WorldWideScience

Sample records for crmovnb 9-1 p91

  1. Microstructural characterization of second phases in X10CrMoVNb9-1 and 12CrMoWCuVNb steels after long steam exposure time at 550 C

    Energy Technology Data Exchange (ETDEWEB)

    Rodak, Kinga; Hernas, Adam [Silesian Univ. of Technology, Inst. of Materials Science, Katowice (Poland); Vodarek, Vlastimil [VSB-Technical Univ. of Ostrava (Czech Republic)

    2015-07-15

    Microstructural changes in high alloy (9-12% Cr) creep resistant martensitic X10CrMoVNb9-1 and 12CrMoW . CuVNb steels after 100 000 h of steam exposure at 550 C have been studied using scanning transmission electron microscopy. Precipitates were identified using electron diffraction patterns and energy dispersive X-ray spectroscopy analysis. After long time exposure, a significant coarsening of M{sub 23}C{sub 6} carbides, and intensive precipitation of the coarse Laves phase were observed. Moreover, in the 12CrMoW . CuVNb steel, a low amount of the modified Z-phase particles was detected. The microstructures of the X10Cr . MoVNb9-1 and 12CrMoWCuVNb steels after 100 000 h of exposure differ in several aspects.

  2. Low temperature friction stir welding of P91 steel

    National Research Council Canada - National Science Library

    Kalvala, Prasad Rao; Akram, Javed; Misra, Mano; Ramachandran, Damodaram; Gabbita, Janaki Ram

    2016-01-01

    ... RPM was well below Ac1 temperature of P91 steel while it was above Ac3 with 1000 RPM. The results suggest that the microstructural degradation in P91 welds can be controlled by low temperature friction stir welding technique.

  3. Low temperature friction stir welding of P91 steel

    Directory of Open Access Journals (Sweden)

    Prasad Rao Kalvala

    2016-08-01

    Full Text Available Bead-on-plate friction stir welds were made on P91 alloy with low and high rotational speeds (100 and 1000 RPM to study their effects on weld microstructural changes and impression creep behavior. Temperatures experienced by the stir zone were recorded at the weld tool tip. Different zones of welds were characterized for their microstructural changes, hardness and creep behavior (by impression creep tests. The results were compared with submerged arc fusion weld. Studies revealed that the stir zone temperature with 100 RPM was well below Ac1 temperature of P91 steel while it was above Ac3 with 1000 RPM. The results suggest that the microstructural degradation in P91 welds can be controlled by low temperature friction stir welding technique.

  4. Weldability investigation steel P 91 by weld thermal cycle simulation

    Directory of Open Access Journals (Sweden)

    M. Dunđer

    2015-07-01

    Full Text Available This paper elaborates results of hardness and impact energy of thermal cycle simulated specimens of high-alloy steel P 91 and their dependence on cooling time from 800 to 500 °C. Results were obtained by measuring hardness HV 1 and by experimental testing of Charpy notched specimens. Metallographic analysis of samples was performed on scanning electronic microscope.

  5. Low temperature friction stir welding of P91 steel

    OpenAIRE

    Kalvala, Prasad Rao; Akram, Javed; Misra, Mano; Ramachandran, Damodaram; Gabbita, Janaki Ram

    2016-01-01

    Bead-on-plate friction stir welds were made on P91 alloy with low and high rotational speeds (100 and 1000 RPM) to study their effects on weld microstructural changes and impression creep behavior. Temperatures experienced by the stir zone were recorded at the weld tool tip. Different zones of welds were characterized for their microstructural changes, hardness and creep behavior (by impression creep tests). The results were compared with submerged arc fusion weld. Studies revealed that the s...

  6. Effect of matrix hardness on the creep properties of a 12CrMoVNb steel

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Y.S.; Yu, J. [Korea Advanced Inst. of Science and Technology, Taejon (Korea, Republic of). Dept. of Materials Science and Engineering

    1999-09-01

    Using a creep-ductile 12CrMoVNb steel, constant-load creep tests were conducted in air at 650 C, and the effects of matrix hardness on the creep properties were investigated. Specimens with a matrix hardness (Rc) of 30, 25, and 20 were prepared using different tempering conditions. The creep behaviors were well described by the power-law creep equation, with the stress exponents of strain rate (n) and rupture time ({chi}) decreasing with matrix hardness. Rupture-time analyses showed that creep rupture occurred by the nucleation of creep cavities on second-phase particles and growth by creep flow of the surrounding matrix. A hardness decrease tends to lower the rupture time and increase the strain rate ({dot {var_epsilon}}), and the effect of hardness was quite distinct at high applied stresses due to the short creep times, but not so at low applied stresses due to elongated creep times. After 10{sup 4} hours, there were almost no effects. The hardness decrease during the creep test was more severe for the specimens with higher hardness and was also more severe in the gage section than in the head section, the latter due to the stress-assisted diffusion in the coarsening of carbides. Microstructural examinations showed that subgrain boundaries grew during creep, and equiaxed carbide particles coarsened during the creep test, the rates of coarsening being greater for specimens with a higher hardness.

  7. Development of a 2 1/4 Cr-Mo-V-Nb steel for heavy duty gas turbine rotor disk. Gas turbine disk yo 2 1/4 Cr-Mo-V-Nb tainetsuko no kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    Tsuji, I.; Kadoya, Y. (Mitsubishi Heavy Industries, Ltd., Tokyo (Japan))

    1991-05-01

    A new low alloy steel for gas turbine rotor disk was menufactured as a trial and examined. A target of new low alloy steel development for disk was to have excellent stress rupture strength without taking account of creep below 400 centigrade, and to have excellent both high temperature strength (yield strength at 400 centigrade higher than 60kgf/mm {sup 2}) and fracture toughness (FATT lower than 40 centigrade) at bore of disk. An effect of chemical composition on mechanical properties and heat treatment characteristics of low allow steel were investigated. Consequently, a 2 {sup 1}/{sub 4} Cr-Mo-V-Nb steel containing low silicon manufactured by vacuum carbon deoxidization (VCD) or electroslag remelting (ESR) process showed the best performance for large size disk. On the basis of the results, the 2 {sup 1}/{sub 4} Cr-Mo-V-Nb steel disk for turbine was produced by commercial base. Tensile, impact, and metallurgical tests were conducted on the disk, and it was confirmed that the disk had excellent yield strength and impact properties at both rim and bore. 14 refs., 12 figs., 4 tabs.

  8. Creep damage development in welded X20 and P91

    Energy Technology Data Exchange (ETDEWEB)

    Brett, Steve; Holmstrom, Stefan; Hald, John; Borg, Ulrik; Aakjaer Jensen, Soeren; Vulpen, Rijk Van; Degnan, Craig; Vinter Dahl, Kristian; Vilhelmsen, Tommy

    2011-03-15

    The Martensitic steel X20CrMoV121 (hereinafter called X20) and the modified 9Cr1Mo steel (hereinafter called P91) have been used for a number of years in high temperature applications since they posses superior creep strength compared to low alloyed steels. Due to the simple fact that very few failures were observed, almost no knowledge as to the evolution of creep damage in welds were available despite long operation times exceeding well over 100.000 hours. It has been suggested that X20 will develop creep damage in a different manner compared to low alloyed steel, i.e damage initiation should be slow followed by accelerated growth. The research work presented in this report included systematic investigations of the first components of X20, which has developed creep during long-term operation. All of the investigated components showed creep damage evolution similar to low alloy steels

  9. IDENTIFICATION OF THERMAL BOUNDARY CONDITIONS AND THERMO-METALLURGICAL BEHAVIOUR OF X10CrMoVNb9-1 STEEL DURING SIMPLE TIG WELDING TESTS

    OpenAIRE

    Roux, Guilhem; Billardon, René

    2006-01-01

    International audience; To validate the thermo-metallurgical models that are used during finite element simulations of multi-pass TIG welding, two simple experiments – called "disk-spot" and "disk-cycle" TIG welding tests- have been designed. A procedure has been developed to identify the thermal boundary conditions that are imposed to the specimen during these experiments. These boundary conditions include the heat source that is equivalent to the TIG torch as well as the heat flux by convec...

