-03-15
High photovoltaic efficiency is a key index in the application of silicon (Si) solar cells. In this study, a composite of a photovoltaic Si p-n junction solar cell and a magnetostrictive Tb{sub x}Dy{sub 1-x}Fe{sub 2} alloy was fabricated. By utilizing the magnetostrictive strain to modulate the energy bandgap of Si, the open-circuit voltage and the maximum photovoltaic output power of the Si p-n junction solar cell could be enhanced by ∝12% and 9.1% under a dc magnetic field of ∝250 mT, respectively. The significantly enhanced photovoltaic performance and the simple fabrication process make the Si-p-n/Tb{sub x}Dy{sub 1-x}Fe{sub 2} composite a promising material for high-efficiency solar cell devices. The structure of the proposed Si-p-n/Tb{sub x}Dy{sub 1-x}Fe{sub 2} laminated composite. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
An experimental study of 99Tcm-HL91 in detection of myocardial viability
International Nuclear Information System (INIS)
Xu Tao; Liu Baoping; Meng Yubao; Sun Bingqi; Niu Guangjun; Han Xingmin; Yuan Qiao
2005-01-01
Objective: To investigate whether 99 Tc m -4,9-diaza-3,3,10,10-tetramethyldodecan-2,11-dione dioxime (HL91) can be used to distinguish ischemic myocardium segments from infarction segments. Methods: Twenty-five acute myocardial infarction patients (≤6 weeks) and 5 old myocardial infarction patients (> 6 weeks) were included in the study. All the study patients underwent 99 Tc m -HL91 and 99 Tc m -methoxyisobutylisonitrile (MIBI) imaging intervented and unintervented with nitroglycerin, and the myocardium segments were divided into three groups according to 99 Tc m -MIBI imaging results: normal, ischemic, and infarction myocardium segments. The difference of the radial counts of 99 Tc m -HL91 in three groups were analyzed after the imaging with 99 Tc m -HL91. Results: 1) In acute myocardial infarction patients, the accumulation rates of 99 Tc m -HL91 was 95% in normal segment group, 157% in ischemic group, 93% in infarction group. The accumulation rates of 99 Tc m -HL91 in the ischemic group was higher than that in the normal group and infarction group. 2)In old myocardial infarction patients, the accumulation rates of 99 Tc m -HL91 were of no difference among the normal, ischemic, and infarction groups. Conclusion: 99 Tc m -HL91 is a potential marker for detecting the ischemic myocardial tissue. (authors)
Complex reassortment events of unusual G9P[4] rotavirus strains in India between 2011 and 2013.
Doan, Yen Hai; Suzuki, Yoshiyuki; Fujii, Yoshiki; Haga, Kei; Fujimoto, Akira; Takai-Todaka, Reiko; Someya, Yuichi; Nayak, Mukti K; Mukherjee, Anupam; Imamura, Daisuke; Shinoda, Sumio; Chawla-Sarkar, Mamta; Katayama, Kazuhiko
2017-10-01
Rotavirus A (RVA) is the predominant etiological agent of acute gastroenteritis in young children worldwide. Recently, unusual G9P[4] rotavirus strains emerged with high prevalence in many countries. Such intergenogroup reassortant strains highlight the ongoing spread of unusual rotavirus strains throughout Asia. This study was undertaken to determine the whole genome of eleven unusual G9P[4] strains detected in India during 2011-2013, and to compare them with other human and animal global RVAs to understand the exact origin of unusual G9P[4] circulating in India and other countries worldwide. Of these 11 RVAs, four G9P[4] strains were double-reassortants with the G9-VP7 and E6-NSP4 genes on a DS-1-like genetic backbone (G9-P[4]-I2-R2-C2-M2-A2-N2-T2-E6-H2). The other strains showed a complex genetic constellation, likely derived from triple reassortment event with the G9-VP7, N1-NSP2 and E6-NSP4 on a DS-1-like genetic backbone (G9-P[4]-I2-R2-C2-M2-A2-N1-T2-E6-H2). Presumably, these unusual G9P[4] strains were generated after several reassortment events between the contemporary co-circulating human rotavirus strains. Moreover, the point mutation S291L at the interaction site between inner and outer capsid proteins of VP6 gene may be important in the rapid spread of this unusual strain. The complex reassortment events within the G9[4] strains may be related to the high prevalence of mixed infections in India as reported in this study and other previous studies. Copyright © 2017. Published by Elsevier B.V.
Barros, Érika Aparecida Felix de; Pontes-Junior, José; Reis, Sabrina Thalita; Lima, Amanda Eunice Ramos; Souza, Isida C; Salgueiro, Jose Lucas; Fontes, Douglas; Dellê, Humberto; Coelho, Rafael Ferreira; Viana, Nayara Izabel; Leite, Kátia Ramos Moreira; Nahas, William C; Srougi, Miguel
2017-05-04
Some studies have reported that deletions at chromosome arm 9p occur frequently and represent a critical step in carcinogenesis of some neoplasms. Our aim was to evaluate the deletion of locus 9p21 and chromosomes 3, 7 and 17 in localized prostate cancer (PC) and correlate these alterations with prognostic factors and biochemical recurrence after surgery. We retrospectively evaluated surgical specimens from 111 patients with localized PC who underwent radical prostatectomy. Biochemical recurrence was defined as a prostate-specific antigen (PSA) >0.2 ng/mL and the mean postoperative follow-up was 123 months. The deletions were evaluated using fluorescence in situ hybridization with centromeric and locus-specific probes in a tissue microarray containing 2 samples from each patient. We correlated the occurrence of any deletion with pathological stage, Gleason score, ISUP grade group, PSA and biochemical recurrence. We observed a loss of any probe in only 8 patients (7.2%). The most common deletion was the loss of locus 9p21, which occurred in 6.4% of cases. Deletions of chromosomes 3, 7 and 17 were observed in 2.3%, 1.2% and 1.8% patients, respectively. There was no correlation between chromosome loss and Gleason score, ISUP, PSA or stage. Biochemical recurrence occurred in 83% cases involving 9p21 deletions. Loss of 9p21 locus was significantly associated with time to recurrence (p = 0.038). We found low rates of deletion in chromosomes 3, 7 and 17 and 9p21 locus. We observed that 9p21 locus deletion was associated with worse prognosis in localized PC treated by radical prostatectomy.
Structural, magnetic and transport properties of Mn3.1Sn0.9 and Mn3.1Sn0.9N compounds
International Nuclear Information System (INIS)
Feng, W.J.; Li, D.; Ren, W.J.; Li, Y.B.; Li, W.F.; Li, J.; Zhang, Y.Q.; Zhang, Z.D.
2007-01-01
The cubic anti-perovskite Mn 3.1 Sn 0.9 N compound is prepared via nitrogenation of the hexagonal Mn 3.1 Sn 0.9 compound. A magnetic phase diagram of Mn 3.1 Sn 0.9 compound is constructed by analysis of data of its magnetic properties. For Mn 3.1 Sn 0.9 N compound, parasitic ferromagnetism exists in the temperature range of 5-370 K, besides a spin-reorientation at about 280 K. Mn 3.1 Sn 0.9 compound exhibits a metallic conducting behavior, while Mn 3.1 Sn 0.9 N displays a metal-nonmetal transition due to the electron localization caused by the static disorder. The differences of the physical properties between the both compounds, are discussed, in terms of the correlation of the hexagonal DO 19 and the cubic anti-perovskite structures, the reduction of the distances between Mn atoms, and the spin-pairing or charge transfer effect due to the electron donation by N 2p to Mn 3d states after introduction of N atoms into the interstitial sites of Mn 3.1 Sn 0.9 compound
Reininghaus, Eva Z; Lackner, Nina; Birner, Armin; Bengesser, Susanne; Fellendorf, Frederike T; Platzer, Martina; Rieger, Alexandra; Queissner, Robert; Kainzbauer, Nora; Reininghaus, Bernd; McIntyre, Roger S; Mangge, Harald; Zelzer, Sieglinde; Fuchs, Dietmar; Dejonge, Silvia; Müller, Norbert
2016-03-01
Matrix metallopeptidase 9 (MMP9) and soluble intercellular adhesion molecule 1 (sICAM-1) are both involved in the restructuring of connective tissues. Evidence also implicates MMP9 and sICAM in cardiovascular and neoplastic diseases, where blood levels may be a marker of disease severity or prognosis. In individuals with bipolar disorder (BD), higher risk for cardiovascular illness has been extensively reported. The aim of this investigation was to measure and compare peripheral levels of serum MMP9 and sICAM in adults with euthymic BD and healthy controls (HC). Furthermore, we focussed on correlations with illness severity and metabolic parameters. MMP9 levels among the BD sample (n = 112) were significantly higher than among the HC (n = 80) (MMP9: F = 9.885, p = 0.002, η(2) = 0.058) after controlling for confounding factors. Patients with BD in a later, progressive stage of disease showed significantly higher MMP9 as well as sICAM-1 levels compared to patients with BD in an earlier stage of disease (MMP9: F = 5.8, p = 0.018, η(2) = 0.054; sICAM-1: F = 5.6, p = 0.020, η(2) = 0.052). Correlation analyses of cognitive measures revealed a negative association between performance on the d2 Test of Attention and MMP9 (r = -0.287, p = 0.018) in the BD sample. Despite the sample being euthymic (i.e., according to conventional criteria) at the time of analysis, we found significant correlations between MMP9 as well as sICAM-1 and subthreshold depressive/hypomanic symptoms. A collection of disparate findings herein point to a role of MMP9 and cICAM-1 in the patho-progressive process of BD: the increased levels of serum MMP9 and sICAM-1, the correlation between higher levels of these parameters, progressive stage, and cognitive dysfunction in BD, and the positive correlation with subthreshold symptoms. As sICAM-1 and MMP9 are reliable biomarkers of inflammatory and early atherosclerotic disease, these markers may provide indications of the
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Definitions. 91.5 Section 91.5 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... disability at the time of his or her death. Poverty level family. Family with an income below the poverty...
Study of the D(p,π+)T and 9Be(p,π+)10Be from 400 to 800MeV
International Nuclear Information System (INIS)
Aslanides, E.; Bauer, T.; Bertini, R.; Beurtey, R.; Bimbot, L.; Bing, O.; Boudard, A.; Brochard, F.; Bruge, G.; Catz, H.; Chaumeaux, A.; Couvert, P.; Duchazeaubeneix, J.C.; Duhm, H.; Garreta, D.; Gorodetzky, P.; Habault, J.; Hibou, F.; Igo, G.; Le Bornec, Y.; Lugol, J.C.; Matoba, M.; Tatischeff, B.; Terrien, Y.
Pion production on CD 2 and 9 Be targets has been observed using the high resolution, energy loss, spectrometer SPES I. Differential cross sections for the D(p,π + ) reaction have been determined at 410, 605 and 809MeV and for the 9 Be(p,π + ) reaction at 410 and 605MeV. The 3.37MeV (2 + ) state in 10 Be is populated preferentially, but a significant part of the transition strength seems to populate the ground state and the higher lying multiplets at about 6.1MeV, 7.4MeV and 9.4MeV [fr
40 CFR 91.603 - Applicability of part 91, subpart F.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Applicability of part 91, subpart F. 91.603 Section 91.603 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... best of (Company Name) knowledge, true and accurate. I am aware of the penalties associated with...
Influence of MC3T3-E1 preosteoblast culture on the corrosion of a T6-treated AZ91 alloy.
Brooks, Emily K; Tobias, Menachem E; Yang, Shuying; Bone, Lawrence B; Ehrensberger, Mark T
2016-02-01
This study investigated the corrosion of artificially aged T6 heat-treated Mg-9%Al-1%Zn (AZ91) for biomedical applications. Corrosion tests and surface analysis were completed both with and without a monolayer of mouse preosteoblast MC3T3-E1 cells cultured on the sample. Electrochemical impedance spectroscopy (EIS) and inductively coupled plasma mass spectroscopy (ICPMS) were used to explore the corrosion processes after either 3 or 21 days of AZ91 incubation in cell culture medium (CCM). The EIS showed both the inner layer resistance (Rin ) and outer layer resistance (Rout ) were lower for samples without cells cultured on the surface at 3 days (Rin = 2.64 e4 Ω/cm(2) , Rout = 140 Ω/cm(2) ) compared to 21 days (Rin = 3.60 e4 Ω/cm(2) , Rout = 287 Ω/cm(2) ) due to precipitation of magnesium and calcium phosphates over time. Samples with preosteoblasts cultured on the surface had a slower initial corrosion (3 day, Rin = 1.88 e5 Ω/cm(2) , Rout = 1060 Ω/cm(2) ) which was observed to increase over time (21 day, Rin = 2.99 e4 Ω/cm(2) , Rout = 287 Ω/cm(2) ). Changes in the corrosion processes were thought to be related to changes in the coverage provided by the cell layer. Our results reveal that the presence of cells and biological processes are able to significantly influence the corrosion rate of AZ91. © 2015 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Henklein Peter
2009-12-01
Full Text Available Abstract Background The equine infection anemia virus (EIAV p9 Gag protein contains the late (L- domain required for efficient virus release of nascent virions from the cell membrane of infected cell. Results In the present study the p9 protein and N- and C-terminal fragments (residues 1-21 and 22-51, respectively were chemically synthesized and used for structural analyses. Circular dichroism and 1H-NMR spectroscopy provide the first molecular insight into the secondary structure and folding of this 51-amino acid protein under different solution conditions. Qualitative 1H-chemical shift and NOE data indicate that in a pure aqueous environment p9 favors an unstructured state. In its most structured state under hydrophobic conditions, p9 adopts a stable helical structure within the C-terminus. Quantitative NOE data further revealed that this α-helix extends from Ser-27 to Ser-48, while the N-terminal residues remain unstructured. The structural elements identified for p9 differ substantially from that of the functional homologous HIV-1 p6 protein. Conclusions These structural differences are discussed in the context of the different types of L-domains regulating distinct cellular pathways in virus budding. EIAV p9 mediates virus release by recruiting the ALG2-interacting protein X (ALIX via the YPDL-motif to the site of virus budding, the counterpart of the YPXnL-motif found in p6. However, p6 contains an additional PTAP L-domain that promotes HIV-1 release by binding to the tumor susceptibility gene 101 (Tsg101. The notion that structures found in p9 differ form that of p6 further support the idea that different mechanisms regulate binding of ALIX to primary versus secondary L-domains types.
Energy Technology Data Exchange (ETDEWEB)
Vinolin, Ada [Dept. of Physics, Madurai Kamaraj University College, Alagarkoil Road, Madurai-625002. India (India); Peter, A. John, E-mail: a.john.peter@gmail.com [Dept. of Physics, Govt. Arts College, Melur-625106. Madurai. India (India)
2015-06-24
Magneto-LO-polaron in a cylindrical GaAs{sub 0.9} P{sub 0.1} / GaAs{sub 0.6} P{sub 0.4} quantum dot is investigated taking into consideration of geometrical confinement effect. The effects of phonon on the exciton binding energy and the interband emission energy as a function of dot radius are found. The calculations are performed within the single band effective mass approximation using the variational method based on the Lee-Low-Pine LLP transformation.
Lee, Hojung; Ro, Jae Y
2015-01-01
Glycogen synthase kinase 3β (GSK3β) and phosphorylated GSK3β at Ser9 (pS9GSK3β) are crucial in cellular proliferation and metabolism. GSK3β and pS9GSK3β are deregulated in many diseases including tumors. Data on altered expression of GSK3β and pS9GSK3β are mainly limited to tumor tissues, thus the expression of GSK3β and pS9GSK3β in normal human tissue has been largely unknown. Thus, we examined the immunohistochemical localization of GSK3β and pS9GSK3β in human fetal and adult tissues, and also compared the expression pattern of GSK3β and pS9GSK3β with that of the CK7 and CK20. We found GSK3β expression in neurons of brain, myenteric plexus in gastrointestinal tract, squamous epithelium of skin, and mammary gland. The expression of pS9GSK3β was restricted to the epithelial cells of breast and pancreaticobiliary duct, distal nephron of kidney, gastrointestinal tract, fallopian tube, epididymis, secretory cell of prostatic gland, and umbrella cell of urinary tract. The staining pattern of pS9GSK3β and CK7 was overlapped in most organs except for gastrointestinal tract where CK7 was negative and CK20 was positive. Our results show that the expression of GSK3β may be associated with differentiation of ectodermal derived tissues and pS9GSK3β with that of epithelial cells of endodermal derived tissues in human. In addition, the expression of pS9GSK3β in the selective epithelial cells may indicate its association with secretory or barrier function of specific cells and may serve as another immunohistochemical marker for epithelial cells.
DEFF Research Database (Denmark)
Larsen, Thomas Stauffer; Hasselbalch, Hans Carl; Pallisgaard, Niels
2007-01-01
Chromosomal aberrations in polycythemia vera (PV) are heterogenous and nonrandom. A prognostic predictive value of these aberrations has not been established. The V617F mutation in the JAK2 gene on chromosome 9p24.1 was identified recently in peripheral blood leukocytes in the majority of patients...
Luminescence of YbP3O9 upon excitation in the UV-VUV range
International Nuclear Information System (INIS)
Stryganyuk, G; Trots, D; Berezovskaya, I; Shalapska, T; Voloshinovskii, A; Dotsenko, V; Zimmerer, G
2007-01-01
X-ray powder diffraction and luminescence spectral-kinetic studies have been performed for ytterbium metaphosphate (YbP 3 O 9 ) in the 12-290 K temperature range. The diffraction investigation has shown YbP 3 O 9 to be of monoclinic P 2 1 /c structure at T = 12-290 K. Charge transfer luminescence originating from Yb 3+ ion has been revealed. The carrier confinement within the Yb 3+ charge transfer state is pronounced at T = 12 K. A tendency has been revealed for charge carriers in YbP 3 O 9 to be localized in a trapped exciton state at room temperature. The quenching mechanisms for Yb 3+ charge transfer luminescence and processes competing with the formation of the Yb 3+ charge transfer state are discussed
Takács, S; Tarkanyi, F; Hermanne, A; Sonck, M
2003-01-01
The use of the sup 9 sup 9 Mo -> sup 9 sup 9 sup m Tc generator in nuclear medicine is well established world wide. The production of the sup 9 sup 9 Mo (T sub 1 sub / sub 2 = 66 h) parent as a fission product of sup 2 sup 3 sup 5 U is largely based on the use of reactor technology. From the early 1990's accelerator based production methods to provide either direct produced sup 9 sup 9 sup m Tc or the parent sup 9 sup 9 Mo, were studied and suggested as potential alternatives to the reactor based production of sup 9 sup 9 Mo. A possible pathway for the charged particle production of sup 9 sup 9 sup m Tc and sup 9 sup 9 Mo is irradiation of molybdenum metal with protons via the reaction sup 1 sup 0 sup 0 Mo(p,2n) sup 9 sup 9 sup m Tc and sup 1 sup 0 sup 0 Mo(p,pn) sup 9 sup 9 Mo, respectively. The earlier published excitation functions show large differences in their maximum that result in large differences in the calculated yields. Study the excitation function for these proton-induced reactions was decided. ...
Energy Technology Data Exchange (ETDEWEB)
Jiang, L.C.; Huang, S.Y.; Zhang, D.S.; Zhang, S.H.; Li, W.G.; Zheng, P.H.; Chen, Z.W. [Shandong Provincial Hospital Affiliated to Shandong University, Department of Oral and Maxillofacial Surgery, Jinan, China, Department of Oral and Maxillofacial Surgery, Shandong Provincial Hospital Affiliated to Shandong University, Jinan (China)
2014-03-03
Beclin 1 plays a critical role in autophagy and functions as a haploinsufficient tumor suppressor. The expression and prognostic significance of beclin 1 in head and neck adenoid cystic carcinoma (ACC) are largely unexplored. Therefore, we investigated the expression of beclin 1, Bcl-2, and p53 in head and neck ACC tissue. Tissue samples from 35 cases (15 females, 20 males) of head and neck ACC were utilized for immunohistochemistry. Beclin 1 expression was observed in 32 cases (91.4%) and considered to be high in 15 cases (42.9%) and low in 20 cases (57.1%). Beclin 1 expression was significantly correlated with a histological growth pattern (P=0.046) and histological grade (P=0.037). Beclin 1 expression was inversely correlated with Bcl-2 expression (P=0.013) and significantly associated with overall survival (P=0.006). Bcl-2 and p53 expression were observed in 21 cases (60.0%) and 16 cases (45.7%). Bcl-2 expression was significantly correlated with perineural invasion (P=0.041) and not associated with overall survival (P=0.053). p53 expression was directly correlated with beclin 1 expression (P=0.044). Our results indicated that beclin 1 may be a novel, promising prognostic factor for clinical outcome in head and neck ACC patients and may play a part in the development of head and neck ACC by interacting with Bcl-2 and p53.
Rare human diseases: 9p deletion syndrome
Directory of Open Access Journals (Sweden)
Galagan V.O.
2014-09-01
Full Text Available Objective of the study was to review the anamnesis, pheno - and genotype in patients with rare chromosome disorders such as 9p deletion syndrome. Genetic methods of investigation (clinical and genealogical, cytogenetic, FISH- method, paraclinical and instrumental methods of examination were used. Karyotyping was performed by the G-method of differential staining of chromosomes. Only three cases of pathology were diagnosed in the Medical Genetics Center over the last 10 years. By anamnesis data nobody in the probands’ families had bad habits, was exposed to occupational hazards, took part in the elimination of the Chernobyl accident or lived in contaminated areas. Clinical signs of diseases have not been identified in probands’ parents. All probands had trigonocephaly, bilateral epicanthal folds, ocular hypertelorism, downslanting palpebral fissures, long philtrum, flat face and nasal bridge, low set ears with malformed auricles. Two patients of three ones had exophthalmos, contracture of the second and third fingers, abnormal external genitalia. In all three cases there was monosomy of chromosome 9 of critical segment p 24. Normal karyotypes were seen in all parents, so there were three cases of new mutations of 9p deletion syndrome. Retardation of physical, psycho-spech, mental development in proband with or without congenital anomalies requires medical genetic counseling in a specialized institution. Cases of reproductive loss in anamnesis require cytogenetic investigation of fetal membranes and amniotic fluid.
Rodriguez, A M; Graef, A J; LeVine, D N; Cohen, I R; Modiano, J F; Kim, J-H
2015-01-01
Sphingosine-1-phosphate (S1P) is a key biolipid signaling molecule that regulates cell growth and survival, but it has not been studied in tumors from dogs. S1P/S1P1 signaling will contribute to the progression of hemangiosarcoma (HSA). Thirteen spontaneous HSA tissues, 9 HSA cell lines, 8 nonmalignant tissues, including 6 splenic hematomas and 2 livers with vacuolar degeneration, and 1 endothelial cell line derived from a dog with splenic hematoma were used. This was a retrospective case series and in vitro study. Samples were obtained as part of medically necessary diagnostic procedures. Microarray, qRT-PCR, immunohistochemistry, and immunoblotting were performed to examine S1P1 expression. S1P concentrations were measured by high-performance liquid chromatography/mass spectrometry. S1P signaling was evaluated by intracellular Ca(2+) mobilization; proliferation and survival were evaluated using the MTS assay and Annexin V staining. Canine HSA cells expressed higher levels of S1P1 mRNA than nonmalignant endothelial cells. S1P1 protein was present in HSA tissues and cell lines. HSA cells appeared to produce low levels of S1P, but they selectively consumed S1P from the culture media. Exogenous S1P induced an increase in intracellular calcium as well as increased proliferation and viability of HSA cells. Prolonged treatment with FTY720, an inhibitor of S1P1 , decreased S1P1 protein expression and induced apoptosis of HSA cells. S1P/S1P1 signaling pathway functions to maintain HSA cell viability and proliferation. The data suggest that S1P1 or the S1P pathway in general could be targets for therapeutic intervention for dogs with HSA. Copyright © 2015 The Authors. Journal of Veterinary Internal Medicine published by Wiley Periodicals, Inc. on behalf of the American College of Veterinary Internal Medicine.
da Costa, Marianges Zadrozny Gouvêa; Pires, Júlia Glória Lucatelli; Nasser, Paulo Dominguez; Ferreira, Camila da Silva; Teixeira, Ana Cristina de Sá; Paranaguá-Vezozzo, Denise Cerqueira; Guarita, Dulce Reis; Carrilho, Flair José; Ono, Suzane Kioko
2016-10-01
This study aimed to investigate the association between chronic pancreatitis and smoking or genetic mutations. The study sample comprised 148 patients with chronic pancreatitis, 110 chronic alcoholic subjects without pancreatic disease, and 297 volunteer blood donors. Of the patients with chronic pancreatitis, 74% had alcoholic etiology and 26% had idiopathic pancreatitis. The frequency of smoking was 91.4% in patients with alcoholic pancreatitis, higher than 73.3% in alcoholic subjects without pancreatitis (P pancreatitis and blood donors. The N34S mutation of serine peptidase inhibitor, Kazal type 1 (SPINK1) was found in 2.7% of patients with chronic alcoholic pancreatitis, in 5.3% of patients with idiopathic pancreatitis, and in 0.4% of blood donors (P = 0.02). The P55S mutation of SPINK1 was found in 2.7% of patients with alcoholic pancreatitis and in 0.7% of blood donors (P = 0.12). The R254W mutation of chymotrypsin C was found in 0.9% of patients with alcoholic pancreatitis, in 0.9% of chronic alcoholic subjects without pancreatitis, and in 0.4% of blood donors (P = 0.75). In all cases, the mutations were heterozygous. Smoking and the N34S mutation of SPINK1 were positively correlated with chronic pancreatitis.
DEFF Research Database (Denmark)
Mortensen, Niels Gylling; Heathfield, D.N.; Myllerup, Lisbeth
. The analysis part consists of a transformation of an observed wind climate (speed and direction distributions) to a wind atlas data set. The wind atlas data set can subsequently be applied for estimation of the wind climate and wind power potential, as well as for siting of specific wind turbines. The WAsP 9...
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
An International Multidisciplinary Journal, Ethiopia ... establishing universities, the peculiarity of university students as elites in .... often have access to such information and ideas that they can use to articulate issues .... rejected, the Structural Adjustment Programme (SAP) for example, and this .... Asian Survey: 15(6) 499.
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
ODL is also multimodal, as it uses the various delivery systems and learning ... system based solely on printed materials, distributed by post; open education is a system of ... by sending them evaluation and examination materials by post as well. .... It saves money, time, and energy of the participants by allowing them to.
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
values are fast shifting with changes in Ikwerre religious beliefs and practices. Records such ... to Ali deity. However, the story of the impact of Christianity and other agents .... eat food cooked by a woman in menstruation, or to sit or have sexual intercourse on .... It was the fear that one might die bad death either with swollen ...
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
conducted on accounting students and the analysis will be by inferential statistics –. Analysis of ... insensitivity to the nature of Biology when planning instructional activities in the classroom. ..... Teaching effectively, Owerri: Career Publishers.
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
advantaged students, while social life was dictated by tribal affiliation. Soyinka ... the civil war that was then ravaging the country. .... Deebam, the SVC created a second confraternity wing, the Icelanders (German), ..... Monograph, Unibadan.
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
events and their effects are still felt today. The truth is .... The resultant effect is a continental .... the family, send her children to school and intrinsically develop her community. Developing the .... continue to be a pipe dream and infantile fantasy.
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
from the seizure of ivory (from ivory raids) buying of tusks from the interior or through direct .... products like textile, footwear, cigarette, processed foods and beverages cum cement .... preferences and behaviour of warring parties. This type of ...
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
market efficiently. And the supervisory role of CBN should roll up their sleeves to do ... banks in economic growth and development explain why each economy seeks ... monetary policy will be reduced in direct proportion to the extent of loss of ... choke the development of the financial intermediation, but it also encourages.
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
demarcated by natural and artificial means such as shrines. So, what the ..... equipment being poured into Esan and the roads and bridges which were constructed .... admirers who demanded for the materials (N.A.I. Intelligence Report,1982).
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
The findings of this work have strong implications on education and health policies and ... connotes the ability to lead a socially and economically productive life (Anyawu et.al,. 1997). ..... The effect of this back drop is unemployment, balance of.
28 CFR 9.1 - Authority, purpose, and scope.
2010-07-01
... have knowledge of, the conduct that resulted in the property being subject to forfeiture and, where... grant remission and mitigation is delegated to the Chief, Asset Forfeiture and Money Laundering Section...
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
Key words: Boko Haram, poverty, terrorism, extremism, democracy, governance, insurgency ... The rise of Boko Haram in Nigeria has been ascribed to bad leadership, mass poverty, unemployment, social ...... Taliban-Style State. In Associated ...
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
model empirically. The role of exchange rate and its effects on macroeconomic ... Literature review. A great deal of attention has been given to the relationship between oil prices .... equilibrium is completed within the first quarter. THE IMPACT ...
4 CFR 9.1 - GAO Senior Executive Service.
2010-01-01
... performance and success in meeting equal employment opportunity goals); (3) Assure that senior executives are..., political activity, and conflicts of interest; (12) Provide for the initial and continuing systematic...
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
Knowledge, Attitude and Practice of Family Planning Among. Air Men in ... a country roughly the size of Arizona, New Mexico and Nevada. She further ... rate is nearly 50% for urban area ages 15 to 24 - driving crime and discontent. In. October ...
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
This is a study on Christ Army Church and socio-cultural changes in Khana Local ... serve as an outlet for frustrated leadership talent (Mbiti, 1969). ... on organisation, structure and ecclesiastical hierarchy but on the gift of the Holy .... men, diviners, witches and oracles, myths, symbols, ritual ceremonies, sacrifices from.
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
against this backdrop that this paper examines the Igala ontology which is about .... general and cosmology which discusses the origin, structure and space - time ..... It is an important key to the knowledge of a people's culture and philosophy.
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
parents to provide better educational opportunities to their children. This study ... economic, and political status (Rahuman and Uddin, 2009). Njuguna .... academic achievement of students is a fundamental criterion to measure standards of.
Energy Technology Data Exchange (ETDEWEB)
Hori, Satoshi [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Suzuki, Kota; Hirayama, Masaaki [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Department of Chemical Science and Engineering, School of Materials and Chemical Technology, Tokyo Institute of Technology, Yokohama (Japan); Kato, Yuki [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Battery Research Division, Higashifuji Technical Center, Toyota Motor Corporation, Susono, Shizuoka (Japan); Battery AT, Advanced Technology 1, Toyota Motor Europe NV/SA, Zaventem (Belgium); Kanno, Ryoji, E-mail: kanno@echem.titech.ac.jp [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Department of Chemical Science and Engineering, School of Materials and Chemical Technology, Tokyo Institute of Technology, Yokohama (Japan)
2016-12-07
Lithium superionic conductors with the Li{sub 10}GeP{sub 2}S{sub 12} (LGPS)-type structure are promising materials for use as solid electrolytes in the next-generation lithium batteries. A novel member of the LGPS family, Li{sub 9.42}Si{sub 1.02}P{sub 2.1}S{sub 9.96}O{sub 2.04} (LSiPSO), and its solid solutions were synthesized by quenching from 1273 K in the Li{sub 2}S–P{sub 2}S{sub 5}–SiO{sub 2} pseudoternary system. The material exhibited an ionic conductivity as high as 3.2 × 10{sup −4} S cm{sup −1} at 298 K, as well as the high electrochemical stability to lithium metal, which was improved by the introduction of oxygen into the LGPS-type structure. An all-solid-state cell with a lithium metal anode and LSiPSO as the separator showed excellent performance with a high reversibility of 100%. Thus, oxygen doping is an effective way of improving the electrochemical stability of LGPS-type structure.
Stewart, Lucy R; Hwang, Min Sook; Falk, Bryce W
2009-11-01
Interactions of Lettuce infectious yellows virus (LIYV)-encoded proteins were tested by yeast-two-hybrid (Y2H) assays. LIYV-encoded P34, Hsp70h, P59, CP, CPm, and P26 were tested in all possible pairwise combinations. Interaction was detected only for the P26-P26 combination. P26 self-interaction domains were mapped using a series of N- and C-terminal truncations. Orthologous P26 proteins from the criniviruses Beet pseudoyellows virus (BPYV), Cucurbit yellow stunting disorder virus (CYSDV), and Lettuce chlorosis virus (LCV) were also tested, and each exhibited strong self-interaction but no interaction with orthologous proteins. Two small putative proteins encoded by LIYV RNA2, P5 and P9, were also tested for interactions with the six aforementioned LIYV proteins and each other. No interactions were detected for P5, but P9-P9 self-interaction was detected. P26- and P9-encoding genes are present in all described members of the genus Crinivirus, but are not present in other members of the family Closteroviridae. LIYV P26 has previously been demonstrated to induce a unique LIYV cytopathology, plasmalemma deposits (PLDs), but no role is yet known for P9.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Base level. 91.861 Section 91.861... level. (a) U.S. Operators. The base level of a U.S. operator is equal to the number of owned or leased... to paragraphs (a) (1) and (2). (1) The base level of a U.S. operator shall be increased by a number...
31 CFR 91.4 - Preservation of property.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Preservation of property. 91.4 Section 91.4 Money and Finance: Treasury Regulations Relating to Money and Finance REGULATIONS GOVERNING CONDUCT IN OR ON THE BUREAU OF THE MINT BUILDINGS AND GROUNDS § 91.4 Preservation of property. It shall be...
Gicquel, Adeline; Bockelée-Morvan, D.; Kelley, M. S.; Woodward, C. E.
2009-09-01
The Deep Impact (DI) spacecraft encountered comet 9P/Tempel 1 on July 4th, 2005 (rh = 1.506 AU). Spectral maps covering 20'' x 67'' (1.85''/pixel) were acquired with the IRS instrument on the Spitzer Space Telescope (ΔSpitzer = 0.72 AU) at different times around the Deep Impact event: twice before impact (TI-41.3hrs and TI-22.9hrs) and twelve times after impact (between TI+0.67hrs and TI+1027hrs). These IRS observations (Lisse et al 2006, Sciences 313, 635) were taken from the Spitzer data archive. We present the interpretation of 5.2-7.6 µm spectra obtained in the second order of the short-wavelength module (SL2). To reduce the contribution of artifacts in the spectra, 5x5 pixel extraction apertures (9.25''x9.25'') were used. On the first stage we studied the water ν2 vibrational band emission at 6.4µm, which is present in most spectra. The water production rate before impact is deduced ( 4.25e27 molecules/sec). In order to study both the amount and origin of the water molecules released after impact, we used extractions centered on the nucleus and along the length of the slit. We analyzed the spatial distribution of water and its time evolution with a time-dependent model which describes the evolution of the water cloud after impact. The underlying continuum in the spectra provides information on the evolution and color temperature of the dust ejecta. The dust mass and dust/gas ratio in the ejecta cloud are derived and compared with other values published in the literature.
Fundamental modelling of particle strengthened 9-12% Cr steels
Energy Technology Data Exchange (ETDEWEB)
Magnusson, Hans; Sandstroem, Rolf [Royal Inst. of Tech., Stockholm (Sweden). Dept. of Materials Science and Engineering; Royal Inst. of Tech., Stockholm (Sweden). Brinell Centre
2010-07-01
Creep strength of particle strengthened 9-12% Cr steels can be predicted by fundamental modelling. The creep strength is evaluated from the state of the microstructure during creep. Particle hardening at high temperatures can be predicted by taking dislocation climb across particles into account. Work hardening is calculated from immobile dislocations in subgrain interiors and at boundaries using the composite theory. Subgrain coarsening will lower the influence of the mechanically hard boundaries. Recovery in dislocation density is predicted through static recovery by climb and dynamic recovery by locking and dipole formation. Solid solution hardening is needed in order to explain the difference in creep strength between different 9-12% Cr steels. The accumulation of large atoms such as Mo and W will slow down the dislocation climb velocity, and thereby the microstructure recovery rate. 100000h rupture strength is predicted for X20, P91, P92 steels without any use of fitting parameters. The creep strength of P91 steel with different microstructure due to Al additions. Z-phase transformation and heat affected material is presented. (orig.)