  10. Stellite failure on a P91 HP valve - failure investigation and modelling of residual stresses

    DEFF Research Database (Denmark)

    Thorborg, Jesper; Hald, John; Hattel, Jesper Henri

    2006-01-01

    The sequence of the primary welding process and the following secondary processes of machining, and heat treatment has been modelled to predict the residual conditions in a Stellite 6 overlay weld on a P91 steam turbine valve. The different process steps are coupled in order to transfer the resid...

  11. Microstructure and mechanical analysis of W/P91 steel HIP-joint with Ti interlayer

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Ji-chao [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Wang, Wanjing, E-mail: wjwang@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Sun, Zhaoxuan; Wang, Xingli; Wei, Ran [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Xie, Chunyi; Li, Qiang [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Luo, Guang-nan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Hefei Center for Physical Science and Technology, Hefei, 230022 (China); Hefei Science Center of Chinese Academy of Sciences, Hefei, 230027 (China)

    2016-11-15

    Highlights: • W and P91 steel can be joined successfully using the Hot Isostatic Pressing (HIP) method with Ti interlayer. • The experiment was conducted at 760 °C below the P91 steel austenitizing temperature with the pressure 150 MPa for 4 h. • The residual stress concentration is responsible for the fracture of HIP joints under low joining temperature. • Low temperature can reduce the reaction products and improve the mechanical properties of W/Ti/P91 steel joints. - Abstract: W and P91 steel were joined by using the Hot Isostatic Pressing method with Ti interlayer, and the experiments were conducted at 760 °C. The mechanical property, bonding quality and interface microstructure were tested by the Torsion test, Non-Destructive Test, Scanning Electron Microscope and Nano-indentation test. The minimum shear strength of joints was 225 MPa and the failure occurred at the W/Ti interfaces. Metallographic analysis revealed good bonding quality across bonding lines. Almost no reaction products were found in the diffusion region and the Nano-indentation test demonstrated that the solid solution strengthening was caused by inter-diffusion in the diffusion zone. The effect of low joining temperature on reducing reaction products and improving mechanical properties of W/Ti/Steel diffusion bonding were investigated in this paper.

  12. Microstructural investigation of the heat-affected zone of simulated welded joint of P91 steel

    Directory of Open Access Journals (Sweden)

    T. Vuherer

    2013-07-01

    Full Text Available In the process of testing real components exposed to elevated temperature, it is not possible to neglect cracks. The most significant cracks can be induced by welding, which is applied for joining of structural components. Pressure equipment in service is also exposed to high pressure and high stresses. Materials for their manufacturing are designed to resist high stress at elevated temperature, and to meet requirements regarding creep resistance. The objective of this study is to investigate microstructure of different regions of the heat affected zone in T/P91 steels by using thermal simulation instead of welding.

  13. Creep, fatigue and creep-fatigue interactions in modified 9% Chromium - 1% Molybdenum (P91) steels

    Science.gov (United States)

    Kalyanasundaram, Valliappa

    Grade P91 steel, from the class of advanced high-chrome ferritic steels, is one of the preferred materials for many elevated temperature structural components. Creep-fatigue (C-F) interactions, along with oxidation, can accelerate the kinetics of damage accumulation and consequently reduce such components' life. Hence, reliable C-F test data is required for meticulous consideration of C-F interactions and oxidation, which in turn is vital for sound design practices. It is also imperative to develop analytical constitutive models that can simulate and predict material response under various long-term in-service conditions using experimental data from short-term laboratory experiments. Consequently, the major objectives of the proposed research are to characterize the creep, fatigue and C-F behavior of grade P91 steels at 625 C and develop robust constitutive models for simulating/predicting their microstructural response under different loading conditions. This work will utilize experimental data from 16 laboratories worldwide that conducted tests (creep, fatigue and C-F) on grade P91 steel at 625°C in a round-robin (RR) program. Along with 7 creep deformation and rupture tests, 32 pure fatigue and 46 C-F tests from the RR are considered in this work. A phenomenological constitutive model formulated in this work needs just five fitting parameters to simulate/predict the monotonic, pure fatigue and C-F behavior of grade P91 at 625 C. A modified version of an existing constitutive model is also presented for particularly simulating its isothermal creep deformation and rupture behavior. Experimental results indicate that specimen C-F lives, as measured by the 2% load drop criterion, seem to decrease with increasing strain ranges and increasing hold times at 625°C. Metallographic assessment of the tested specimens shows that the damage mode in both pure fatigue and 600 seconds hold time cyclic tests is predominantly transgranular fatigue with some presence of

  14. Analysis of internal crack in a six-ton P91 ingot

    Directory of Open Access Journals (Sweden)

    Jing-an Yang

    2016-05-01

    Full Text Available P91 is a new kind of heat-resistant and high-tensile steel. It can be extruded after ingot casting and can be widely used for different pipes in power plants. However, due to its mushy freezing characteristics, a lack of feeding in the ingot center often generates many defects, such as porosity and crack. A six-ton P91 ingot was cast and sliced, and a representative part of the longitudinal section was inspected in more detail. The morphology of crack-like defects was examined by X-ray high energy industrial CT and reconstructed by 3D software. There are five main portions of defects larger than 200 mm3, four of which are interconnected. These initiated from continuous liquid film, and then were torn apart by excessive tensile stress within the brittle temperature range (BTR. The 3D FEM analysis of thermo-mechanical simulation was carried out to analyze the formation of porosity and internal crack defects. The results of shrinkage porosity and Niyama values revealed that the center of the ingot suffers from inadequate feeding. Several criteria based on thermal and mechanical models were used to evaluate the susceptibility of hot crack formation. The Clyne and Davies’ criterion and Katgerman’s criterion successfully predicted the high hot crack susceptibility in the ingot center. Six typical locations in the longitudinal section had been chosen for analysis of the stresses and strains evolution during the BTR. Locations in the defects region showed the highest tensile stresses and relative high strain values, while other locations showed either low tensile stresses or low strain values. In conclusion, hot crack develops only when stress and strain exceed a threshold value at the same time during the BTR.

  15. A hardness-based creep rupture model for new and service aged P91 steel

    Energy Technology Data Exchange (ETDEWEB)

    Allen, D.J.; Fenton, S.T. [E.ON UK plc, Power Technology, Nottingham (United Kingdom)

    2007-06-15

    The use of creep rupture data in remanent life assessment is complicated by performance differences between different casts and between new and service degraded materials. Direct tests on suspect components are not always feasible. This paper describes a novel approach which enables the component - specific remanent life to be estimated, and requires only a measurement of hardness at room temperature to characterise the component material. The basic principles are to normalise the creep test stress by reference to the material flow stress at the test temperature, and to use cast-specific hardness data to estimate the cast-specific flow stress. Statistical analysis shows that rupture data on a range of new P91 materials of varying hardness >200 HV then fall naturally into two regimes. The data at a high ratio of test stress to flow stress can be fitted to a 'high n' line (high Norton exponent), while data at a lower stress ratio fit a 'low n' line. This analysis shows substantially reduced scatter compared with conventional methods. An empirical refinement, allowing the hardness exponent to vary from unity, further reduces scatter and eliminates bias. The model derived for new P91 materials is then applied to ex-service materials of hardnesses from above 200 ITV down to 154 HV. In general, the fit is almost as good as that to the original new material data set. The model thus provides a reasonably accurate and far less onerous alternative to direct component testing in remanent life assessment. (orig.)

  16. Effect of Impurity Tin on the Creep Properties of a P91 Heat-Resistant Steel

    Science.gov (United States)

    Song, S.-H.; Xu, Y.-W.; Yang, H.-F.

    2014-09-01

    The creep properties of P91 steel specimens undoped and doped with 0.058 wt pct tin, which was normalized from 1328 K (1055 °C) and tempered at 1033 K (760 °C), were examined under different engineering stresses (150 to 210 MPa) and temperatures [873 K to 923 K (600 °C to 650 °C)]. The creep behavior followed the temperature-compensated power law and Monkman-Grant equations. In the temperature-compensated power law equation, the apparent activation energy and stress exponent for creep were approximately 541 kJ/mol and 12 for the undoped steel and 527 kJ/mol and 11 for the Sn-doped one, respectively. In the Monkman-Grant relation, the values of constants m and C were around 1.062 and 0.0672 for the undoped steel, and 1.012 and 0.0650 for the Sn-doped one, respectively. The 100 MPa stress creep lifetime at 873 K (600 °C) was estimated as 100641 hours for the undoped steel and 35290 hours for the Sn-doped steel, respectively. These indicated that Sn substantially deteriorated the creep properties of the steel. It was found that grain or subgrain boundary segregation of Sn could promote the nucleation of cavities or microcracks, thereby leading to the deterioration of the steel creep properties.

  17. Effect of normalizing temperature on microstructural stability and mechanical properties of creep strength enhanced ferritic P91 steel

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, C.; Giri, A.; Mahapatra, M.M.

    2016-03-07

    Mechanical properties of creep enhanced ferritic (CSEF) steels is affected by various parameters, the solutionizing temperature is one of them. The present work demonstrates the effect of solutionizing temperature on microstructure and mechanical properties of CSEF P91 steel. Optical metallography (OM) and Scanning electron microscopy (SEM) were carried out to study the microstructure of P91 steel in different heat treatment conditions. In order to determine the precipitates present in microstructure; X-ray analysis was performed. Moreover, the influence of solutionizing temperature on the mechanical properties (strength, hardness and impact toughness) has also been studied. - Highlights: • SEM-EDS analysis of P91 steel precipitates present at grain boundary and grain interior were carried out. • For constant tempering time effect of normalizing temperature on precipitate size, particle-to particle distance, and grain size were carried out. • Effect of normalizing temperature on tensile strength, yield strength, hardness, % elongation and % reduction of area of P91 steel were studied. • For constant tempering time effect of normalizing temperature on room temperature impact toughness of P91 steel were studied. Fracture surface after impact testing were also characterized by using SEM. • Fracture surface after room temperature tensile testing were also characterized by using SEM to study the effect of normalizing temperature on fracture surface.

  18. Measuring Dilution and Wear for Laser Cladding of Stellite 6 Produced on a P91 Steel Substrate using Two Different Heat Inputs

    Directory of Open Access Journals (Sweden)

    Kusmoko Alain

    2016-01-01

    Full Text Available Stellite 6 was deposited by laser cladding on a P91 substrate with energy inputs of 1 kW (P91-1 and 1.8 kW (P91–1.8. The chemical compositions, microstructures and surface roughnesses of these coatings were characterized by atomic absorption spectroscopy, scanning electron microscopy and atomic force microscopy. The microhardness of the coatings was measured and the wear mechanism of the coatings was evaluated using a pin-on-plate (reciprocating wear testing machine. The results showed less cracking and pore development for Stellite 6 coatings applied to the P91 steel substrate with the lower heat input (P91–1. Further, the Stellite coating for P91-1 was significantly harder than that obtained for P91–1.8. The wear test results indicated that the weight loss for P91–1 was much lower than for P91–1.8. The surface topography data indicated that the surface roughness for P91-1 was much lower than for P91–1.8. The measurements of dilution and carbon content showed that P91–1 has lower dilution and higher concentration of carbon than P91–1.8. It is concluded that the lower hardness of the coating for P91–1.8, together with the softer underlying substrate structure, markedly reduced the wear resistance of the Stellite 6 coating and the lower hardness of the coating for P91-1.8 was due to higher level of dilution and lower concentration of carbon.

  19. A Study to Increase Weld Penetration in P91 Steel During TIG Welding by using Activating Fluxes

    Science.gov (United States)

    Singh, Akhilesh Kumar; Kumar, Mayank; Dey, Vidyut; Naresh Rai, Ram

    2017-08-01

    Activated Flux TIG (ATIG) welding is a unique joining process, invented at Paton Institute of electric welding in 1960. ATIG welding process is also known as flux zoned TIG (FZTIG). In this process, a thin layer of activating flux is applied along the line on the surface of the material where the welding is to be carries out. The ATIG process aids to increase the weld penetration in thick materials. Activating fluxes used in the literature show the use of oxides like TiO2, SiO2, Cr2O3, ZnO, CaO, Fe2O3, and MnO2 during welding of steels. In the present study, ATIG was carried out on P-91 steel. Though, Tungsten Inert Gas welding gives excellent quality welds, but the penetration obtained in such welding is still demanding. P91 steel which is ferritic steel is used in high temperature applications. As this steel is, generally, used in thick sections, fabrication of such structures with TIG welding is limited, due to its low depth of penetration. To increase the depth of penetration in P91while welding with ATIG, the role of various oxides were investigated. Apart from the oxides mentioned above, in the present study the role of B2O3, V2O5 and MgO, during ATIG welding of P91 was investigated. It was seen that, compared to TIG welding, there was phenomenal increase in weld penetration during ATIG welding. Amongst all the oxides used in this study, maximum penetration was achieved in case of B2O3. The measurements of weld penetration, bead width and heat affected zone of the weldings were carried out using an image analysis technique.

  20. Changes in Precipitate Distributions and the Microstructural Evolution of P24/P91 Dissimilar Metal Welds During PWHT

    Science.gov (United States)

    Dawson, Karl E.; Tatlock, Gordon J.; Chi, Kuangnan; Barnard, Peter

    2013-11-01

    The effect of post-weld heat treatments (PWHTs) on the evolution of precipitate phases in dissimilar metal welds made between 9 pct Cr P91 alloy and 2.25 pct Cr T/P24-type weld metal has been investigated. Sections of multi-pass fusion welds were analyzed in their as welded condition and after PWHTs of 2 and 8 hour duration at 1003 K (730 °C). Thin foil specimens and carbon extraction replicas have been examined in transmission electron microscopes in order to identify precipitate phases and substantiate their distributions in close proximity to the fusion line. The findings of these studies confirm that a carbon-depleted region develops in the lower alloyed weld material, adjacent to the weld interface, during thermal processing. A corresponding carbon enriched region is formed, simultaneously, in the coarse grain heat affected zone of the P91 parent alloy. It has been demonstrated that carbon depletion from the weld alloy results in the dissolution of M7C3 and M23C6 chromium carbides. However, micro-alloying additions of vanadium and niobium which are made to both the P24 and P91 alloys facilitate the precipitation of stable, nano-scale, MX carbonitride particles. This work demonstrates that these particles, which are of key importance to the strength of ferritic creep resistant alloys, are retained in carbon-depleted regions. The microstructural stability which is conferred by their retention means that the pernicious effects of recrystallization are largely avoided.

  1. Influence of low nickel (0.09 wt%) content on microstructure and toughness of P91 steel welds

    Science.gov (United States)

    Arivazhagan, B.; Vasudevan, M.; Kamaraj, M.

    2015-05-01

    Modified 9Cr-1Mo (P91) steel is widely used as a high temperature structural material in the fabrication of power plant components. Alloying elements significantly influences the microstructure and mechanical properties of P91 steel weldments. The alloying elements manganese and nickel significantly influence the lower critical phase transformation temperature (AC1) as well as tempering response of welds. In the existing published information there was wide spread use of high Mn+Ni filler wire. In the present study, weldment preparation was completed using GTA filler wire having low Nickel content (Mn+Ni of 0.58 wt% including nickel content of 0.09 wt%). Microstructure and mechanical properties characterization was done. There is a requirement on minimum toughness of 47 Joules for P91 steel tempered welds at room temperature. Microstructural observation revealed that the GTA welds have low δ-ferrite content (<0.5%) in the martensite matrix. In the as-weld condition, the toughness was 28 Joules whereas after PWHT at 760 °C-2 h it was 115 Joules. In the present study, toughness of low nickel weld was higher due to low δ-ferrite content (<0.5%), multipass grain refinement and weld metal deposition of single pass per layer of weldment.