Directory of Open Access Journals (Sweden)
Elena Vigorito
Full Text Available Population-based genome wide association studies have identified a locus at 9p22.2 associated with ovarian cancer risk, which also modifies ovarian cancer risk in BRCA1 and BRCA2 mutation carriers. We conducted fine-scale mapping at 9p22.2 to identify potential causal variants in BRCA1 and BRCA2 mutation carriers. Genotype data were available for 15,252 (2,462 ovarian cancer cases BRCA1 and 8,211 (631 ovarian cancer cases BRCA2 mutation carriers. Following genotype imputation, ovarian cancer associations were assessed for 4,873 and 5,020 SNPs in BRCA1 and BRCA 2 mutation carriers respectively, within a retrospective cohort analytical framework. In BRCA1 mutation carriers one set of eight correlated candidate causal variants for ovarian cancer risk modification was identified (top SNP rs10124837, HR: 0.73, 95%CI: 0.68 to 0.79, p-value 2× 10-16. These variants were located up to 20 kb upstream of BNC2. In BRCA2 mutation carriers one region, up to 45 kb upstream of BNC2, and containing 100 correlated SNPs was identified as candidate causal (top SNP rs62543585, HR: 0.69, 95%CI: 0.59 to 0.80, p-value 1.0 × 10-6. The candidate causal in BRCA1 mutation carriers did not include the strongest associated variant at this locus in the general population. In sum, we identified a set of candidate causal variants in a region that encompasses the BNC2 transcription start site. The ovarian cancer association at 9p22.2 may be mediated by different variants in BRCA1 mutation carriers and in the general population. Thus, potentially different mechanisms may underlie ovarian cancer risk for mutation carriers and the general population.
Creep strength and ductility of 9 to 12% chromium steels
DEFF Research Database (Denmark)
Hald, John
2004-01-01
The present paper focuses in on long-term creep properties of parent material of the new 9-12%Cr creep resistant steels, P91, E911 and P92 developed for use in advanced ultrasupercritical power plants. These steels have been at the center of activities in the ECCC Working Group 3A (WG3A) "Ferriti...
Harris, Christopher M; Mittelstadt, Scott; Banfor, Patricia; Bousquet, Peter; Duignan, David B; Gintant, Gary; Hart, Michelle; Kim, Youngjae; Segreti, Jason
2016-10-01
Inhibition of the sphingosine-1-phosphate (S1P)-catabolizing enzyme S1P lyase (S1PL) elevates the native ligand of S1P receptors and provides an alternative mechanism for immune suppression to synthetic S1P receptor agonists. S1PL inhibition is reported to preferentially elevate S1P in lymphoid organs. Tissue selectivity could potentially differentiate S1PL inhibitors from S1P receptor agonists, the use of which also results in bradycardia, atrioventricular block, and hypertension. But it is unknown if S1PL inhibition would also modulate cardiac S1P levels or cardiovascular function. The S1PL inhibitor 6-[(2R)-4-(4-benzyl-7-chlorophthalazin-1-yl)-2-methylpiperazin-1-yl]pyridine-3-carbonitrile was used to determine the relationship in rats between drug concentration, S1P levels in select tissues, and circulating lymphocytes. Repeated oral doses of the S1PL inhibitor fully depleted circulating lymphocytes after 3 to 4 days of treatment in rats. Full lymphopenia corresponded to increased levels of S1P of 100- to 1000-fold in lymph nodes, 3-fold in blood (but with no change in plasma), and 9-fold in cardiac tissue. Repeated oral dosing of the S1PL inhibitor in telemeterized, conscious rats resulted in significant bradycardia within 48 hours of drug treatment, comparable in magnitude to the bradycardia induced by 3 mg/kg fingolimod. These results suggest that S1PL inhibition modulates cardiac function and does not provide immune suppression with an improved cardiovascular safety profile over fingolimod in rats. Copyright © 2016 by The American Society for Pharmacology and Experimental Therapeutics.
Dicty_cDB: Contig-U06595-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ilus oremlandii OhILAs, ... 32 9.1 FJ563415_1( FJ563415 |pid:none) Rodriguezia arevaloi voucher Willi... 32 ...TCC ... 32 9.1 (Q8T305) RecName: Full=Paramyosin; &AJ439882_1( AJ439882 |pid:none) 32 9.1 FJ563162_1( FJ563162 |pid:none) Rodriguez
Immunohistochemical expression of TGF-β1 and MMP-9 in periapical lesions
Directory of Open Access Journals (Sweden)
Pâmella Recco ÁLVARES
2017-07-01
Full Text Available Abstract The objective of this study was to evaluate the expression of matrix metalloproteinase 9 (MMP-9 and transforming growth factor beta (TGF-β1 in periapical lesion samples correlated with the intensity of the inflammatory infiltrate and thickness of the epithelial lining. Forty-five cases of periapical lesions (23 periapical granulomas and 22 radicular cysts were subjected to morphological and immunohistochemical analyses using anti-MMP-9 and anti-TGF-β1 antibodies. The data were analyzed using the following tests: non-parametric Mann-Whitney, chi-square, Fisher’s exact test and Spearman’s correlation test (P<0.05. Analysis of inflammatory infiltrate revealed that 78% of periapical granulomas presented infiltrate grade III, in contrast with 32% of radicular cysts (P<0.001. Morphological evaluation of the epithelial thickness in radicular cysts revealed the presence of atrophic epithelium in 86% of the cysts. The immunostaining of MMP-9 was score 2 in 67% of the granulomas and 77% of the cysts. Both lesions were predominantly score 1 for TGF-β1. Significant differences were confirmed between the expression scores of TGF-β1 and MMP-9 in periapical granulomas (p = 0.004 and in radicular cysts (p < 0.001. Expression of TGF-β1 was different for periapical granulomas and radicular cysts. This immunoregulatory cytokine seems more representative in asymptomatic lesions. The extracellular matrix remodeling process dependent on MMP-9 seems to be similar for both periapical granulomas and radicular cysts. TGF-β1 and MMP-9 may play an important role in the maintenance of periapical lesions.
Everard, M. J.; Macaulay, V. M.; Miller, J. L.; Smith, I. E.
1992-01-01
Analogues of the neurotransmitter substance P (SP) can interact with neuropeptide receptors, and are reported to inhibit growth of small cell lung cancer cell lines (SCLC CLs). We found [D-Arg1, D-Phe5, D-Trp7,9, Leu11] substance P (D-Phe5SP) significantly inhibited DNA synthesis by 10/10 human tumour CLs; six SCLC, one N-SCLC (squamous), two ovarian and one squamous cervical carcinoma, with inhibition to 50% control levels (IC50) of 20-50 microM. There was dose dependent inhibition of colony...
Dicty_cDB: Contig-U04551-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Methods for generating databases and databases fo... 42 9.1 1 ( DD019107 ) METHODS FOR GENERATING DATABAS...ES AND FOR IDENTIFY... 42 9.1 1 ( DD019106 ) METHODS FOR GENERATING DATABASES AND F...0417 ) METHODS FOR GENERATING DATABASES AND FOR IDENTIFY... 42 9.1 1 ( BD350416 ) METHODS FOR GENERATING DATABASE
DEFF Research Database (Denmark)
Vigorito, Elena; Kuchenbaecker, Karoline B; Beesley, Jonathan
2016-01-01
Population-based genome wide association studies have identified a locus at 9p22.2 associated with ovarian cancer risk, which also modifies ovarian cancer risk in BRCA1 and BRCA2 mutation carriers. We conducted fine-scale mapping at 9p22.2 to identify potential causal variants in BRCA1 and BRCA2...... mutation carriers. Genotype data were available for 15,252 (2,462 ovarian cancer cases) BRCA1 and 8,211 (631 ovarian cancer cases) BRCA2 mutation carriers. Following genotype imputation, ovarian cancer associations were assessed for 4,873 and 5,020 SNPs in BRCA1 and BRCA 2 mutation carriers respectively...... of BNC2. In BRCA2 mutation carriers one region, up to 45 kb upstream of BNC2, and containing 100 correlated SNPs was identified as candidate causal (top SNP rs62543585, HR: 0.69, 95%CI: 0.59 to 0.80, p-value 1.0 × 10-6). The candidate causal in BRCA1 mutation carriers did not include the strongest...
Study of the reactions 9Be(p, α)6Li, 9Be(p,d)8Be from 300 keV to 900 keV
International Nuclear Information System (INIS)
Bertrand, F.; Grenier, G.; Pornet, J.
1968-10-01
The experimental results concerning the two reactions 9 Be(p,α) 6 Li and 9 Be(p,d) 8 Be from 300 to 900 keV are presented. The angular distribution, excitation and total cross-section curves are expressed in absolute values after a normalization carried out using results given by Weber, Davis and Marion. (authors) [fr
28 CFR 91.59 - OJP's responsibilities.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false OJP's responsibilities. 91.59 Section 91.59 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) GRANTS FOR CORRECTIONAL FACILITIES... be required. (b) Specific duties. As part of its role in the NEPA process, OJP shall: (1) Issue...
International Nuclear Information System (INIS)
De Cicco, H; Zavaleta Gutierrez, N; Marrero, J; Luppo, M.I; Danon, C.A
2006-01-01
Due to its good properties of creep resistance, toughness and rust resistance, martensitic-ferritic 9%Cr-1%Mo steels are widely used for the production of heating plant components, boilers, heat exchangers, piping and tubing, etc. The effectiveness in steels of MX carbonitrides such as (Nb,V) (C,N) on improving creep resistance at high temperatures is well known. Controlling the behavior of the MX phases to precipitation, during annealing, is essential for obtaining a stable microstructure that can resist high temperatures. This study investigates the relationship between creep resistance and the microstructural changes that occur at different annealing times at a temperature of 780 o C -used industrially during the production and post-welding- in T91 steel. Creep trials were carried out at 600 o C and 190 MPa, and the samples were characterized using optic microscopy (OM), inductively coupled plasma-atomic emission spectrometry (ICP-AES) and transmission electron microscopy (TEM), the latter including a facility for energy dispersive spectroscopy (EDS). Based on its morphological characteristics, the MX precipitates are classified into three types, types I, II and III. Tempering time at 780 o C has been found to be one of the factors that determines which MX is dominant in the annealed steel. The presence of type MX-III, formed by the secondary precipitation of a VN particle adhering to a NbX, commonly called 'wing', seems to favor creep resistance in these steels. This type of of precipitate, then, fills an effective role in the anchoring of dislocations during creep (cw)
Kikuchi, Hidehiko; Mimuro, Hitomi; Kuribayashi, Futoshi
2018-01-01
The membrane bound cytochrome b 558 composed of gp91-phox and p22-phox proteins, and cytosolic proteins p40-, p47-and p67-phox are important components of superoxide (O 2 - )-generating system in phagocytes. Here, we describe that resveratrol, a pleiotropic phytochemical belonging to the stilbenoids, dramatically activates the O 2 - -generating system during retinoic acid (RA)-induced differentiation of human monoblastic leukemia U937 cells to macrophage-like cells. When U937 cells were cultured in the presence of RA and resveratrol, the O 2 - -generating activity increased more than 5-fold compared with that in the absence of the latter. Semiquantitative RT-PCR showed that co-treatment with RA and resveratrol strongly enhanced transcription of the gp91-phox compared with those of the RA-treatment only. On the other hand, immunoblot analysis revealed that co-treatment with RA and resveratrol caused remarkable accumulation of protein levels of gp91-phox (to 4-fold), p22-phox (to 5-fold) and p47-phox (to 4-fold) compared with those of the RA-treatment alone. In addition, ChIP assay suggested that resveratrol participates in enhancing the gene expression of gp91-phox via promoting acetylation of Lys-9 residues and Lys-14 residues of histone H3 within chromatin around the promoter regions of the gene. These results suggested that resveratrol strongly enhances the RA-induced O 2 - -generating activity via up-regulation of gp91-phox gene expression in U937 cells. Copyright © 2017 Elsevier Inc. All rights reserved.
2010-01-01
... cattle over 1 month of age shall be negative to a caudal intradermal tuberculin test using 0.1 ml. of... shall be negative to a test for brucellosis conducted as prescribed in “Standard Agglutination Test... for use in treating animals infested with the ectoparasite involved in accordance with the label...
Buckley ANGB, Colorado. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.
1983-09-19
911. 91. 911, 94.1 9.1. 914.1 9,4. 94.1 9c( ;J.t 92.1 92.8 93.1’ 94.? 94.2! 94 11.6 91.6 911.7 91.7i 91.8’ 94.7l 9 .9 95.9 9.19 9.1 & Kc ’ 3 .1 92.1 .F9...1 7, El.....’ (X) l I s ![ .i N. Oh.. N e N.. .4 Nw.~e wil Teq.. * 6 ’ I. N .... ti0P 132F * TeO . 2 11.. , 1 ... .. 4 1.. S.97 • , - -4 a It maml Wd
Directory of Open Access Journals (Sweden)
Min-Hsiung Pan
2011-01-01
Full Text Available Invasive breast cancer is the major cause of death among females and its incidence is closely linked to HER2 (human epidermal growth factor receptor 2 overexpression. Pterostilbene, a natural analog of resveratrol, exerts its cancer chemopreventive activity similar to resveratrol by inhibiting cancer cell proliferation and inducing apoptosis. However, the anti-invasive effect of pterostilbene on HER2-bearing breast cancer has not been evaluated. Here, we used heregulin-β1 (HRG-β1, a ligand for HER3, to transactivate HER2 signaling. We found that pterostilbene was able to suppress HRG-β1-mediated cell invasion, motility and cell transformation of MCF-7 human breast carcinoma through down-regulation of matrix metalloproteinase-9 (MMP-9 activity and growth inhibition. In parallel, pterostilbene also inhibited protein and mRNA expression of MMP-9 driven by HRG-β1, suggesting that pterostilbene decreased HRG-β1-mediated MMP-9 induction via transcriptional regulation. Examining the signaling pathways responsible for HRG-β1-associated MMP-9 induction and growth inhibition, we observed that pterostilbene, as well as SB203580 (p38 kinase inhibitor, can abolish the phosphorylation of p38 mitogen-activated protein kinase (p38 kinase, a downstream HRG-β1-responsive kinase responsible for MMP-9 induction. In addition, HRG-β1-driven Akt phosphorylation required for cell proliferation was also suppressed by pterostilbene. Taken together, our present results suggest that pterostilbene may serve as a chemopreventive agent to inhibit HRG-β1/HER2-mediated aggressive and invasive phenotype of breast carcinoma through down-regulation of MMP-9, p38 kinase and Akt activation.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Action plan. 91.220 Section 91.220 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development..., evaluate and reduce lead-based paint hazards, reduce the number of poverty-level families, develop...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Action plan. 91.320 Section 91.320 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development...), evaluate and reduce lead-based paint hazards, reduce the number of poverty level families, develop...
Brun, Sonia; Abella, Neus; Berciano, Maria T; Tapia, Olga; Jaumot, Montserrat; Freire, Raimundo; Lafarga, Miguel; Agell, Neus
2017-01-01
We previously showed that p21Cip1 transits through the nucleolus on its way from the nucleus to the cytoplasm and that DNA damage inhibits this transit and induces the formation of p21Cip1-containing intranucleolar bodies (INoBs). Here, we demonstrate that these INoBs also contain SUMO-1 and UBC9, the E2 SUMO-conjugating enzyme. Furthermore, whereas wild type SUMO-1 localized in INoBs, a SUMO-1 mutant, which is unable to conjugate with proteins, does not, suggesting the presence of SUMOylated proteins at INoBs. Moreover, depletion of the SUMO-conjugating enzyme UBC9 or the sumo hydrolase SENP2 changed p21Cip1 intracellular distribution. In addition to SUMO-1 and p21Cip1, cell cycle regulators and DNA damage checkpoint proteins, including Cdk2, Cyclin E, PCNA, p53 and Mdm2, and PML were also detected in INoBs. Importantly, depletion of UBC9 or p21Cip1 impacted INoB biogenesis and the nucleolar accumulation of the cell cycle regulators and DNA damage checkpoint proteins following DNA damage. The impact of p21Cip1 and SUMO-1 on the accumulation of proteins in INoBs extends also to CRM1, a nuclear exportin that is also important for protein translocation from the cytoplasm to the nucleolus. Thus, SUMO and p21Cip1 regulate the transit of proteins through the nucleolus, and that disruption of nucleolar export by DNA damage induces SUMO and p21Cip1 to act as hub proteins to form a multiprotein complex in the nucleolus.
Energy Technology Data Exchange (ETDEWEB)
Sun, Mingxiao; Zhang, Deteng; Li, Yiping; Wang, Jianfeng; Gao, Yangyang; Yang, Wenjun, E-mail: ywjph2004@qust.edu.cn
2014-04-15
A cruciform 9,10-distyrylanthracene-containing luminogen, 9,10-bis(p-dibutylaminostyryl)-2,6-bis(p-t-butylstyryl)anthracene (DDC), has been synthesized and the optical properties investigated. The results show that DDC is an aggregation-induced enhanced emission (AIEE) and piezofluorochromic (PFC) dye. The fluorescence quantum yield in THF/water=1/9 (18.1%) is about 12-fold over that in THF (1.53%). PFC experiment shows that the fluorescence colors (emission spectra) of DDC solid change reversibly between orange-red (602 nm) and red (632 nm) emissions upon pressing and annealing. Wide-angle X-ray diffraction and differential scanning calorimetric analyses reveal that the grinding has induced the phase transition of DDC solid from pristine crystalline to ground amorphous states, and annealing could cause the re-crystallization of amorphized DDC solid. This transformation between crystalline and amorphous states is responsible for the reversible PFC behavior upon external stimuli. Highlights: • A two-dimensional cross-conjugated luminogen (DDC) was synthesized. • DDC exhibits aggregation-enhanced emission and piezofluorochromic behaviors. • DDC emits bluer light in the crystalline phase than in the amorphous phase. • The PFC mechanism is ascribed to grinding-induced amorphization.
Energy Technology Data Exchange (ETDEWEB)
Augustyniak, Bolesław, E-mail: bolek@mif.pg.gda.pl; Piotrowski, Leszek; Maciakowski, Paweł; Chmielewski, Marek [Faculty of Applied Physics and Mathematics, Gdansk University of Technology, 80-233 Gdansk (Poland); Lech-Grega, Marzena; Żelechowski, Janusz [The Institute of Non-Ferrous Metals, 32-050 Skawina (Poland)
2014-05-07
The paper deals with assessment of microstress state of martensite P91 steel using three complementary techniques: mechanical Barkhausen emission, magnetoacoustic emission (MAE), and X-ray diffraction (XRD) profile analysis. Magnetic coercivity Hc and microstructure were investigated with inductive magnetometry and magnetic force microscopy (MFM), respectively. Internal stress level of P91 steel was modified by heat treatment. Steel samples were austenitized, quenched, and then tempered at three temperatures (720 °C, 750 °C, and 780 °C) during increasing time (from 15 min up to 240 min). The microstrain level ε{sub i} was evaluated using Williamson–Hall method. It was revealed that during tempering microstrain systematically decreases from ε{sub i} = 2.5 × 10{sup −3} for as quenched state down to ε{sub i} = 0.3 × 10{sup −3} for well tempered samples. Both mechanical hardness (Vicker's HV) and magnetic hardness (coercivity) decrease almost linearly with decreasing microstrain while the MAE and MBE intensities strongly increase. Tempering leads to evident shift of the MeBN intensity maximum recorded for the first load towards lower applied strain values and to increase of MAE intensity. This indicates that the microstress state deduced by magnetic techniques is correlated with microstrains evaluated with XRD technique.
Use of hypoxia imaging agent 99mTc-HL91 in rat cerebral ischemia models
International Nuclear Information System (INIS)
Zhou Ying; Qu Wanying; Li Meng; Chen Fang; Yao Zhiming; Zhu Ming; Zhu Lin
1999-01-01
Objective: To explore the possibility of diagnosis for cerebrovascular disease by a novel synthetic hypoxia agent 99m Tc-HL91 used in rat cerebral ischemia models. Methods: Pharmacological experiments of 99m Tc-HL91 were carried out including common properties, radiochemical purity, stability in vitro, anomalous toxicity test and biodistribution in mice. Fifteen cerebral ischemic rat models were established and received 99m Tc-HL91 scintigraphy. Results: 1) HL91 kits were labelled with 99m Tc easily and showed high radiochemical purity and stability. 2) Rapid clearance in blood, heart and lungs and high activity in liver, kidneys and intestines were observed. Relatively low uptake in brain was identified. 3) The radioactivity in ischemic brain tissue increased significantly at 4h postinjection in both rat images and isolated brain images. 4) The radioactivity ratios of lesion to normal brain tissue by drawing ROIs in isolated brain planar images were 0.98 +- 0.06, 0.99 +- 0.05, 1.29 +- 0.03, 1.56 +- 0.14 and 1.66 +- 0.06 at 1,2,4,8 and 12 h postinjection, respectively. There were significant differences among all groups except for 1 h and 2 h, 8 h and 12 h postinjection (P 99m Tc-HL91 in the hypoxic, ischemic brain tissue have been proved. It is appropriate to perform imaging at 4 h postinjection
31 CFR 91.3 - Recording presence.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Recording presence. 91.3 Section 91.3 Money and Finance: Treasury Regulations Relating to Money and Finance REGULATIONS GOVERNING CONDUCT IN... exists, and at such other times as may be necessary for the orderly conduct of the Government's business...
Editorial Volume 9, Issue 2 2018
Directory of Open Access Journals (Sweden)
Karen Nelson
2018-03-01
Full Text Available Welcome to our second issue for 2018. In February we opened the year with the publication of Volume 9(1, a special issue dedicated to the top papers from the 6th Biennial National Association of Enabling Educators of Australia (NAEEA Conference which was hosted by Southern Cross University at the Gold Coast, Australia in December 2017. Shortly after this Conference, the Australian Government announced that undergraduate funding was to be capped at 2017 levels, effectively stopping the demand driven funding system for high education in Australia. With that backdrop Volume 9(1 was a timely opportunity to consider the impact of disruption, and as perceptions of the value of higher education are challenged, to reiterate the value of supporting access and equity to higher education institutions.
9 CFR 91.22 - Protection from heat of boilers and engines.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Protection from heat of boilers and... Protection from heat of boilers and engines. No animals shall be stowed along the alleyways leading to the engine or boiler rooms unless the sides of said engine or boiler rooms are covered by a tongue and groove...
[Nah-plasmids of IncP-9 group from natural strains of Pseudomonas].
Levchuk, A A; Bulyga, I M; Izmalkova, T Iu; Sevast'ianovich, Ia R; Kosheleva, I A; Thomas, C M; Titok, M A
2006-01-01
Use of polymerase chain reaction helped to establish that the most frequent among naphthalene utilizing bacteria, isolated on the territory of Belarus, are Nah-plasmids of IncP-9 incompatibility group and those with indefinite systematic belonging. With the help of classical test of incompatibility, restriction and sequence analyses three new subgroups within the IncP-9 group were discovered (zeta, eta and IncP-9-like replicons). Conducting of restriction analysis for amplification products of nahG and nahAc genes allowed us to reveal, in addition to known sequences of stated determinants, two new types of nahG gene. Restriction analysis performed on amplification products of 16S RNA genes (ARDRA method) showed that native hosts of Nah-plasmids of IncP-9 group are not only fluorescent bacteria from genus Pseudomonas (P. fluorescens, P. putida, P. aeruginosa, P. species), but also non-fluorescent bacteria with indefinite specific belonging.
Structural and spectroscopic studies of 2,9-dimethyl-1,10 ...
African Journals Online (AJOL)
The crystal structures of the pronated ligand, 2,9-dimethyl-1,10-phenanthrolinium (DPH) cation with selected counter anions (chloride (1), triflate (2), and gold dicyanide (3)) are reported. The role of a hydrogen bond interaction in influencing the solid state p-p stacking found in all three compounds has been investigated.
Monkey liver cytochrome P450 2C9 is involved in caffeine 7-N-demethylation to form theophylline.
Utoh, Masahiro; Murayama, Norie; Uno, Yasuhiro; Onose, Yui; Hosaka, Shinya; Fujino, Hideki; Shimizu, Makiko; Iwasaki, Kazuhide; Yamazaki, Hiroshi
2013-12-01
Caffeine (1,3,7-trimethylxanthine) is a phenotyping substrate for human cytochrome P450 1A2. 3-N-Demethylation of caffeine is the main human metabolic pathway, whereas monkeys extensively mediate the 7-N-demethylation of caffeine to form pharmacological active theophylline. Roles of monkey P450 enzymes in theophylline formation from caffeine were investigated using individual monkey liver microsomes and 14 recombinantly expressed monkey P450 enzymes, and the results were compared with those for human P450 enzymes. Caffeine 7-N-demethylation activity in microsomes from 20 monkey livers was not strongly inhibited by α-naphthoflavone, quinidine or ketoconazole, and was roughly correlated with diclofenac 4'-hydroxylation activities. Monkey P450 2C9 had the highest activity for caffeine 7-N-demethylation. Kinetic analysis revealed that monkey P450 2C9 had a high Vmax/Km value for caffeine 7-N-demethylation, comparable to low Km value for monkey liver microsomes. Caffeine could dock favorably with monkey P450 2C9 modeled for 7-N-demethylation and with human P450 1A2 for 3-N-demethylation. The primary metabolite theophylline was oxidized to 8-hydroxytheophylline in similar ways by liver microsomes and by recombinant P450s in both humans and monkeys. These results collectively suggest a high activity for monkey liver P450 2C9 toward caffeine 7-N-demethylation, whereas, in humans, P450 1A2-mediated caffeine 3-N-demethylation is dominant.
Effect of Heat Treatment on Microstructure and Hardness of Grade 91 Steel
Directory of Open Access Journals (Sweden)
Triratna Shrestha
2015-01-01
Full Text Available Grade 91 steel (modified 9Cr-1Mo steel is considered a prospective material for the Next Generation Nuclear Power Plant for application in reactor pressure vessels at temperatures of up to 650 °C. In this study, heat treatment of Grade 91 steel was performed by normalizing and tempering the steel at various temperatures for different periods of time. Optical microscopy, scanning and transmission electron microscopy in conjunction with microhardness profiles and calorimetric plots were used to understand the microstructural evolution including precipitate structures and were correlated with mechanical behavior of the steel. Thermo-Calc™ calculations were used to support the experimental work. Furthermore, carbon isopleth and temperature dependencies of the volume fraction of different precipitates were constructed.
Structure of intruder band in "1"1"9"-"1"2"9Xe
International Nuclear Information System (INIS)
Sharma, H.P.; Chakraborty, S.; Tiwary, S.S.
2017-01-01
Xe isotopes in A∼130 mass region are known for their variety of structural phenomena, such as, unexpected signature splitting, signature inversion, γ-vibration etc. These phenomena are associated to axialy asymmetric shape. The triaxial shape in Xe nuclei are expected to originate due to the availability of prolate driving low-Ω πh_1_1_/_2 orbital and oblate driving high-Ω νh11/2 orbital near Fermi surface. The observed experimental E (4"+)/E (2"+) value (∼2.5) also support the γ-soft nature of these nuclei. Interestingly, both proton and neutron alignments have been observed in νh_1_1_/_2 band in "1"1"9"-"1"2"5Xe and neutron alignment dominates. In "1"2"9Xe, proton alignment reported to dominate. It is also supported by TPRM calculations, although, there are no significant change in the neutron orbitals. Whether this change in the alignment is occurred at N=75 or 73 is not known. Therefore, it is interesting to understand the status of the neutron and proton alignment in "1"2"7Xe, which are not studied well. Hence, in-beam γ-ray spectroscopy of "1"2"7Xe was carried out using "1"2"2Sn("9Be, 4nγ) fusion-evaporation reaction at 48 MeV using INGA facility at Inter-University Accelerator Centre, New Delhi. Details of the analysis and results will be discussed during the conference. (author)
Dennis-Wall, Jennifer C; Culpepper, Tyler; Nieves, Carmelo; Rowe, Cassie C; Burns, Alyssa M; Rusch, Carley T; Federico, Ashton; Ukhanova, Maria; Waugh, Sheldon; Mai, Volker; Christman, Mary C; Langkamp-Henken, Bobbi
2017-03-01
Background: Rhinoconjunctivitis-specific quality of life is often reduced during seasonal allergies. The Mini Rhinoconjunctivitis Quality of Life Questionnaire (MRQLQ) is a validated tool used to measure quality of life in people experiencing allergies (0 = not troubled to 6 = extremely troubled). Probiotics may improve quality of life during allergy season by increasing the percentage of regulatory T cells (Tregs) and inducing tolerance. Objective: The objective of this study was to determine whether consuming Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and B. longum MM-2 compared with placebo would result in beneficial effects on MRQLQ scores throughout allergy season in individuals who typically experience seasonal allergies. Secondary outcomes included changes in immune markers as part of a potential mechanism for changes in MRQLQ scores. Design: In this double-blind, placebo-controlled, parallel, randomized clinical trial, 173 participants (mean ± SEM: age 27 ± 1 y) who self-identified as having seasonal allergies received either a probiotic (2 capsules/d, 1.5 billion colony-forming units/capsule) or placebo during spring allergy season for 8 wk. MRQLQ scores were collected weekly throughout the study. Fasting blood samples were taken from a subgroup (placebo, n = 37; probiotic, n = 35) at baseline and week 6 (predicted peak of pollen) to determine serum immunoglobulin (Ig) E concentrations and Treg percentages. Results: The probiotic group reported an improvement in the MRQLQ global score from baseline to pollen peak (-0.68 ± 0.13) when compared with the placebo group (-0.19 ± 0.14; P = 0.0092). Both serum total IgE and the percentage of Tregs increased from baseline to week 6, but changes were not different between groups. Conclusions: This combination probiotic improved rhinoconjunctivitis-specific quality of life during allergy season for healthy individuals with self-reported seasonal allergies; however, the associated mechanism is
International Nuclear Information System (INIS)
Gomonaj, A.N.; Imre, A.I.
2005-01-01
Radiation transitions between 4d 9 ( 2 D 5/2,3/2 )5s 2 nl and 4d 10 5p( 2 P 1/2,3/2 0 )nl self-ionized states of Cd atom being dielectron satellites of λ325.0 nm (4d 9 5s 22 D 3/2 →4d 10 5p 2 P 1/2 0 ) and λ353.6 nm (4d 9 5s 22 D 3/2 → 4d 10 5p 2 P 3/2 0 ) laser lines of Cd + ion were detected for the first time at electron-ion collisions. One studied energy dependences of the effective cross sections of electron excitation of the satellite lines within 7-10 eV energy range. The effective cross sections of excitation of dielectron satellites constitutes ∼ 10 -17 cm 2 that is comparable with the efficiency of excitation of the laser lines [ru
Energy Technology Data Exchange (ETDEWEB)
Chuvas, Tatiane C.; Pardal, Juan M.; Garcia, Pedro P.; Souza, Guttemberg C. de; Fonseca, Maria P. Cindra, E-mail: chuvas@vm.uff.br [Universidade Federal Fluminense (PGMEC/UFF), Niteroi, RJ (Brazil). Departamento de Engenharia Mecanica; Cardote, Ismael [UTC Engenharia S/A, Niteroi, Rio de Janeiro, RJ (Brazil)
2014-07-01
The welding is one of the main industrial manufacturing processes structures and piping, knowledge of residual stress from this process is of paramount importance because the mechanical properties of welded components are not only determined by the microstructures present in the joint, but also by residual stresses heterogeneous introduced by thermal cycling during the process. The aim of this work is the characterization ASTM P91 joints welded by MCAW / FCAW (Metal Cored Arc Welding / Flux Cored Arc Welding) processes through the residual stresses evaluating associated with welding and post-weld heat treatments. Residual stresses were measured using X-rays diffraction sin2psi method, with Crκα radiation and they presented tensile at the root joints with larger magnitudes in the weld metal region and compressive on the surface. The post weld heat treatment resulted relief of residual stresses at the root of the joints. However, the same effect was observed in compressive surface stresses, which could adversely affect the service life of the pipe, reducing the fatigue and stress corrosion cracking resistances. (author)
Comparison of polarization and analysing power for the /sup 9/Be(p,n)/sup 9/B reaction
Energy Technology Data Exchange (ETDEWEB)
Byrd, R.C.; Lisowski, P.W.; Tornow, W.; Walter, R.L. (Duke Univ., Durham, NC (USA). Dept. of Physics; Triangle Universities Nuclear Lab., Durham, NC (USA))
1983-08-01
A recent Lane model of the /sup 9/Be + nucleon system raised the question of differences between the polarization P(THETA) and the analyzing power A(THETA) in (p, n) reactions between mirror nuclei. Since these two observables are identical under exact charge symmetry, observation of a difference would indicate the breaking of this symmetry, probably by the Coulomb interaction. This paper describes the techniques for measurements of P(THETA) and A(THETA) in (p, n) reactions, with an emphasis on the elimination of systematic errors and the determination of background contributions. Measurements of both observables were made for the /sup 9/Be(p, n/sub 0/)/sup 9/B reaction at several angles for energies from 3 to 10 MeV. The results are combined with previous measurements to develop data sets for a comprehensive comparison of P(THETA) and A(THETA). Previous A(THETA) values agree well with the present measurements, while most of the earlier P(THETA) data are shown to be in error. Our data show that there do exist sizeable differences between P(THETA) and A(THETA) at energies from Esub(p) = 5-7 MeV. The existence of such differences in light nuclear systems is consistent with recent shell-model calculations for the /sup 11/B(p, n/sub 0/)/sup 11/C reaction.
Nakaoka, Hirofumi; Takahashi, Tomoko; Akiyama, Koichi; Cui, Tailin; Tajima, Atsushi; Krischek, Boris; Kasuya, Hidetoshi; Hata, Akira; Inoue, Ituro
2010-08-01
Recently, a genome-wide association study identified associations between single nucleotide polymorphisms on chromosome 9p21 and risk of harboring intracranial aneurysm (IA). Aneurysm characteristics or subphenotypes of IAs, such as history of subarachnoid hemorrhage, presence of multiple IAs and location of IAs, are clinically important. We investigated whether the association between 9p21 variation and risk of IA varied among these subphenotypes. We conducted a case-control study of 981 cases and 699 controls in Japanese. Four single nucleotide polymorphisms tagging the 9p21 risk locus were genotyped. The OR and 95% CI were estimated using logistic regression analyses. Among the 4 single nucleotide polymorphisms, rs1333040 showed the strongest evidence of association with IA (P=1.5x10(-6); per allele OR, 1.43; 95% CI, 1.24-1.66). None of the patient characteristics (gender, age, smoking, and hypertension) was a significant confounder or effect modifier of the association. Subgroup analyses of IA subphenotypes showed that among the most common sites of IAs, the association was strongest for IAs of the posterior communicating artery (OR, 1.69; 95% CI, 1.26-2.26) and not significant for IAs in the anterior communicating artery (OR, 1.22; 95% CI, 0.96-1.57). When dichotomizing IA sites, the association was stronger for IAs of the posterior circulation-posterior communicating artery group (OR, 1.73; 95% CI, 1.32-2.26) vs the anterior circulation group (OR, 1.28; 95% CI, 1.07-1.53). Heterogeneity in these ORs was significant (P=0.032). The associations did not vary when stratifying by history of subarachnoid hemorrhage (OR, 1.42; 95% CI, 1.18-1.71 for ruptured IA; OR, 1.27; 95% CI, 1.00-1.62 for unruptured IA) or by multiplicity of IA (OR, 1.57; 95% CI, 1.21-2.03 for multiple IAs; OR, 1.36; 95% CI, 1.15-1.61 for single IA). Our results suggest that genetic influence on formation may vary between IA subphenotypes.