  2. Development of references of anomalies detection on P91 material using Self-Magnetic Leakage Field (SMLF) technique

    Science.gov (United States)

    Husin, Shuib; Afiq Pauzi, Ahmad; Yunus, Salmi Mohd; Ghafar, Mohd Hafiz Abdul; Adilin Sekari, Saiful

    2017-10-01

    This technical paper demonstrates the successful of the application of self-magnetic leakage field (SMLF) technique in detecting anomalies in weldment of a thick P91 materials joint (1 inch thickness). Boiler components such as boiler tubes, stub boiler at penthouse and energy piping such as hot reheat pipe (HRP) and H-balance energy piping to turbine are made of P91 material. P91 is ferromagnetic material, therefore the technique of self-magnetic leakage field (SMLF) is applicable for P91 in detecting anomalies within material (internal defects). The technique is categorized under non-destructive technique (NDT). It is the second passive method after acoustic emission (AE), at which the information on structures radiation (magnetic field and energy waves) is used. The measured magnetic leakage field of a product or component is a magnetic leakage field occurring on the component’s surface in the zone of dislocation stable slipbands under the influence of operational (in-service) or residual stresses or in zones of maximum inhomogeneity of metal structure in new products or components. Inter-granular and trans-granular cracks, inclusion, void, cavity and corrosion are considered types of inhomogeneity and discontinuity in material where obviously the output of magnetic leakage field will be shown when using this technique. The technique does not required surface preparation for the component to be inspected. This technique is contact-type inspection, which means the sensor has to touch or in-contact to the component’s surface during inspection. The results of application of SMLF technique on the developed P91 reference blocks have demonstrated that the technique is practical to be used for anomaly inspection and detection as well as identification of anomalies’ location. The evaluation of this passive self-magnetic leakage field (SMLF) technique has been verified by other conventional non-destructive tests (NDTs) on the reference blocks where simulated

  3. Study of microstress state of P91 steel using complementary mechanical Barkhausen, magnetoacoustic emission, and X-ray diffraction techniques

    Energy Technology Data Exchange (ETDEWEB)

    Augustyniak, Bolesław, E-mail: bolek@mif.pg.gda.pl; Piotrowski, Leszek; Maciakowski, Paweł; Chmielewski, Marek [Faculty of Applied Physics and Mathematics, Gdansk University of Technology, 80-233 Gdansk (Poland); Lech-Grega, Marzena; Żelechowski, Janusz [The Institute of Non-Ferrous Metals, 32-050 Skawina (Poland)

    2014-05-07

    The paper deals with assessment of microstress state of martensite P91 steel using three complementary techniques: mechanical Barkhausen emission, magnetoacoustic emission (MAE), and X-ray diffraction (XRD) profile analysis. Magnetic coercivity Hc and microstructure were investigated with inductive magnetometry and magnetic force microscopy (MFM), respectively. Internal stress level of P91 steel was modified by heat treatment. Steel samples were austenitized, quenched, and then tempered at three temperatures (720 °C, 750 °C, and 780 °C) during increasing time (from 15 min up to 240 min). The microstrain level ε{sub i} was evaluated using Williamson–Hall method. It was revealed that during tempering microstrain systematically decreases from ε{sub i} = 2.5 × 10{sup −3} for as quenched state down to ε{sub i} = 0.3 × 10{sup −3} for well tempered samples. Both mechanical hardness (Vicker's HV) and magnetic hardness (coercivity) decrease almost linearly with decreasing microstrain while the MAE and MBE intensities strongly increase. Tempering leads to evident shift of the MeBN intensity maximum recorded for the first load towards lower applied strain values and to increase of MAE intensity. This indicates that the microstress state deduced by magnetic techniques is correlated with microstrains evaluated with XRD technique.

  4. 22 CFR 9.1 - Basis.

    Science.gov (United States)

    2010-04-01

    ... of the Department's Foreign Affairs Manual, provide the basis for the security classification program... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Basis. 9.1 Section 9.1 Foreign Relations DEPARTMENT OF STATE GENERAL SECURITY INFORMATION REGULATIONS § 9.1 Basis. These regulations, taken together...

  5. Study of residual stresses generated in P91 pipe steel welded by MCAW / FCAW processes; Estudo das tensoes residuais geradas na soldagem de tubulacao de aco P91 pelos processos MCAW/FCAW

    Energy Technology Data Exchange (ETDEWEB)

    Chuvas, Tatiane C.; Pardal, Juan M.; Garcia, Pedro P.; Souza, Guttemberg C. de; Fonseca, Maria P. Cindra, E-mail: chuvas@vm.uff.br [Universidade Federal Fluminense (PGMEC/UFF), Niteroi, RJ (Brazil). Departamento de Engenharia Mecanica; Cardote, Ismael [UTC Engenharia S/A, Niteroi, Rio de Janeiro, RJ (Brazil)

    2014-07-01

    The welding is one of the main industrial manufacturing processes structures and piping, knowledge of residual stress from this process is of paramount importance because the mechanical properties of welded components are not only determined by the microstructures present in the joint, but also by residual stresses heterogeneous introduced by thermal cycling during the process. The aim of this work is the characterization ASTM P91 joints welded by MCAW / FCAW (Metal Cored Arc Welding / Flux Cored Arc Welding) processes through the residual stresses evaluating associated with welding and post-weld heat treatments. Residual stresses were measured using X-rays diffraction sin2psi method, with Crκα radiation and they presented tensile at the root joints with larger magnitudes in the weld metal region and compressive on the surface. The post weld heat treatment resulted relief of residual stresses at the root of the joints. However, the same effect was observed in compressive surface stresses, which could adversely affect the service life of the pipe, reducing the fatigue and stress corrosion cracking resistances. (author)

  6. Residual stress distributions in a P91 steel-pipe girth weld before and after post weld heat treatment

    Energy Technology Data Exchange (ETDEWEB)

    Paddea, S., E-mail: s.paddea@open.ac.uk [Materials Engineering, Open University, Walton Hall, Milton Keynes MK7 6AA (United Kingdom); Francis, J.A. [School of Mechanical, Aerospace and Civil Engineering, University of Manchester, Manchester M13 9PL (United Kingdom); Paradowska, A.M. [ISIS Facility, Rutherford-Appleton Laboratory, Didcot OX11 0QX, Oxon (United Kingdom); Bouchard, P.J. [Materials Engineering, Open University, Walton Hall, Milton Keynes MK7 6AA (United Kingdom); Shibli, I.A. [European Technology Development Ltd., Leatherhead KT22 7RD, Surrey (United Kingdom)

    2012-02-01

    Highlights: Black-Right-Pointing-Pointer Residual stresses in a pipe girth weld in P91 steel have been measured in both the as-welded and PWHT conditions. Black-Right-Pointing-Pointer The highest tensile residual stresses coincided with the HAZ boundary and the microstructural region that is prone to type IV cracking. Black-Right-Pointing-Pointer Compressive residual stresses were measured in the weld metal, in a location corresponding to the final weld pass. Black-Right-Pointing-Pointer The location of the peak compressive stresses can be explained by the effect of solid-state phase transformation. - Abstract: In this study the residual stresses in a pipe girth weld in a ferritic-martensitic power plant steel were measured by neutron diffraction and compared with the corresponding metallurgical zones in the weld region. It was found that, in both the as-welded and post-weld heat treated condition, the highest tensile stresses resided near the outer boundary of the heat-affected zone (HAZ), and towards the weld root region. Substantial tensile direct and hydrostatic stresses existed across the HAZ, including the fine-grained and intercritically annealed regions, where premature type IV creep failures manifest in 9-12 Cr steel welds. Compressive stresses were found in the weld metal coinciding with the last weld bead to be deposited. Constrained cooling tests on test coupons illustrated that these compressive stresses can be explained in terms of the influence that solid-state phase transformations have on the accumulation of stress in welds.

  7. 45 CFR 9.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Purpose. 9.1 Section 9.1 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION USE OF HHS RESEARCH FACILITIES BY ACADEMIC... and study facilities to academic scientists, engineers, and qualified students. ...

  8. Next-Generation 9-1-1.

    Science.gov (United States)

    2012-01-01

    The nations current 9-1-1 system is designed around outdated telephone technology : and cannot handle the text, data, images, and video that are common in personal : communications and critical to future safety and mobility advances. In addition, ...

  9. Study of the continuous corrosion in an oxidation environment derived from the theoretical combustion products in a refinery. Case study: Ferritic steel ASTM A335 P91

    Science.gov (United States)

    Alviz Meza, A.; Kafarov, V.; Y Peña Ballesteros, D.

    2017-12-01

    Corrosion studies are key element that ensure the correct functioning of equipment in the industrial sector. The oxidation phenomena were evaluated, taking as a case study steel ASTM A335 P91 (P91), a steel of typical use in equipment that work at high temperatures. Five (5) exposure times were selected for the experimental development: 1, 20, 50, 100 and 200h; as well as four (4) analysis temperatures: 450, 550, 650 and 750°C. Through the metallographic analysis was possible to evidence the presence of multiple carbide precipitates and a ferritic structure, after all the temperatures tested. On the other hand, the analysis of hardness and microhardness showed an increase for all the evaluated temperatures. These increases were mainly related to the precipitation of carbides in the coupons of P91. Regarding to the chemical analysis, it was possible to conclude that after 200h of experimentation in each temperature, a layer of duplex oxide, composed mainly of hematite, magnetite and spinel iron-chromium, was formed in the O2/H2O atmosphere. Finally, the kinetic study demonstrated that the oxide layer formed on each coupon of P91 was of protective character.

  10. An Approach to Maximize Weld Penetration During TIG Welding of P91 Steel Plates by Utilizing Image Processing and Taguchi Orthogonal Array

    Science.gov (United States)

    Singh, Akhilesh Kumar; Debnath, Tapas; Dey, Vidyut; Rai, Ram Naresh

    2017-10-01

    P-91 is modified 9Cr-1Mo steel. Fabricated structures and components of P-91 has a lot of application in power and chemical industry owing to its excellent properties like high temperature stress corrosion resistance, less susceptibility to thermal fatigue at high operating temperatures. The weld quality and surface finish of fabricated structure of P91 is very good when welded by Tungsten Inert Gas welding (TIG). However, the process has its limitation regarding weld penetration. The success of a welding process lies in fabricating with such a combination of parameters that gives maximum weld penetration and minimum weld width. To carry out an investigation on the effect of the autogenous TIG welding parameters on weld penetration and weld width, bead-on-plate welds were carried on P91 plates of thickness 6 mm in accordance to a Taguchi L9 design. Welding current, welding speed and gas flow rate were the three control variables in the investigation. After autogenous (TIG) welding, the dimension of the weld width, weld penetration and weld area were successfully measured by an image analysis technique developed for the study. The maximum error for the measured dimensions of the weld width, penetration and area with the developed image analysis technique was only 2 % compared to the measurements of Leica-Q-Win-V3 software installed in optical microscope. The measurements with the developed software, unlike the measurements under a microscope, required least human intervention. An Analysis of Variance (ANOVA) confirms the significance of the selected parameters. Thereafter, Taguchi's method was successfully used to trade-off between maximum penetration and minimum weld width while keeping the weld area at a minimum.

  11. Measurements of micron-scale meteoroids and orbital debris with the Space Dust (SPADUS) instrument on the upcoming ARGOS P91-1 mission

    Science.gov (United States)

    McKibben, R. B.; Simpson, J. A.; Tuzzolino, A. J.

    1997-01-01

    The space dust (SPADUS) experiment, to be launched into a sun-synchronous polar orbit at an altitude of 833 km onboard the USAF ARGOS P91-1 mission, will provide time-resolved measurements of the intensity, size spectrum and geocentric trajectories of dust particles encountered during the nominal three year mission. The experiment uses polyvinylidene fluoride dust sensors with a total detector area of 576 sq cm. The SPADUS will measure particle sizes between 2 and 200 microns, particle velocities between 1 and 10 km/s to better than 4 percent, and the direction of incidence with a mean error of 7 percent. These data will identify the particles as being debris or of natural origin.

  12. Evolution of phases in P91 steel in various heat treatment conditions and their effect on microstructure stability and mechanical properties

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, Chandan, E-mail: chandanpy.1989@gmail.com; Giri, Anoj; Mahapatra, M.M.

    2016-05-10

    To achieve high thermal efficiency, modern day thermal power plants operate at higher operating temperature and pressure which necessitates use of steels with high creep rupture strength such as modified 9Cr-1Mo steels. In the present study, the evolution of phases in modified 9Cr-1Mo P91 steel and their effects on microstructural stability and mechanical properties have been studied for specimens that were subjected to different thermal heat treatment conditions. The main focus has been to study the effect of heat treatment temperature ranging from 623 K to 1033 K (350–760 °C) on P91 steel. Further, the effect of furnace cooling, water quenching, tempering at 1273 K (1000 °C) and austenitizing on the mechanical properties and microstructure has been studied. The techniques used for material characterization were scanning electron microscopy (SEM), optical microscopy (OM) and X-ray diffraction. For low tempering temperature, i.e. 623 K (350 °C), M{sub 23}C{sub 6}, M{sub 3}C, M{sub 7}C{sub 3,} and MX precipitates have been observed with high yield strength (YS), tensile strength (UTS), hardness and low toughness. In the high temperature range, 923–1033 K (650–760 °C), fine MX, M{sub 7}C{sub 3}, M{sub 23}C{sub 6}, M{sub 2}X, and M{sub 3}C precipitates have been observed with low YS, UTS, hardness and high toughness. The steel tempered at 1033 K (760 °C) was observed to be having best combination of YS, UTS, hardness, toughness and ductility.

  13. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Indexed African Journals Online: www.ajol.info. An International Multidisciplinary Journal, Ethiopia. Vol. 9(1), Serial No. 36, January, 2015:228-236 ..... Balogun, S. O. (1994). Effects and remedies of bank failure. CBN Economic Review. Vol. 32 (16): 48-64. Doil, J. G. (2004). Causes of bank distress and resolution options.

  14. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    An International Multidisciplinary Journal, Ethiopia. Vol. 9(1), Serial No. 36, January ... be mandated to have students union for effective administration of their institutions and continuity of their countries' ..... rejected, the Structural Adjustment Programme (SAP) for example, and this was done in conjunction with civil society ...

  15. 15 CFR 9.1 - Goal of program.

    Science.gov (United States)

    2010-01-01

    ... Protection Agency develop a voluntary labeling program which would apply to energy-consuming home appliances... FOR HOUSEHOLD APPLIANCES AND EQUIPMENT TO EFFECT ENERGY CONSERVATION § 9.1 Goal of program. (a) This..., with information on the energy consumption and energy efficiency of household appliances and equipment...

  16. Influência dos parâmetros de soldagem na resistência à fluência de juntas soldadas de aço  ASTM A 335 P91.

    OpenAIRE

    Diego Martins Garcia

    2013-01-01

    A utilização do aço ASTM A 335 P91 tem sofrido um aumento considerável, especialmente em função da necessidade de materiais com maior resistência à fluência para aplicações em unidades de utilidades (geração de vapor) e de processo. Por ser um material de difícil soldabilidade, diversos problemas são enfrentados durante a construção das unidades e, posteriormente, durante manutenção, geralmente em função de problemas de s...