Microstructure-based assessment of creep rupture behaviour of cast-forged P91 steel
Energy Technology Data Exchange (ETDEWEB)
Pandey, Chandan, E-mail: chandanpy.1989@gmail.com [Department of Mechanical and Industrial Engineering, Indian Institute of Technology Roorkee, Uttrakhand 247667 (India); Mahapatra, M.M. [School of Mechanical Sciences, Indian Institute of Technology Bhubaneswar, Odisha 751013 (India); Kumar, Pradeep; Vidyrathy, R.S. [Department of Mechanical and Industrial Engineering, Indian Institute of Technology Roorkee, Uttrakhand 247667 (India); Srivastava, A. [Senior Engineer, HEEP Section, BHEL Haridwar (India)
2017-05-17
The work presented in this study was performed with the intent to characterize the microstructure evolution for short term creep exposure of cast-forged P91 steel. The short-term creep test was performed at temperature range of 620–650 °C and stresses ranging from 120 to 200 MPa. To characterize the sample after creep exposure, field emission scanning electron microscopy (FESEM) with energy dispersive X-ray spectroscopy (EDS), optical microscope and micro-hardness testing were utilized. Creep tests were performed on round creep specimens. For low temperature service condition, longer creep life was obtained. The fracture surface of creep ruptured specimen were characterized by using the FESEM. The transgranular fracture mode was noticed in all the tests condition. The creep rupture life was found to be decreased with increase in applied stress. The maximum rupture life was measured about to be 3329.28 h for the sample exposed at 620 °C for 120 MPa. A negligible microstructural change was measured in gripping area compared to the gauge area (necking area) of crept sample. The laves phase formation was also noticed along the grain boundaries for creep exposure life of 3329.28 h.
Microstructure-based assessment of creep rupture behaviour of cast-forged P91 steel
International Nuclear Information System (INIS)
Pandey, Chandan; Mahapatra, M.M.; Kumar, Pradeep; Vidyrathy, R.S.; Srivastava, A.
2017-01-01
The work presented in this study was performed with the intent to characterize the microstructure evolution for short term creep exposure of cast-forged P91 steel. The short-term creep test was performed at temperature range of 620–650 °C and stresses ranging from 120 to 200 MPa. To characterize the sample after creep exposure, field emission scanning electron microscopy (FESEM) with energy dispersive X-ray spectroscopy (EDS), optical microscope and micro-hardness testing were utilized. Creep tests were performed on round creep specimens. For low temperature service condition, longer creep life was obtained. The fracture surface of creep ruptured specimen were characterized by using the FESEM. The transgranular fracture mode was noticed in all the tests condition. The creep rupture life was found to be decreased with increase in applied stress. The maximum rupture life was measured about to be 3329.28 h for the sample exposed at 620 °C for 120 MPa. A negligible microstructural change was measured in gripping area compared to the gauge area (necking area) of crept sample. The laves phase formation was also noticed along the grain boundaries for creep exposure life of 3329.28 h.
Hess, Glen W.; Haluska, Tana L.
2016-04-13
Digital flood-inundation maps for a 9.1-mile reach of the Coast Fork Willamette River near Creswell and Goshen, Oregon, were developed by the U.S. Geological Survey (USGS) in cooperation with the U.S. Army Corps of Engineers (USACE). The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected stages at the USGS streamgage at Coast Fork Willamette River near Goshen, Oregon (14157500), at State Highway 58. Current stage at the streamgage for estimating near-real-time areas of inundation may be obtained at http://waterdata.usgs.gov/or/nwis/uv/?site_no=14157500&PARAmeter_cd=00065,00060. In addition, the National Weather Service (NWS) forecasted peak-stage information may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation.In this study, areas of inundation were provided by USACE. The inundated areas were developed from flood profiles simulated by a one-dimensional unsteady step‑backwater hydraulic model. The profiles were checked by the USACE using documented high-water marks from a January 2006 flood. The model was compared and quality assured using several other methods. The hydraulic model was then used to determine eight water-surface profiles at various flood stages referenced to the streamgage datum and ranging from 11.8 to 19.8 ft, approximately 2.6 ft above the highest recorded stage at the streamgage (17.17 ft) since 1950. The intervals between stages are variable and based on annual exceedance probability discharges, some of which approximate NWS action stages.The areas of inundation and water depth grids provided to USGS by USACE were used to create interactive flood‑inundation maps. The availability of these maps with current stage from USGS streamgage and forecasted stream stages from the NWS provide emergency management
International Nuclear Information System (INIS)
Lin, C.-C.; Tseng, Hsiao-Wei; Hsieh, Hsi-Lung; Lee, Chiang-Wen; Wu, C.-Y.; Cheng, C.-Y.; Yang, C.-M.
2008-01-01
Matrix metalloproteinases (MMPs), in particular MMP-9, have been shown to be induced by cytokines including tumor necrosis factor-α (TNF-α) and contributes to airway inflammation. However, the mechanisms underlying MMP-9 expression induced by TNF-α in human A549 cells remain unclear. Here, we showed that TNF-α induced production of MMP-9 protein and mRNA is determined by zymographic, Western blotting, RT-PCR and ELISA assay, which were attenuated by inhibitors of MEK1/2 (U0126), JNK (SP600125), and NF-κB (helenalin), and transfection with dominant negative mutants of ERK2 (ΔERK) and JNK (ΔJNK), and siRNAs for MEK1, p42 and JNK2. TNF-α-stimulated phosphorylation of p42/p44 MAPK and JNK were attenuated by pretreatment with the inhibitors U0126 and SP600125 or transfection with dominant negative mutants of ΔERK and ΔJNK. Furthermore, the involvement of NF-κB in TNF-α-induced MMP-9 production was consistent with that TNF-α-stimulated degradation of IκB-α and translocation of NF-κB into the nucleus which were blocked by helenalin, but not by U0126 and SP600125, revealed by immunofluorescence staining. The regulation of MMP-9 gene transcription by MAPKs and NF-κB was further confirmed by gene luciferase activity assay. MMP-9 promoter activity was enhanced by TNF-α in A549 cells transfected with wild-type MMP-9-Luc, which was inhibited by helenalin, U0126, or SP600125. In contrast, TNF-α-stimulated MMP-9 luciferase activity was totally lost in cells transfected with mutant-NF-κB MMP-9-luc. Moreover, pretreatment with actinomycin D and cycloheximide attenuated TNF-α-induced MMP-9 expression. These results suggest that in A549 cells, phosphorylation of p42/p44 MAPK, JNK, and transactivation of NF-κB are essential for TNF-α-induced MMP-9 gene expression
14 CFR 91.1081 - Crewmember training requirements.
2010-01-01
... particular assignment of the crewmember: (1) Basic indoctrination ground training for newly hired crewmembers... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Crewmember training requirements. 91.1081... Operations Program Management § 91.1081 Crewmember training requirements. (a) Each program manager must...
14 CFR 91.529 - Flight engineer requirements.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight engineer requirements. 91.529...-Powered Multiengine Airplanes and Fractional Ownership Program Aircraft § 91.529 Flight engineer... flight engineer certificate: (1) An airplane for which a type certificate was issued before January 2...
International Nuclear Information System (INIS)
Lagutin, B M; Petrov, I D; Sukhorukov, V L; Demekhin, Ph V; Zimmermann, B; Mickat, S; Kammer, S; Schartner, K-H; Ehresmann, A; Shutov, Yu A; Schmoranzer, H
2003-01-01
The energy dependence of the alignment parameter A 20 for the Kr II 4p 4 5p(E 1 J 1 ) states following excitation in the Raman regime with the exciting-photon energy passing through the Kr I 3dJ 9 barnpjbar resonances was investigated theoretically and experimentally. Interference between the resonance and direct photoionization channels explains the dependence of A 20 on the excitation energy. Experimentally, A 20 was determined after the analysis of 5p-5s fluorescence decay of the 4p 4 5p(E 1 J 1 ) states excited with monochromatized synchrotron radiation. The band pass of the synchrotron radiation was set to 10 meV which is smaller than the natural width of the 3d 9 np resonances (∼83 meV). Additionally, a strong energy dependence was predicted for the orientation parameter O 10 as well as for the angular distribution parameter of photoelectrons, β e , for several 4p 4 5p(E 1 J 1 ) ionic states
Li, M Y; Chao, H Y; Sun, A N; Qiu, H Y; Jin, Z M; Tang, X W; Han, Y; Fu, C C; Chen, S N; Wu, D P
2017-04-14
Objective: To explore the prevalences of JAK2, CALR and MPL gene mutations and the mutation types in patients with Philadelphia chromosome negative myeloproliferative neoplasms (MPNs) , and to compare their clinical characteristics of different mutation types with each other and mutation negative group. Methods: The mutations of JAK2 V617F, JAK2 gene at exon 12, CALR gene at exon 9 and MPL gene at exon 10 in 1 648 Ph negative MPNs patients were detected by direct sequencing. Results: ① The JAK2V617F mutation was found in 471 (92.7%) of 508 PV patients, 819 (78.1%) of 1 049 ET patients and 74 (81.3%) of 91 PMF patients respectively, with the total mutation rate as 82.8% (1 364/1 648) . The JAK2 exon12 mutation was found in 9 (1.7%) of 508 PV patients, none was found in ET or PMF patients, with the total mutation rate as 0.5% (9/1 648) . The CALR mutation was found in 132 (12.6%) of 1 049 ET patients and 11 (12.1%) of 91 PMF patients respectively, with the total mutation rate as 8.7% (143/1 648) ; the MPL mutation was found in 9 (0.9%) of 1 049 ET patients and 1 (1.1%) of 91 PMF patients respectively, with the total mutation rate as 0.6% (10/1 648) . The co-occurrence of any two types of driver gene mutations was not detected by direct sequencing. ②The median onset age of patients with JAK2V617F[61 (15-95) y] was significant higher than of with JAK2 exon12 mutation[49 (33-62) y] or without mutations[42 (3-78) y] ( P MPL mutation[59 (22-71) y] ( P >0.05) . Patients with JAK2V617F had higher white blood cell count and hemoglobin level ( P MPL mutation ( P =0.013) . The platelet count of patients with CALR mutation was significantly higher than of with JAK2V617F[966 (400-2 069) ×10(9)/L vs 800 (198-3 730) ×10(9)/L, P MPL gene mutation revealed normal karyotype. Conclusions: Driver gene mutations detection could ensure the diagnosis and prognosis judgment of MPN more reliable, different subtypes of MPNs had different profiles of driver gene mutations, the latter
International Nuclear Information System (INIS)
Tang, Wai-Kwan; Li, Dongyang; Esser, Lothar; Xia, Di
2009-01-01
Mutations in the human AAA+ protein p97 cause a disease in humans called IBMPFD. How these mutations affect the structure and function of p97 is unknown. Here, the crystallization of three disease-related mutants of p97 in the presence of ATPγS are reported. The human type II AAA+ protein p97 participates in various cellular activities, presumably through its involvement in the ubiquitin–proteasome degradation pathway. Mutations in p97 have been implicated in patients with inclusion-body myopathy associated with Paget’s disease of the bone and frontotemporal dementia (IBMPFD). In this work, three mutant p97 N-D1 fragments, R86A, R95G and R155H, were crystallized in the presence of ATPγS with PEG 3350 as a main precipitant, yielding two different crystal forms. The R155H mutant crystal belonged to space group R3, with unit-cell parameters in the hexagonal setting of a = b = 134.2, c = 182.9 Å, and was merohedrally twinned, with an estimated twin fraction of 0.34. The crystals of the R86A and R95G mutants belonged to space group P1, with similar unit-cell parameters of a = 90.89, b = 102.6, c = 107.2 Å, α = 97.5, β = 90.6, γ = 91.5° and a = 92.76, b = 103.7, c = 107.7 Å, α = 97.7, β = 91.9, γ = 89.7°, respectively
2001-09-01
p,pN-Dichlorodiphenyl sulfone is used as a starting material in the production of polysulfones and polyethersulfones and as a component in reactive dyes in the textile industry; it is also a by-product of pesticide production. p,pN-Dichlorodiphenyl sulfone was nominated for study by the National Cancer Institute because of its history of high production and use, the prospect of increased production and use, and the absence of adequate toxicity testing. Male and female F344/N rats and B6C3F1 mice were exposed top,pN-dichlorodiphenyl sulfone (greater than 99% pure)in feed for 14 weeks or 2 years. Genetic toxicology studies were conducted in Salmonella typhimurium,cultured Chinese hamster ovary cells, and mouse bone marrow. 14-WEEK STUDY IN RATS: Groups of 10 male and 10 female F344/N rats were fed diets containing 0, 30, 100, 300, 1,000, or 3,000 ppm p,pN-dichlorodiphenyl sulfone (equivalent to average daily doses of approximately 2, 6, 19, 65, or 200 mgp,pN-dichlorodiphenyl sulfone/kg body weight) for 14 weeks. All rats survived until the end of the study. Mean body weights of groups exposed to 300 ppm or greater were significantly less than those of the controls. Liver weights of groups exposed to 100 ppm or greater and kidney weights of 1,000 and 3,000 ppm male rats were significantly greater than those of the controls. Centrilobular hepatocyte hypertrophy of the liver was observed in most male rats exposed to 100 ppm or greater and in all female rats exposed to 300 ppm or greater, and the severities were increased in 300 ppm males and 1,000 and 3,000 ppm males and females. The incidences of nephropathy in 1,000 and 3,000 ppm female rats were significantly increased. Dose-related increases in severity of nephropathy were observed in male rats. 14-WEEK STUDY IN MICE: Groups of 10 male and 10 female B6C3F1 mice were fed diets containing 0, 30, 100, 300, 1,000, or 3,000 ppm p,pN-dichlorodiphenyl sulfone (equivalent to average daily doses of approximately 3.5, 15, 50
International Nuclear Information System (INIS)
Elsentriecy, Hassan H.; Azumi, Kazuhisa; Konno, Hidetaka
2008-01-01
The effects of pH and temperature of a stannate bath on the quality of stannate chemical conversion coatings formed on AZ91 D magnesium alloy by using the potentiostatic polarization technique at E = -1.1 V were investigated in order to improve uniformity and corrosion protection performance of the coating films. It was found that the uniformity and corrosion resistance of coating films deposited by potentiostatic polarization were closely associated with pH and temperature of the coating bath. The pH and temperature to obtain the best coating film were investigated as a function of corrosion protection performance evaluated by curves of potentiodynamic anodic polarization conducted in borate buffer solution. Scanning electron microscope observation and electrochemical corrosion tests of the stannate-coated samples confirmed significant improvement in uniformity and corrosion resistivity of coating films deposited by the potentiostatic technique by modifying the pH and temperature of the coating bath. It was also found that uniformity and corrosion resistivity of the coating films deposited by the potentiostatic technique were considerably improved compared to those of coatings deposited by the simple immersion method at the best conditions of pH and temperature of the coating bath
A high-temperature tolerant species in clade 9 of the genus Phytophthora: P. hydrogena sp. nov.
Yang, Xiao; Gallegly, Mannon E; Hong, Chuanxue
2014-01-01
A previously unknown Phytophthora species was isolated from irrigation water in Virginia, USA. This novel species produces abundant noncaducous and nonpapillate sporangia in soil water extract solution. It sometimes produces chlamydospores and hyphal swellings in aged cultures and in Petri's solution. This species has optimum vegetative growth at 30 C and grows well at 35 C. The lowest and highest temperatures for growth are 5 and 40 C. All isolates examined in this study are compatibility type A1 and produce mostly plerotic oospores when paired with an A2 mating-type tester of P. cinnamomi. Sequence analyses of the rDNA internal transcribed spacer (ITS) regions and the mitochondrially encoded cytochrome c oxidase 1 (cox 1) gene placed this species in clade 9 of the genus Phytophthora. These characteristics support the description of this taxon as a new species for which we propose the name P. hydrogena sp. nov. Further phylogenetic and physiological investigations of clade 9 species revealed a high-temperature tolerant cluster including P. hydrogena, P. aquimorbida, P. hydropathica, P. irrigata, P. chrysanthemi, P. insolita, P. polonica and P. parsiana. These species all grow well at 35 C. The monophyly of the species in this heat-tolerant cluster except P. insolita and P. polonica is highly supported by the maximum-likelihood analyses of the ITS and cox 1 sequences.
40 CFR 91.1008 - National security exemption.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false National security exemption. 91.1008... Engines § 91.1008 National security exemption. (a)(1) Any marine SI engine, otherwise subject to this part... for purposes of national security. No request for exemption is necessary. (2) Manufacturers may...
Miao, P P; Meng, T; Jia, Q; Niu, Y; Ye, M; Ji, Y Q; Ju, R; Chen, X L; Shao, H; Zheng, Y X; Dai, Y F
2016-05-01
To investigate the effect of occupational toluene diisocyanate(TDI) exposure on matrix metalloproteinases-9 (MMP-9) and tissue inhibitor of metalloproteinase-1(TIMP-1), and analysis of the correlation of MMP-9,TIMP-1,MMP-9/TIMP-1 and lung function. In October 2014, based on cluster sampling, we conducted a cross-sectional study in a TDI production factory located in China's western region. 61 exposed workers were recruited from workers engaged in packing, operating and checking. Based on different levels of the external exposure, the packers were classified as high exposed group, while operators and checkers as low exposed group. 58 factory managers, matching age and agent, were selected as controls, having same work intense and not contacting the TDI or other allergens. The questionnaire surveys were used to obtain the agent, age, work age, smoking and drinking, personal and family allergic history, occupational history, and the recent health conditions. The levels of MMP-9 and TIMP-1 in serum of subjects were determind by ELISA. The time weighted average concentrations (8h-TWA) were used to describe the levels of TDI air exposure in working environment. Spearman correlation assay was used to investigate the correlation of MMP-9, TIMP-1, MMP-9/TIMP-1 and lung function, exposure time. 8-hour TWA means of TDI air levels in exposed group, packers, operators and checkers were 0.39, 0.76, 0.25 mg/m(3), respectively . According to the external exposure concentration, the packers were classified as high exposed group, and the operators and checkers were classified as low exposed group. In controls, low exposed group and high exposed group, the levels of MMP-9, respectively, were (807.21±347.70),(586.91±317.50),(388.94±312.01) ng/ml (χ(2)=16.69, Pcorrelation analysis showed that levels of MMP-9 were positively associated with FEV1.0, and FEV1.0/FVC (r values were 0.27, 0.25, respectively, all Pcorrelated with exposure time(r=-0.26, P=0.040). The positive correlations
A high precision n-p scattering measurement at 14.9 MeV
Directory of Open Access Journals (Sweden)
Kornilov N.V.
2017-01-01
Full Text Available The n-p scattering angular distribution was measured with 14.9 MeV incident neutrons using the traditional time-of-flight technique with neutron-gamma discrimination. The scattering angle varied from 20o to 65o (laboratory system in 5o incremental steps. The efficiency of the neutron detectors was measured in the energy range 2–9 MeV relative to the 252Cf-standard, and was calculated using Monte Carlo methods in the 2–14 MeV energy range. Two methods of analysis were applied for experimental and simulated data: a traditional approach with a fixed threshold, and a dynamic threshold approach. The present data agree with the ENDF/B-VII evaluation for the shape of n-p angular distribution within about 1.5%.
Crystal Structure of the Yeast Nicotinamidase Pnc1p
Hu, Gang; Taylor, Alexander B.; McAlister-Henn, Lee; Hart, P. John
2007-01-01
The yeast nicotinamidase Pnc1p acts in transcriptional silencing by reducing levels of nicotinamide, an inhibitor of the histone deacetylase Sir2p. The Pnc1p structure was determined at 2.9 Å resolution using MAD and MIRAS phasing methods after inadvertent crystallization during the pursuit of the structure of histidine-tagged yeast isocitrate dehydrogenase (IDH). Pnc1p displays a cluster of surface histidine residues likely responsible for its co-fractionation with IDH from Ni2+-coupled chro...
Expression of KAI1/CD82 and MRP-1/CD9 in transitional cell carcinoma of bladder.
Ai, Xing; Zhang, Xu; Wu, Zhun; Ma, Xin; Ju, Zhenghua; Wang, Baojun; Shi, Taoping
2007-02-01
The expression of KAI1/CD82 and MRP-1/CD9 in transitional cell carcinoma of bladder (TCCB) and its clinical significance were investigated. Immunohistochemistry was used to detect KAI1/CD82 and MRP-1/CD9 protein expression in 52 TCCB specimens. Correlation between the expression of KAI1/CD82 and MRP-1/CD9 to clinicopathologic factors was statistically analyzed. The results showed that the positive rate of KAI1/CD82 and MRP-1/CD9 in TCCB was 50% and 61.5%, respectively. The MRP-1/CD9 and KAI1/CD82 expression was significantly associated with grade of TCCB (PMRP-1/CD9 or KAI1/CD82 expression and clinical stage of TCCB (P>0.05). The expression level of MRP-1/CD9 and KAI1/CD82 in recurrent TCCB samples was lower than that in non-recurrent samples (PMRP-1/CD9 expression was statistically significant (r=0.316, PMRP-1/CD9 expression may be important prognostic indicators and potentially useful for assessing the biological behavior of TCCB.
THE TEMPORAL CHANGES IN THE EMISSION SPECTRUM OF COMET 9P/TEMPEL 1 AFTER DEEP IMPACT
International Nuclear Information System (INIS)
Jackson, William M.; Yang Xueliang; Shi Xiaoyu; Cochran, Anita L.
2009-01-01
The time dependence of the changes in the emission spectra of Comet 9P/Tempel 1 after Deep Impact is derived and discussed. This was a unique event because for the first time it gave astronomers the opportunity to follow the time history of the formation and decay of O( 1 S), OH, CN, C 2 , C 3 , NH, and NH 2 . Least-squares fits of a modified Haser model with constraints using known rate constants were fit to the observed data. In the case of OH, a simple two-step Haser model provides a reasonable fit to the observations. Fitting the emissions from O( 1 S), CN, C 2 , C 3 , NH, and NH 2 requires the addition of a delayed component to a regular two- or three-step Haser model. From this information, a picture of the Deep Impact encounter emerges where there is an initial formation of gas and dust, which is responsible for the prompt emission that occurs right after impact. A secondary source of gas starts later after impact when the initial dust has dissipated enough so that solar radiation can reach the surface of freshly exposed material. The implications of this and other results are discussed in terms of the structure and composition of the comet's nucleus.
Dennis S. Ojima; Louis R. Iverson; Brent L. Sohngen; James M. Vose; Christopher W. Woodall; Grant M. Domke; David L. Peterson; Jeremy S. Littell; Stephen N. Matthews; Anantha M. Prasad; Matthew P. Peters; Gary W. Yohe; Megan M. Friggens
2014-01-01
What is "risk" in the context of climate change? How can a "risk-based framework" help assess the effects of climate change and develop adaptation priorities? Risk can be described by the likelihood of an impact occurring and the magnitude of the consequences of the impact (Yohe 2010) (Fig. 9.1). High-magnitude impacts are always...
Energy Technology Data Exchange (ETDEWEB)
Karthik, V., E-mail: karthik@igcar.gov.in [Metallurgy and Materials Group, Indira Gandhi Centre for Atomic Research, Kalpakkam, Tamil Nadu 603102 (India); Laha, K.; Parameswaran, P.; Chandravathi, K.S.; Kasiviswanathan, K.V.; Jayakumar, T.; Raj, Baldev [Metallurgy and Materials Group, Indira Gandhi Centre for Atomic Research, Kalpakkam, Tamil Nadu 603102 (India)
2011-10-15
Modified 9Cr-1Mo ferritic steel (P91) is subjected to a series of heat treatments consisting of soaking for 5 min at the selected temperatures in the range 973 K-1623 K (below Ac{sub 1} to above Ac{sub 4}) followed by oil quenching and tempering at 1033 K for 1 h to obtain different microstructural conditions. The tensile properties of the different microstructural conditions are evaluated from small volumes of material by shear punch test technique. A new methodology for evaluating yield strength, ultimate tensile strength and strain hardening exponent from shear punch test by using correlation equations without employing empirical constants is presented and validated. The changes in the tensile properties are related to the microstructural changes of the steel investigated by electron microscopic studies. The steel exhibits minimum strength and hardness when soaked between Ac{sub 1} and Ac{sub 3} (intercritical range) temperatures due to the replacement of original lath martensitic structure with subgrains. The finer martensitic microstructure produced in the steel after soaking at temperatures above Ac{sub 3} leads to a monotonic increase in hardness and strength with decreasing strain hardening exponent. For soaking temperatures above Ac{sub 4}, the hardness and strength of the steel increases marginally due to the formation of soft {delta} ferrite. - Highlights: > A methodology presented for computing tensile properties from shear punch test. > UTS and strain hardening estimated using extended analysis of blanking models. > The analysis methodology validated for different heat treated 9Cr-1Mo steel. > Changes in tensile properties of steel correlated with microstructures.
DST9-1, an ASIC for receiving and delivery of time signals
International Nuclear Information System (INIS)
Cuzon, J.C.
1999-01-01
In order to evaluate the 1.2 μ BiCMOS technology of AMS foundry the electronics department developed a full custom ASIC for time signal receiving and shaping according to our fast TDC pre-diffused ASIC. (author)
9 CFR 91.18 - Cleaning and disinfection of transport carriers for export.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cleaning and disinfection of transport....18 Cleaning and disinfection of transport carriers for export. All fittings, utensils and equipment... port. Such disinfection of halters, ropes, and similar equipment used in handling and tying of animals...
Year-round poultry litter decomposition and N, P, K and Ca release
Directory of Open Access Journals (Sweden)
Christiano Santos Rocha Pitta
2012-06-01
Full Text Available Poultry litter is an important nutrient source in agriculture, although little information is available regarding its decomposition rate and nutrient release. To evaluate these processes, poultry litter (PL was applied to the soil to supply 100, 200 and 300 kg ha-1 N contained in 4,953, 9,907 and 14,860 kg ha-1 PL, respectively. The litter bag technique was used to monitor the process of decomposition and nutrient release from the litter. These bags were left on the soil surface and collected periodically (after 15, 30, 60, 90, 120, 150, 180, 210, 240, 270, 300, 330, and 365 days. The dry matter (DM loss was highest (35 % after the first 30 days of field incubation. The highest nutrient release occurred in the first 60 days on the field, when 40, 34, 91, and 39 %, respectively, of N, P, K, and Ca of the initial PL dry matter (4,860 kg ha-1 was already released to the soil. In absolute terms, these percentages represent 40, 23, 134, and 69 kg ha-1 of N, P, K, and Ca and these values doubled and tripled as the PL fertilization rates increased to 9,907 and 14,860 kg ha-1, respectively. After one year of field incubation, the residual contents in the litter were 27, 15, 18 and 30 % of the initial DM , and N, P and Ca, respectively. The release rate of K was the fastest and 91 % of the K had been released from the PL after 30 days of field incubation.
Novel RepA-MCM proteins encoded in plasmids pTAU4, pORA1 and pTIK4 from Sulfolobus neozealandicus
DEFF Research Database (Denmark)
Greve, B.; Jensen, S.; Phan, H.
2005-01-01
Three plasmids isolated from the crenarchaeal thermoacidophile Sulfolobus neozealandicus were characterized. Plasmids pTAU4 (7,192 bp), pORA1 (9,689 bp) and pTIK4 (13,638 bp) show unusual properties that distinguish them from previously characterized cryptic plasmids of the genus Sulfolobus. Plas...
Eficiencia de la respuesta superovulatoria del ganado Brahman al protocolo P-24
Roger Salgado O.; Andrés Mejía A.; Pablo Suárez S.
2011-01-01
Objetivo. Evaluar la eficiencia de la respuesta superovulatoria del ganado Brahman al protocolo P-24. Materiales y métodos. Se utilizaron doce vacas Brahman donadoras con más de 60 días postparto, a las cuales se les realizó un total de 21 tratamientos superovulatorios con base en el protocolo P-24. Se realizó la colecta de los embriones a través del método convencional y los embriones fueron clasificados (IETS). Resultados. Se obtuvo un promedio de 9.1 estructuras, 4.4 embriones transferible...
RAC1 P29S regulates PD-L1 expression in melanoma
Vu, Ha Linh; Rosenbaum, Sheera; Purwin, Timothy J.; Davies, Michael A.; Aplin, Andrew E.
2015-01-01
Summary Whole exome sequencing of cutaneous melanoma has led to the detection of P29 mutations in RAC1 in 5–9% of samples, but the role of RAC1 P29 mutations in melanoma biology remains unclear. Using reverse phase protein array analysis to examine the changes in protein/phospho-protein expression, we identified cyclin B1, PD-L1, Ets-1, and Syk as being selectively upregulated with RAC1 P29S expression and downregulated with RAC1 P29S depletion. Using the melanoma patient samples in TCGA, we found PD-L1 expression to be significantly increased in RAC1 P29S patients compared to RAC1 WT as well as other RAC1 mutants. The finding that PD-L1 is upregulated suggests that oncogenic RAC1 P29S may promote suppression of the antitumor immune response. This is a new insight into the biological function of RAC1 P29S mutations with potential clinical implications as PD-L1 is a candidate biomarker for increased benefit from treatment with anti-PD1 or anti-PD-L1 antibodies. PMID:26176707
International Nuclear Information System (INIS)
Leite, Melissa Furlaneto Lellis; Reis, Marilia Alves dos; Oliveira, Cassio Miri; Castiglioni, Mario Luiz Vieira; Bressan, Rodrigo Affonseca
2017-01-01
TRODAT-1 is a radiopharmaceutical derived from tropane and linked to Technetium-99m (["9"9"mTc] TRODAT-1) has been used in studies of dopamine transporter (DAT) in central nervous system. Associated with the SPECT technique of acquisition, is able to detect changes in neurological disorders like Parkinson´s disease, evaluating the binding potential (BP) of DAT. The aim of this study was to evaluate the influence of the image reconstruction methods, Filtered Back Projection (FBP) and iterative reconstruction (OSEM), in BP values at the striatal region in 30 healthy volunteers. Images were analyzed by visual inspection and semi-quantitative analysis. Regions of interest (ROI) were made over striatal areas on both sides. Nonparametric Wilcoxon statistical analysis was performed between the BP values from the FBP and OSEM methods. Our results showed that the reconstruction methods have a statistical significant BP values difference in the total striatum (Z = -2,2787 p = 0.005), right striatum (Z = -2,602 p = 0.009) and left striatum (Z= 2,746 p = 0.006). The effect size was calculated to see if there influence in this test: the 'large effect size' for all measurements was observed (total striatum r= -0.51; right striatum r= -0.48; left striatum r= -0.50). FBP is the usual method of reconstruction for brain SPECT images, and our results showed influence of the OSEM method in BP. It is concluded that the method of image reconstruction adopted should be standardized to avoid incorrect evaluations of BP values using ["9"9"mTc]TRODAT-1. (author)
Calderon-Gonzalez, R; Terán-Navarro, H; García, I; Marradi, M; Salcines-Cuevas, D; Yañez-Diaz, S; Solis-Angulo, A; Frande-Cabanes, E; Fariñas, M C; Garcia-Castaño, A; Gomez-Roman, J; Penades, S; Rivera, F; Freire, J; Álvarez-Domínguez, C
2017-08-03
Dendritic cell-based (DC-based) vaccines are promising immunotherapies for cancer. However, several factors, such as the lack of efficient targeted delivery and the sources and types of DCs, have limited the efficacy of DCs and their clinical potential. We propose an alternative nanotechnology-based vaccine platform with antibacterial prophylactic abilities that uses gold glyconanoparticles coupled to listeriolysin O 91-99 peptide (GNP-LLO 91-99 ), which acts as a novel adjuvant for cancer therapy. GNP-LLO 91-99 , when used to vaccinate mice, exhibited dual antitumour activities, namely, the inhibition of tumour migration and growth and adjuvant activity for recruiting and activating DCs, including those from melanoma patients. GNP-LLO 91-99 nanoparticles caused tumour apoptosis and induced antigen- and melanoma-specific cytotoxic Th1 responses (P ≤ 0.5). We propose this adjuvant nanotherapy for preventing the progression of the first stages of melanoma.
Tatte, Vaishali S; Chaphekar, Deepa; Gopalkrishna, Varanasi
2017-08-01
Group A rotaviruses (RVA) are the major enteric etiological agents of severe acute gastroenteritis among children globally. As G9 RVA now represents as one of the major human RVA genotypes, studies on full genome of this particular genotype are being carried out worldwide. So far, no such studies on G9P[8] RVAs have been reported from Pune, western part of India. Keeping in view of this, the study was undertaken to understand the degree of genetic diversity of the commonly circulating G9P[8] RVA strains. Rotavirus surveillance studies carried out earlier during the years 2009-2011 showed increase in the prevalence of G9P[8] RVAs. Representative G9P[8] RVA strains from the years 2009, 2010, and 2011 were selected for the study. In general, all the G9 RVA strains showed clustering in the globally circulating sublineage of the VP7 gene and showed nucleotide/amino acid identities of 96.8-99.7%/96.9-99.8% with global G9 RV strains. Full genome analysis, of all three RVAs in this study indicated Wa-like genotype constellation G9-P[8]-I1-R1-C1-M1-A1-N1-T1-E1-H1. Within the strains nucleotide/amino acid divergence of 0.1-3.4%/0.0-4.1% was noted in all the RVA structural and non-structural genes. In conclusion, the present study highlights intra-genotypic variations throughout the RVA genome. The study further emphasizes the need for surveillance and analysis of the whole genomic constellation of the commonly circulating RVA strains of other regions in the country for understanding to a greater degree of the impact of rotavirus vaccination recently introduced in India. © 2017 Wiley Periodicals, Inc.
Immunohistochemical expression of TGF-β1 and MMP-9 in periapical lesions.
Álvares, Pâmella Recco; Arruda, José Alcides Almeida de; Silva, Leorik Pereira da; Nascimento, George João Ferreira do; Silveira, Maria Fonseca da; Sobral, Ana Paula Veras
2017-07-03
The objective of this study was to evaluate the expression of matrix metalloproteinase 9 (MMP-9) and transforming growth factor beta (TGF-β1) in periapical lesion samples correlated with the intensity of the inflammatory infiltrate and thickness of the epithelial lining. Forty-five cases of periapical lesions (23 periapical granulomas and 22 radicular cysts) were subjected to morphological and immunohistochemical analyses using anti-MMP-9 and anti-TGF-β1 antibodies. The data were analyzed using the following tests: non-parametric Mann-Whitney, chi-square, Fisher's exact test and Spearman's correlation test (Pperiapical granulomas presented infiltrate grade III, in contrast with 32% of radicular cysts (Pcysts revealed the presence of atrophic epithelium in 86% of the cysts. The immunostaining of MMP-9 was score 2 in 67% of the granulomas and 77% of the cysts. Both lesions were predominantly score 1 for TGF-β1. Significant differences were confirmed between the expression scores of TGF-β1 and MMP-9 in periapical granulomas (p = 0.004) and in radicular cysts (p periapical granulomas and radicular cysts. This immunoregulatory cytokine seems more representative in asymptomatic lesions. The extracellular matrix remodeling process dependent on MMP-9 seems to be similar for both periapical granulomas and radicular cysts. TGF-β1 and MMP-9 may play an important role in the maintenance of periapical lesions.
Microstructural Stability and Oxidation Resistance of 9-12 Chromium Steels at Elevated Temperatures
Energy Technology Data Exchange (ETDEWEB)
Dogan, O.N.; Alman, D.E.; Jablonski, P.D.; Hawk, J.A.
2006-05-01
Various martensitic 9-12 Cr steels are utilized currently in fossil fuel powered energy plants for their good elevated temperature properties such as creep strength, steam side oxidation resistance, fire side corrosion resistance, and thermal fatigue resistance. Need for further improvements on the properties of 9-12 Cr steels for higher temperature (>600oC) use is driven by the environmental concerns (i.e., improve efficiency to reduce emissions and fossil fuel consumption). In this paper, we will discuss the results of the research done to explore new subsitutional solute solution and precipitate hardening mechanisms for improved strength of 9-12 Cr martensitic steels. Stability of the phases present in the steels will be evaluated for various temperature and time exposures. A comparison of microstructural properties of the experimental steels and commercial steels will also be presented.