  17. Neighborhood Poverty and 9-1-1 Ambulance Contacts.

    Science.gov (United States)

    Seim, Josh; English, Joshua; Sporer, Karl

    2017-01-01

    Neighborhood poverty is positively associated with frequency of 9-1-1 ambulance utilization, but it is unclear whether this association remains significant when accounting for variations in the severities and types of ambulance contacts. We merged EMS ambulance contact records in a single California county (n = 88,027) with data from the American Community Survey at the census tract level (n = 300). Using tract as a proxy for neighborhood and negative binomial regression as an analytical tool, we predicted 16 outcomes: any ambulance contacts, ambulance contacts stratified by three intervention severities, and ambulance contacts varied by 12 primary impression categories. For each model, we estimated the incident rate ratios for 10 percentage point increases in tract-level poverty while controlling for geographic patterns in race, citizenship, gender, age, emergency department proximity, population density, and population size. Our study produced three major findings. First, tract-level poverty was positively associated with ambulance contacts (incident rate ratio [IRR] 1.45; 95% confidence interval [CI] 1.34 to 1.57). Second, poverty was positively associated with low severity contacts (IRR 1.48; 95% CI 1.35 to 1.61), medium severity contacts (IRR 1.38; 95% CI 1.28 to 1.49), and high severity contacts (IRR 1.40; 95% CI 1.30 to 1.51). Third, poverty was positively associated with 12 primary impression categories: abdominal (IRR 1.48; 95% CI 1.36 to 1.61), altered level of consciousness (IRR 1.37; 95% CI 1.25 to 1.50), cardiac (IRR 1.28; 95% CI 1.14 to 1.42), overdose/intoxication (IRR 1.59; 95% CI 1.40 to 1.81), pain (IRR 1.56; 95% CI 1.41 to 1.73), psych/behavioral (IRR 1.50; 95% CI 1.34 to 1.67), respiratory (IRR 1.42; 95% CI 1.29 to 1.56) seizure (IRR 1.52; 95% CI 1.38 to 1.68), stroke (IRR 1.14; 95% CI 1.01 to 1.28), syncope/near syncope (IRR 1.23; 95% CI 1.12 to 1.36), trauma (IRR 1.44; 95% CI 1.31 to 1.58), and general weakness (IRR 1.31; 95% CI 1.20 to 1

  18. Neighborhood Poverty and 9-1-1 Ambulance Response Time.

    Science.gov (United States)

    Seim, Josh; Glenn, Melody J; English, Joshua; Sporer, Karl

    2018-01-30

    Are 9-1-1 ambulances relatively late to poorer neighborhoods? Studies suggesting so often rely on weak measures of neighborhood (e.g., postal zip code), limit the analysis to particular ambulance encounters (e.g., cardiac arrest responses), and do little to account for variations in dispatch priority or intervention severity. We merged EMS ambulance contact records in a single California county (n = 87,554) with tract-level data from the American Community Survey (n = 300). After calculating tract-level median ambulance response time (MART), we used ordinary least squares (OLS) regression to estimate a conditional average relationship between neighborhood poverty and MART and quantile regression to condition this relationship on 25th, 50th, and 75th percentiles of MART. We also specified each of these outcomes by five dispatch priorities and by three intervention severities. For each model, we estimated the associated changes in MART per 10 percentage point increase in tract-level poverty while adjusting for emergency department proximity, population density, and population size. Our study produced three major findings. First, most of our tests suggested tract-level poverty was negatively associated with MART. Our baseline OLS model estimates that a 10 percentage point increase in tract-level poverty is associated with almost a 24 s decrease in MART (-23.55 s, 95% confidence interval [CI] -33.13 to -13.98). Results from our quantile regression models provided further evidence for this association. Second, we did not find evidence that ambulances are relatively late to poorer neighborhoods when specifying MART by dispatch priority. Third, we were also unable to identify a positive association between tract-level poverty and MART when we specified our outcomes by three intervention severities. Across each of our 36 models, tract-level poverty was either not significantly associated with MART or was negatively associated with MART by a magnitude smaller than a full

  19. Influencia de la temperatura de austenización y tiempo de permanencia sobre el tamaño de grano en aceros ferrítico-martensíticos del tipo 9Cr1MoVNb utilizados en calderas supercríticas

    Directory of Open Access Journals (Sweden)

    Gutiérrez-Urrutia, L.

    2001-04-01

    Full Text Available The aim of the present work is to determine the influence of austenitizing temperature holding time and heating velocity on grain size of ferritic-martensitic type 9CrlMoVNb steels developed for Oak Ridge National Laboratories & Combustion Engineering, T91/P91[1] Steels (USA and X10CrMoVNb 9.1 (Europe. The potential benefits of this material, in term of high resistance, good ductily and oxidation resistance, weldability and in particular good high temperature creep strength, are now widely acknowledged, particulary by supercritical boilers (P = 300 bar, T = 550±50 °C. The studied steels have been produced in, high frecuency induction vacum furnaces and hot-rolled.

    Se estudia la influencia de la temperatura de austenización, tiempo de permanencia a esta temperatura y velocidad de calentamiento sobre el tamaño de grano de varios aceros ferrítico-martensíticos de última generación del tipo 9CrlMoVNb, desarrollados por Oak Ridge National Laboratories (ORNL conjuntamente con Combustion Enginering en USA, conocidos por ASME/ASTM por las designaciones T91/P91[1] y en Europa como X10CrMoVNb9.1. Son aceros ductiles y tenaces que presentan muy buenas propiedades de resistencia a fluencia, soldabilidad y conductividad térmica. Son cada vez más utilizados como tubos de alta temperatura (550±50 °C y presión (300 bar en calderas supercríticas para centrales térmicas avanzadas. Los aceros estudiados se han fabricado en hornos de inducción de alta frecuencia al vacío y laminados en caliente.

  20. Effects of CYP2C9*1/*13 on the pharmacokinetics and pharmacodynamics of meloxicam

    Science.gov (United States)

    Bae, Jung-Woo; Choi, Chang-Ik; Jang, Choon-Gon; Lee, Seok-Yong

    2011-01-01

    AIMS To determine the effects of the CYP2C9*1/*13 genotype on the pharmacokinetics and pharmacodynamics of meloxicam in Korean subjects. METHODS Meloxicam (15 mg) was orally administered to 21 healthy Korean volunteers with either the CYP2C9*1/*1 or the CYP2C9*1/*13 genotype. Plasma meloxicam concentrations were analysed by HPLC-UV for 72 h after drug administration. The pharmacodynamic effects of meloxicam were determined by measuring TXB2 generated in blood. RESULTS The AUC(0,∞) and Cmax of meloxicam were 2.43- and 1.46-fold higher in the CYP2C9*1/*13 group than in the CYP2C9*1/*1 group, respectively. The oral clearance of meloxicam was significantly lower in the CYP2C9*1/*13 group (37.9% of wild type) than in the CYP2C9*1/*1 group. The t1/2 of meloxicam was 1.84-fold longer in the CYP2C9*1/*13 group than in the CYP2C9*1/*1 group. The rate of TXB2 production was significantly lower in the CYP2C9*1/*13 group than in the CYP2C9*1/*1 group. CONCLUSIONS The CYP2C9*1/*13 genotype is associated with decreased metabolism and increased pharmacodynamic effects of meloxicam. PMID:21395648

  1. Caracterização de juntas soldadas por Arame Tubular com proteção gasosa do aço ferrítico ASTM A335 P91, antes e após situação de duplo reparo.

    OpenAIRE

    Diego Teixeira Pedro

    2014-01-01

    Pouco se sabe a respeito das consequências da operação de reparo nas propriedades mecânicas e metalúrgicas das juntas do aço ASTM A335 grau P91 soldadas por Arame Tubular. Neste trabalho foi realizado um estudo para analisar e caracterizar juntas de um tubo do aço P91 soldadas pelo processo Arame Tubular com proteção gasosa, antes e após situação de duplo reparo. Foram utilizadas técnicas de microscopia eletrônica de varredura (MEV), análise química semiquantitativa por EDS ...