The influence of a Ce surface treatment on oxidation behavior of a commercial (P91) and several experimental steels containing 9 to 12 weight percent Cr was examined at 650ºC in flowing dry and moist air. The oxidation behavior of all the alloys without the Ce modification was significantly degraded by the presence of moisture in the air during testing. For instance the weight gain for P91 was two orders of magnitude greater in moist air than in dry air. This was accompanied by a change in oxide scale from the formation of Cr-based scales in dry air to the formation of Fe-based scales in moist air. The Ce surface treatment was very effective in improving the oxidation resistance of the experimental steels in both moist and dry air. For instance, after exposure to moist air at 650ºC for 2000 hours, an experimental alloy with the cerium surface modification had a weight gain three orders of magnitude lower than the alloy without the Ce modification and two orders of magnitude lower than P91. The Ce surface treatment suppressed the formation of Fe-based scales and
25 CFR 91.11 - Domestic animals in village reserves.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Domestic animals in village reserves. 91.11 Section 91.11... VILLAGES, OSAGE RESERVATION, OKLAHOMA § 91.11 Domestic animals in village reserves. (a) No livestock shall... owner of the animal, if known, by certified mail or by posting in the village square. The notice shall...
27 CFR 4.91 - List of approved prime names.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false List of approved prime names. 4.91 Section 4.91 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF WINE American Grape Variety Names § 4.91 List...
Sathananthan, Matheni; Farrugia, Luca P; Miles, John M; Piccinini, Francesca; Dalla Man, Chiara; Zinsmeister, Alan R; Cobelli, Claudio; Rizza, Robert A; Vella, Adrian
2013-08-01
Exendin-(9,39) is a competitive antagonist of glucagon-like peptide-1 (GLP-1) at its receptor. However, it is unclear if it has direct and unique effects of its own. We tested the hypothesis that exendin-(9,39) and GLP-1-(9,36)amide have direct effects on hormone secretion and β-cell function as well as glucose metabolism in healthy subjects. Glucose containing [3-(3)H]glucose was infused to mimic the systemic appearance of glucose after a meal. Saline, GLP-1-(9,36)amide, or exendin-(9,39) at 30 pmol/kg/min (Ex 30) or 300 pmol/kg/min (Ex 300) were infused in random order on separate days. Integrated glucose concentrations were slightly but significantly increased by exendin-(9,39) (365 ± 43 vs. 383 ± 35 vs. 492 ± 49 vs. 337 ± 50 mmol per 6 h, saline, Ex 30, Ex 300, and GLP-1-[9,36]amide, respectively; P = 0.05). Insulin secretion did not differ among groups. However, insulin action was lowered by exendin-(9,39) (25 ± 4 vs. 20 ± 4 vs. 18 ± 3 vs. 21 ± 4 10(-4) dL/kg[min per μU/mL]; P = 0.02), resulting in a lower disposition index (DI) during exendin-(9,39) infusion (1,118 ± 118 vs. 816 ± 83 vs. 725 ± 127 vs. 955 ± 166 10(-14) dL/kg/min(2) per pmol/L; P = 0.003). Endogenous glucose production and glucose disappearance did not differ significantly among groups. We conclude that exendin-(9,39), but not GLP-1-(9,36)amide, decreases insulin action and DI in healthy humans.
Directory of Open Access Journals (Sweden)
Stefan Schulz
2010-11-01
Full Text Available The title compound, [Rh(C8H12(C18H36P2]BF4, exhibits a rhodium(I complex cation with a bidentate bisphosphine ligand and a bidentate η2,η2-coordinated cycloocta-1,5-diene ligand. The ligands form a slightly distorted square-planar coordination environment for the Rh(I atom. An intramolecular P–Rh–P bite angle of 83.91 (2° is observed. The dihedral angle between the P—Rh—P and the X—Rh—X planes (X is the centroid of a double bond is 14.0 (1°. The BF4 anion is disordered over two positions in a 0.515 (7:0.485 (7 ratio.
31 CFR 50.91 - Notice to Congress.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Notice to Congress. 50.91 Section 50... PROGRAM Cap on Annual Liability § 50.91 Notice to Congress. Pursuant to section 103(e)(3) of the Act, the Secretary shall provide an initial notice to Congress within 15 days of the certification of an act of...
Study of the (p,pn) reaction on 1p shell nuclei at 46 MeV
Energy Technology Data Exchange (ETDEWEB)
Miller, C A
1974-01-01
The (p,pn) reaction on four 1p shell nuclei, /sup 6/Li, /sup 9/Be, /sup 13/C and /sup 12/C, as well as the /sup 6/Li(p,2p) reaction, have been studied at 46 MeV. The /sup 6/Li(p,pn) cross section was found to be approximately four times that for (p,2p) and to have a very different angular dependence. Both reactions show the s-state admixture in /sup 6/Li observed with (p,2p) at higher energies. For all of the target nuclei, the cross sections have features that cannot be fitted by a renormalized Plane Wave Impulse Approximation (PWIA) calculation. A zero range distorted wave calculation was found to be in only fair agreement with the /sup 9/Be and /sup 13/C data. The overall magnitudes of the results of the calculation were found to be very sensitive to the RMS radii of the bound state wave functions of the knocked-out neutrons.
SOX9 regulates microRNA miR-202-5p/3p expression during mouse testis differentiation
DEFF Research Database (Denmark)
Wainwright, Elanor N; Jorgensen, Joan S; Kim, Youngha
2013-01-01
MicroRNAs are important regulators of developmental gene expression, but their contribution to fetal gonad development is not well understood. We have identified the evolutionarily conserved gonadal microRNAs miR-202-5p and miR-202-3p as having a potential role in regulating mouse embryonic gonad....... Expression of the primary transcript of miR-202-5p/3p remained low in XY gonads in a conditional Sox9-null mouse model, suggesting that pri-miR-202 transcription is downstream of SOX9, a transcription factor that is both necessary and sufficient for male sex determination. We identified the pri-miR-202...
Arecoline-induced growth arrest and p21WAF1 expression are dependent on p53 in rat hepatocytes
International Nuclear Information System (INIS)
Chou, W.-W.; Guh, J.-Y.; Tsai, J.-F.; Hwang, C.-C.; Chen, H.-C.; Huang, J.-S.; Yang, Y.-L.; Hung, W.-C.; Chuang, L.-Y.
2008-01-01
Betel-quid use is associated with the risk of liver cirrhosis and hepatocellular carcinoma and arecoline, the major alkaloid of betel-quid, is hepatotoxic in mice. Therefore, we studied the cytotoxic and genotoxic effects of arecoline in normal rat hepatocytes (Clone-9 cells). Arecoline dose-dependently (0.1-1 mM) decreased cell cycle-dependent proliferation while inducing DNA damage at 24 h. Moreover, arecoline (1 mM)-induced apoptosis and necrosis at 24 h. Arecoline dose-dependently (0.1-0.5 mM) increased transforming growth factor-β (TGF-β) mRNA, gene transcription and bioactivity and neutralizing TGF-β antibody attenuated arecoline (0.5 mM)-inhibited cell proliferation at 24 h. Arecoline (0.5 mM) also increased p21 WAF1 protein expression and p21 WAF1 gene transcription. Moreover, arecoline (0.5 mM) time-dependently (8-24 h) increased p53 serine 15 phosphorylation. Pifithrin-α (p53 inhibitor) and the loss of the two p53-binding elements in the p21 WAF1 gene promoter attenuated arecoline-induced p21 WAF1 gene transcription at 24 h. Pifithrin-α also attenuated arecoline (0.5 mM)-inhibited cell proliferation at 24 h. We concluded that arecoline induces cytotoxicity, DNA damage, G 0 /G 1 cell cycle arrest, TGF-β1, p21 WAF1 and activates p53 in Clone-9 cells. Moreover, arecoline-induced p21 WAF1 is dependent on p53 while arecoline-inhibited growth is dependent on both TGF-β and p53
2011-11-03
..., Social Security Online, at http://www.socialsecurity.gov . SUPPLEMENTARY INFORMATION: SSRs make available... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2011-0068] Social Security Rulings, SSR 91-1c and SSR 66-18c; Rescission of Social Security Rulings (SSR) 66-18c and SSR 91-1c AGENCY: Social Security...
International Nuclear Information System (INIS)
Slovinskij, B.; Mulas, Eh.
1981-01-01
The energy spectra of protons (ESP) emitted in reactions p+Xe→kp+... at 2.34 GeV/c (k=1-9) and π - +Xe→kp+... at 9 GeV/c (k=1-17) have been studied. An evidence has been obtained for a unified description of those spectra by an exponential dependence of the invariant cross sections upon the kinetic energy independently of the proton emission angle. It is found that the ESP temperature becomes independent of the proton emission frequency when the energy of the interaction induced hadron is greater than approximately 3 GeV [ru
Gatfield, John; Monnier, Lucile; Studer, Rolf; Bolli, Martin H; Steiner, Beat; Nayler, Oliver
2014-07-01
The sphingosine-1-phosphate (S1P) type 1 receptor (S1P1R) is a novel therapeutic target in lymphocyte-mediated autoimmune diseases. S1P1 receptor desensitization caused by synthetic S1P1 receptor agonists prevents T-lymphocyte egress from secondary lymphoid organs into the circulation. The selective S1P1 receptor agonist ponesimod, which is in development for the treatment of autoimmune diseases, efficiently reduces peripheral lymphocyte counts and displays efficacy in animal models of autoimmune disease. Using ponesimod and the natural ligand S1P, we investigated the molecular mechanisms leading to different signaling, desensitization and trafficking behavior of S1P1 receptors. In recombinant S1P1 receptor-expressing cells, ponesimod and S1P triggered Gαi protein-mediated signaling and β-arrestin recruitment with comparable potency and efficiency, but only ponesimod efficiently induced intracellular receptor accumulation. In human umbilical vein endothelial cells (HUVEC), ponesimod and S1P triggered translocation of the endogenous S1P1 receptor to the Golgi compartment. However, only ponesimod treatment caused efficient surface receptor depletion, receptor accumulation in the Golgi and degradation. Impedance measurements in HUVEC showed that ponesimod induced only short-lived Gαi protein-mediated signaling followed by resistance to further stimulation, whereas S1P induced sustained Gαi protein-mediated signaling without desensitization. Inhibition of S1P lyase activity in HUVEC rendered S1P an efficient S1P1 receptor internalizing compound and abrogated S1P-mediated sustained signaling. This suggests that S1P lyase - by facilitating S1P1 receptor recycling - is essential for S1P-mediated sustained signaling, and that synthetic agonists are functional antagonists because they are not S1P lyase substrates. Copyright © 2014 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Fujii, Yasuyuki; Ueda, Yasuji; Ohtake, Hidenori; Ono, Naoya; Takayama, Tetsuo; Nakazawa, Kiyoshi; Igarashi, Yasuyuki; Goitsuka, Ryo
2012-01-01
Highlights: ► The effect of a newly developed S1P 1 -selective antagonist on angiogenic responses. ► S1P 1 is a critical component of VEGF-related angiogenic responses. ► S1P 1 -selective antagonist showed in vitro activity to inhibit angiogenesis. ► S1P 1 -selective antagonist showed in vivo activity to inhibit angiogenesis. ► The efficacy of S1P 1 -selective antagonist for anti-cancer therapies. -- Abstract: Sphingosine 1-phosphate receptor type 1 (S1P 1 ) was shown to be essential for vascular maturation during embryonic development and it has been demonstrated that substantial crosstalk exists between S1P 1 and other pro-angiogenic growth factors, such as vascular endothelial growth factor (VEGF) and basic fibroblast growth factor. We developed a novel S1P 1 -selective antagonist, TASP0277308, which is structurally unrelated to S1P as well as previously described S1P 1 antagonists. TASP0277308 inhibited S1P- as well as VEGF-induced cellular responses, including migration and proliferation of human umbilical vein endothelial cells. Furthermore, TASP0277308 effectively blocked a VEGF-induced tube formation in vitro and significantly suppressed tumor cell-induced angiogenesis in vivo. These findings revealed that S1P 1 is a critical component of VEGF-related angiogenic responses and also provide evidence for the efficacy of TASP0277308 for anti-cancer therapies.
DRD2 A1 allele and P300 abnormalities in obesity
Energy Technology Data Exchange (ETDEWEB)
Blum, K. [Univ. of Texas Health Science Center, San Antonio, TX (United States)]|[PATH Foundation, Princeton, NJ (United States); Wood, R.; Sheridan, L.P.J. [Univ. of Texas Health Science Center, San Antonio, TX (United States)] [and others
1994-09-01
Obesity is a heterogeneous and prevalent disorder having both inheritable and environmental components. The role of the dopamine system in P300 has been implicated. We genotyped 193 neuropsychiatrically ill patients with and without comorbid drug and alcohol/abuse/dependence and obesity for the prevalence of the A1 allele of the DRD2 gene. We found a significant linear trend ({chi}{sup 2} = 40.4, df=1, p<0.00001) where the percent prevalence of the A1 increased with increasing polysubstance abuse. Where the A1 allele was found in 44% of 40 obese subjects, the A1 allele prevalence was found in as much as 91% of 11 obese subjects with comorbid polysubstance abuse. 53 obese subjects having a mean body weight (BMI) of 34.6{+-}8.2 were mapped for brain electrical activity and compared with 15 controls with a BMI of 22.3{+-}3.0 (P<.001). The P3 amplitude was significantly different (two tailed; t=3.24, df=16.2, P = 0.005), whereas P3 latency was not significant. Preliminarily, we found a significant decreased P3 amplitude correlated with parental polysubstance abuse (p=0.4) with prolongation of P3 latency correlated with the three risk factors of parental substance abuse, chemical dependency and carbohydrate bingeing (P<0.02). Finally, in a small sample, the A1 allele was present in 25% of probands having 0 risk compared to 66% in those obese subjects with any risk. This work represents the first electrophysiological data to implicate P3 abnormalities in a subset of obesity and further confirms an association of the DRD2 gene and a electrophysiological marker previously indicated to have predictive value in vulnerability to addictive behaviors.
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš
2008-01-01
Roč. 100, č. 9 (2008), 091802/1-091802/7 ISSN 0031-9007 R&D Projects: GA MŠk LC527; GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008
Final report for Tank 241-B-101, push mode cores 90 and 91. Revision 1
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-11-01
This is the final report for tank 241-at sign 101, cores 90 and 91. Samples from these cores were analyzed for safety screening purposes in accordance with the Tank 241-B-101 Tank Characterization Plan (TCP) (Reference 1). This final report contains the results for three sets of TGA and gravimetric analyses performed after the 90-day report was issued. Two of these TGA/gravimetric percent water sets of analyses were done because low original TGA results were obtained for the lower half segment of core 90, segment 2 and the facie of core 91, segment 2; the third set of analyses were performed because the TGA and gravimetric percent water results for the upper half segment of core 90, segment 2 differed by approximately a factor of three and further investigation was warranted
Matusiak, Agnieszka; Kuczer, Mariola; Czarniewska, Elżbieta; Rosiński, Grzegorz; Kowalik-Jankowska, Teresa
2014-09-01
Mono- and polynuclear copper(II) complexes of the alloferon 1 with point mutations (H1A) A(1)GVSGH(6)GQH(9)GVH(12)G (Allo1A) and (H9A) H(1)GVSGH(6)GQA(9)GVH(12)G (Allo9A) have been studied by potentiometric, UV-visible, CD, EPR spectroscopic and mass spectrometry (MS) methods. To obtain a complete complex speciation different metal-to-ligand molar ratios ranging from 1:1 to 4:1 for Allo1A and to 3:1 for Allo9A were studied. The presence of the His residue in first position of the peptide chain changes the coordination abilities of the Allo9A peptide in comparison to that of the Allo1A. Imidazole-N3 atom of N-terminal His residue of the Allo9A peptide forms stable 6-membered chelate with the terminal amino group. Furthermore, the presence of two additional histidine residues in the Allo9A peptide (H(6),H(12)) leads to the formation of the CuL complex with 4N {NH2,NIm-H(1),NIm-H(6),NIm-H(12)} binding site in wide pH range (5-8). For the Cu(II)-Allo1A system, the results demonstrated that at physiological pH7.4 the predominant complex the CuH-1L consists of the 3N {NH2,N(-),CO,NIm} coordination mode. The inductions of phenoloxidase activity and apoptosis in vivo in Tenebrio molitor cells by the ligands and their copper(II) complexes at pH7.4 were studied. The Allo1A, Allo1K peptides and their copper(II) complexes displayed the lowest hemocytotoxic activity while the most active was the Cu(II)-Allo9A complex formed at pH7.4. The results may suggest that the N-terminal-His(1) and His(6) residues may be more important for their proapoptotic properties in insects than those at positions 9 and 12 in the peptide chain. Copyright © 2014 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Lee, Hyeong Yeon; Kim, Woo Gon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Lee, Han Sang; Kim, Yun Jae [Korea Univ., Seoul (Korea, Republic of)
2013-10-15
In this study, the material properties of tensile strength, creep properties, and creep crack growth model for Gr.91 steel at elevated temperature were obtained from material tests at KAERI, and the test data were compared with those of the French elevated temperature design code, RCC-MRx. The conservatism of the material properties in the French design code is highlighted. Mod.9Cr-1Mo (ASME Grade 91; Gr.91) steel is widely adopted as candidate material for Generation IV nuclear systems as well as for advanced thermal plants. In a Gen IV sodium-cooled fast reactor of the PGSFR (Prototype Gen IV Sodium-cooled Fast Reactor) being developed by KAERI (Korea Atomic Energy Research Institute), Gr.91 steel is selected as the material for the steam generator, secondary piping, and decay heat exchangers. However, as this material has a relatively shorter history of usage in an actual plant than austenitic stainless steel, there are still many issues to be addressed including the long-term creep rupture life extrapolation and ratcheting behavior with cyclic softening characteristics.
Coexistence of 9p Deletion Syndrome and Autism Spectrum Disorder
Günes, Serkan; Ekinci, Özalp; Ekinci, Nuran; Toros, Fevziye
2017-01-01
Deletion or duplication of the short arm of chromosome 9 may lead to a variety of clinical conditions including craniofacial and limb abnormalities, skeletal malformations, mental retardation, and autism spectrum disorder. Here, we present a case report of 5-year-old boy with 9p deletion syndrome and autism spectrum disorder.
Professor håber på åbenhed om CRISPR/Cas9
DEFF Research Database (Denmark)
Hokland, Peter
2016-01-01
CRISPR/Cas9 er navnet på en ny, revolutionerende genteknologi, der på sigt kan ændre menneskeheden. Forhåbentligt vil processen være være løbende opdateringer om frem- og tilbageskridt om teknikken, skriver professor.......CRISPR/Cas9 er navnet på en ny, revolutionerende genteknologi, der på sigt kan ændre menneskeheden. Forhåbentligt vil processen være være løbende opdateringer om frem- og tilbageskridt om teknikken, skriver professor....
Panic disorder and hyperventilation Transtorno do pânico e hiperventilação
Directory of Open Access Journals (Sweden)
ANTONIO EGIDIO NARD
1999-12-01
Full Text Available Respiratory abnormalities are associated with anxiety, particularly with panic attacks. Symptoms such as shortness of breath, "empty-head" feeling, dizziness, paresthesias and tachypnea have been described in the psychiatric and respiratory physiology related to panic disorder. Panic disorder patients exhibit both behaviorally and physiologically abnormal responses to respiratory challenges tests. Objective: We aim to observe the induction of panic attacks by hyperventilation in a group of panic disorder patients (DSM-IV. Method: 13 panic disorder patients and 11 normal volunteers were randomly selected. They were drug free for a week. They were induced to hyperventilate (30 breaths/min for 3 minutes. Anxiety scales were taken before and after the test. Results: 9 (69.2% panic disorder patients and one (9.1% of control subjects had a panic attack after hyperventilating (pDistúrbios respiratórios estão associados à ansiedade, especialmente aos ataques de pânico. Sufocamento, sensação de "cabeça leve", tonteira, parestesias e taquipnéia aparecem na descrição psiquiátrica e respiratória do transtorno do pânico. Pacientes com transtorno do pânico apresentam respostas comportamentais e fisiológicas anormais a testes respiratórios. Objetivo: Observamos a indução de ataques de pânico através de hiperventilação em um grupo de pacientes com transtorno do pânico (DSM-IV. Método: Selecionamos de forma randomizada 13 pacientes com transtorno do pânico e 11 voluntários normais. Todos estavam sem medicação há uma semana. Foram induzidos a hiperventilar (30 inspirações/minuto durante 3 minutos. Escalas de ansiedade foram utilizadas antes e após o teste. Resultados: No grupo com transtorno de pânico, 9 (69,2% pacientes apresentaram ataque de pânico após a hiperventilação e apenas 1 (9,1% no grupo controle (p<0,05. Conclusão: Os pacientes com transtorno do pânico foram mais sensíveis à hiperventilação que o grupo
40 CFR 91.123 - Denial, revocation of certificate of conformity.
2010-07-01
... conformity. 91.123 Section 91.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Certification Provisions § 91.123 Denial, revocation of certificate of conformity. (a) If, after review of the... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...
Analysis list: CDK9 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available CDK9 Blood,Liver + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/CDK9....1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/CDK9.5.tsv http://dbarchive.biosciencedbc.jp/k...yushu-u/hg19/target/CDK9.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/CDK9.Blood.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/CDK9.Liver.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Liver.gml ...
Evidence for presumable feline origin of sporadic G6P[9] rotaviruses in humans.
Pietsch, Corinna; Liebert, Uwe G
2018-05-31
Species A rotaviruses are highly diverse and impose a substantial burden to human and animal health. Interspecies transmission between livestock, domestic animals and humans is commonly observed, but spread of animal-like rotaviruses within the human population is limited. During the continued monitoring of rotavirus strains in Germany, an unusual G6P[9] rotavirus strain was detected in feces of a child. The complete rotavirus coding sequences revealed a unique G6-P[9]-I2-R2-C2-M2-A3-N2-T3-E2-H3 genotype constellation. The virus was phylogenetically related to feline G3P[9] strains and other human G6P[9] rotaviruses of presumable zoonotic origin. Analysis of primer binding sites of G6 specific genotyping revealed further evidence of a G6P[9] feline reservoir. Moreover, substantial deficits of conventional semi-nested PCR genotyping approaches in detecting contemporary G6P[9] were revealed. Rotavirus strain GER29-14 most likely resulted from a direct or recent interspecies transmission from a cat to human. Further studies could assess nucleic acid sequences and genotype constellations of feline rotavirus to confirm the likely feline origin of sporadic human G6P[9] strains. Copyright © 2018 Elsevier B.V. All rights reserved.
Glycosylation at Asn91 of H1N1 haemagglutinin affects binding to glycan receptors.
Jayaraman, Akila; Koh, Xiaoying; Li, Jing; Raman, Rahul; Viswanathan, Karthik; Shriver, Zachary; Sasisekharan, Ram
2012-06-15
The glycoprotein HA (haemagglutinin) on the surface of influenza A virus plays a central role in recognition and binding to specific host cell-surface glycan receptors and in fusion of viral membrane to the host nuclear membrane during viral replication. Given the abundance of HA on the viral surface, this protein is also the primary target for host innate and adaptive immune responses. Although addition of glycosylation sites on HA are a part of viral evolution to evade the host immune responses, there are specific glycosylation sites that are conserved during most of the evolution of the virus. In the present study, it was demonstrated that one such conserved glycosylation site at Asn(91) in H1N1 HA critically governs the glycan receptor-binding specificity and hence would potentially impinge on the host adaptation of the virus.
Yang, Yanlong; Chen, Kai; Zhou, Yongchun; Hu, Zaoxiu; Chen, Shuai; Huang, Yunchao
2018-01-01
Xuanwei City is located in late Permian coal-accumulating areas of the northeastern region of Yunnan Province. In China, morbidity and mortality from lung cancer are highest in Yunnan. Identifying useful circulating markers suitable for the diagnosis of lung cancer in this region is quite meaningful. In this study, we evaluated diagnostic roles of serum miR-9-5p, 21-5p, 223-3p, 135b-5p, 339-5p, and 501-5p in patients with non-small-cell lung cancer (NSCLC) in Yunnan. Moreover, we evaluated the diagnostic performance of several tumor markers, including carcinoembryonic antigen (CEA), cytokeratin 19 fragment 21-1 (CYFRA21-1), and squamous cell carcinoma-related antigen (SCC). Quantitative real-time polymerase chain reaction detected six miRNAs in the serum of 104 NSCLC patients and 50 cancer-free controls. Other markers, including CEA, CYFRA21-1, and SCC, in serum were also measured. The diagnostic ability of miRNAs and tumor markers was evaluated by receiver operating characteristic (ROC) curve analysis. The diagnostic performance of these serum markers was also evaluated in Xuanwei and non-Xuanwei subjects, because the etiological and the epidemiological characteristics of lung cancer in Xuanwei were quite different from those in other regions. Serum miR-9-5p, miR-21-5p, miR-223-3p, CEA, CYFRA21-1, and SCC were upregulated in NSCLC patients, compared with cancer-free controls. No significant difference was found in miR-135b-5p, miR-339-5p, and miR-501-5p expression. The area under ROC curves (AUCs) of miR-9-5p, miR-21-5p, miR-223-3p, CEA, CYFRA21-1, and SCC were 0.706, 0.765, 0.744, 0.749, 0.735, and 0.616, respectively. When combined, miRNAs and tumor markers yielded the highest diagnostic power, with AUC of 0.886, sensitivity of 82.69%, and specificity of 88.00%. In Xuanwei subjects, miR-223-3p and CEA may be suitable biomarkers to distinguish NSCLC from cancer-free states with AUCs of 0.752 and 0.791, respectively. The diagnostic power of the combination of mi
Fierro-Fernández, Marta; Busnadiego, Óscar; Sandoval, Pilar; Espinosa-Díez, Cristina; Blanco-Ruiz, Eva; Rodríguez, Macarena; Pian, Héctor; Ramos, Ricardo; López-Cabrera, Manuel; García-Bermejo, Maria Laura; Lamas, Santiago
2015-10-01
Uncontrolled extracellular matrix (ECM) production by fibroblasts in response to injury contributes to fibrotic diseases, including idiopathic pulmonary fibrosis (IPF). Reactive oxygen species (ROS) generation is involved in the pathogenesis of IPF. Transforming growth factor-β1 (TGF-β1) stimulates the production of NADPH oxidase 4 (NOX4)-dependent ROS, promoting lung fibrosis (LF). Dysregulation of microRNAs (miRNAs) has been shown to contribute to LF. To identify miRNAs involved in redox regulation relevant for IPF, we performed arrays in human lung fibroblasts exposed to ROS. miR-9-5p was selected as the best candidate and we demonstrate its inhibitory effect on TGF-β receptor type II (TGFBR2) and NOX4 expression. Increased expression of miR-9-5p abrogates TGF-β1-dependent myofibroblast phenotypic transformation. In the mouse model of bleomycin-induced LF, miR-9-5p dramatically reduces fibrogenesis and inhibition of miR-9-5p and prevents its anti-fibrotic effect both in vitro and in vivo. In lung specimens from patients with IPF, high levels of miR-9-5p are found. In omentum-derived mesothelial cells (MCs) from patients subjected to peritoneal dialysis (PD), miR-9-5p also inhibits mesothelial to myofibroblast transformation. We propose that TGF-β1 induces miR-9-5p expression as a self-limiting homeostatic response. © 2015 The Authors.
21 CFR 1301.91 - Employee responsibility to report drug diversion.
2010-04-01
... REGISTRATION OF MANUFACTURERS, DISTRIBUTORS, AND DISPENSERS OF CONTROLLED SUBSTANCES Employee Screening-Non-Practitioners § 1301.91 Employee responsibility to report drug diversion. Reports of drug diversion by fellow... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Employee responsibility to report drug diversion...
Gicquel, Adeline; Bockelée-Morvan, D.; Kelley, M. S.; Woodward, C. E.; Wooden, D. H.
2010-10-01
The Deep Impact (DI) spacecraft encountered comet 9P/Tempel 1 on July 4th, 2005. The spacecraft released an impactor that collided with the comet nucleus and excavated (possibly unprocessed) cometary material in a prominent ejecta plume. Spectral maps covering 20'' x 67'' (1.85''/pixel) were acquired with the IRS instrument on the Spitzer Space Telescope at different times around the DI event: twice before impact (TI-41.3hrs and TI-22.9hrs) and twelve times after impact (between TI+0.67hrs and TI+1027hrs). These IRS observations are stored in the Spitzer data archive and presented by Lisse et al. (2006, Science 313, 635). We present the interpretation of 5.2-7.6 micrometer spectra obtained in the second order of the short-wavelength module (SL2). To reduce the contribution of artifacts in the spectra, 5x5 pixel extraction apertures (9.25''x9.25'') were used. The underlying continuum in the spectra provides information on the grain size distribution and color temperature of the dust ejecta. In order to determine the grain size distribution, we assumed that ejecta consist of a composition of both amorphous carbon and silicates. The grains are assumed to be spherical with sizes in range from 0.1 to 100 micrometers. We used the Mie theory to calculate the optical properties of each material and the temperature of the grain. We constrained the grain size distribution and velocities from the spectra and the temporal evolution of the dust flux. The dust mass and dust/gas ratio in the ejecta cloud are also derived and compared with other values published in the literature.
International Nuclear Information System (INIS)
Shiue, Grace G.; Shiue, Chyng-Yann; Lee, Roland L.; MacDonald, Douglas; Hustinx, Roland; Eck, Stephen L.; Alavi, Abass A.
2001-01-01
9-[(3-[ 18 F]Fluoro-1-hydroxy-2-propoxy)methyl]guanine ([ 18 F]FHPG, 2) has been synthesized by nucleophilic substitution of N 2 -(p-anisyldiphenylmethyl)-9-{[1-(p-anisyldiphenylmethoxy)-3 -toluenesulfonyloxy-2-propoxy]methyl}guanine (1) with potassium [ 18 F]fluoride/Kryptofix 2.2.2 followed by deprotection with 1 N HCl and purification with different methods in variable yields. When both the nucleophilic substitution and deprotection were carried out at 90 deg. C and the product was purified by HPLC (method A), the yield of compound 2 was 5-10% and the synthesis time was 90 min from EOB. However, if both the nucleophilic substitution and deprotection were carried out at 120 deg. C and the product was purified by HPLC, the yield of compound 2 decreased to 2%. When compound 2 was synthesized at 90 deg. C and purified by Silica Sep-Pak (method B), the yield increased to 10-15% and the synthesis time was 60 min from EOB. Similarly, 9-(4-[ 18 F]fluoro-3-hydroxymethylbutyl)guanine ([ 18 F]FHBG, 4) was synthesized with method A and method B in 9% and 10-15% yield, respectively, in a synthesis time of 90 and 60 min, respectively, from EOB. Compound 2 was relatively unstable in acidic medium at 120 deg. C while compound 4 was stable under the same condition. Both compound 2 and compound 4 had low lipid/water partition coefficient (0.126±0.022, n=5 and 0.165±0.023, n=5, respectively). Although it contains non-radioactive ganciclovir (∼5-30 μg) as a chemical by-product, compound 2 synthesized by method B has a similar uptake in 9L glioma cells as that synthesized by method A, and is a potential tracer for imaging herpes simplex virus thymidine kinase gene expression in tumors using PET. Similarly, compound 4 synthesized by method B contains ∼10-25 μg of penciclovir as a chemical by-product. Thus, the simplified one pot synthesis (method B) is a useful method for synthesizing both compound 2 and compound 4 in good yield for routine clinical use, and the method is
International Nuclear Information System (INIS)
Pal'chikov, V.G.; Ya Faenov, A.; Yu Skobelev, I.
2002-01-01
The wavelengths of the 1snp 1 P 1 0 -1s 2 1 S 0 transitions in the He-like Mg XI (n = 4-9) and F VIII (n=4-8) have been measured in laser-produced plasmas. The accuracy of the present measurements (0.4-1.6 mA) is a large improvement over previous results. The Rydberg series is used to determine the ground-state ionization energy of F VIII and Mg XI: E i on (F VIII) 953.96±0.11 eV, E i on (Mg XI)=1761.88±0.15 eV. These experimental results are compared with theoretical data calculated by the 1/Z-expansion method and the HFR and MCDF approaches. Fairly good agreement between theory and experiment is observed with a precision up to 5x10 -5 . Radiative corrections to the 1s 2 1 S 0 state are analysed and compared with experiments. It is found that QED corrections to the ground-state ionization energy are significant at the present level of experimental accuracy. (author)
22 CFR 40.91 - Certain aliens previously removed.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Certain aliens previously removed. 40.91... IMMIGRANTS UNDER THE IMMIGRATION AND NATIONALITY ACT, AS AMENDED Aliens Previously Removed § 40.91 Certain aliens previously removed. (a) 5-year bar. An alien who has been found inadmissible, whether as a result...
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_PFM+FM1_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Terra-FM1_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
Effect of thermo-mechanical treatments on creep and fatigue properties of 9% Cr martensitic steels
International Nuclear Information System (INIS)
Hollner, S.; Fournier, B.; Le Pendu, J.; Caes, C.; Tournie, I.; Pineau, A.
2011-01-01
In the framework of the development of Generation IV nuclear reactors and fusion nuclear reactors, materials with high mechanical properties up to 550 C are required. In service the materials will be subjected to high-temperature creep and cyclic loadings. 9-12%Cr martensitic steels are candidate materials for these applications; however, they show a pronounced cyclic softening effect under cyclic loadings. This softening effect is linked to the coarsening of the martensitic microstructure. In order to refine its microstructure and its precipitation state, the commercial P91 steel has been submitted to a thermo-mechanical treatment including warm-rolling at 600 C and a tempering stage at 700 C. Microstructural observations confirm that this thermo-mechanical treatment led to a finer martensite with smaller MX-type precipitates. This evolution has an effect on the high-temperature mechanical properties: the optimized P91 steel is 100 Hv harder than the as-received P91, and its yield strength is 430 MPa higher at 20 C and 220 MPa higher at 550 C. Its lifetime under creep (at 650 C under 120 MPa) is at least 14 times longer; and the fatigue test at 650 C under 0.7% strain shows a slightly slower cyclic softening effect for the optimized P91. (authors)
A study of the (p,pn) reaction on 1p shell nuclei at 46 MeV
International Nuclear Information System (INIS)
Miller, C.A.
1974-01-01
The (p,pn) reaction on four 1p shell nuclei, 6 Li, 9 Be, 13 C and 12 C, as well as the 6 Li(p,2p) reaction, have been studied at 46 MeV. The 6 Li(p,pn) cross section was found to be approximately four times that for (p,2p) and to have a very different angular dependence. Both reactions show the s-state admixture in 6 Li observed with (p,2p) at higher energies. For all of the target nuclei, the cross sections have features that cannot be fitted by a renormalized Plane Wave Impulse Approximation (PWIA) calculation. A zero range distorted wave calculation was found to be in only fair agreement with the 9 Be and 13 C data. The overall magnitudes of the results of the calculation were found to be very sensitive to the RMS radii of the bound state wave functions of the knocked-out neutrons. (author)
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Authority. 91.3 Section 91.3 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections... AND GENERAL INFORMATION Administration § 91.3 Authority. The Deputy Administrator is charged with the...
Matrix metalloproteinase-9 predicts pulmonary status declines in α1-antitrypsin deficiency
Directory of Open Access Journals (Sweden)
Rames Alexis
2011-03-01
Full Text Available Abstract Background Matrix metalloproteinase-9 (MMP-9 may be important in the progression of emphysema, but there have been few longitudinal clinical studies of MMP-9 including pulmonary status and COPD exacerbation outcomes. Methods We utilized data from the placebo arm (n = 126 of a clinical trial of patients with alpha1-antitrypsin deficiency (AATD and emphysema to examine the links between plasma MMP-9 levels, pulmonary status, and COPD exacerbations over a one year observation period. Pulmonary function, computed tomography lung density, incremental shuttle walk test (ISWT, and COPD exacerbations were assessed at regular intervals over 12 months. Prospective analyses used generalized estimating equations to incorporate repeated longitudinal measurements of MMP-9 and all endpoints, controlling for age, gender, race-ethnicity, leukocyte count, and tobacco history. A secondary analysis also incorporated highly-sensitive C-reactive protein levels in predictive models. Results At baseline, higher plasma MMP-9 levels were cross-sectionally associated with lower FEV1 (p = 0.03, FVC (p Conclusions Increased plasma MMP-9 levels generally predicted pulmonary status declines, including worsening transfer factor and lung density as well as greater COPD exacerbations in AATD-associated emphysema.
Sato, Masaya; Ikeda, Hitoshi; Uranbileg, Baasanjav; Kurano, Makoto; Saigusa, Daisuke; Aoki, Junken; Maki, Harufumi; Kudo, Hiroki; Hasegawa, Kiyoshi; Kokudo, Norihiro; Yatomi, Yutaka
2016-08-26
The role of sphingosine 1-phosphate (S1P) in liver fibrosis or inflammation was not fully examined in human. Controversy exists which S1P receptors, S1P1 and S1P3 vs S1P2, would be importantly involved in its mechanism. To clarify these matters, 80 patients who received liver resection for hepatocellular carcinoma and 9 patients for metastatic liver tumor were enrolled. S1P metabolism was analyzed in background, non-tumorous liver tissue. mRNA levels of sphingosine kinase 1 (SK1) but not SK2 were increased in livers with fibrosis stages 3-4 compared to those with 0-2 and to normal liver. However, S1P was not increased in advanced fibrotic liver, where mRNA levels of S1P transporter spinster homolog 2 (SPNS2) but not S1P-degrading enzymes were enhanced. Furthermore, mRNA levels of S1P2 but not S1P1 or S1P3 were increased in advanced fibrotic liver. These increased mRNA levels of SK1, SPNS2 and S1P2 in fibrotic liver were correlated with α-smooth muscle actin mRNA levels in liver, and with serum ALT levels. In conclusion, S1P may be actively generated, transported to outside the cells, and bind to its specific receptor in human liver to play a role in fibrosis or inflammation. Altered S1P metabolism in fibrotic liver may be their therapeutic target.
Creep and Creep Crack Growth Behaviors for SMAW Weldments of Gr. 91 Steel
International Nuclear Information System (INIS)
Kim, Woo Gon; Yin, Song Nan; Park, Ji Yeon; Hong, Sung Deok; Kim, Yong Wan; Park, Jae Young
2010-01-01
High Cr ferritic resistance steels with tempered martensite microstructures posses enhanced creep strength at the elevated temperatures. Those steels as represented by a modified 9Cr-1Mo steel (ASME Grade 91, hereafter Gr.91) are regarded as main structural materials of sodium-cooled fast reactors (SFR) and reactor pressure vessel materials of very high temperature reactors (VHTR). The SFR and VHTR systems are designed during long-term duration reaching 60 years at elevated temperatures and often subjected to non-uniform stress and temperature distribution during service. These conditions may generate localized creep damage and propagate the cracks and ultimately may cause a fracture. A significant portion of its life is spent in crack propagation. Therefore, a creep crack growth rate (CCGR) due to creep damage should be assessed for both the base metal (BM) and welded metal (WM). Enough CCGR data for them should be provided for assessing their structural integrities. However, their CCGR data for the Gr. 91 steels is still insufficient. In this study, the CCGR for the BM and the WM of the Gr. 91 steel was comparatively investigated. A series of the CCG tests were conducted under different applied loads for the BM and the WM at 600 .deg. C. The CCGR was characterized in terms of the C parameter, and their CCG behavior were compared, respectively
Experimental study of 99Tcm-HL91 and 99Tcm-MIBI in mice bearing Lewis lung cancer
International Nuclear Information System (INIS)
Han Chunqi; Li Yaming; Ren Yangang; Yi Lijie
2000-01-01
Objective: To evaluate the ability of detecting lung cancer by 99 Tc m -HL91 and 99 Tc m -MIBI in mice bearing Lewis lung cancer. Methods: Four model mice underwent whole body planar imaging at 2 h, 4 h after injection of 99 Tc m -MIBI; four mice underwent whole body planar imaging at 2 h and 4 h after injection of 99 Tc m -HL91, and the mice of the 99 Tc m -HL91 group were then killed, the tumor, blood and organs were removed, weighted and the radioactivity was measured. ROIs were drawn around the tumor, head and chest in whole body planar images, and radioactivity ratios of tumor to head (T/H), chest (T/C) and contralateral limbs (T/L) were calculated. Results: No significant tumor radioactivity in 2 h and 4 h images of 99 Tc m -MIBI mice (T/C: 0.20 +- 0.08 and 0.14 +- 0.07) was found; increased tumor radioactivity was identified in images of 99 Tc m -HL91 mice (T/C: 3.25 +- 1.25 and 2.44 +- 1.07), and there was significant difference (t = 4.8 - 7.5, P 99 Tc m -HL91 in tumor tissue of mice is higher and clearance rate is slower. 99 Tc m -HL91 is a valuable tumor imaging agent for clinical diagnosis for the cancer
Molecular cytogenetic characterization and origin of two de novo duplication 9p cases.
Tsezou, A; Kitsiou, S; Galla, A; Petersen, M B; Karadima, G; Syrrou, M; Sahlèn, S; Blennow, E
2000-03-13
We report on two additional cases with duplication of 9p, minor with facial anomalies and developmental delay. Using fluorescence in situ hybridization and single-copy probes, we showed that the first case was a direct duplication, whereas the second case was inverted. The extent of the direct duplication was defined as 9p12 --> p24 by microdissection and microcloning of the aberrant chromosome and subsequent chromosome-specific comparative genomic hybridization. DNA polymorphism analysis with eight microsatellite markers revealed that the origin of the dup(9p) was maternal in the first case, whereas it was paternal in the second. Copyright 2000 Wiley-Liss, Inc.
Apparent suppression of MMP-9 activity by GD1a as determined by gelatin zymography.
Hu, Dan; Tan, Xuan; Sato, Toshinori; Yamagata, Sadako; Yamagata, Tatsuya
2006-10-13
Gelatin zymography is widely used to detect and evaluate matrix metalloproteinase-9 (MMP-9) activity. MMP-9 transcription was previously shown to be negatively regulated by ganglioside GD1a [D. Hu, Z. Man, T. Xuan, P. Wang, T. Takaku, S. Hyuga, X.S. Yao, T. Sato, S. Yamagata, T. Yamagata, Ganglioside GD1a regulation of matrix metalloproteinase-9 (MMP-9) expression in mouse FBJ cell Lines: GD1a suppression of MMP-9 expression stimulated by PI3K-Akt and p38 though not by the Erk signaling pathway, 2006, submitted for publication.]. Zymography of MMP-9 of FBJ-M5 cells preincubated with GD1a indicated a greater decrease in activity than expected from mRNA suppression. Incubation of conditioned medium containing MMP-9 with GD1a caused MMP-9 activity to decrease. Examination was thus made to confirm that MMP-9 activity is actually suppressed and/or MMP-9 protein undergoes degradation by GD1a. GD1a was found to have no effect on MMP-9 activity and Western blots indicated GD1a not to diminish MMP-9 during electrophoresis under reducing conditions. GD1a appeared to mediate the binding of a portion of MMP-9 with certain molecules, with consequently greater molecular mass on the gel, to cause decrease in the activity of MMP-9 at the site where it would normally appear. Caution should be used in doing gelatin zymography since molecules other than GD1a may similarly work, causing decrease in MMP-9 activity in zymography.
1975-06-16
I 91, 91o4 9i.4 91. 91.6 9j.6 91. S700 tb~o 097K97 89o 90.106 9o’ - 9 -1LT ItC lp -,1 .7 s6 91p 9 91* WO- 96 6000 6.4 9c1 90.4, 90,9 91,2 91.3 9i...88.7 88.7 88.8 68.9 9i86 S700 ~78.5 04I70 53~ v "om 39-; Th 18b17 l 9 9313 6W_- 78.6 64.2 85.3 86.9 88.2 88.4 89?o 89.1 89.1 89.6 89.8 89.8 89.9 9o...800 086 93,6 94.11 947 95.3 95.4 95.6 95,7 95.7 96.2 96.3 96.3 9 6 ,L 96.4 96.4 96.4 S700 - _ 94.2 94o8 9ř. 95 e 99--9 9 - -- 99 6 65 965 >__6W 88.6
Mapping of epitopes on Poa p I and Lol p I allergens with monoclonal antibodies.
Lin, Z W; Ekramoddoullah, A K; Jaggi, K S; Dzuba-Fischer, J; Rector, E; Kisil, F T
1990-01-01
Allergen Poa p I isolated from the dialysed aqueous extract of Kentucky blue grass pollen by affinity chromatography with an anti-Lol p I murine monoclonal antibody (MAb) 290A-167 was previously shown to consist of a 35.8-kilodalton (kD) component with a pI of 6.4, designated as Poa p Ia, and a 33-kD component with a pI of 9.1, designated as Poa p Ib. The present study reports on the comparative antigenic analyses of these two components, using MAbs produced separately against Poa p I and Lol p I. Thus, anti-Poa p I MAbs 60 and 61 and anti-Lol p I MAb 290A-167 recognized Poa p Ia and Poa p Ib whereas anti-Poa p I MAbs 62, 63 and 64 and anti-Lol p I MAb 348A-6 recognized only Poa p Ia. The specificities of the MAbs were further resolved by comparing their respective abilities to inhibit the binding of 125I-Poa p I or 125I-Lol p I to the different MAbs prepared in the form of solid phase. These studies revealed that at least 4 distinct epitopes (designated as E1, E2, E3 and E4) were shared by both Poa p I and Lol p I. All 4 epitopes were present on Poa p Ia whereas only E1 and E3 were detected on Poa p Ib. E1 was recognized by MAbs 60 and 61, E2 by MAbs 62, 63 and 64, E3 by MAb 290A-167 and E4 by MAb 348A-6.(ABSTRACT TRUNCATED AT 250 WORDS)
Directory of Open Access Journals (Sweden)
Khalid Arhzaouy
Full Text Available Heterozygous mutations in the human VCP (p97 gene cause autosomal-dominant IBMPFD (inclusion body myopathy with early onset Paget's disease of bone and frontotemporal dementia, ALS14 (amyotrophic lateral sclerosis with or without frontotemporal dementia and HSP (hereditary spastic paraplegia. Most prevalent is the R155C point mutation. We studied the function of p97 in the social amoeba Dictyostelium discoideum and have generated strains that ectopically express wild-type (p97 or mutant p97 (p97(R155C fused to RFP in AX2 wild-type and autophagy 9 knock-out (ATG9(KO cells. Native gel electrophoresis showed that both p97 and p97(R155C assemble into hexamers. Co-immunoprecipitation studies revealed that endogenous p97 and p97(R155C-RFP form heteromers. The mutant strains displayed changes in cell growth, phototaxis, development, proteasomal activity, ubiquitinylated proteins, and ATG8(LC3 indicating mis-regulation of multiple essential cellular processes. Additionally, immunofluorescence analysis revealed an increase of protein aggregates in ATG9(KO/p97(R155C-RFP and ATG9(KO cells. They were positive for ubiquitin in both strains, however, solely immunoreactive for p97 in the ATG9(KO mutant. A major finding is that the expression of p97(R155C-RFP in the ATG9(KO strain partially or fully rescued the pleiotropic phenotype. We also observed dose-dependent effects of p97 on several cellular processes. Based on findings in the single versus the double mutants we propose a novel mode of p97 interaction with the core autophagy protein ATG9 which is based on mutual inhibition.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 91.1305 Section 91.1305 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF EMISSIONS FROM MARINE SPARK-IGNITION ENGINES In-Use Credit Program for New Marine Engines § 91.1305 Banking...
Directory of Open Access Journals (Sweden)
Kaori Asamitsu
Full Text Available In this study, we applied molecular dynamics (MD simulation to analyze the dynamic behavior of the Tat/CycT1/CDK9 tri-molecular complex and revealed the structural changes of P-TEFb upon Tat binding. We found that Tat could deliberately change the local flexibility of CycT1. Although the structural coordinates of the H1 and H2 helices did not substantially change, H1', H2', and H3' exhibited significant changes en masse. Consequently, the CycT1 residues involved in Tat binding, namely Tat-recognition residues (TRRs, lost their flexibility with the addition of Tat to P-TEFb. In addition, we clarified the structural variation of CDK9 in complex with CycT1 in the presence or absence of Tat. Interestingly, Tat addition significantly reduced the structural variability of the T-loop, thus consolidating the structural integrity of P-TEFb. Finally, we deciphered the formation of the hidden catalytic cavity of CDK9 upon Tat binding. MD simulation revealed that the PITALRE signature sequence of CDK9 flips the inactive kinase cavity of CDK9 into the active form by connecting with Thr186, which is crucial for its activity, thus presumably recruiting the substrate peptide such as the C-terminal domain of RNA pol II. These findings provide vital information for the development of effective novel anti-HIV drugs with CDK9 catalytic activity as the target.
Corrosion studies of thermally sensitised AGR fuel element brace in pH7 and pH9.2 borate solutions
International Nuclear Information System (INIS)
Tyfield, S.P.; Smith, C.A.
1987-04-01
Brace and cladding of AGR fuel elements sensitised in reactor are susceptible to intergranular and crevice corrosion, which may initiate in the pH7 borate pond storage environment of CEGB/SSEB stations. This report considers the benefit in corrosion control that is provided by raising the pond solution pH to 9.2, whilst maintaining the boron level at 1250 gm -3 . The greater corrosion protection provided by pH9.2 solution compared to the pH7 borate solution is demonstrated by a series of tests with non-active laboratory sensitised brace samples exposed to solutions dosed with chloride or sulphate in order to promote localised corrosion. The corrosion tests undertaken consisted of 5000 hour immersions at 32 0 C and shorter term electrochemically monitored experiments (rest potential, impedance, anodic current) generally conducted at 22 0 C. The pH9.2 solution effectively inhibited the initiation of crevice and intergranular corrosion in the presence of low levels of chloride and sulphate, whereas the pH7 solution did not always do so. However, the pH9.2 solution, dosed with 40 gm -3 chloride, failed to suppress fully crevice corrosion initiated in unborated 40 gm -3 chloride solution at 22 0 C. Fluoride is not deleterious at low levels ∼ 10 gm -3 in the borate solutions. The significant improvement in corrosion control demonstrated for the change from pH7 to pH9.2 borate solution on laboratory sensitised brace samples should ideally be confirmed using complete irradiated AGR fuel elements. (U.K.)
Mechanical behaviour of SFR materials: proposition of fatigue weld joint coefficient for MOD9CR-1MO
International Nuclear Information System (INIS)
Ancelet, O.; Matheron, Ph.
2012-01-01
Mod 9Cr-1Mo steel (T91) is a candidate material for steam generator of SFR (Sodium Fast Reactors). In order to validate this choice, it is necessary, firstly to verify that it is able to withstand the planned environmental and operating conditions, and secondly to check if it is covered by the existing design codes, concerning its procurement, fabrication, welding, examination methods and mechanical design rules. A large R and D program on mod9Cr-1Mo steel has been undertaken at CEA in order to characterize the behavior of this material and of its welded junctions. In this program, the role of the Laboratory for structural Integrity and Standards (LISN) is to develop high temperature defect assessment procedures under fatigue and creep loadings. In this frame, complementary studies are conducted in order to validate the existing methods (developed for the fast reactors) and to get new experimental data on Mod9Cr-1Mo steel. In particular, some new experiments are conducted on specimen with a weld joint and compared with classical experiments on base metal specimen. These results associated with finite element modeling allow to propose a weld joint coefficient at 550 degrees C for the Mod9Cr1Mo steel. (authors)
29 CFR 1917.91 - Eye and face protection.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Eye and face protection. 1917.91 Section 1917.91 Labor... with any of the following consensus standards: (A) ANSI Z87.1-2003, “American National Standard... accordance with one of the above consensus standards will be deemed to be in compliance with the requirements...
2010-07-01
... included. The method for calculating effective dose equivalent and the definition of reference man are... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Definitions. 61.91 Section 61.91... Other Than Radon From Department of Energy Facilities § 61.91 Definitions. As used in this subpart, all...
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 91.205 Section 91.205... EMISSIONS FROM MARINE SPARK-IGNITION ENGINES Averaging, Banking, and Trading Provisions § 91.205 Banking. (a... banking. (i) For outboard engines in model year (MY) 1997, a manufacturer may bank positive emission...
Cochran, A. L.; Barker, E. S.; Caballero, M. D.; Györgey-Ries, J.
2009-01-01
We report on low-spectral resolution observations of Comet 9P/Tempel 1 from 1983, 1989, 1994 and 2005 using the 2.7 m Harlan J. Smith telescope of McDonald Observatory. This comet was the target of NASA's Deep Impact mission and our observations allowed us to characterize the comet prior to the impact. We found that the comet showed a decrease in gas production from 1983 to 2005, with the decrease being different factors for different species. OH decreased by a factor 2.7, NH by 1.7, CN by 1.6, C 3 by 1.8, CH by 1.4 and C 2 by 1.3. Despite the decrease in overall gas production and these slightly different decrease factors, we find that the gas production rates of OH, NH, C 3, CH and C 2 ratioed to that of CN were constant over all of the apparitions. We saw no change in the production rate ratios after the impact. We found that the peak gas production occurred about two months prior to perihelion. Comet Tempel 1 is a "normal" comet.
19 CFR 11.9 - Special marking on certain articles.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Special marking on certain articles. 11.9 Section... OF THE TREASURY PACKING AND STAMPING; MARKING Marking § 11.9 Special marking on certain articles. (a... of additional U.S. Note 4, Chapter 91. If any article so required to be marked is found not to be...
DEFF Research Database (Denmark)
Ringholm, Lene; Juul, Anders; Pedersen-Bjergaard, Ulrik
2015-01-01
and median HbA1c 6.6% (range 4.9-10.5) (49 mmol/mol (30-91)) in early pregnancy. At 8, 14, 21, 27 and 33 weeks weight was recorded and blood was sampled for measurements of placental GH, IGF-I and HbA1c. LGA was defined as birth weight >90th percentile after adjustment for gender and gestational age. RESULTS......,multivariate logistic regression analysis identified placental GH levels at 8 weeks (OR 0.4 (95% CI: 0.2-0.9), p = 0.02), HbA1c at 33 weeks (3.6 (1.3-9.9), p = 0.01) and parity ≥1 (3.1 (1.3-7.5), p = 0.01) after adjustment for pre-pregnancy BMI. CONCLUSIONS: Women delivering LGA infants had lower placental GH levels...
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Trading. 91.206 Section 91.206... EMISSIONS FROM MARINE SPARK-IGNITION ENGINES Averaging, Banking, and Trading Provisions § 91.206 Trading. (a... manufacturers in trading. These credits must be used in the same averaging set as generated. (b) Credits for...
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Trading. 91.1306 Section 91.1306... EMISSIONS FROM MARINE SPARK-IGNITION ENGINES In-Use Credit Program for New Marine Engines § 91.1306 Trading... engine manufacturers through trading. (b) In-use credits for trading can be obtained from credits banked...
31 CFR 91.11 - Dogs and other animals.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Dogs and other animals. 91.11 Section... CONDUCT IN OR ON THE BUREAU OF THE MINT BUILDINGS AND GROUNDS § 91.11 Dogs and other animals. Dogs and other animals, except seeing-eye dogs, shall not be brought upon the property for other than official...
31 CFR 91.14 - Penalties and other law.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Penalties and other law. 91.14... CONDUCT IN OR ON THE BUREAU OF THE MINT BUILDINGS AND GROUNDS § 91.14 Penalties and other law. Whoever...). Nothing contained in the regulations in this part shall be construed to abrogate any other Federal laws or...
CRISPR/Cas9-loxP-Mediated Gene Editing as a Novel Site-Specific Genetic Manipulation Tool.
Yang, Fayu; Liu, Changbao; Chen, Ding; Tu, Mengjun; Xie, Haihua; Sun, Huihui; Ge, Xianglian; Tang, Lianchao; Li, Jin; Zheng, Jiayong; Song, Zongming; Qu, Jia; Gu, Feng
2017-06-16
Cre-loxP, as one of the site-specific genetic manipulation tools, offers a method to study the spatial and temporal regulation of gene expression/inactivation in order to decipher gene function. CRISPR/Cas9-mediated targeted genome engineering technologies are sparking a new revolution in biological research. Whether the traditional site-specific genetic manipulation tool and CRISPR/Cas9 could be combined to create a novel genetic tool for highly specific gene editing is not clear. Here, we successfully generated a CRISPR/Cas9-loxP system to perform gene editing in human cells, providing the proof of principle that these two technologies can be used together for the first time. We also showed that distinct non-homologous end-joining (NHEJ) patterns from CRISPR/Cas9-mediated gene editing of the targeting sequence locates at the level of plasmids (episomal) and chromosomes. Specially, the CRISPR/Cas9-mediated NHEJ pattern in the nuclear genome favors deletions (64%-68% at the human AAVS1 locus versus 4%-28% plasmid DNA). CRISPR/Cas9-loxP, a novel site-specific genetic manipulation tool, offers a platform for the dissection of gene function and molecular insights into DNA-repair pathways. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Lee, Seung J.; Kim, Chae E.; Yun, Mi R.; Seo, Kyo W.; Park, Hye M.; Yun, Jung W.; Shin, Hwa K.; Bae, Sun S.; Kim, Chi D.
2010-01-01
Exaggerated levels of 4-hydroxynonenal (HNE) and 5-lipoxygenase (5-LO) co-exist in macrophages in atherosclerotic lesions, and activated macrophages produce MMP-9 that degrades atherosclerotic plaque constituents. This study investigated the effects of HNE on MMP-9 production, and the potential role for 5-LO derivatives in MMP-9 production in murine macrophages. Stimulation of J774A.1 cells with HNE led to activation of 5-LO, as measured by leukotriene B 4 (LTB 4 ) production. This was associated with an increased production of MMP-9, which was blunted by inhibition of 5-LO with MK886, a 5-LO inhibitor or with 5-LO siRNA. A cysteinyl-LT 1 (cysLT 1 ) receptor antagonist, REV-5901 as well as a BLT 1 receptor antagonist, U-75302, also attenuated MMP-9 production induced by HNE. Furthermore, LTB 4 and cysLT (LTC 4 and LTD 4 ) enhanced MMP-9 production in macrophages, suggesting a pivotal role for 5-LO in HNE-mediated production of MMP-9. Among the MAPK pathways, LTB 4 and cysLT enhanced phosphorylation of ERK and p38 MAPK, but not JNK. Linked to these results, a p38 MAPK inhibitor as well as an ERK inhibitor blunted MMP-9 production induced by LT. Collectively, these data suggest that 5-LO-derived LT mediates HNE-induced MMP-9 production via activation of ERK and p38 MAPK pathways, consequently leading to plaque instability in atherosclerosis.
1991-01-01
RESERVE SERVICE. GELTECH, INC. Topic#: 91-242 W. 91SDC-017 TWO INNOVATION DRIVE Office: SDC ALACHUA, FL 32615 Contract #: Phone: (904) 462-2358 P1: VINAY K...REFERENCE PHYSICAL OPTICS CORP. PRADEEP K. GUPTA , INC. ARMY 91-071 AF 91-128 ARMY 91-144 ARMY 91-169 PRECISION COMBUSTION, INC. NAVY 91-102 ARMY 91-011 NAVY
Directory of Open Access Journals (Sweden)
Melha Mellata
Full Text Available Extra-intestinal pathogenic E. coli (ExPEC, including Avian Pathogenic E. coli (APEC, are very diverse. They cause a complex of diseases in Human, animals, and birds. Even though large plasmids are often associated with the virulence of ExPEC, their characterization is still in its infancy.We fully sequenced and analyzed the large plasmid pAPEC-1 (103,275-bp associated with the APEC strain chi7122, from worldwide serogroup O78ratioK80ratioH9. A putative virulence region spanning an 80-kb region of pAPEC-1 possesses four iron acquisition systems (iutA iucABCD, sitABCD, iroBCDN, and temperature-sensitive hemagglutinin tsh, a colicin V operon, increasing serum sensitivity iss, ompT, hlyF, and etsABC. Thirty three ORFs in pAPEC-1 are identified as insertion sequences (ISs that belong to nine families with diverse origins. The full length of the transfer region in pAPEC-1 (11 kb is shorter compared to the tra region of other sequenced F plasmids; the absence of some tra genes in pAPEC-1 affects its self-transferability, and the conjugative function of the plasmid was effective only in the presence of other plasmids. Two-replicon systems, repFIIA-repFIC and repFIB, and two post-segregational systems, srnB and hok/sok, are also present in the sequence of pAPEC-1. The comparison of the pAPEC-1 sequence with the two available plasmid sequences reveals more gene loss and reorganization than previously appreciated. The presence of pAPEC-1-associated genes is assessed in human ExPEC by PCR. Many patterns of association between genes are found.The pathotype typical of pAPEC-1 was present in some human strains, which indicates a horizontal transfer between strains and the zoonotic risk of APEC strains. ColV plasmids could have common virulence genes that could be acquired by transposition, without sharing genes of plasmid function.
Abe, Fujio; Tabuchi, M.; Tsukamoto, S.
Boundary hardening is shown to be the most important strengthening mechanism in creep of tempered martensitic 9% Cr steel base metal and welded joints at 650 °C. The enrichment of soluble boron near prior austenite grain boundaries (PAGBs) by the GB segregation is essential for the reduction of coarsening rate of M23C6 carbides near PAGBs, enhancing the boundary and sub-boundary hardening near PAGBs, and also for the change in α/γ transformation behavior in heat-affected-zone (HAZ) of welded joints during heating of welding, producing the same microstructure in HAZ as in the base metal. Excess addition of nitrogen to the 9Cr-boron steel promotes the formation of boron nitrides during normalizing heat treatment, which consumes most of soluble boron and degrades the creep strength. A NIMS 9Cr steel (MARBN; Martensitic 9Cr steel strengthened by boron and MX nitrides) with 120-150 ppm boron and 60-90 ppm nitrogen, where no boron nitride forms during normalizing heat treatment, exhibits not only much higher creep strength of base metal than Grades 91, 92 and 122 but also substantially no degradation in creep strength due to Type IV fracture in HAZ of welded joints at 650°C. The protective Cr2O3-rich scale forms on the surface of 9Cr steel by pre-oxidation treatment in Ar gas, which significantly improves the oxidation resistance in steam at 650°C.
Optical properties of lattice matched InxGa1-xP1-yNy heteroepitaxial layers on GaP
International Nuclear Information System (INIS)
Imanishi, T.; Wakahara, A.; Kim, S.M.; Yonezu, H.; Furukawa, Y.
2005-01-01
Optical constants and band structure of In x Ga 1-x P 1-y N y lattice matched to GaP (100) substrate are investigated. Nitrogen concentration in the film estimated by X-ray diffraction and X-ray photoelectron spectroscopy, was 1.4%, 1.8% and 3.5%. Refractive index and transition critical points E 0 (Γ v to Γ c ), E 1 (L v to L c ) and E 2 (X v to X c ) are evaluated by spectroscopic ellipsometry. When N composition increases from 1.4% to 3.5%, both photoluminescence (PL) peak energy, E PL , and E 0 shift to lower energy, and the energy difference ΔE=E 0 -E PL decrease from 380 meV to 110 meV. The large red-sift of E PL from the E 0 suggest that the luminescence is of defect-related luminescence, and crossover point of indirect band structure estimated by the extrapolation of N-composition dependence of ΔE is estimated to be around in In 0.1 Ga 0.9 P 0.96 N 0.04 . (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
10 CFR 51.91 - Final environmental impact statement-contents.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Final environmental impact statement-contents. 51.91... Implementing Section 102(2) Final Environmental Impact Statements-General Requirements § 51.91 Final environmental impact statement—contents. (a)(1) The final environmental impact statement will include responses...
An unusual methylene aziridine refined in P2(1)/c and the nonstandard setting P2(1)/n.
Feast, George C; Haestier, James; Page, Lee W; Robertson, Jeremy; Thompson, Amber L; Watkin, David J
2009-12-01
The unusual methylene aziridine 6-tert-butyl-3-oxa-2-thia-1-azabicyclo[5.1.0]oct-6-ene 2,2-dioxide, C(9)H(15)NO(3)S, was found to crystallize with two molecules in the asymmetric unit. The structure was solved in both the approximately orthogonal and the oblique settings of space group No. 14, viz. P2(1)/n and P2(1)/c, respectively. A comparison of these results clearly displayed an increase in the correlation between coordinates in the ac plane for the oblique cell. The increase in the corresponding covariances makes a significant contribution to the standard uncertainties of derived parameters, e.g. bond lengths. Since there is yet no CIF definition for the full variance-covariance matrix, there are clear advantages to reporting the structure in the nonstandard space-group setting.
Directory of Open Access Journals (Sweden)
Miao Teng
Full Text Available BACKGROUND: Our previous research found that structural changes of the microtubule network influence glycolysis in cardiomyocytes by regulating the hypoxia-inducible factor (HIF-1α during the early stages of hypoxia. However, little is known about the underlying regulatory mechanism of the changes of HIF-1α caused by microtubule network alternation. The von Hippel-Lindau tumor suppressor protein (pVHL, as a ubiquitin ligase, is best understood as a negative regulator of HIF-1α. METHODOLOGY/PRINCIPAL FINDINGS: In primary rat cardiomyocytes and H9c2 cardiac cells, microtubule-stabilization was achieved by pretreating with paclitaxel or transfection of microtubule-associated protein 4 (MAP4 overexpression plasmids and microtubule-depolymerization was achieved by pretreating with colchicine or transfection of MAP4 siRNA before hypoxia treatment. Recombinant adenovirus vectors for overexpressing pVHL or silencing of pVHL expression were constructed and transfected in primary rat cardiomyocytes and H9c2 cells. With different microtubule-stabilizing and -depolymerizing treaments, we demonstrated that the protein levels of HIF-1α were down-regulated through overexpression of pVHL and were up-regulated through knockdown of pVHL in hypoxic cardiomyocytes. Importantly, microtubular structure breakdown activated p38/MAPK pathway, accompanied with the upregulation of pVHL. In coincidence, we found that SB203580, a p38/MAPK inhibitor decreased pVHL while MKK6 (Glu overexpression increased pVHL in the microtubule network altered-hypoxic cardiomyocytes and H9c2 cells. CONCLUSIONS/SIGNIFICANCE: This study suggests that pVHL plays an important role in the regulation of HIF-1α caused by the changes of microtubular structure and the p38/MAPK pathway participates in the process of pVHL change following microtubule network alteration in hypoxic cardiomyocytes.
Energy Technology Data Exchange (ETDEWEB)
Fujii, Yasuyuki, E-mail: y.fujii@po.rd.taisho.co.jp [Department of Molecular Function and Pharmacology Laboratories, Taisho Pharmaceutical Co. Ltd., 1-403 Saitama, Saitama 331-9530 (Japan); Ueda, Yasuji; Ohtake, Hidenori; Ono, Naoya; Takayama, Tetsuo; Nakazawa, Kiyoshi [Department of Molecular Function and Pharmacology Laboratories, Taisho Pharmaceutical Co. Ltd., 1-403 Saitama, Saitama 331-9530 (Japan); Igarashi, Yasuyuki [Laboratory of Biomembrane and Biofunctional Chemistry, Hokkaido University, Sapporo, Hokkaido 060-0812 (Japan); Goitsuka, Ryo [Division of Development and Aging, Research Institute for Biological Sciences, Tokyo University of Science, Noda, Chiba 278-0022 (Japan)
2012-03-23
Highlights: Black-Right-Pointing-Pointer The effect of a newly developed S1P{sub 1}-selective antagonist on angiogenic responses. Black-Right-Pointing-Pointer S1P{sub 1} is a critical component of VEGF-related angiogenic responses. Black-Right-Pointing-Pointer S1P{sub 1}-selective antagonist showed in vitro activity to inhibit angiogenesis. Black-Right-Pointing-Pointer S1P{sub 1}-selective antagonist showed in vivo activity to inhibit angiogenesis. Black-Right-Pointing-Pointer The efficacy of S1P{sub 1}-selective antagonist for anti-cancer therapies. -- Abstract: Sphingosine 1-phosphate receptor type 1 (S1P{sub 1}) was shown to be essential for vascular maturation during embryonic development and it has been demonstrated that substantial crosstalk exists between S1P{sub 1} and other pro-angiogenic growth factors, such as vascular endothelial growth factor (VEGF) and basic fibroblast growth factor. We developed a novel S1P{sub 1}-selective antagonist, TASP0277308, which is structurally unrelated to S1P as well as previously described S1P{sub 1} antagonists. TASP0277308 inhibited S1P- as well as VEGF-induced cellular responses, including migration and proliferation of human umbilical vein endothelial cells. Furthermore, TASP0277308 effectively blocked a VEGF-induced tube formation in vitro and significantly suppressed tumor cell-induced angiogenesis in vivo. These findings revealed that S1P{sub 1} is a critical component of VEGF-related angiogenic responses and also provide evidence for the efficacy of TASP0277308 for anti-cancer therapies.
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF ( CER_ES9_Terra-FM1_Edition1-CV)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2006-09-30] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
Zimnik, Susan; Gaestel, Matthias; Niedenthal, Rainer
2009-03-01
Post-translational modifications control the physiological activity of the signal transducer and activator of transcription STAT1. While phosphorylation at tyrosine Y701 is a prerequisite for STAT1 dimerization, its SUMOylation represses the transcriptional activity. Recently, we have demonstrated that SUMOylation at lysine K703 inhibits the phosphorylation of nearby localized Y701 of STAT1. Here, we analysed the influence of phosphorylation of Y701 on SUMOylation of K703 in vivo. For that reason, an Ubc9/substrate dimerization-dependent SUMOylation (USDDS) system was developed, which consists of fusions of the SUMOylation substrate and of the SUMO-conjugating enzyme Ubc9 to the chemically activatable heterodimerization domains FKBP and FRB, respectively. When FKBP fusion proteins of STAT1, p53, CRSP9, FOS, CSNK2B, HES1, TCF21 and MYF6 are coexpressed with Ubc9-FRB, treatment of HEK293 cells with the rapamycin-related dimerizer compound AP21967 induces SUMOylation of these proteins in vivo. For STAT1-FKBP and p53-FKBP we show that this SUMOylation takes place at their specific SUMOylation sites in vivo. Using USDDS, we then demonstrate that STAT1 phosphorylation at Y701 induced by interferon-beta treatment inhibits SUMOylation of K703 in vivo. Thus, pY701 and SUMO-K703 of STAT1 represent mutually exclusive modifications, which prevent signal integration at this molecule and probably ensure the existence of differentially modified subpopulations of STAT1 necessary for its regulated nuclear cytoplasmic activation/inactivation cycle.
Sashina, T A; Morozova, O V; Epifanova, N V; Novikova, N A
2017-08-01
Genotype G9P[8] rotaviruses are rare in the territory of Russia. They were found in Nizhny Novgorod only in 2011-2012 for the first time, when their proportion was 25.9%. During the next two seasons, G9P[8] strains were detected in only 1.8% of cases. Their proportion substantially increased again in 2014, and they became predominant in the city by 2016. Phylogenetic analysis on the basis of gene VP7 nucleotide sequences showed that this increase was accompanied by the emergence of new strains in the population. These isolates were related to Turkish strains, but not to Russian ones detected earlier.
Alekseeva, O. S.; Devdariani, A. Z.; Grigorian, G. M.; Lednev, M. G.; Zagrebin, A. L.
2017-02-01
This study is devoted to the theoretical investigation of the quasimolecular emission of Xe*-He and Kr*-He collision pairs near the Xe (5p 56s 1,3 P 1 - 5p 6 1 S 0) and Kr (4p 55s 1,3 P 1 - 4p 6 1 S 0) resonance atomic lines. The potential curves of the quasimolecules Xe(5p 56s) + He and Kr(4p 55s) + He have been obtained with the use of the effective Hamiltonian and pseudopotential methods. Based on these potential curves the processes of quasimolecular emission of Xe*+He and Kr*+He mixtures have been considered and the spectral distributions I(ħΔω) of photons emitted have been obtained in the framework of quasistatic approximation.