  2. Measurements of the Cosmic Background Radiation Temperature at 3.3and 9.1 MM

    Energy Technology Data Exchange (ETDEWEB)

    Witebsky, C.; De Amici, G.; Smoot, G.F.; Friedman, S.D.

    1983-06-01

    The authors report the results of measurements of the cosmic background radiation temperature at wavelengths of 9.1 and 3.3 mm. The 9.1 mm result, T{sub CBR} = 2.87 {+-} 0.21 K, is in good agreement with previous results and those obtained at longer wavelengths during the same experiment. The 3.3 mm result, T{sub CBR} = 2.4 {+-} 1.0 K, is consistent with previous measurements, but has a large error due to uncertainty in the atmospheric correction.

  3. Coordinating the Global Information Grid Initiative with the NG9-1-1 Initiative

    Energy Technology Data Exchange (ETDEWEB)

    Michael Schmitt

    2008-05-01

    As the Department of Defense develops the Global Information Grid, the Department of Transportation develops the Next Generation 9-1-1 system. Close examinations of these initiatives show that the two are similar in architectures, applications, and communications interoperability. These similarities are extracted from the lowest user level to the highest commander rank that will be involved in each network. Once the similarities are brought into perspective, efforts should be made to collaborate between the two departments.

  4. Migrating to 9.1 -- Why Not...How Hard Could It Be?

    Science.gov (United States)

    Little, Keith; Miller, Carole; Schwindt, Paul; Zimmerman, Cheryl

    2011-01-01

    With 19+ Million documents in the 8.0 Vault. the decision was to migrate only selected top-level Documents, Drawings, Models and Assemblies to Kennedy Space Center's Brand-Spankin-New 9.1 Windchill system. Come with us as we detail our journey. We'll share our triumphs. tools, and approaches, as well as our challenges (and a surprise or two) discovered on the trip.

  5. ’n Retoriese analise van Romeine 9:1–10:4

    Directory of Open Access Journals (Sweden)

    A.H. (Andries Snyman

    2015-03-01

    Full Text Available Die artikel is ’n poging om Paulus se retoriese strategie uit die teks self te rekonstrueer, eerder as om ’n klassieke of moderne retoriese model op die teks toe te pas. ’n Voorstel virso ’n teksgesentreerde benadering word kortliks opgesom, gevolg deur ’n beskrywing van die retoriese situasie wat Paulus in die brief wil ondersoek. Daar word geargumenteer dat Romeine 9:1–10:4 ’n integrale deel van Paulus se retoriese strategie vorm met die doel om sy gehoor te oortuig om sy siening van God se verlossingsplan, asook sy beoogde sending na Spanje te steun. In die proses van oorreding gebruik hy verskillende soorte argumente en retoriese tegnieke om die trefkrag van sy kommunikasie te verhoog. Die gevolgtrekkingis dat ’n teksgesentreerde benadering (met fokus op die funksionele aspekte van die teks ’n beter alternatief as die bestaande benaderings (met fokus op die formele aspekte van die teks bied.A rhetorical analysis of Romans 9:1-10:4. This article is an attempt to reconstruct Paul’s rhetorical strategy from the text itself, rather than applying ancient or modern rhetorical models to his letters. A proposal for such a text-centred approach is briefly summarised, followed by a discussion of the rhetorical situation that Paul wants to address in this letter. It is argued that Romans 9:1–10:4 forms an integral part of his rhetorical strategy, aimed at persuading his audience in Rome to support his view on God’s plan of salvationas well as his forthcoming mission to Spain. In the process of persuasion Paul uses various types of argument and rhetorical techniques to enhance the impact of his communication.The conclusion is that a text-centred approach (with its focus on the functional aspects of the text provides a better alternative to existing approaches (which focus on the formal aspects of the text. 

  6. Examining the Fundamental Obstructs of Adopting Cloud Computing for 9-1-1 Dispatch Centers in the USA

    Science.gov (United States)

    Osman, Abdulaziz

    2016-01-01

    The purpose of this research study was to examine the unknown fears of embracing cloud computing which stretches across measurements like fear of change from leaders and the complexity of the technology in 9-1-1 dispatch centers in USA. The problem that was addressed in the study was that many 9-1-1 dispatch centers in USA are still using old…

  7. Numerical calculation and experimental validation of damage development in 9 Cr steels

    Energy Technology Data Exchange (ETDEWEB)

    Rauch, M.; Maile, K.; Ringel, M. [Stuttgart Univ. (Germany). Materialpruefungsanstalt

    2004-07-01

    The investigations carried out for hollow cylinder specimens under multiaxial stress state for the materials 14MoV6-3, 10CrMo9-10, X10CrMoVNb9-1 and X11CrMoWVNb9-1-1 permit a comparative view on the damage development under service like loading conditions. All samples experienced relatively low rupture deformation values within the range < 5%, reflecting real component behaviour. Also the creep damage behaviour, well-known from components made of 14MoV6-3, can be identified in the frame of the experimental work: a significant number of creep cavities of clearly > 100 mm{sup -2} were already found at creep strains < 1%. Thus, the operational experience and the results of component tests is confirmed, that creep cavity occur within the range of approximately 50% of the service life. In contrast to this are the results of the steel X10CrMoVNb9-1: the creep cavities initiate at clearly larger creep strains, the number per unit area is rather small. With a cavity density of partially < 50 mm{sup -2} the problem of uncertainty results, that the cavities identified have also to be considered as artefacts. Life time assessment and damage evaluation of components made of modern martensitic steels therefore must be based on a more realistic calculation of the life time consumption. In this case it is necessary to include the multiaxiality of stress state in the material model used in finite element simulations. A first step is the usage of a mathematical description of the creep cavity density with respect to deformation and multiaxiality, which was determined for P91 at 600 C. Using this equation it is possible to calculate for the creep cavity density in a component. More research work has to be done in order to model the influence of the damage itself on the further development of stress and strain. (orig.)

  8. Changes In Properties and Microstructure of High-Chromium 9-12%Cr Steels Due to Long-Term Exposure at Elevated Temperature

    Directory of Open Access Journals (Sweden)

    Zieliński A.

    2016-06-01

    Full Text Available This paper presents the characteristics of the performance of P91 (X10CrMoVNb9-1, P92 (X10CrWMoVNb9-2 and VM12 (X12CrCoWVNb12-2-2 steels used for condition assessment of the pressure components of boilers with supercritical steam parameters. Studies on the mechanical properties, microstructure tests using scanning and transmission electron microscopy, and X-ray analysis of the phase composition of precipitates were performed for selected steels in the as-received condition and after long-term annealing. These steel characteristics are used for the evaluation of the microstructural changes and mechanical properties of the material of components after long-term service. The result of this study is the database of material characteristics representing the mechanical properties related to the microstructure analysis and it can be used for diagnosis of the components of pressure parts of power boilers.

  9. Quantitative analysis of stability of 9%Cr steel microstructure after long-term ageing

    Directory of Open Access Journals (Sweden)

    Golański G.

    2017-03-01

    Full Text Available The paper presents the results of research on the microstructure of martensitic X10CrMoVNb9-1 (P91 and X13CrMoCo- VNbNB9-2-1 (PB2 steel subject to long-term ageing at the temperature of 620°C and holding times up to 30 000 hours. The microstructural tests of the examined steel types were performed using a scanning microscope Joel JSM - 6610LV and a transmission electron microscope TITAN 80 - 300. The stability of the microstructure of the investigated steels was analyzed using a quantitative analysis of an image, including measurements of the following: the density of dislocations inside martensite/subgrain laths, the width of martensite laths, and the mean diameter of precipitates. It has been concluded that during long-term ageing, the microaddition of boron in PB2 steel significantly influenced the slowing of the process of degradation of the martensitic steel microstructure, as a result of slowing the process of coagulation of M23C6 carbides and Laves phase. It had a favorable effect on the stabilization of lath microstructure as a result of retardation of the processes of recovery and polygonization of the matrix.