Synthesis of 9H-Indeno [1, 2-b] Pyrazine and 11H-Indeno [1, 2-b ...
African Journals Online (AJOL)
NICO
Synthesis of 9H-Indeno [1, 2-b] Pyrazine and. 11H-Indeno [1, 2-b] Quinoxaline Derivatives in. One-step Reaction from 2-Bromo-4-chloro-1-indanone. S. Jasouri1,2, J. Khalafy1,*, M. Badali2 and R.H. Prager3. 1Department of Chemistry, Urmia University, Urmia 57154, Iran. 2Daana Pharmaceutical Co., P.O. Box 5181, Tabriz ...
DEFF Research Database (Denmark)
Ossum, Alvilde; van Deurs, Ulla; Engstrøm, Thomas
2009-01-01
GLP-1 and its metabolite GLP-1(9-36)a have been shown to exert cardiotropic effects, and were demonstrated to be cardioprotective agents in isolated, postischemic rat or mouse hearts. An agent's total effect on myocardial performance in a postconditioning paradigm is a sum of its myocyte-preservi......GLP-1 and its metabolite GLP-1(9-36)a have been shown to exert cardiotropic effects, and were demonstrated to be cardioprotective agents in isolated, postischemic rat or mouse hearts. An agent's total effect on myocardial performance in a postconditioning paradigm is a sum of its myocyte...... protocol, as exemplified by use of GLP-1 and GLP-1(9-36)a following a global ischemia in isolated rat hearts. Peptides were administered during the first 15min of 120min reperfusion. GLP-1 0.3nM reduced infarct size from 23.2+/-2.4% to 14.1+/-2.3% of area-at-risk (n=15, P=0.0223), an effect abolished......, rather than any true inotropic effect. In contrast, GLP-1(9-36)a did not reduce infarct size significantly, but acted as a strong negative inotrope in postischemic hearts, causing a contractility deficit (LVDP 58.8%, P=0.0004; RPP 58.2%, P=0.0007; dP/dt(max)=58.2%, P=0.0012), quantifiable by an analysis...
SPAG9 is involved in hepatocarcinoma cell migration and invasion via modulation of ELK1 expression
Directory of Open Access Journals (Sweden)
Yan QY
2016-03-01
Full Text Available Qiuyue Yan,1,2 Guohua Lou,3 Ying Qian,1 Bo Qin,1 Xiuping Xu,1,2 Yanan Wang,1,2 Yanning Liu,3 Xuejun Dong1 1Shaoxing People’s Hospital, Shaoxing Hospital Zhejiang University, Shaoxing, Zhejiang, 2The Key Laboratory of Laboratory Medicine, Ministry of Education of China, School of Laboratory Medicine and Life Science, Wenzhou Medical University, Wenzhou, 3State Key Laboratory for Diagnosis and Treatment of Infectious Diseases, Collaborative Innovation Center for Diagnosis and Treatment of Infectious Diseases, The First Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang, People’s Republic of China Background: Sperm-associated antigen 9 (SPAG9 is upregulated in several malignancies and its overexpression is positively correlated with cancer cell malignancies. However, the specific biological roles of SPAG9 in hepatocellular carcinoma (HCC are less understood. Methods: We analyzed SPAG9 and ETS-like gene 1, tyrosine kinase (ELK1 expression in 50 paired HCC specimens and adjacent noncancerous liver specimens using immunohistochemistry. SPAG9 small interfering RNA (siRNA was used to knockdown SPAG9 expression in HCCLM3 and HuH7 cell lines. We used plasmids to upregulate ELK1 expression and siRNA to downregulate ELK1 expression in HuH7 cells. Quantitative real-time polymerase chain reaction and Western blot were used to evaluate the expression of SPAG9 and ELK1 at the mRNA and protein level, respectively. Wound healing, matrigel migration, and invasion analyses were performed to determine the effect of SPAG9 and ELK1 on HCC metastasis. Results: SPAG9 and ELK1 were overexpressed in HCC tissue specimens and their expressions were higher in HCCLM3 and HuH7 cells compared to the low-metastatic HepG2 cells. Overexpression of SPAG9 was positively associated with tumor-node-metastasis staging (P=0.032, metastasis parameters (P=0.018 of HCC patients, and ELK1 expression (r=0.422, P<0.001 in HCC tissue specimens. In addition
Attenuated Expression of DFFB is a Hallmark of Oligodendrogliomas with 1p-Allelic Loss
Directory of Open Access Journals (Sweden)
Fuller Gregory N
2005-09-01
Full Text Available Abstract Allelic loss of chromosome 1p is frequently observed in oligodendroglioma. We screened 177 oligodendroglial tumors for 1p deletions and found 6 tumors with localized 1p36 deletions. Several apoptosis regulation genes have been mapped to this region, including Tumor Protein 73 (p73, DNA Fragmentation Factor subunits alpha (DFFA and beta (DFFB, and Tumor Necrosis Factor Receptor Superfamily Members 9 and 25 (TNFRSF9, TNFRSF25. We compared expression levels of these 5 genes in pairs of 1p-loss and 1p-intact tumors using quantitative reverse-transcriptase PCR (QRTPCR to test if 1p deletions had an effect on expression. Only the DFFB gene demonstrated decreased expression in all tumor pairs tested. Mutational analysis did not reveal DFFB mutations in 12 tested samples. However, it is possible that DFFB haploinsufficiency from 1p allelic loss is a contributing factor in oligodendroglioma development.
Directory of Open Access Journals (Sweden)
Pardo, L.
2002-02-01
Full Text Available Ceramics of composition (SrBi2Nb2O91-x(Bi3TiNbO9x with x = 0.35, 0.65 and 1.00 and Aurivillius type structure have been prepared by natural sintering and hot pressing. Amorphous precursors were obtained by mechanochemical activation of stoichiometric mixtures of oxides and carbonates, which allows using moderate processing temperatures. These materials are interesting for their use as high temperature piezoelectrics. Dielectric characterisation allows to know the temperature at what takes place the ferro-paraelectric transition, which limits the working temperature of the material. It also gives information on how the electric properties, especially the d. c. conductivity, affect the polarizability of the ceramics. The properties relation with the microstructure and the texture is studied. In this work, dielectric studies of these materials have been made, in the frequency interval from 100 Hz to 5 MHz and in the temperature range from 200 ºC up to the ferroparaelectric transition temperatures (>900 ºC for Bi3TiNbO9.Se han preparado cerámicas de la solución sólida (SrBi2Nb2O91-x(Bi3TiNbO9x con x = 0.35, 0.65 y 1.00 y estructura tipo Aurivillius obtenidas por sinterización natural y por prensado en caliente. Se parte de precursores amorfos obtenidos por activación mecanoquímica de una mezcla estequiométrica de óxidos y carbonatos, lo que permite utilizar temperaturas moderadas de procesado. Estos materiales son interesantes por su posible uso como piezoeléctricos de alta temperatura. La caracterización dieléctrica permite establecer a qué temperatura se encuentra la transición ferro-paraeléctrica que limita la temperatura de uso del material y como afectan las propiedades eléctricas, especialmente la conductividad d. c., a la polarizabilidad de las cerámicas, así como su relación con su microestructura y textura. En este trabajo se ha realizado el estudio dieléctrico de estos materiales en el intervalo de frecuencias de 100
25 CFR 91.13 - Health, sanitation, and sewerage disposal.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Health, sanitation, and sewerage disposal. 91.13 Section... INDIAN VILLAGES, OSAGE RESERVATION, OKLAHOMA § 91.13 Health, sanitation, and sewerage disposal. Health, sanitation, and sewerage disposal problems within the village reserves shall be subject to and controlled by...
Tang, Qi; Li, Guohui; Yao, Qin; Chen, Liang; Lv, Peng; Lian, Chaoqun; Chen, Keping
2013-05-01
Orf91 (Bm91) of Bombyx mori nucleopolyhedrovirus (BmNPV) is a highly conserved gene that encodes a predicted 105-amino-acid protein, but its function remains unknown. In the current study, 5'-RACE revealed that the transcription initiation site of Bm91 was - 12 nucleotides upstream of the start codon ATG, transcription of Bm91 was detected from 12 to 96 h postinfection (p.i.) and Bm91 protein was detected from 24 to 96 h p.i. in BmNPV-infected BmN cells. Furthermore, Western blot analysis revealed that Bm91 was in occlusion-derived virus (ODV) but not in budded virus (BV). To investigate the role of Bm91 in baculovirus life cycle, a Bm91-knockout virus was constructed by bacmid recombination in E. coli. Fluorescence and light microscopy showed that the production of BV and occlusion bodies (OBs) in Bm91-deficient-virus-infected BmN cells were similar to those in wild-type-virus-infected ones. Bioassay results showed that genetic deletion of Bm91 did not significantly affect BmNPV infectivity, but extended the median lethal time (LT50). Taken together, these results indicate that Bm91 is not essential for viral propagation in vitro, but absence of the gene may affect the virulence of ODVs in silkworm larvae. Copyright © 2013 Elsevier Inc. All rights reserved.
24 CFR 91.225 - Certifications.
2010-04-01
... provided family violence prevention or treatment services under any project assisted under the ESG program, including protection against the release of the address or location of any family violence shelter project... be included in the annual submission to HUD. (See definition of “certification” in § 91.5.) (1...
Comparison of Electrochemical Methods for the Evaluation of Cast AZ91 Magnesium Alloy
Czech Academy of Sciences Publication Activity Database
Tkacz, J.; Minda, J.; Fintová, Stanislava; Wasserbauer, J.
2016-01-01
Roč. 9, č. 11 (2016), č. článku 925. ISSN 1996-1944 Institutional support: RVO:68081723 Keywords : AZ91 magnesium alloy * cathodic polarization curve * anodic polarization curve * linear polarization curve Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.654, year: 2016 http://www.mdpi.com/1996-1944/9/11/925
(p,3He) reactions on 1p shell nuclei at 41 and 45 MeV
International Nuclear Information System (INIS)
Rapp, V.
1982-01-01
In the present thesis the (p, 3 He) reactions on target nuclei of the 1p shell were studied. The measurements were performed at the isochronous cyclotron of the KFA Juelich. Angular distribution at 41 and 45 MeV to residual nuclear states in 7 Li, 8 Be, 9 Be, 10 B, 11 B, 12 C, 13 C, and 14 N. were evaluated. (orig.) [de
Isospin effect in the (e, e'p) reaction on Zr-isotopes and others
International Nuclear Information System (INIS)
Allen, K.J.F.; Davison, A.; Thompson, M.N.
1974-01-01
A considerable amount of work concerning 90 Zr and 91 Zr has been carried out by both the Melbourne and Tohoku groups. This interest largely originated from the observance of marked structure about the giant resonance region in early (p, γ 0 ) experiments on 90 Zr. A result of these studies so far is the proposal of a weak coupling core excitation model to explain the change in character of the isotopes 90 and 91. This has been successful with one major exception -- the lack of strength about Ep=7.9 MeV in 91 Zr. In order to further test this model and possibly arrive at some explanation for the above mentioned anomaly, the obvious progression to the isotopes 92 and 94 constitutes the basic theme of the present series of experiments. For protons from 92 Zr, to determine the nature of the proton groups seen in spectra obtained with Esub(e)=30 MeV, a series of runs with Esub(e) ranging from 22.5 to 15.0 MeV were taken with the end points differing by 0.5 MeV. It should be possible to obtain the estimates of P 0 , P 1 , and possibly P 2 cross-sections from these data. As to protons from 94 Zr, although it was not possible to make the investigation as detailed as that for 92 Zr, it will be possible to establish the nature of some of the decay scheme. (Tai, I.)
25 CFR 91.12 - Business enterprises and public buildings.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Business enterprises and public buildings. 91.12 Section... INDIAN VILLAGES, OSAGE RESERVATION, OKLAHOMA § 91.12 Business enterprises and public buildings. No... buildings shall be erected on lands within the boundaries of a village reserve except on tracts described in...
Rosenquist, Aske Hess; Høyer, Birgit Bjerre; Julvez, Jordi; Sunyer, Jordi; Pedersen, Henning Sloth; Lenters, Virissa; Jönsson, Bo A G; Bonde, Jens Peter; Toft, Gunnar
2017-10-03
Studies have reported some evidence of adverse effects of organochlorine exposures on child development, but the results have been inconsistent, and few studies have evaluated associations with child behavior. We investigated the association between prenatal and early-life exposures to 2,2',4,4',5,5'-hexachlorobiphenyl (PCB-153) and 1,1-dichloro-2,2-bis( p -chlorophenyl)-ethylene ( p,p '-DDE) and behaviors in children between 5 and 9 y of age. In the Biopersistent organochlorines in diet and human fertility: Epidemiologic studies of time to pregnancy and semen quality in Inuit and European populations (INUENDO) cohort, consisting of mother-child pairs from Greenland and Ukraine ( n =1,018), maternal serum PCB-153 and p,p '-DDE concentrations were measured during pregnancy, and cumulative postnatal exposures during the first 12 months after delivery were estimated using a pharmacokinetic model. Parents completed the Strengths and Difficulties Questionnaire (SDQ), and children's behaviors were dichotomized as abnormal (high) versus normal/borderline for five SDQ subscales and the total difficulties score. The total difficulties score, an overall measure of abnormal behavior, was not clearly associated with pre- or postnatal exposures to PCB-153 or to p,p '-DDE. However, pooled adjusted odds ratios (ORs) for high conduct problem scores with a doubling of exposure were 1.19 (95% CI: 0.99, 1.42) and 1.16 (95% CI: 0.96, 1.41) for pre- and postnatal PCB-153, respectively, and 1.25 (95% CI: 1.04, 1.51) and 1.24 (95% CI: 1.01, 1.51) for pre- and postnatal p,p '-DDE, respectively. Corresponding ORs for high hyperactivity scores were 1.24 (95% CI: 0.94, 1.62) and 1.08 (95% CI: 0.81, 1.45) for pre- and postnatal PCB-153, respectively, and 1.43 (95% CI: 1.06, 1.92) and 1.27 (95% CI: 0.93, 1.73) for pre- and postnatal p,p '-DDE, respectively. Prenatal and early postnatal exposures to p,p '-DDE and PCB-153 were associated with a higher prevalence of abnormal scores for conduct
Directory of Open Access Journals (Sweden)
Jun Amaki
2016-01-01
Full Text Available We experienced the case of a 56-year-old male with B-lymphoid/myeloid lineage mixed phenotype acute leukemia (MPAL. A cytogenetic analysis of the patient's bone marrow revealed a complex karyotype, including der(9t(7;9(q11.2;p13. We identified an aberrant PAX5 transcript, including the exons 1A to 5 and the contiguous intron 5/6 sequence using the 3′ rapid amplification of cDNA ends-polymerase chain reaction method, and confirmed their expression in the leukemic cells. Our case suggests that der(9t(7;9(q11.2;p13 can cause the truncation of the PAX5 transcript, which is supposed to contribute to the generation of MPAL, in addition to three previously reported types of PAX5 fusion.
Stolzenburg, Jens-Uwe; Rabenalt, Robert; Do, Minh; Truss, Michael C; Burchardt, Martin; Herrmann, Thomas R; Schwalenberg, Thilo; Kallidonis, Panagiotis; Liatsikos, Evangelos N
2007-03-01
We herein review our experience with endoscopic extraperitoneal radical prostatectomy (EERPE) as a first line therapy for localized prostate cancer. A series of 1,300 patients underwent EERPE ("wide excision", standard nervesparing technique (nsEERPE), or intrafascial nsEERPE). The mean age of the patients was 63.3 years. Preoperative PSA mean value was 10.1 ng/ml. A total of 415 patients had undergone previous surgical procedure in the lower abdomen (n = 336) and prior surgery of the prostate (n = 79), respectively. The EERPE was employed in all cases without any specific selection criteria. Mean operative time was 153 (50-320) min. including lymphadenectomy with no conversion to open surgery. Seven intraoperative, 91 early and 4 late complications occurred. The transfusion rate was 0.9%. Positive surgical margins were found in 83 patients with pT2 stage (9.8%) and in 154 patients in pT3 stage (34.3%). The mean catheterization time was 6.2 days. The 12 month follow up indicated continence rate of 91.9% and potency rates of 34% in the unilateral nerve sparing group and 69.8% in the bilateral group. In the intrafascial nsEERPE group potency rates were 33.3% (unilateral) and 79.1% (bilateral) after 12 months. Postoperative positive surgical margins rate were 6.1% for pT2 and 20% for pT3 and the complications rate 4%. The results of this large series of 1,300 patients are promising. The recently introduced intrafascial nsEERPE further ameliorates the outcome of the procedure.
Meltzer, H Y; Matsubara, S; Lee, J C
1989-10-01
The pKi values of 13 reference typical and 7 reference atypical antipsychotic drugs (APDs) for rat striatal dopamine D-1 and D-2 receptor binding sites and cortical serotonin (5-HT2) receptor binding sites were determined. The atypical antipsychotics had significantly lower pKi values for the D-2 but not 5-HT2 binding sites. There was a trend for a lower pKi value for the D-1 binding site for the atypical APD. The 5-HT2 and D-1 pKi values were correlated for the typical APD whereas the 5-HT2 and D-2 pKi values were correlated for the atypical APD. A stepwise discriminant function analysis to determine the independent contribution of each pKi value for a given binding site to the classification as a typical or atypical APD entered the D-2 pKi value first, followed by the 5-HT2 pKi value. The D-1 pKi value was not entered. A discriminant function analysis correctly classified 19 of 20 of these compounds plus 14 of 17 additional test compounds as typical or atypical APD for an overall correct classification rate of 89.2%. The major contributors to the discriminant function were the D-2 and 5-HT2 pKi values. A cluster analysis based only on the 5-HT2/D2 ratio grouped 15 of 17 atypical + one typical APD in one cluster and 19 of 20 typical + two atypical APDs in a second cluster, for an overall correct classification rate of 91.9%. When the stepwise discriminant function was repeated for all 37 compounds, only the D-2 and 5-HT2 pKi values were entered into the discriminant function.(ABSTRACT TRUNCATED AT 250 WORDS)
International Nuclear Information System (INIS)
Tian, Mei; Cui, Ya-Zhou; Song, Guan-Hua; Zong, Mei-Juan; Zhou, Xiao-Yan; Chen, Yu; Han, Jin-Xiang
2008-01-01
There is an urgent need to discover more sensitive and specific biomarkers to improve early diagnosis and screen high-risk patients for pancreatic ductal adenocarcinoma (PDAC). Pancreatic juice is an ideal specimen for PDAC biomarkers discovery, because it is an exceptionally rich source of proteins released from pancreatic cancer cells. To identify novel potential biomarkers for PDAC from pancreatic juice, we carried out difference gel electrophoresis (DIGE) and tandem mass spectrometry (MS/MS) to compare the pancreatic juice profiling from 9 PDAC patients and 9 cancer-free controls. Of the identified differently expressed proteins, three up-regulated proteins in pancreatic cancer juice, matrix metalloproteinase-9 (MMP-9), oncogene DJ1 (DJ-1) and alpha-1B-glycoprotein precursor (A1BG), were selected for validation by Western blot and immunohistochemistry. Serum MMP-9 levels were also detected by enzyme linked immunosorbent assay (ELISA). Fourteen proteins were up-regulated and ten proteins were down-regulated in cancerous pancreatic juice compared with cancer-free controls. Increased MMP-9, DJ-1 and A1BG expression in cancerous pancreatic juice were confirmed by Western blot. Immunohistochemical study showed MMP-9, DJ-1 and A1BG positively expressed in 82.4%, 72.5% and 86.3% of pancreatic cancer tissues, significantly higher than that in normal pancreas tissues. Up-regulation of DJ-1 was associated with better differentiation (p < 0.05). Serum MMP-9 levels were significantly higher in PDAC (255.14 ng/ml) than those in chronic pancreatitis (210.22 ng/ml, p = 0.009) and healthy control (203.77 ng/ml, p = 0.027). The present proteome analysis revealed MMP-9, DJ-1 and A1BG proteins as elevated in pancreatic juice from PDAC, which suggest their further utility in PDAC diagnosis and screening. This is the first time A1BG was identified as a potential biomarker in pancreatic cancer associated samples. The measurement of serum MMP-9 might be clinically useful for PDAC
2010-01-01
... Marketing § 455.91 Eligibility. To be eligible to receive financial assistance for technical assistance, program assistance, and marketing, a State must: (a) Have in place a State Plan approved by DOE which... assistance, and marketing, pursuant to § 455.20(j)(1); (b) Have established a program consistent with this...
25 CFR 91.7 - Permits to occupy land for dwelling purposes.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Permits to occupy land for dwelling purposes. 91.7... INDIAN VILLAGES, OSAGE RESERVATION, OKLAHOMA § 91.7 Permits to occupy land for dwelling purposes. The issuance of permits for the use of land for dwelling purposes within any village reserve described in § 91...
Energy Technology Data Exchange (ETDEWEB)
Majumdar, Sanjib, E-mail: sanjib@barc.gov.in [High Temperature Materials Development Section, Materials Processing & Corrosion Engineering Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Paul, Bhaskar [High Temperature Materials Development Section, Materials Processing & Corrosion Engineering Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Chakraborty, Poulami [Materials Science Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Kishor, Jugal; Kain, Vivekanand [High Temperature Materials Development Section, Materials Processing & Corrosion Engineering Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Dey, Gautam Kumar [Materials Science Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Materials Group, Bhabha Atomic Research Centre, Trombay, Mumbai (India)
2017-04-01
Iron aluminide coating layers were formed on a ferritic martensitic grade 9Cr-1Mo (P 91) steel using pack aluminizing process. The formation of different aluminide compositions such as orthorhombic-Fe{sub 2}Al{sub 5}, B2-FeAl and A2-Fe(Al) on the pack chemistry and heat treatment conditions have been established. About 4–6 μm thick Al{sub 2}O{sub 3} scale was formed on the FeAl phase by controlled heat treatment. The corrosion tests were conducted using both the FeAl and Al{sub 2}O{sub 3}/FeAl coated specimens in an electro-magnetic pump driven Pb-17Li Loop at 500 °C for 5000 h maintaining a flow velocity of 1.5 m/s. The detailed characterization studies using scanning electron microscopy, back-scattered electron imaging and energy dispersive spectrometry revealed no deterioration of the coating layers after the corrosion tests. Self-healing oxides were formed at the cracks generated in the aluminide layers during thermal cycling and protected the base alloy (steel) from any kind of elemental dissolution or microstructural degradation. - Highlights: •Al{sub 2}O{sub 3}/FeAl coating produced on P91 steel by pack aluminizing and heat treatment. •Corrosion tests of coated steel conducted in flowing Pb-17Li loop at 500 °C for 5000 h. •Coating was protective against molten metal corrosion during prolonged exposure. •Self-healing protective oxides formed in the cracks generated in aluminide layers.
Microstructural evolution of ASTM P91 after 100,000 hours exposure at 550 C and 600 C
Energy Technology Data Exchange (ETDEWEB)
Cipolla, L.; Venditti, D.; Di Gianfrancesco, A. [Centro Sviluppo Materiali SpA, Rome (Italy); Caminada, S. [TenarisDalmine, Dalmine (Italy); Danielsen, H.K. [Technical Univ. of Denmark, Lyngby (Denmark)
2010-07-01
ASTM A335 P91 samples were investigated after creep testing at 550 C and 600 C for over 10{sup 5} h. X-Ray Diffraction, Scanning and Transmission Electron Microscopy were adopted to assess the microstructural evolution of the material in terms of precipitation changes during high temperature exposure. Mean equivalent diameters and average chemical compositions of MX and M{sub 23}C{sub 6} precipitates and Laves phases were assessed through the analysis of a large number of particles. Their growth and coarsening kinetics were determined at 600 C on many samples with increasing exposure times up to 100,000 hours. Also the presence of modified Z-phase, Cr(V, Nb)N, was investigated. The high microstructural stability of Grade 91 is related to the presence of fine and distributed MX carbonitrides, always present even after very long term temperature exposure. The mean size of MX carbonitrides remains almost constant and stays below 45 nm after 10{sup 5} h at 600 C. Although MX particles exhibit a Cr enrichment with increasing ageing times, indicating that they are absorbing Cr atoms from the surrounding matrix, their transformation into Z-phase is still at a very preliminary stage: only a few hybrid MX/Z particles and a few Z-phase precipitates were identified in the most aged sample after 10{sup 5} at 600 C. Coarsening of M{sub 23}C{sub 6} occurs during thermal exposure, but their average equivalent diameter, initially of 140 nm in the as-treated material, remains below 200 nm after 10{sup 5} h at 600 C. Laves particles form at grain boundaries after a relatively short time and soon become the largest precipitates. (orig.)
Development of ferritic-martensitic P9 steel for wrapper application in future SFRs
International Nuclear Information System (INIS)
Choudhary, B.K.; Mathew, M.D.; Isaac Samuel, E.; Moitra, A.
2011-01-01
The paper deals with the outcome of the research and development efforts directed towards the development of ferritic-martensitic P9 steel for wrapper application in future sodium cooled fast reactors with an objective to achieve high fuel burnup and more economical nuclear energy. The important and critical issues involved for the development of P9 wrappers such as optimisation of chemical composition in terms of trace elements like sulphur and phosphorous and appropriate thermo-mechanical treatments along with thermal ageing and irradiation effects on fracture properties have been discussed. Tensile properties evaluated at temperatures ranging from 300 to 873 K on the experimental three heats of P9 steel with different silicon contents and made using primary vacuum induction melting followed by secondary electro slag refining route, have been presented. Fracture behaviour examined mainly in terms of ductile to brittle transition temperature and upper shelf energy provided encouraging results. Based on these investigations, a roadmap has been drawn to make experimental P9 steel wrappers for tests in fast breeder test reactor and prototype fast breeder reactor. (author)
Jackman, Jane E; Montange, Rebecca K; Malik, Harmit S; Phizicky, Eric M
2003-05-01
Methylation of tRNA at the N-1 position of guanosine to form m(1)G occurs widely in nature. It occurs at position 37 in tRNAs from all three kingdoms, and the methyltransferase that catalyzes this reaction is known from previous work of others to be critically important for cell growth in Escherichia coli and the yeast Saccharomyces cerevisiae. m(1)G is also widely found at position 9 in eukaryotic tRNAs, but the corresponding methyltransferase was unknown. We have used a biochemical genomics approach with a collection of purified yeast GST-ORF fusion proteins to show that m(1)G(9) formation of yeast tRNA(Gly) is associated with ORF YOL093w, named TRM10. Extracts lacking Trm10p have undetectable levels of m(1)G(9) methyltransferase activity but retain normal m(1)G(37) methyltransferase activity. Yeast Trm10p purified from E. coli quantitatively modifies the G(9) position of tRNA(Gly) in an S-adenosylmethionine-dependent fashion. Trm10p is responsible in vivo for most if not all m(1)G(9) modification of tRNAs, based on two results: tRNA(Gly) purified from a trm10-Delta/trm10-Delta strain is lacking detectable m(1)G; and a primer extension block occurring at m(1)G(9) is removed in trm10-Delta/trm10-Delta-derived tRNAs for all 9 m(1)G(9)-containing species that were testable by this method. There is no obvious growth defect of trm10-Delta/trm10-Delta strains. Trm10p bears no detectable resemblance to the yeast m(1)G(37) methyltransferase, Trm5p, or its orthologs. Trm10p homologs are found widely in eukaryotes and many archaea, with multiple homologs in several metazoans, including at least three in humans.
SLC9B1 methylation predicts fetal intolerance of labor.
Knight, Anna K; Conneely, Karen N; Kilaru, Varun; Cobb, Dawayland; Payne, Jennifer L; Meilman, Samantha; Corwin, Elizabeth J; Kaminsky, Zachary A; Dunlop, Anne L; Smith, Alicia K
2018-01-01
Fetal intolerance of labor is a common indication for delivery by Caesarean section. Diagnosis is based on the presence of category III fetal heart rate tracing, which is an abnormal heart tracing associated with increased likelihood of fetal hypoxia and metabolic acidemia. This study analyzed data from 177 unique women who, during their prenatal visits (7-15 weeks and/or 24-32 weeks) to Atlanta area prenatal care clinics, consented to provide blood samples for DNA methylation (HumanMethylation450 BeadChip) and gene expression (Human HT-12 v4 Expression BeadChip) analyses. We focused on 57 women aged 18-36 (mean 25.4), who had DNA methylation data available from their second prenatal visit. DNA methylation patterns at CpG sites across the genome were interrogated for associations with fetal intolerance of labor. Four CpG sites (P value intolerance of labor. DNA methylation and gene expression were negatively associated when examined longitudinally during pregnancy using a linear mixed-effects model. Positive predictive values of methylation of these four sites ranged from 0.80 to 0.89, while negative predictive values ranged from 0.91 to 0.92. The four CpG sites were also associated with fetal intolerance of labor in an independent cohort (the Johns Hopkins Prospective PPD cohort). Therefore, fetal intolerance of labor could be accurately predicted from maternal blood samples obtained between 24-32 weeks gestation. Fetal intolerance of labor may be accurately predicted from maternal blood samples obtained between 24-32 weeks gestation by assessing DNA methylation patterns of SLC9B1. The identification of pregnant women at elevated risk for fetal intolerance of labor may allow for the development of targeted treatments or management plans.
Genetic Polymorphism of CYP2C9 Among Sistani Ethnic Group in Gorgan.
Marjani, Abdoljalal; Gharanjik, Aman Mohammad
2018-04-01
Cytochrome P450 2C9 (CYP2C9) is involved in metabolism of many important drugs and its genotype variations is thought to affect drug efficacy and the treatment process. The aim of this study was to assess the distribution of CYP2C9 allele and genotypic variants in Sistani ethnic group, living in Gorgan, South East of Caspian Sea and North East of Iran. This study included 140 Sistani, referred to the health center of Gorgan. CYP2C9 genotyping was carried out by polymerase chain reaction-restriction fragment length polymorphism technique. The allele frequency of CYP2C9*1, CYP2C9*2 and CYP2C9*3 was 76.1, 16.1 and 7.8%, respectively. The frequency of CYP2C9*1/*1, CYP2C9*1/*2, CYP2C9*1/*3, CYP2C9*2/*2, CYP2C9*2/*3 and CYP2C9*3/*3 genotypes was 53.9, 22.1, 11.4, 2.9, 4.3% and nil, respectively. In this study the genotypic variations of the CYP2C9 allele among the Sistani ethnic group was investigated and great differences were observed in comparison to other populations. Our findings suggest that different genotypes of CYP2C9 may influence the pharmacokinetics of some drugs. More studies on the pharmacokinetic effects of CYP2C9 genotypes may help physicians choose optimal dosage of some drugs for treatment and prevention of their side effects. Since different ethnic groups from all over the world use medications, it suggests to investigate the pharmacokinetic effects of CYP2C9 genotypes in different populations.
File list: InP.Emb.20.AllAg.Mitotic_cycle_8-9 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Emb.20.AllAg.Mitotic_cycle_8-9 dm3 Input control Embryo Mitotic cycle 8-9 http:...//dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/InP.Emb.20.AllAg.Mitotic_cycle_8-9.bed ...
File list: InP.Emb.50.AllAg.Mitotic_cycle_8-9 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Emb.50.AllAg.Mitotic_cycle_8-9 dm3 Input control Embryo Mitotic cycle 8-9 http:...//dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/InP.Emb.50.AllAg.Mitotic_cycle_8-9.bed ...
Trentini, Alessandro; Manfrinato, Maria C; Castellazzi, Massimiliano; Tamborino, Carmine; Roversi, Gloria; Volta, Carlo A; Baldi, Eleonora; Tola, Maria R; Granieri, Enrico; Dallocchio, Franco; Bellini, Tiziana; Fainardi, Enrico
2015-08-01
The activity of matrix metalloproteinase-9 (MMP-9) depends on two isoforms, an 82 kDa active MMP-9 modulated by its specific tissue inhibitor (TIMP-1), and a 65 kDa TIMP-1 resistant active MMP-9. The relevance of these two enzymatic isoforms in multiple sclerosis (MS) is still unknown. To investigate the contribution of the TIMP-1 modulated and resistant active MMP-9 isoforms to MS pathogenesis. We measured the serum levels of the 82 kDa and TIMP-1 resistant active MMP-9 isoforms by activity assay systems in 86 relapsing-remitting MS (RRMS) patients, categorized according to clinical and magnetic resonance imaging (MRI) evidence of disease activity, and in 70 inflammatory (OIND) and 69 non-inflammatory (NIND) controls. Serum levels of TIMP-1 resistant MMP-9 were more elevated in MS patients than in OIND and NIND (p < 0.05, p < 0.02, respectively). Conversely, 82 kDa active MMP-9 was higher in NIND than in the OIND and MS patients (p < 0.01 and p < 0.00001, respectively). MRI-active patients had higher levels of TIMP-1 resistant MMP-9 and 82 kDa active MMP-9, than did those with MRI inactive MS (p < 0.01 and p < 0.05, respectively). Our findings suggested that the TIMP-1 resistant MMP-9 seem to be the predominantly active isoform contributing to MS disease activity. © The Author(s), 2015.
Dual ferroic properties of hexagonal ferrite ceramics BaFe_1_2O_1_9 and SrFe_1_2O_1_9
International Nuclear Information System (INIS)
Kostishyn, V.G.; Panina, L.V.; Timofeev, A.V.; Kozhitov, L.V.; Kovalev, A.N.; Zyuzin, A.K.
2016-01-01
Dual ferroic properties of a strong magnetism and large ferroelectricity have been observed in barium BaFe_1_2O_1_9 and strontium SrFe_1_2O_1_9 hexaferrite ceramics. The samples were fabricated by a modified ceramic technique from highly purified raw materials with addition of boron oxide allowing the control of grain size and enhancement of bulk resistivity. Whereas the samples of PbFe_1_2O_1_9 fabricated by the same technological method did not have sufficient electric resistivity to support an electric field and did not exhibit the ferroelectric properties. The structure of the samples examined by X-ray diffraction is consistent with a single hexagonal phase. The grains are randomly oriented with the average grain size of 300–400 nm coated with boron oxide. The magnetic properties are characterised by standard ferrimagnetic behavior with the Neel temperature of about 450 °C. Large spontaneous polarization was observed with the maximal values of 45–50 μC/cm"2 under an applied electric field of 100–300 kV/m. A strong coupling between magnetic and electric ordering was confirmed by measuring the magnetoelectric (ME) parameter and magnetodielectric ratio. These ME characteristics are more advanced than those for well-known room temperature multiferroic BiFeO_3. Furthermore, by applying an electric field, the manipulation of magnetization in the range of up to 9% was observed, which is even greater than in some substituted hexaferrites with a non-collinear magnetic structure. The obtained results on electrical polarization are similar to the values reported for the corresponding hexaferrites sintered by polymer precursor technique. This suggests a promising potential of M-type hexaferrite ceramics in devices utilizing magnetoelectric coupling. - Highlights: • Ba(Sr)Fe_1_2O_1_9-hexaferrites show large room-temperature multiferroic properties. • Small addition of B_2O_3 increases the hexaferrite resistivity by 4 orders of magnitude. • Large spontaneous
Wang Li; Sun, L L; Wang, W H; Wang, W K
2003-01-01
The pressure dependence of the acoustic velocities of a Pd sub 3 sub 9 Ni sub 1 sub 0 Cu sub 3 sub 0 P sub 2 sub 1 bulk metallic glass have been investigated up to 0.5 GPa at room temperature with the pulse echo overlap method. Two independent second-order elastic coefficients C sub 1 sub 1 and C sub 4 sub 4 and their pressure derivatives are yielded. The vibrational anharmonicity is shown by calculating both the acoustic mode Grueneisen parameters in the long-wavelength limit and the thermal Grueneisen parameter, and this result is compared with that for the Pd sub 4 sub 0 Ni sub 4 sub 0 P sub 2 sub 0 bulk glass.
26 CFR 9.1 - Investment credit-public utility property elections.
2010-04-01
... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Investment credit-public utility property... Investment credit—public utility property elections. (a) Applicability of prior election under section 46(f... respect to public utility property described in section 46(f)(5) by reason of sections 301 and 302 of the...
V{sub 18}P{sub 9}C{sub 2}. A complex phosphide carbide
Energy Technology Data Exchange (ETDEWEB)
Boller, Herbert [Linz Univ. (Austria). Inst. fuer Anorganische Chemie; Effenberger, Herta [Wien Univ. (Austria). Inst. fuer Mineralogie und Kristallographie
2016-08-01
V{sub 18}P{sub 9}C{sub 2} crystallizes in the orthorhombic space group Pmma with the lattice parameters a = 17.044(3), b = 3.2219(7), and c = 13.030(2) Aa, Z = 2. The crystal structure is composed of 19 symmetry-independent atoms. The crystal structure is considered as a network formed by the transition metal atoms exhibiting cubic, trigonal prismatic, and octahedral voids centered by V, P, and C atoms, respectively. Vice versa, the V and P atoms form a three-dimensional network. The two CV{sub 6} octahedra are edge- and corner-connected to chains running parallel to [010]. The five unique P atoms are trigonal prismatically coordinated by V atoms with one to three faces capped again by a V atom. The V atoms have mainly cubic environments formed solely by V or by V and P atoms. V{sub 18}P{sub 9}C{sub 2} exhibits some structural relations to other compounds of the ternary system V-P-C as well as to other intermetallic phases. Despite the low carbon content, V{sub 18}P{sub 9}C{sub 2} is considered as a ternary compound rather than an interstitially stabilized (binary) phosphide in view of its special structural features.
Constraints on Comet 332P/Ikeya-Murakami
Hui, Man-To; Ye, Quan-Zhi; Wiegert, Paul
2017-01-01
Encke-type comet 332P/Ikeya-Murakami is experiencing cascading fragmentation events during its 2016 apparition. It is likely the first splitting Encke-type comet ever observed. A nongravitational solution to the astrometry reveals a statistical detection of the radial and transverse nongravitational parameters, {A}1=(1.54+/- 0.39)× {10}-8 au day‑2 and {A}2=(7.19+/- 1.92)× {10}-9 au day‑2, respectively, which implies a nucleus erosion rate of (9.1+/- 1.7)‰ per orbital revolution. The mass-loss rate likely has to be supported by a much larger fraction of an active surface area than known cases of short-period comets; it may be relevant to the ongoing fragmentation. We failed to detect any serendipitous pre-discovery observations of the comet in archival data from major sky surveys, whereby we infer that 332P used to be largely inactive, and is perhaps among the few short-period comets that have been reactivated from weakly active or dormant states. We therefore constrain an upper limit to the nucleus size as 2.0 ± 0.2 km in radius. A search for small bodies in similar orbits to that of 332P reveals comet P/2010 B2 (WISE) to be the best candidate. From an empirical generalized Jupiter-family (Encke-type included) comet population model, we estimate the likelihood of a chance alignment of the 332P–P/2010 B2 pair to be 1 in 33, a small number indicative of a genetic linkage between the two comets on a statistical basis. The pair possibly originated from a common progenitor, which underwent a disintegration event well before the twentieth century.
Generation of CRISPR/Cas9-mediated bicistronic knock-in ins1-cre driver mice.
Hasegawa, Yoshikazu; Hoshino, Yoshikazu; Ibrahim, Abdelaziz E; Kato, Kanako; Daitoku, Yoko; Tanimoto, Yoko; Ikeda, Yoshihisa; Oishi, Hisashi; Takahashi, Satoru; Yoshiki, Atsushi; Yagami, Ken-Ichi; Iseki, Hiroyoshi; Mizuno, Seiya; Sugiyama, Fumihiro
2016-07-29
In the present study, we generated novel cre driver mice for gene manipulation in pancreatic β cells. Using the CRISPR/Cas9 system, stop codon sequences of Ins1 were targeted for insertion of cre, including 2A sequences. A founder of C57BL/6J-Ins1(em1 (cre) Utr) strain was produced from an oocyte injected with pX330 containing the sequences encoding gRNA and Cas9 and a DNA donor plasmid carrying 2A-cre. (R26GRR x C57BL/6J-Ins1(em1 (cre) Utr)) F1 mice were histologically characterized for cre-loxP recombination in the embryonic and adult stages; cre-loxP recombination was observed in all pancreatic islets examined in which almost all insulin-positive cells showed tdsRed fluorescence, suggesting β cell-specific recombination. Furthermore, there were no significant differences in results of glucose tolerance test among genotypes (homo/hetero/wild). Taken together, these observations indicated that C57BL/6J-Ins1(em1 (cre) Utr) is useful for studies of glucose metabolism and the strategy of bicistronic cre knock-in using the CRISPR/Cas9 system could be useful for production of cre driver mice.
File list: InP.Emb.50.AllAg.Mitotic_cycle_7-9 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Emb.50.AllAg.Mitotic_cycle_7-9 dm3 Input control Embryo Mitotic cycle 7-9 SRX64...5137 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/InP.Emb.50.AllAg.Mitotic_cycle_7-9.bed ...
IL12A, MPHOSPH9/CDK2AP1 and RGS1 are novel multiple sclerosis susceptibility loci
DEFF Research Database (Denmark)
Sørensen, Per Soelberg
2010-01-01
and the same direction of effect observed in the discovery phase. Three loci exceeded genome-wide significance in the joint analysis: RGS1 (P value=3.55 x 10(-9)), IL12A (P=3.08 x 10(-8)) and MPHOSPH9/CDK2AP1 (P=3.96 x 10(-8)). The RGS1 risk allele is shared with celiac disease (CD), and the IL12A risk allele......A recent meta-analysis identified seven single-nucleotide polymorphisms (SNPs) with suggestive evidence of association with multiple sclerosis (MS). We report an analysis of these polymorphisms in a replication study that includes 8,085 cases and 7,777 controls. A meta-analysis across...... the replication collections and a joint analysis with the discovery data set were performed. The possible functional consequences of the validated susceptibility loci were explored using RNA expression data. For all of the tested SNPs, the effect observed in the replication phase involved the same allele...
Toxicokinetics and biotransformation of p-nitrophenol in red abalone (Haliotis rufescens)
Energy Technology Data Exchange (ETDEWEB)
TenBrook, Patti L.; Kendall, Shellie M.; Viant, Mark R.; Tjeerdema, Ronald S
2003-02-26
Red abalone (Haliotis rufescens) were exposed to 3.6 {mu}M (0.5 ppm) {sup 14}C-labelled p-nitrophenol (PNP) for 24 h, then were allowed to depurate in clean seawater for another 24 h. Absorption, conditional uptake clearance and elimination rate constants were 0.12{+-}0.04 h{sup -1}, 3.2{+-}1.1 ml g{sup -1} h{sup -1} and 0.05{+-}0.02 h{sup -1}, respectively. The sigmoidal shape of the PNP uptake curve suggests a biphasic process. A whole-organism total concentration factor (TCF) of 2.37{+-}0.07 was determined from equilibrium tissue and water concentrations, with the highest concentration of PNP plus metabolites found in gill tissue (11.8{+-}0.2 nmol g{sup -1}, wet weight). Digestive gland, foot muscle and remaining body tissues accumulated 8.8{+-}0.9, 7.7{+-}0.6 and 7.5{+-}0.6 nmol g{sup -1} radiolabelled residues, respectively. Abalone depurated 91.6% of absorbed PNP within 24 h, of which 87.5{+-}3.1% was unmetabolized parent compound, 13.1{+-}3.1% was p-nitrophenylsulfate, 0.32{+-}0.09% was p-nitroanisole, and 0.14{+-}0.07% was p-acetamidophenol.
International Nuclear Information System (INIS)
Tran Duc Thiep; Truong Thi An; Phan Viet Cuong; Nguyen The Vinh; Bui Minh Hue; Belov, A.G.; Maslov, O.D.; Mishinsky, G.V.; Zhemenik, V.I.
2017-01-01
We have determined the isomeric ratios of isomeric pairs "9"7"m","gNb, "9"5"m","gNb and "9"1"m","gMo produced in "9"8Mo(γ, p)"9"7"m","gNb, "9"6Mo(γ, p)"9"5"m","gNb and "9"2Mo(γ, n)"9"1"m","gMo photonuclear reactions in the giant dipole resonance (GDR) region by the activation method. The results were analyzed, discussed and compared with the similar data from literature to examine the role of excitation energy, neutron configuration, channel effect, and direct and pre-equilibrium processes in (γ, p) photonuclear reactions. In this work the isomeric ratios for "9"7"m","gNb from 14 to 19 MeV, for "1"9"5"m","gNb from 14 to 24 MeV except 20 and 23.5 MeV and for "9"1"m","gMo at 14 and 15 MeV were first measured.
[1,4-Bis(diphenylphosphanylbutane-κ2P,P′]chlorido(η5-indenylruthenium(II
Directory of Open Access Journals (Sweden)
Hui-Ling Sung
2011-05-01
Full Text Available Facile ligand substitution is observed when the ruthenium chloride complex [Ru(η5-C9H7Cl(PPh32] is treated with 1,4-bis(diphenylphosphanylbutane in refluxing toluene yielding the title compound, [Ru(C9H7Cl(C28H28P2]. The RuII atom has a typical piano-stool coordination, defined by the indenyl ligand, one Cl atom and two phosphanyl P atoms. The Ru—P bond lengths are 2.2502 (9 and 2.2968 (8 Å.
International Nuclear Information System (INIS)
Stiborová, Marie; Moserová, Michaela; Černá, Věra; Indra, Radek; Dračínský, Martin; Šulc, Miroslav; Henderson, Colin J.; Wolf, C. Roland; Schmeiser, Heinz H.; Phillips, David H.; Frei, Eva; Arlt, Volker M.
2014-01-01
In previous studies we had administered benzo[a]pyrene (BaP) to genetically engineered mice (HRN) which do not express NADPH:cytochrome P450 oxidoreductase (POR) in hepatocytes and observed higher DNA adduct levels in livers of these mice than in wild-type mice. To elucidate the reason for this unexpected finding we have used two different settings for in vitro incubations; hepatic microsomes from control and BaP-pretreated HRN mice and reconstituted systems with cytochrome P450 1A1 (CYP1A1), POR, cytochrome b 5 , and epoxide hydrolase (mEH) in different ratios. In microsomes from BaP-pretreated mice, in which Cyp1a1 was induced, higher levels of BaP metabolites were formed, mainly of BaP-7,8-dihydrodiol. At a low POR:CYP1A1 ratio of 0.05:1 in the reconstituted system, the amounts of BaP diones and BaP-9-ol formed were essentially the same as at an equimolar ratio, but formation of BaP-3-ol was ∼1.6-fold higher. Only after addition of mEH were BaP dihydrodiols found. Two BaP-DNA adducts were formed in the presence of mEH, but only one when CYP1A1 and POR were present alone. At a ratio of POR:CYP1A1 of 0.05:1, addition of cytochrome b 5 increased CYP1A1-mediated BaP oxidation to most of its metabolites indicating that cytochrome b 5 participates in the electron transfer from NADPH to CYP1A1 required for enzyme activity of this CYP. BaP-9-ol was formed even by CYP1A1 reconstituted with cytochrome b 5 without POR. Our results suggest that in livers of HRN mice Cyp1a1, cytochrome b 5 and mEH can effectively activate BaP to DNA binding species, even in the presence of very low amounts of POR
14 CFR 91.517 - Passenger information.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Passenger information. 91.517 Section 91... Multiengine Airplanes and Fractional Ownership Program Aircraft § 91.517 Passenger information. (a) Except as... belts and when smoking is prohibited. (c) If passenger information signs are installed, no passenger or...
14 CFR 91.1107 - Recurrent training.
2010-01-01
..., as appropriate, including low-altitude windshear training and training on operating during ground... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Recurrent training. 91.1107 Section 91.1107... Management § 91.1107 Recurrent training. (a) Each program manager must ensure that each crewmember receives...
Jiang, Wen-Hao; Liu, Jian-Hong; Liu, Yin; Jin, Ge; Zhang, Jun; Pan, Jian-Wei
2017-12-15
InGaAs/InP single-photon detectors (SPDs) are the key devices for applications requiring near-infrared single-photon detection. The gating mode is an effective approach to synchronous single-photon detection. Increasing gating frequency and reducing the module size are important challenges for the design of such a detector system. Here we present for the first time, to the best of our knowledge, an InGaAs/InP SPD with 1.25 GHz sine wave gating (SWG) using a monolithically integrated readout circuit (MIRC). The MIRC has a size of 15 mm×15 mm and implements the miniaturization of avalanche extraction for high-frequency SWG. In the MIRC, low-pass filters and a low-noise radio frequency amplifier are integrated based on the technique of low temperature co-fired ceramic, which can effectively reduce the parasitic capacitance and extract weak avalanche signals. We then characterize the InGaAs/InP SPD to verify the functionality and reliability of the MIRC, and the SPD exhibits excellent performance with 27.5% photon detection efficiency, a 1.2 kcps dark count rate, and 9.1% afterpulse probability at 223 K and 100 ns hold-off time. With this MIRC, one can further design miniaturized high-frequency SPD modules that are highly required for practical applications.
Energy Technology Data Exchange (ETDEWEB)
Antolkovic, B; Holmqvist, B; Wiedling, T
1964-10-15
The angular distributions of neutrons from the reaction {sup 9}Be (p, n) {sup 9}B have been studied at the proton energies 2.300, 2.335, 2.389, and 2.560 MeV. Time-of-flight techniques have been used. The angular distribution measurements show remarkable differences compared to earlier published results using long-counters as detectors. The new results are ascribed to the different experimental methods. By using time-of-flight techniques it has been possible to eliminate disturbing influences from neutrons obtained from the {sup 9}Be (p,p'n) {sup 8}Be reaction which has a lower reaction threshold than the {sup 9}Be (p, n) {sup 9}B reaction as well as other Be-p-reactions emitting neutrons. The experimental distribution at 2.30 MeV has been compared with the simplified theories for direct interaction processes developed by Satchler and Rodberg. It is shown that Rodberg's proposal of using optical model wave functions describes the experiment better than Satchler's original theory. However, a good fitting leads to a nuclear radius as well as an optical potential which is appreciably smaller than ordinarily obtained in scattering experiments.
Effects of CPG ODN on biological behavior of PANC-1 and expression of TLR9 in pancreatic cancer.
Wu, Han-Qing; Wang, Bo; Zhu, Shi-Kai; Tian, Yuan; Zhang, Jing-Hui; Wu, He-Shui
2011-02-28
To determine the expression of toll-like receptor 9 (TLR9) in pancreatic tumor and the effects of cytosine phosphate-guanosine oligodeoxynucleotides 2216 (CPG ODN2216) on biological behavior of pancreatic carcinoma cell line PANC-1 and explore their clinical significance. The immunohistochemistry and Western blot were used to determine the expression of TLR9 protein in pancreatic cancer tissues, and immunofluorescence staining was performed to detect the TLR9 protein expression in pancreatic carcinoma cell line PANC-1. To assess the effects of CPG ODN2216 on the invasive property of Panc-1 cells, in vitro cell adhesion, wound-healing scrape, and invasion and cell colony formation were evaluated. TLR9 was highly expressed in pancreatic cancer tissues and PANC-1 cells. The percentage of positive cells expressing TLR9 protein in human pancreatic tissues, paracancerous tissues and normal tissues were 73.3%, 33.3% and 20.0%, respectively, and the protein expression level of TLR9 was gradually descending (P PANC-1 cells in CPG ODN 2216 treatment group were significantly lower than in the control group (P PANC-1 cells in treatment group was significantly decreased and CPG ODN2216 had an inhibitive effect in the growth of Panc-1 cells in a dose and time-dependent manner (P Panc-1 cells.
14 CFR 141.91 - Satellite bases.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Satellite bases. 141.91 Section 141.91... OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Operating Rules § 141.91 Satellite bases. The holder of a... assistant chief instructor is designated for each satellite base, and that assistant chief instructor is...
Spitzer, Petra; Giera, Janine; Fraga, Isabel Cristina Serta; Jakobsen, Pia Tonnes; Jensen, Hans D.; Hyllested, Peter; Karpov, Oleg; Kutovoy, Viatcheslav; Nakamura, Susumu; Vospelova, Alena; Zvezdina, Valentina
2008-01-01
CCQM-K9.2 was performed supplementary to the key comparison CCQM-K9 [1] on the pH determination of a phosphate buffer with nominal pH ~ 6.9 (at 25 °C). The sample composition was very similar in both comparisons. Only the source of the starting material used for sample preparation was different. The comparison was restricted to the use of the primary method for pH (Harned cell measurement) as defined in the IUPAC Recommendations [2]. The measurement temperatures were15 °C, 25 °C , 37...
Correlation Between Th1, Th2 Cells and Levels of Serum MMP-2, MMP-9 in Children with Asthma
Directory of Open Access Journals (Sweden)
Xuan WANG
2015-12-01
Full Text Available Abstract Objective: To explore the correlation between Th1 and Th2 cells and the levels of serum matrix metalloproteinase-2 (MMP-2 and MMP-9 in children with asthma. Methods: A total of 89 children with asthma were divided into acute group (n=48 and chronic group (n=41 according to the course of disease, and 40 healthy children at the same term were collected as control group. The ratios of Th1 and Th2 cells as well as levels of MMP-2 and MMP-9 were compared in three groups, and the correlation between Th1 and Th2 cells and levels of MMP-2, MMP-9 was analyzed in acute group and chronic group. Results: When compared with control group, the ratios of Th1 and Th2 cells went down in both acute group and chronic group (P<0.01, while the levels of serum MMP-2 and MMP-9 up (P<0.01. The levels of serum MMP-2 and MMP-9 in acute group were dramatically higher than those in chronic group, and there was statistical significance (P<0.01. Pearson correlation analysis revealed that there was no significant correlation between Th1 and Th2 cells and MMP-2 level (r=0.148, P=0.314, r=0.299, P=0.058; r=0.183, P=0.214, r=0.289, P=0.067, whereas both Th1 and Th2 cells were negatively correlated with MMP-9 level in acute group and chronic group (r=-0.489, P=0.000, r=-0.324, P=0.039; r=-0.352, P=0.014, r=-0.357, P=0.022. Conclusion: Aberrant secretion of Th cells can not only damage the immune function of children with asthma, but also decrease the level of serum MMP-9, consequently affecting the collagen degradation and airway remodeling.
Experimental study of hypoxia-imaging agent 99mTc-HL91 in mice bearing glioblastoma G422
International Nuclear Information System (INIS)
Zhou Ying; Qu Wanying; Yao Zhiming; Chen Fang; Zhu Ming; Zhu Lin
1999-01-01
Objective: To evaluate the ability of detecting cerebral tumor by 99m Tc-HL91 in mice bearing glioblastoma G422. Methods: Six model mice underwent static whole body planar imagings at once and at 1,2,3,4,6,7,8 h postinjection of 99m Tc-HL91. Three mice each were killed at 4 h and 8 h, respectively. the tumor, blood and organs were removed, weighted and the radioactivity was measured. ROIs were drawn around tumor, head, contralateral axilla and chest in whole body planar images, and the radioactivity ratios of tumor to head (T/H), contralateral axilla (T/A) and chest (T/C) were calculated. Results: Increased tumor activity was identified in static whole body planar images since 1 h postinjection. At 2h postinjection, T/H, T/A and T/C were 2.93 +- 0.51, 4.86 +- 0.79 and 2.00 +- 0.35 respectively, which were significantly higher than those at once and at 1h postinjection (P 99m Tc-HL91 in tumor tissue of mice bearing glioblastoma G422 is increased and clearance rate is decreased. 99m Tc-HL91 imaging is suitable for glioblastoma at 2 h postinjection. It is appropriate to image tumors in head, neck, thorax, bone and soft tissues, but not in abdominal area
Compact self-Q-switched Tm:YLF laser at 1.91 μm
Zhang, B.; Li, L.; He, C. J.; Tian, F. J.; Yang, X. T.; Cui, J. H.; Zhang, J. Z.; Sun, W. M.
2018-03-01
We report self-Q-switching operation in a diode-pumped Tm:YLF bulk laser by exploiting saturable re-absorption under the quasi-three-level regime. Robust self-Q-switched pulse output at 1.91 μm in fundamental mode is demonstrated experimentally with 1.5 at.% doped Tm:YLF crystal. At maximum absorbed pump power of 4.5 W, the average output power and pulse energy are obtained as high as 610 mW and 29 μJ, respectively, with the corresponding slope efficiency of 22%. Pulse repetition rate is tunable in the range of 3-21 kHz with changing the pump power. The dynamics of self-Q-switching of Tm:YLF laser are discussed with the help of a rate equation model showing good agreement with the experiment. The compact self-Q-switched laser near 2 μm has potential application in laser radar systems for accurate wind velocity measurements.
DEFF Research Database (Denmark)
Deacon, Carolyn F; Plamboeck, Astrid; Møller, Søren
2002-01-01
impossible to assess its true efficacy in vivo. In chloralose-anesthetized pigs given valine-pyrrolidide (to block endogenous DPP IV activity), the independent effects of GLP-1-(7-36) amide on glucose and insulin responses to intravenous glucose were assessed, and the metabolite generated by DPP IV, GLP-1......-(9-36) amide, was investigated for any ability to influence these responses. GLP-1-(7-36) amide enhanced insulin secretion (P amide was without effect, either alone or when coinfused with GLP-1-(7-36) amide. In contrast, GLP-1-(9-36) amide did affect glucose responses (P...... amide (73 +/- 19 mmol x l(-1) x min; P amide (62 +/- 13 mmol x l(-1) x min; P amide + GLP-1-(9-36) amide (50 +/-13 mmol x l(-1) x min; P
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Home office. 545.91 Section 545.91 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY FEDERAL SAVINGS ASSOCIATIONS-OPERATIONS § 545.91 Home office. (a) All operations of a Federal savings association (“you”) are subject to...
49 CFR 325.91 - Exhaust systems.
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Exhaust systems. 325.91 Section 325.91... EMISSION STANDARDS Exhaust Systems and Tires § 325.91 Exhaust systems. Link to an amendment published at 75 FR 57193, Sept. 20, 2010. A motor vehicle does not conform to the visual exhaust system inspection...
10 CFR 76.91 - Emergency planning.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Emergency planning. 76.91 Section 76.91 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) CERTIFICATION OF GASEOUS DIFFUSION PLANTS Safety § 76.91 Emergency planning... Emergency Planning and Community Right-to-Know Act of 1986, Title III, Public Law 99-499, or other State or...
Yin, T; Tsang, M L; Yang, Y C
1994-10-28
Interleukin (IL)-4 and IL-9 regulate the proliferation of T lymphocytes through interactions with their receptors. Previous studies have shown that unknown tyrosine kinases are involved in the proliferative signaling triggered by IL-4 and IL-9. Here we show that IL-4 and IL-9 induce overlapping (170, 130, and 125 kilodalton (kDa)) and distinct (45 and 88/90 kDa, respectively) protein tyrosine phosphorylation in T lymphocytes. We further identify the 170-kDa tyrosine-phosphorylated protein as 4PS/insulin receptor substrate-1-like (IRS-1L) protein and 130-kDa protein as JAK1 kinase. Furthermore, we demonstrate for the first time that JAK1 forms complexes with the IL-4 receptor and 4PS/IRS-1L protein following ligand-receptor interaction. In addition, we demonstrate that IL-9, but not IL-4, induced tyrosine phosphorylation of Stat 91 transcriptional factor. The overlapping and distinct protein tyrosine phosphorylation and activation of the same JAK1 kinase in T lymphocytes strongly suggests that IL-4 and IL-9 share the common signal transduction pathways and that the specificity for each cytokine could be achieved through the unique tyrosine-phosphorylated proteins triggered by individual cytokines.
Directory of Open Access Journals (Sweden)
Seok Joong Yun
2016-06-01
Full Text Available Purpose: Previously, we reported the presence of virus-encoded microRNAs (miRNAs in the urine of prostate cancer (CaP patients. In this study, we investigated the expression of two herpes virus-encoded miRNAs in prostate tissue. Methods: A total of 175 tissue samples from noncancerous benign prostatic hyperplasia (BPH, 248 tissue samples from patients with CaP and BPH, and 50 samples from noncancerous surrounding tissues from these same patients were analyzed for the expression of two herpes virus-encoded miRNAs by real-time polymerase chain reaction (PCR and immunocytochemistry using nanoparticles as molecular beacons. Results: Real-time reverse transcription-PCR results revealed significantly higher expression of hsv1-miR-H18 and hsv2-miRH9- 5p in surrounding noncancerous and CaP tissues than that in BPH tissue (each comparison, P<0.001. Of note, these miRNA were expressed equivalently in the CaP tissues and surrounding noncancerous tissues. Moreover, immunocytochemistry clearly demonstrated a significant enrichment of both hsv1-miR-H18 and hsv2-miR-H9 beacon-labeled cells in CaP and surrounding noncancerous tissue compared to that in BPH tissue (each comparison, P<0.05 for hsv1-miR-H18 and hsv2- miR-H9. Conclusions: These results suggest that increased expression of hsv1-miR-H18 and hsv2-miR-H95p might be associated with tumorigenesis in the prostate. Further studies will be required to elucidate the role of these miRNAs with respect to CaP and herpes viral infections.
A Novel Protein Interaction between Nucleotide Binding Domain of Hsp70 and p53 Motif
Directory of Open Access Journals (Sweden)
Asita Elengoe
2015-01-01
Full Text Available Currently, protein interaction of Homo sapiens nucleotide binding domain (NBD of heat shock 70 kDa protein (PDB: 1HJO with p53 motif remains to be elucidated. The NBD-p53 motif complex enhances the p53 stabilization, thereby increasing the tumor suppression activity in cancer treatment. Therefore, we identified the interaction between NBD and p53 using STRING version 9.1 program. Then, we modeled the three-dimensional structure of p53 motif through homology modeling and determined the binding affinity and stability of NBD-p53 motif complex structure via molecular docking and dynamics (MD simulation. Human DNA binding domain of p53 motif (SCMGGMNR retrieved from UniProt (UniProtKB: P04637 was docked with the NBD protein, using the Autodock version 4.2 program. The binding energy and intermolecular energy for the NBD-p53 motif complex were −0.44 Kcal/mol and −9.90 Kcal/mol, respectively. Moreover, RMSD, RMSF, hydrogen bonds, salt bridge, and secondary structure analyses revealed that the NBD protein had a strong bond with p53 motif and the protein-ligand complex was stable. Thus, the current data would be highly encouraging for designing Hsp70 structure based drug in cancer therapy.
Crystal structure of the yeast nicotinamidase Pnc1p.
Hu, Gang; Taylor, Alexander B; McAlister-Henn, Lee; Hart, P John
2007-05-01
The yeast nicotinamidase Pnc1p acts in transcriptional silencing by reducing levels of nicotinamide, an inhibitor of the histone deacetylase Sir2p. The Pnc1p structure was determined at 2.9A resolution using MAD and MIRAS phasing methods after inadvertent crystallization during the pursuit of the structure of histidine-tagged yeast isocitrate dehydrogenase (IDH). Pnc1p displays a cluster of surface histidine residues likely responsible for its co-fractionation with IDH from Ni(2+)-coupled chromatography resins. Researchers expressing histidine-tagged proteins in yeast should be aware of the propensity of Pnc1p to crystallize, even when overwhelmed in concentration by the protein of interest. The protein assembles into extended helical arrays interwoven to form an unusually robust, yet porous superstructure. Comparison of the Pnc1p structure with those of three homologous bacterial proteins reveals a common core fold punctuated by amino acid insertions unique to each protein. These insertions mediate the self-interactions that define the distinct higher order oligomeric states attained by these molecules. Pnc1p also acts on pyrazinamide, a substrate analog converted by the nicotinamidase from Mycobacterium tuberculosis into a product toxic to that organism. However, we find no evidence for detrimental effects of the drug on yeast cell growth.
de Vries, K.J.; Buchmueller, O.; Cavanaugh, R.; Citron, M.; De Roeck, A.; Dolan, M.J.; Ellis, J.R.; Flächer, H.; Heinemeyer, S.; Isidori, G.; Malik, S.; Marrouche, J.; Martinez Santos, D.; Olive, K.A.; Sakurai, K.; Weiglein, G.
2015-01-01
We present a frequentist analysis of the parameter space of the pMSSM10, in which the following 10 soft SUSY-breaking parameters are specified independently at the mean scalar top mass scale Msusy = Sqrt[M_stop1 M_stop2]: the gaugino masses M_{1,2,3}, the 1st-and 2nd-generation squark masses M_squ1 = M_squ2, the third-generation squark mass M_squ3, a common slepton mass M_slep and a common trilinear mixing parameter A, the Higgs mixing parameter mu, the pseudoscalar Higgs mass M_A and tan beta. We use the MultiNest sampling algorithm with 1.2 x 10^9 points to sample the pMSSM10 parameter space. A dedicated study shows that the sensitivities to strongly-interacting SUSY masses of ATLAS and CMS searches for jets, leptons + MET signals depend only weakly on many of the other pMSSM10 parameters. With the aid of the Atom and Scorpion codes, we also implement the LHC searches for EW-interacting sparticles and light stops, so as to confront the pMSSM10 parameter space with all relevant SUSY searches. In addition, ou...
International Nuclear Information System (INIS)
Hafez, N.H.; Tahoun, N.S.
2011-01-01
The differentiation of benign mesothelial cells from malignant tumor cells, primary, or metastatic, in serous effusions based on cytomorphologic features alone can be problematic. Purpose: This study was conducted to evaluate the utility of p53 and ki67 imrminocytochemical markers in differentiating benign from malignant tumor cells in serous effusions. Patients and methods: Archival Papanicolaou-stained smears of 91 pleura and peritoneal effusions were retrieved from Cytology Unit, Pathology Department, NCI, Cairo University between 2008 and 2010. Forty-one cases were positive for malignant cells and 50 cases were benign based on cytomorphologic features. Cases having doubt were excluded from the study. The slides were de stained and subjected to immunocytochemical staining for p53 and ki67. Histologic sections of colonic carcinoma and tonsillar tissue were used as positive control for p53 and ki67, respectively. Smears having > 5% positively stained nuclei for p53 were taken as positive and labeling index 10% of ki67 was considered positive. Frequencies of the individual immunocytochemical stains; p53 and ki67, in benign and malignant effusion as well as the combination of both stains were calculated. Results: p53 immunostaining showed nuclear positivity in 31 out of 41 malignant effusions (75.6%) and in 3 out of 50 benign effusions (6%), p < 0.005. p53 had 75.6% sensitivity, 94% specificity, 91.2% PPV, and 82.5% NPV. ki67 immunostaining was positive in 30 out of 41 malignant effusions (73.2%) and in 17 out of 50 benign effusions (34%), p < 0.05. ki67 had 73.2% sensitivity, 66% specificity, 63.8% PPV, and 75% NPV. Cases were then analyzed for combined immuno profile of p3 and ki67. Among the 24 cases that coexpressed both antigens, 22 cases (91.7%) were malignant. Thirty two out of 34 cases (94.1%) that showed negative results for both antigens were benign. For the cases that showed p53 immunostaining only, 9 out of 10 cases (90%) were malignant. Fifteen out of
Singlet ground-state fluctuations in praseodymium observed by muon spin relaxation in PrP and PrP0.9
International Nuclear Information System (INIS)
Noakes, D R; Waeppling, R; Kalvius, G M; Jr, M F White; Stronach, C E
2005-01-01
Muon spin relaxation (μSR) in the singlet ground-state compounds PrP and PrP 0.9 reveals the unusual situation of a Lorentzian local field distribution with fast-fluctuation-limit strong-collision dynamics, a case that does not show motional narrowing. Contrary to publications by others, where PrP 0.9 was asserted to have vacancy-induced spin-glass freezing, no spin-glass freezing is seen in PrP 0.9 or PrP down to ≤100mK. This was confirmed by magnetization measurements on these same samples. In both compounds, the muon spin relaxation rate does increase as temperature decreases, demonstrating increasing strength of the paramagnetic response. A Monte Carlo model of fluctuations of Pr ions out of their crystalline-electric-field singlet ground states into their magnetic excited states (and back down again) produces the strong-collision-dynamic Lorentzian relaxation functions observed at each individual temperature but not the observed temperature dependence. This model contains no exchange interaction, and so predicts decreasing paramagnetic response as the temperature decreases, contrary to the temperature dependence observed. Comparison of the simulations to the data suggests that the exchange interaction is causing the system to approach magnetic freezing (by mode softening), but fails to complete the process
International Nuclear Information System (INIS)
Nieves-Marrero, Carlos A.; Ruiz-Martínez, Carlos R.; Estremera-Andújar, Rafael A.; González-Ramírez, Luis A.; López-Garriga, Juan; Gavira, José A.
2010-01-01
oxyHbII crystals have been grown at pH 4, 5, 8 and 9 by capillary counterdiffusion technique by a two-step protocol: (i) mini screen (searching step) and (ii) pH screen (optimization step). Lucina pectinata haemoglobin II (HbII) transports oxygen in the presence of H 2 S to the symbiotic system in this bivalve mollusc. The composition of the haem pocket at the distal site includes TyrB10 and GlnE7, which are very common in other haem proteins. Obtaining crystals of oxyHbII at various pH values is required in order to elucidate the changes in the conformations of TyrB10 and GlnE7 and structural scenarios induced by changes in pH. Here, the growth of crystals of oxyHbII using the capillary counterdiffusion (CCD) technique at various pH values using a two-step protocol is reported. In the first step, a mini-screen was used to validate sodium formate as the best precipitating reagent for the growth of oxyHbII crystals. The second step, a pH screen typically used for optimization, was used to produce crystals in the pH range 4–9. Very well faceted prismatic ruby-red crystals were obtained at all pH values. X-ray data sets were acquired using synchrotron radiation of wavelength 0.886 Å (for the crystals obtained at pH 5) and 0.908 Å (for those obtained at pH 4, 8 and 9) to maximum resolutions of 3.30, 1.95, 1.85 and 2.00 Å for the crystals obtained at pH 4, 5, 8 and 9, respectively. All of the crystals were isomorphous and belonged to space group P4 2 2 1 2
Role of MYH9 and APOL1 in African and non-African populations with lupus nephritis
DEFF Research Database (Denmark)
Lin, C P; Adrianto, I; Lessard, C J
2012-01-01
) and African-Americans (AAs) (N = 407). Multiple peaks of association exceeding a Bonferroni corrected P-value of P ...Systemic lupus erythematosus (SLE) is a complex autoimmune disease characterized by autoantibody production and organ damage. Lupus nephritis (LN) is one of the most severe manifestations of SLE. Multiple studies reported associations between renal diseases and variants in the non-muscle myosin...... heavy chain 9 (MYH9) and the neighboring apolipoprotein L 1 (APOL1) genes. We evaluated 167 variants spanning MYH9 for association with LN in a multiethnic sample. The two previously identified risk variants in APOL1 were also tested for association with LN in European-Americans (EAs) (N = 579...
Duerinckx, Sarah; Meuwissen, Marije; Perazzolo, Camille; Desmyter, Laurence; Pirson, Isabelle; Abramowicz, Marc
2018-04-24
Autosomal recessive intellectual disability (ARID) is vastly heterogeneous. Truncating mutations of TRAPPC9 were reported in 8 ARID families. Autosomal recessive primary microcephaly (MCPH) represents another subgroup of ARID, itself very heterogeneous, where the size of the brain is very small since birth. MCPH1 plays a role at the centrosome via a BRCT1 domain, and in DNA Damage Repair (DDR) via BRCT2 and BRCT3, and it is not clear which of these two mechanisms causes MCPH in man. We studied the phenotype and sequenced the exome in two siblings with MCPH and their unaffected sister. Homozygous mutations of TRAPPC9 (p.Leu178Pro) and of MCPH1 (p.Arg741X) were found in both affected siblings. Brain MRI showed anomalies previously associated with TRAPPC9 defects, supporting the implication of TRAPPC9 in the phenotype. Importantly, the asymptomatic sister with normal head size was homozygous for the MCPH1 truncating mutation and heterozygous for the TRAPPC9 mutation. The affected siblings represent the first ARID cases with a TRAPPC9 missense mutation and with microcephaly of prenatal onset of. Furthermore, their unaffected sister represents strong evidence that the lack of MCPH1 BRCT3 domain does not cause MCPH in man, supporting a bifunctional model of MCPH1 where the centrosomal function is involved in brain volumic development and not the DDR function. © 2018 The Authors. Molecular Genetics & Genomic Medicine published by Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
Shibata, Nobuyuki; Kagiyama, Megumi; Nakagawa, Masahiro; Hirano, Yoshinori; Hakoshima, Toshio
2010-01-01
Crystals of the Arabidopsis abscisic acid receptors PYL9/RCAR1, PYL5/RCAR8 and PYR1/RCAR11 have been obtained. Abscisic acid (ABA) is a plant hormone that plays key regulatory roles in physiological pathways for the adaptation of vegetative tissues to abiotic stresses such as water stress in addition to events pertaining to plant growth and development. The Arabidopsis ABA receptor proteins PYR/PYLs/RCARs form a START family that contains 14 members which are classified into three subfamilies (I–III). Here, purification, crystallization and X-ray data collection are reported for a member of each of the subfamilies, PYL9/RCAR1 from subfamily I, PYL5/RCAR8 from subfamily II and PYR1/RCAR11 from subfamily III, in the presence of (+)-abscisic acid. The three proteins crystallize in space groups P3 1 21/P3 2 21, P2 and P1, respectively. X-ray intensity data were collected to 1.9–2.6 Å resolution
Phadungsil, Wansika; Smooker, Peter M; Vichasri-Grams, Suksiri; Grams, Rudi
2016-01-01
Even at the present age of whole-organism analysis, e.g., genomics, transcriptomics, and proteomics, the biological roles of many proteins remain unresolved. Classified among the proteins of unknown function is a family of proteins harboring repeats of the DM9 domain, a 60-75 amino acids motif first described in a small number of Drosophila melanogaster proteins. Proteins may carry two or more DM9 domains either in combination with other domains or as their sole constituent. Here we have characterized a 16.8 kDa Fasciola gigantica protein comprising two tandem repeated DM9 domains (FgDM9-1). The protein was located in the parenchyma of the immature and mature parasite and consequently it was not detected in the ES product of the parasite but only in the whole worm extract. Interestingly, extraction with SDS yielded a substantially higher amount of the protein suggesting association with insoluble cell components. In Sf9 insect cells a heterologously expressed EGFP-FgDM9-1 chimera showed cell-wide distribution but relocated to vesicle-like structures in the cytoplasm after stimulating cellular stress by bacteria, heat shock or chloroquine. These structures did not colocalize with the markers of endocytosis/phagocytosis ubiquitin, RAB7, GABARAP. The same behavior was noted for Aedes aegypti PRS1, a homologous mosquito DM9 protein as a positive control while EGFP did not exhibit such relocation in the insect cells. Cross-linking experiments on soluble recombinant FgDM9-1 indicated that the protein can undergo specific oligomerization. It is speculated that proteins carrying the DM9 domain have a role in vesicular transport in flatworms and insects. Copyright © 2016 Elsevier B.V. All rights reserved.
Lifescience Database Archive (English)
Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...
Wang, Xinbo
2015-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Yodmeeklin, Arpaporn; Khamrin, Pattara; Chuchaona, Watchaporn; Kumthip, Kattareeya; Kongkaew, Aphisek; Vachirachewin, Ratchaya; Okitsu, Shoko; Ushijima, Hiroshi; Maneekarn, Niwat
2017-01-01
Whole genomes of G9P[19] human (RVA/Human-wt/THA/CMH-S070-13/2013/G9P[19]) and porcine (RVA/Pig-wt/THA/CMP-015-12/2012/G9P[19]) rotaviruses concurrently detected in the same geographical area in northern Thailand were sequenced and analyzed for their genetic relationships using bioinformatic tools. The complete genome sequence of human rotavirus RVA/Human-wt/THA/CMH-S070-13/2013/G9P[19] was most closely related to those of porcine rotavirus RVA/Pig-wt/THA/CMP-015-12/2012/G9P[19] and to those of porcine-like human and porcine rotaviruses reference strains than to those of human rotavirus reference strains. The genotype constellation of G9P[19] detected in human and piglet were identical and displayed as the G9-P[19]-I5-R1-C1-M1-A8-N1-T1-E1-H1 genotypes with the nucleotide sequence identities of VP7, VP4, VP6, VP1, VP2, VP3, NSP1, NSP2, NSP3, NSP4, and NSP5 at 99.0%, 99.5%, 93.2%, 97.7%, 97.7%, 85.6%, 89.5%, 93.2%, 92.9%, 94.0%, and 98.1%, respectively. The findings indicate that human rotavirus strain RVA/Human-wt/THA/CMH-S070-13/2013/G9P[19] containing the genome segments of porcine genetic backbone is most likely a human rotavirus of porcine origin. Our data provide an evidence of interspecies transmission and whole-genome transmission of nonreassorted G9P[19] porcine RVA to human occurring in nature in northern Thailand. Copyright © 2016. Published by Elsevier B.V.
Arithmetically Cohen-Macaulay sets of points in P^1 x P^1
Guardo, Elena
2015-01-01
This brief presents a solution to the interpolation problem for arithmetically Cohen-Macaulay (ACM) sets of points in the multiprojective space P^1 x P^1. It collects the various current threads in the literature on this topic with the aim of providing a self-contained, unified introduction while also advancing some new ideas. The relevant constructions related to multiprojective spaces are reviewed first, followed by the basic properties of points in P^1 x P^1, the bigraded Hilbert function, and ACM sets of points. The authors then show how, using a combinatorial description of ACM points in P^1 x P^1, the bigraded Hilbert function can be computed and, as a result, solve the interpolation problem. In subsequent chapters, they consider fat points and double points in P^1 x P^1 and demonstrate how to use their results to answer questions and problems of interest in commutative algebra. Throughout the book, chapters end with a brief historical overview, citations of related results, and, where relevan...
The 3d8-(3d74p + 3p53d9) transitions in Br X: A striking case of configuration interaction
International Nuclear Information System (INIS)
Kleef, T.A.M. van; Uylings, P.H.M.; Ryabtsev, A.N.; Podobedova, L.I.; Joshi, Y.N.
1988-01-01
The spectrum of nine times ionized bromine (Br X) was photographed in the 90-120 A wavelength region on a variety of grazing incidence spectrographs using an open spark and a triggered spark as light sources. The analysis of the 3d 8 -(3d 7 4p + 3p 5 3d 9 ) transitions has resulted in establishing all 9 levels of the 3d 8 configuration, all 12 levels of the 3p 5 3d 9 configuration and 99 out of 110 levels of the 3d 7 4p configuration. The excitation probability of the 3p inner-shell electron increases with nuclear charge and in Br X is comparable with the excitation probability of the optical electrons resulting in a very strong configuration interaction between the 3p 5 3d 9 and 3d 7 4p configurations. Parametric calculations treating these configurations as one super configuration support the analysis. Two hundred and thirty two lines have been classified in this spectrum. (orig.)
/sup 9/Be(p,n)/sup 9/B reaction with polarized protons from 2. 4 to 2. 9 MeV
Energy Technology Data Exchange (ETDEWEB)
Rohrer, U [Basel Univ. (Switzerland); Brown, L [Carnegie Institution of Washington, D.C. (USA). Dept. of Terrestrial Magnetism
1976-04-19
A polarized beam was used to measure angular distributions of the proton analyzing power of the /sup 9/Be(p,n)/sup 9/B reaction at six energies from 2.4 to 2.9 MeV. The data were measured typically to an accuracy of 0.02 with a target 23 keV thick at 2.5 MeV bombarding energy. The analyzing power can be fitted with three associated Legendre polynomials, the coefficients of which show considerable variation in the vicinity of the pair of degenerate states at 2.56 MeV. The coefficients of the odd polynomials are not zero over the energy range of these states, indicating that they are of opposite parity. Comparison of these analyzing power measurements with previous data for the neutron polarization induced with unpolarized protons shows near equality at all energies, as expected from Conzett's theorem.
International Nuclear Information System (INIS)
Jia Cuiying
2008-01-01
Objective: To assess the clinical value of determination of serum matrix metallo-proteinase-9 (MMP 9 ) and type III pro-collagen peptide (PIIIP) levels in patients with pulmonary interstitial fibrosis. Methods: Serum MMP 9 (with ELISA) and PIIIP(with RIA) levels were determined in 46 patients with pulmonary interstitial fibrosis and 30 controls. Results: Serum MMP 9 and PIIIP levels in patients with pulmonary interstitial fibrosis were significantly higher than those in controls (P 9 and PIIIP might be used as clinical diagnostic markers for pulmonary interstitial fibrosis. (authors)
G protein-coupled receptor 91 signaling in diabetic retinopathy and hypoxic retinal diseases.
Hu, Jianyan; Li, Tingting; Du, Xinhua; Wu, Qiang; Le, Yun-Zheng
2017-10-01
G protein-coupled receptor 91 (GPR91) is a succinate-specific receptor and activation of GPR91 could initiate a complex signal transduction cascade and upregulate inflammatory and pro-angiogenic cytokines. In the retina, GPR91 is predominately expressed in ganglion cells, a major cellular entity involved in the pathogenesis of diabetic retinopathy (DR) and other hypoxic retinal diseases. During the development of DR and retinopathy of prematurity (ROP), chronic hypoxia causes an increase in the levels of local succinate. Succinate-mediated GPR91 activation upregulates vascular endothelial growth factor (VEGF) through ERK1/2-C/EBP β (c-Fos) and/or ERK1/2-COX-2/PGE2 signaling pathways, which in turn, leads to the breakdown of blood-retina barriers in these disorders. In this review, we will have a brief introduction of GPR91 and its biological functions and a more detailed discussion about the role and mechanisms of GPR91 in DR and ROP. A better understanding of GPR91 regulation may be of great significance in identifying new biomarkers and drug targets for the prediction and treatment of DR, ROP, and hypoxic retinal diseases. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Asari, E.; Souda, R.
2000-01-01
The surface structure of TiO 2 (1 1 0)-p(1x1), p(1x2) and p(1x3) were studied using impact collision ion scattering spectroscopy (ICISS). We found that (i) the height of bridging oxygen for the p(1x1) is comparative to that of bulk structure, (ii) the p(1x2) surface has the added Ti 2 O 3 unit rows proposed by Onishi et al. and also the oxygen atoms rows between Ti 2 O 3 unit rows and (iii) the p(1x3) surface is constructed with the same added Ti 2 O 3 unit rows as that in the p(1x2) surface, but the bridging oxygen rows exist between the Ti 2 O 3 unit rows
Ma, Jie; Li, Haiyan; Chi, Liping; Chen, Hongkun; Chen, Changzhao
2017-12-01
Persulfate (peroxydisulfate, S 2 O 8 2- ) is the newest oxidant used for the in situ chemical oxidation (ISCO) remediation of soil and groundwater. The present study investigated impacts of solution pH, temperature, and persulfate concentration on the reaction rate constant (k 1 ), activation energy (E a ), and reaction order of the heat-activated persulfate process. Phenol was chosen as the model organic contaminant. As temperature increased from 30 °C to 70 °C, k 1 exhibited a significant increase from 0.003 h -1 ∼0.962 h -1 (pH 1.3-13.9) to 1.184 h -1 ∼9.91 h -1 (pH 1.3-13.9), which corroborated with the activation of persulfate using heat. As pH increased from 1.3 to 13.9, k 1 exhibited a 4.3-fold increase at 70 °C and a 320-fold increase at 30 °C, thereby suggesting that: 1) the phenol oxidation rate increased under alkaline conditions, and 2) the enhancement of reaction rate due to alkaline activation was more pronounced at a lower temperature. Increasing pH significantly reduced E a from 139.7 ± 1.3 kJ/mol at pH 1.3 to 52.0 ± 3.3 kJ/mol at pH 13.9. In contrast to changing pH, increasing persulfate concentration from 20 to 320 mM significantly increased k 1 but did not affect E a . Changes in E a suggest that persulfate oxidation of phenol experienced different reaction pathways or elementary reaction sequences as the pH changed from 1.3 to 13.9. In addition, the k 1 and E a data also suggest that a minimal pH threshold of ∼11 was required for the effective alkaline activation of persulfate. Copyright © 2017 Elsevier Ltd. All rights reserved.
Jamison, Sandra; Campbell, Bruce
The ninth grade unit of the FICSS series (Focus on Inner City Social Studies -- see SO 008 271) studies the economic and political realities of the inner city. This document, the first unit of the 9th grade section, deals with the ecological crises involving pollution and its causes. Specific problems include air pollution, pesticides, herbicides,…
Deraos, George; Rodi, Maria; Kalbacher, Hubert; Chatzantoni, Kokona; Karagiannis, Fotios; Synodinos, Loukas; Plotas, Panayiotis; Papalois, Apostolos; Dimisianos, Nikolaos; Papathanasopoulos, Panagiotis; Gatos, Dimitrios; Tselios, Theodore; Apostolopoulos, Vasso; Mouzaki, Athanasia; Matsoukas, John
2015-08-28
Multiple sclerosis (MS) is an inflammatory, demyelinating disease of the central nervous system, and it has been established that autoreactive T helper (Th) cells play a crucial role in its pathogenesis. Myelin basic protein (MBP) epitopes are major autoantigens in MS, and the sequence MBP87-99 is an immunodominant epitope. We have previously reported that MBP87-99 peptides with modifications at principal T-cell receptor (TCR) contact sites suppressed the induction of EAE symptoms in rats and SJL/J mice, diverted the immune response from Th1 to Th2 and generated antibodies that did not cross react with the native MBP protein. In this study, the linear and cyclic analogs of the MBP87-99 epitope, namely linear (Ala91,Ala96)MBP87-99 (P2) and cyclo(87-99)(Ala91,Ala96)MBP87-99 (P3), were evaluated for their binding to HLA-DR4, stability to lysosomal enzymes, their effect on cytokine secretion by peripheral blood mononuclear cells (PBMC) derived from MS patients or healthy subjects (controls), and their effect in rat EAE. P1 peptide (wild-type, MBP87-99) was used as control. P2 and P3 did not alter significantly the cytokine secretion by control PBMC, in contrast to P1 that induced moderate IL-10 production. In MS PBMC, P2 and P3 induced the production of IL-2 and IFN-γ, with a simultaneous decrease of IL-10, whereas P1 caused a reduction of IL-10 secretion only. The cellular response to P3 indicated that cyclization did not affect the critical TCR contact sites in MS PBMC. Interestingly, the cyclic P3 analog was found to be a stronger binder to HLA-DR4 compared to linear P2. Moreover, cyclic P3 was more stable to proteolysis compared to linear P2. Finally, both P2 and P3 suppressed EAE induced by an encephalitogenic guinea pig MBP74-85 epitope in Lewis rats whereas P1 failed to do so. In conclusion, cyclization of myelin altered peptide ligand (Ala91,Ala96)MBP87-99 improved binding affinity to HLA-DR4, resistance to proteolysis and antigen-specific immunomodulation
Rdiation protection. Progress report 1990-91
International Nuclear Information System (INIS)
1993-01-01
The progress report of the 1990-91 radiation protection programme outlines the research work carried out during the whole contractual period under all contracts between the Commission of the European Communities and research groups in the Member States. More than 400 scientists collaborated on this program. Objectives and results of more than 130 projects are reported. They are grouped into three sectors: human exposure to radiation and radioactivity; consequences of radiation exposure to man, their assessment, prevention and treatment; risks and management of radiation protection. 134 reports were abstracted and indexed individually for the INIS database. (R.P.)
Toxicity of inhaled 91YCl3 in beagle dogs. X
International Nuclear Information System (INIS)
Muggenburg, B.A.; Benjamin, S.A.; Boecker, B.B.; McClellan, R.O.
1976-01-01
Studies on the metabolism, dosimetry, and effects of inhaled 91 YCl 3 in Beagle dogs are being continued to provide information that will aid in assessing the biological consequences of nuclear accidents in which 91 Y or other radionuclides that produce a similar radiation dose pattern may be released. Forty-two dogs with 91 Y initial body burdens from 64 to 1300 μCi/kg body weight were placed in four groups with mean lung burdens of 310, 180, 75 and 40 μCi/kg body weight. These dogs and 12 control dogs are being maintained for lifetime observation. An additional group of four dogs with a mean initial 91 Y body burden of 180 μCi/kg body weight were placed in a sacrifice study. Eleven dogs within the highest activity level groups died or were euthanized at 12 to 33 days after inhalation of 91 Y with changes related to severe bone marrow damage and associated pancytopenia. Two dogs died approximately 1 yr after 91 Y inhalation with convulsive seizures that were presumed to be unrelated to the 91 Y exposure. Five 91 Y-exposed dogs died or were euthanized due to neoplasms 2000 to 3341 days after exposure. Three dogs had nasal squamous cell carcinomas, one had a bronchioloalveolar carcinoma and another, a mast cell sarcoma. One dog died of renal failure 2660 days after exposure and one control dog died of empyema. Serial observations are continuing on all surviving dogs
Research of TGF-beta1 Inducing Lung Adencarcinoma PC9 Cells to Mesenchymal Cells Transition
Directory of Open Access Journals (Sweden)
Xiaofeng CHEN
2010-01-01
Full Text Available Background and objective It has been proven that epithelial-mesenchymal transition (EMT not only correlated with embryonic development but also could promote tumor invasion and metastasis. Transforming growth factor beta-1 (TGF-β1 has been identified as the main inducer of tumor EMT. The aim of this study was to investigate the effects of TGF-β1 on EMT and PI3K/AKT signaling pathway in lung adencarcinoma PC9 cells. Methods Cultured PC9 cells were treated with different concentrations of TGF-β1 for 48 h. The morphological changes were observed under phase-contrast microscopy; EMT relative marker protein changes were assessed by Western blot and immunoflurescence staining. In addition, the expression of AKT and P-AKT were also measured by Western blot. Results The data showed that TGF-β1 could induce PC9 morphological alteration from epithelial to mesenchymal and upregulate the expression of mesenchymal maker protein Fibronectin. Obviously, the expression of P-AKT was downregulated by TGF-β1 treatment for 48 h. Conclusion TGF-β1 might induce EMT of PC9 cells , accompanied by the changes of PI3K/AKT signaling pathway.
Harijith, Anantha; Pendyala, Srikanth; Ebenezer, David L; Ha, Alison W; Fu, Panfeng; Wang, Yue-Ting; Ma, Ke; Toth, Peter T; Berdyshev, Evgeny V; Kanteti, Prasad; Natarajan, Viswanathan
2016-08-01
Hyperoxia-induced lung injury adversely affects ICU patients and neonates on ventilator assisted breathing. The underlying culprit appears to be reactive oxygen species (ROS)-induced lung damage. The major contributor of hyperoxia-induced ROS is activation of the multiprotein enzyme complex NADPH oxidase. Sphingosine-1-phosphate (S1P) signaling is known to be involved in hyperoxia-mediated ROS generation; however, the mechanism(s) of S1P-induced NADPH oxidase activation is unclear. Here, we investigated various steps in the S1P signaling pathway mediating ROS production in response to hyperoxia in lung endothelium. Of the two closely related sphingosine kinases (SphKs)1 and 2, which synthesize S1P from sphingosine, only Sphk1(-/-) mice conferred protection against hyperoxia-induced lung injury. S1P is metabolized predominantly by S1P lyase and partial deletion of Sgpl1 (Sgpl1(+/-)) in mice accentuated lung injury. Hyperoxia stimulated S1P accumulation in human lung microvascular endothelial cells (HLMVECs), and downregulation of S1P transporter spinster homolog 2 (Spns2) or S1P receptors S1P1&2, but not S1P3, using specific siRNA attenuated hyperoxia-induced p47(phox) translocation to cell periphery and ROS generation in HLMVECs. These results suggest a role for Spns2 and S1P1&2 in hyperoxia-mediated ROS generation. In addition, p47(phox) (phox:phagocyte oxidase) activation and ROS generation was also reduced by PF543, a specific SphK1 inhibitor in HLMVECs. Our data indicate a novel role for Spns2 and S1P1&2 in the activation of p47(phox) and production of ROS involved in hyperoxia-mediated lung injury in neonatal and adult mice. Copyright © 2016 the American Physiological Society.
Lin, Hsiu-Fen; Tsai, Pei-Chien; Liao, Yi-Chu; Lin, Tsung-Hsien; Tai, Chih-Ta; Juo, Suh-Hang Hank; Lin, Ruey-Tay
2011-08-01
Genetic variants on chromosome 9p21 confer a robust risk for coronary artery disease but inconsistent risk for stroke. This study investigated whether such genetic variants exert differential risks on myocardial infarction (MI) and ischemic stroke in a Taiwanese population. The study recruited 425 MI patients, 687 patients with ischemic stroke, and 1377 healthy controls. Four key single nucleotide polymorphisms (SNPs) on chromosome 9p21 were genotyped. Multivariate permutation analyses demonstrated that the risk T allele of rs1333040 and G allele of rs2383207 were associated with MI (P = 0.045 and 0.002, respectively). Subjects with the rs2383207 GG genotype had a 1.85-fold (P = 0.021) risk for MI when compared with the subjects with the AA genotype. Further analysis showed that significant results only exist in the young MI group (stroke (adjusted P ranged from 0.097 to 0.540). Haplotype analysis showed global P values of 0.032 for MI and 0.290 for stroke. Genetic variations in the 9p21 region are associated with MI but not with stroke in a Taiwanese population. Early-onset MI was more likely to carry the risk genotypes of 9p21 SNPs.
Familial partial duplication (1)(p21p31)
Energy Technology Data Exchange (ETDEWEB)
Hoechstetter, L.; Soukup, S.; Schorry, E.K. [Children`s Hospital Research Foundation, Cincinnati, OH (United States)
1995-11-20
A partial duplication (1)(p21p31), resulting from a maternal direct insertion (13,1) (q22p21p31), was found in a 30-year-old woman with mental retardation, cleft palate, and multiple minor anomalies. Two other affected and deceased relatives were presumed to have the same chromosome imbalance. Duplication 1p cases are reviewed. 8 refs., 5 figs., 1 tab.
Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk
Broderick, Peter; Chen, Bowang; Johnson, David C; Försti, Asta; Vijayakrishnan, Jayaram; Migliorini, Gabriele; Dobbins, Sara E; Holroyd, Amy; Hose, Dirk; Walker, Brian A; Davies, Faith E; Gregory, Walter A; Jackson, Graham H; Irving, Julie A; Pratt, Guy; Fegan, Chris; Fenton, James AL; Neben, Kai; Hoffmann, Per; Nöthen, Markus M; Mühleisen, Thomas W; Eisele, Lewin; Ross, Fiona M; Straka, Christian; Einsele, Hermann; Langer, Christian; Dörner, Elisabeth; Allan, James M; Jauch, Anna; Morgan, Gareth J; Hemminki, Kari; Houlston, Richard S; Goldschmidt, Hartmut
2016-01-01
To identify variants for multiple myeloma risk, we conducted a genome-wide association study with validation in additional series totaling 4,692 cases and 10,990 controls. We identified four risk loci at 3q26.2 (rs10936599, P=8.70x10-14), 6p21.33 (rs2285803, PSORS1C2; P= 9.67x10-11), 17p11.2 (rs4273077, TNFRSF13B; P=7.67x10-9) and 22q13.1 (rs877529, CBX7; P=7.63x10-16). These data provide further evidence for genetic susceptibility to this B-cell hematological malignancy and insight into the biological basis of predisposition. PMID:23955597
40 CFR 91.408 - Pre-test procedures.
2010-07-01
....408 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... accordance with § 91.117. (b) Engine pre-test preparation. (1) Drain and charge the fuel tank(s) with the..., including the sample probe, using mode 1 from Table 2 in appendix A of this subpart. The emission sampling...
Basu, Debapriya; Huq, Afroza; Iqbal, Jahangir; Hussain, M Mahmood; Jiang, Xian-Cheng; Jin, Weijun
2015-01-01
Site-1 protease (S1P) is the key enzyme required for activation of the sterol regulatory element binding proteins (SREBPs) that govern lipid synthesis. While S1P has been speculated to influence plasma apoB-containing lipoprotein (Blp) metabolism, there has been little investigative work. LDL receptor (LDLR) is the major receptor for clearing plasma LDL cholesterol (LDL-c). Proprotein convertase subtilisin kexin type 9 (PCSK9) modulates LDL-c through post-translational degradation of the LDLR. A hepatic-specific knockdown (KD) of S1P was achieved using floxed S1P mouse models (S1P(f/f) and LDLR(-/-)S1P(f/f)) and hepatic expression of Cre recombinase. Lipids were measured in total plasma and size fractionated plasma using colorimetric assays. Realtime polymerase chain reaction, western blotting and ELISA were used to determine hepatic expression of key genes/protein. Plasmid mediated overexpression and siRNA mediated knockdown of genes were performed in mouse primary hepatocytes to determine the mechanistic basis of PCSK9 gene regulation. A hepatic-specific KD of S1P resulted in a 45 % and 38 % reduction in plasma total cholesterol and triglyceride levels, respectively. Hepatic S1P KD had a minimal effect on plasma Blp cholesterol (Blp-c) in S1P(f/f) mice, despite significantly reducing VLDL secretion. Notably, hepatic S1P KD decreased the LDL receptor (LDLR) mRNA expression by 50 %. However, the reduction in LDLR protein levels was less than that of mRNA expression, especially under fed conditions. Further assessment of hepatic S1P deficiency revealed that it increased LDLR protein stability in vivo. Mechanistically, hepatic S1P KD was shown to decrease the liver and plasma levels of the protein proprotein convertase subtilisin/kexin type 9 (PCSK9), which degrades LDLR protein. This effect was more prominent in the fed condition and sufficient to account for the discordance in LDLR mRNA and protein levels. Furthermore, hepatic S1P was shown to regulate PCSK9
Directory of Open Access Journals (Sweden)
Juan José Vaquero
2012-07-01
Full Text Available The synthesis of 9,9'-[1,2-ethanediylbis(oxymethylene]bis-2-amino-1,9-dihydro-6H-purin-6-one, a minor impurity of acyclovir, is described. Starting with commercial N-(9-acetyl-6-oxo-1H-purin-2-ylacetamide, the process uses an acid catalysed phase transfer catalysis (PTC process to produce the selective alkylation at the 9 position of the guanine ring.
CA 19-9 in the diagnosis and differential diagnosis of exocrine pancreatic carcinoma
International Nuclear Information System (INIS)
Klapdor, R.; Lehmann, U.; Bahlo, M.; Greten, H.; Ackeren, H. v.; Dallek, M.; Schreiber, W.H.
1983-01-01
CA 19-9 serum concentrations were determined in 56 controls and 66 patients with various pancreatic diseases using a commercially available radioimmunoassay. 56 controls showed mean serum concentrations of 7.3 +- 9.6 U/ml (anti x +- 2 SD) range 0-24, median 6), n = 21 patients suffering from chronic pancreatitis mean values of 16 +- 24 U/ml (anti x +- 2 SD) (range 4.9-42, median 13). The majority of the patients with exocrine pancreatic carcinoma demonstrated significantly elevated values: in 91% and 82% respectively, CA 19-9 levels were elevated above the upper limit of 95% of the controls (> 15 U/ml) and of the patients with chronic pancreatitis (> 37 U/ml) (P [de
Benis, E. P.; Zouros, T. J. M.
2016-12-01
New results are presented on the ratio {R}m={σ }{T2p}( {}4P)/{σ }{T2p}({}2P) concerning the production cross sections of Li-like 1s2s2p quartet and doublet P states formed in energetic ion-atom collisions by single 2p electron transfer to the metastable 1s2s {}3S component of the He-like ion beam. Spin statistics predict a value of R m = 2 independent of the collision system in disagreement with most reported measurements of {R}m≃ 1{--}9. A new experimental approach is presented for the evaluation of R m having some practical advantages over earlier approaches. It also allows for the determination of the separate contributions of ground- and metastable-state beam components to the measured spectra. Applying our technique to zero-degree Auger projectile spectra from 4.5 MeV {{{B}}}3+ (Benis et al 2002 Phys. Rev. A 65 064701) and 25.3 MeV {{{F}}}7+ (Zamkov et al 2002 Phys. Rev. A 65 062706) mixed state (1{s}2 {}1S,1s2s {}3S) He-like ion collisions with H2 targets, we report new values of {R}m=3.5+/- 0.4 for boron and {R}m=1.8+/- 0.3 for fluorine. In addition, the ratios of {}2D/{}2P and {{}2P}+/{{}2P}- populations from either the metastable and/or ground state beam component, also relevant to this analysis, are evaluated and compared to previously reported results for carbon collisions on helium (Strohschein et al 2008 Phys. Rev. A 77 022706) including a critical comparison to theory.
Toxicokinetics and biotransformation of p-nitrophenol in red abalone (Haliotis rufescens)
International Nuclear Information System (INIS)
TenBrook, Patti L.; Kendall, Shellie M.; Viant, Mark R.; Tjeerdema, Ronald S.
2003-01-01
Red abalone (Haliotis rufescens) were exposed to 3.6 μM (0.5 ppm) 14 C-labelled p-nitrophenol (PNP) for 24 h, then were allowed to depurate in clean seawater for another 24 h. Absorption, conditional uptake clearance and elimination rate constants were 0.12±0.04 h -1 , 3.2±1.1 ml g -1 h -1 and 0.05±0.02 h -1 , respectively. The sigmoidal shape of the PNP uptake curve suggests a biphasic process. A whole-organism total concentration factor (TCF) of 2.37±0.07 was determined from equilibrium tissue and water concentrations, with the highest concentration of PNP plus metabolites found in gill tissue (11.8±0.2 nmol g -1 , wet weight). Digestive gland, foot muscle and remaining body tissues accumulated 8.8±0.9, 7.7±0.6 and 7.5±0.6 nmol g -1 radiolabelled residues, respectively. Abalone depurated 91.6% of absorbed PNP within 24 h, of which 87.5±3.1% was unmetabolized parent compound, 13.1±3.1% was p-nitrophenylsulfate, 0.32±0.09% was p-nitroanisole, and 0.14±0.07% was p-acetamidophenol
Directory of Open Access Journals (Sweden)
Mauricio Ewens
2012-03-01
Full Text Available Prosopis alba seedlings, that grew at the 45 dS m−1 salinity level in a previous study of growth and survival of Argentine and Peruvian Prosopis, were propagated by rooting cuttings and established in a seed orchard/long term evaluation trial on soils with low salinity (EC 5.1–7.5 dS m−1 but high pH (8.9 to 10.2. A pH gradient occurred in the field with values ranging from pH 9.4 in block 1 to pH 10.3 in block 5. After five years growth, almost all of the clones had a mean height greater than 4 m and one clone was more than 5 m. Ten of the 21 tested clones had significantly greater biomass growth than the three seed propagated check varieties. The broad-sense (i.e., clone mean heritability was estimated to be 0.45 for biomass, 0.53 for diameter and 0.59 for height indicating that strong genetic gains should be possible by selecting and vegetatively propagating the best genotypes. In the block with the highest pH values, two clones that appear to be P. alba × P. ruscifolia hybrids (i.e., P. vinallilo had the greatest biomass. Correlations between growth during the last two months in the high salinity hydroponic greenhouse selection system and growth in the field were significant (R2 = 0.262 and positive, although the relationship was negative for putative P. vinallilo clones (R2 = 0.938. The several fold increase in biomass of some of the clones over the three check varieties, suggests that the greenhouse screen was successful in identifying superior salt tolerant clones. Apparently whether the greenhouse seedlings had lesser (~1 cm to greater (~3 cm height growth was not as important as just having a healthy live apical meristem. The observed salt tolerance of the putative P. vinalillo clones may prove useful as rootstocks for recently described high pod producing P. alba clones.
p38 MAPK and MMP-9 cooperatively regulate mucus overproduction in mice exposed to acrolein fog.
Liu, Dai-Shun; Wang, Tao; Han, Su-Xia; Dong, Jia-Jia; Liao, Zeng-Lin; He, Guang-Ming; Chen, Lei; Chen, Ya-Juan; Xu, Dan; Hou, Yan; Li, Yan-Ping; Wen, Fu-Qiang
2009-09-01
To evaluate the role of p38 mitogen-activated protein kinase (MAPK) on mice airway inflammation, mucus production and the possible cross-talk between p38 MAPK and matrix metalloproteinase-9 (MMP-9) in mucin protein synthesis. Mice were exposed to 4.0 ppm of acrolein for 21 days with daily intraperitoneal injection of SB203580, a specific inhibitor of p38 MAPK. In control mice, sterile saline was administered instead. On days 7 and 21, mice were sacrificed to examine airway inflammation and mucus production by BALF cell counts, cytokine ELISA, and H&E and AB-PAS staining. The mRNA and protein levels of Muc5ac, p38 MAPK and MMP-9 in the lung were determined by RT-PCR, immunohistochemistry and Western blotting analysis. MMP-9 activity was measured by gelatin zymography. Both the numbers of inflammatory cells and mucus-secreting goblet cells were significantly increased in the airways of mice exposed to acrolein as compared to the control mice. Acrolein-increased phosphorylation of p38 MAPK was significantly reduced by SB203580. The airway inflammation and goblet cell hyperplasia after acrolein challenge were also attenuated by SB203580 administration. Moreover, SB203580 treatment decreased the acrolein-induced increase of Muc5ac and MMP-9 expression and MMP-9 activity in airway epithelium. The results indicate an important role of p38 MAPK in acrolein-induced airway inflammation and mucus hypersecretion in mice. The cooperation of p38 and MMP-9 may contribute to the mucin overproduction after inflammatory challenge.
Multi-pass 1.9 um Tm:YLF slab laser pump source
CSIR Research Space (South Africa)
Strauss
2010-09-01
Full Text Available stream_source_info Strauss1_2010.pdf.txt stream_content_type text/plain stream_size 4116 Content-Encoding ISO-8859-1 stream_name Strauss1_2010.pdf.txt Content-Type text/plain; charset=ISO-8859-1 Multi-Pass 1.9 ?m Tm...:YLF Slab Laser Pump Source H.J. Strauss1, S.C. Burd2, W. Koen1, M.J.D. Esser1, C. Jacobs1, O.J.P. Collett1, K. Nyangaza1, D. Preussler1 and C. Bollig1 1 Laser Centre, Council for Scientific and Industrial Research, PO Box 395, Pretoria, 0001, South...
International Nuclear Information System (INIS)
Kim, Jaehee; Jeon, Soonmee; Yang, Yun-Seok; Kim, Jinmi
2004-01-01
The major biochemical activities ascribed to Kem1p/Xrn1p of Saccharomyces cerevisiae are 5'-3' exoribonuclease functioning in RNA turnover and a microtubule-binding protein. Mutational analysis has shown that Kem1p/Xrn1p participates in microtubule-related functions such as nuclear fusion (karyogamy) during mating, chromosome transmission, and spindle pole body duplication. Here, evidence is presented that Kem1p plays a specific role in nuclear fusion by affecting, at the posttranscriptional level, the pheromone induction of the karyogamy-specific transcription factor Kar4p and the expression of Rok1p, a putative RNA helicase. We found that Rok1p itself also affects the pheromone induction of Kar4p and thereby participates in nuclear fusion. Analysis of the active-site mutations, xrn1-D206A or D208A, shows that nuclear fusion as well as the Rok1p synthesis do not require the exoribonuclease activity of Kem1p. Our data provide an important insight into the gene-specific regulatory function mediated by the general RNA-modulating enzymes