  10. Properties of thick welded joints on superheater collectors made from new generation high alloy martensitic creep-resisting steels for supercritical parameters

    Energy Technology Data Exchange (ETDEWEB)

    Dobrzanski, Janusz; Zielinski, Adam [Institute for Ferrous Metallurgy, Gliwice (Poland); Pasternak, Jerzy [Boiler Engineering Company RAFAKO S.A., Raciborz (Poland)

    2010-07-01

    The continuously developing power generation sector, including boilers with supercritical parameters, requires applications of new creep-resistant steel grades for construction of boilers steam superheater components. This paper presents selected information, experience within the field of research and implementation of a new group of creep-resistant as X10CrMoVNb9-1(P91), X10CrWMoVNb9-2(P92) and X12CrCoWVNb12-2-2(VM12) grades, containing 9-12%Cr. During welding and examination process the results of mechanical properties, requested level for base material and welded joints, as well as: tensile strength, impact strength and technological properties have been evaluated. Additional destructive examinations, with evaluation of structure stability, hardness distribution, for base material and welded joints after welding, heat treatment, again process have been determined. Recommendations due to the implementation influence of operating parameters of the main boiler components are part of this paper. (orig.)

  11. DNA damage response clamp 9-1-1 promotes assembly of ZMM proteins for formation of crossovers and synaptonemal complex

    Science.gov (United States)

    Shinohara, Miki; Hayashihara, Kayoko; Grubb, Jennifer T.; Bishop, Douglas K.; Shinohara, Akira

    2015-01-01

    Formation of crossovers between homologous chromosomes during meiosis is positively regulated by the ZMM proteins (also known as SIC proteins). DNA damage checkpoint proteins also promote efficient formation of interhomolog crossovers. Here, we examined, in budding yeast, the meiotic role of the heterotrimeric DNA damage response clamp composed of Rad17, Ddc1 and Mec3 (known as ‘9-1-1’ in other organisms) and a component of the clamp loader, Rad24 (known as Rad17 in other organisms). Cytological analysis indicated that the 9-1-1 clamp and its loader are not required for the chromosomal loading of RecA homologs Rad51 or Dmc1, but are necessary for the efficient loading of ZMM proteins. Interestingly, the loading of ZMM proteins onto meiotic chromosomes was independent of the checkpoint kinase Mec1 (the homolog of ATR) as well as Rad51. Furthermore, the ZMM member Zip3 (also known as Cst9) bound to the 9-1-1 complex in a cell-free system. These data suggest that, in addition to promoting interhomolog bias mediated by Rad51–Dmc1, the 9-1-1 clamp promotes crossover formation through a specific role in the assembly of ZMM proteins. Thus, the 9-1-1 complex functions to promote two crucial meiotic recombination processes, the regulation of interhomolog recombination and crossover formation mediated by ZMM. PMID:25736290

  12. The Central Point Source in G76.9++1.0 V. R. Marthi1,∗ , J. N. ...

    Indian Academy of Sciences (India)

    Abstract. We describe the serendipitous discovery of a very steep- spectrum radio point source in low-frequency Giant Metrewave Radio. Telescope (GMRT) images of the supernova remnant (SNR) G76.9+1.0. The steep spectrum, as well as the location of the point source near the centre of this SNR confirm that this indeed ...

  13. 26 CFR 301.6103(k)(9)-1 - Disclosure of returns and return information relating to payment of tax by credit card and debit...

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Disclosure of returns and return information relating to payment of tax by credit card and debit card. 301.6103(k)(9)-1 Section 301.6103(k)(9)-1... ADMINISTRATION PROCEDURE AND ADMINISTRATION Information and Returns Returns and Records § 301.6103(k)(9)-1...

  14. Crystallographic analysis reveals octamerization of viroplasm matrix protein P9-1 of Rice black streaked dwarf virus.

    Science.gov (United States)

    Akita, Fusamichi; Higashiura, Akifumi; Shimizu, Takumi; Pu, Yingying; Suzuki, Mamoru; Uehara-Ichiki, Tamaki; Sasaya, Takahide; Kanamaru, Shuji; Arisaka, Fumio; Tsukihara, Tomitake; Nakagawa, Atsushi; Omura, Toshihiro

    2012-01-01

    The P9-1 protein of Rice black streaked dwarf virus accumulates in viroplasm inclusions, which are structures that appear to play an important role in viral morphogenesis and are commonly found in viruses in the family Reoviridae. Crystallographic analysis of P9-1 revealed structural features that allow the protein to form dimers via hydrophobic interactions. Each dimer has carboxy-terminal regions, resembling arms, that extend to neighboring dimers, thereby uniting sets of four dimers via lateral hydrophobic interactions, to yield cylindrical octamers. The importance of these regions for the formation of viroplasm-like inclusions was confirmed by the absence of such inclusions when P9-1 was expressed without its carboxy-terminal arm. The octamers are vertically elongated cylinders resembling the structures formed by NSP2 of rotavirus, even though there are no significant similarities between the respective primary and secondary structures of the two proteins. Our results suggest that an octameric structure with an internal pore might be important for the functioning of the respective proteins in the events that occur in the viroplasm, which might include viral morphogenesis.

  15. Editorial 9 (1

    Directory of Open Access Journals (Sweden)

    Jana Dlouhá

    2014-05-01

    Full Text Available Dear readers and other members of the Envigogika community,We are pleased to inform you that new English issue is available online as of the end of May (along with the Czech versions of almost all texts and we offer it to you for your perusal. Since the previous edition of Envigogika, our journal has undergone relatively substantial changes in order to raise its quality and academic recognition. Steps we have taken in this respect include:joining the CrossRef database. This means that all our articles are now indexed by the CrossRef database –all articles have their DOI;improving referencing. Joining the CrossRef obliges us to use DOI links also for all references in all articles which have DOI – by the end of the summer we hope to upgrade references and other details in all pdf versions (also retrospectively;joining Open Archives Initiative;joining the WorldCat OCLC database;joining Sherpa/Romeo;application for inclusion to the OAIster database;improving our publication policy and ethical code of conduct;broadening the scope of journal so that now it might be concerned with other sustainability oriented issues: including psychological and behavioural themes, sustainable (regional development issues and analyses of related (social transformations, reflections of the social role of science, and of course discussions on whole range of prerequisites and barriers for quality EE and ESD on different education levels;based on these steps we have also applied for being embedded in the SCOPUS database and DOAJ directory;last but not least we have extended our supporting international professional community inviting new editorial board members who are warmly welcome to share their ideas and views with us and to support the journal’s editing policy.We have a small editorial team, and so all these activities have been quite demanding. However now we are happy to offer you the first issue of this year in which you can find following: a text by Jan Činčera  and his colleagues “Organic food is fertilised at night”: Why people (do not buy environmentally friendly products in which the authors analyze barriers for environmentally friendly consumer behaviour in relation to consumers’ personal history. Lubomír Hanel and Jana Hanelová explore parental care of the genus Elasmucha and outline principles of direct observation of the environment and practical scientific enquiry outside the classroom which they consider to be fundamental to an understanding of the nature of science for which they show its application in education. In relation to the document Peoples’ Sustainability Treaty on Higher Education Towards Sustainable Development, the last article from the reviewed column: Higher education for sustainability – a change of education genre? demonstrates the main changes currently in progress in higher education curricula, both based on theoretical considerations and providing practical examples of innovations in HE teaching in the context of CR universities.For Inspiration, we recommend you the text by Beáta Tisucká: The intertwinedness of forest and cultural landscapes in the context of cultural ecology where she discusses how nature is reflected in the social discourse and aesthetically interpreted so that it can be “read as a text”. Petr Mikšíček has a close relationship with the Ore Mountain region and writes about its landscape full of cultural footprints left by former inhabitants, the destruction of which also erases our memory (Discovery of a supposed extinct settlement species made at Königsmühle in the Ore Mountains. In her interview with Daniella Tilbury, Majda Naji learns more about the UNESCO Monitoring and Evaluation Expert Group (MEEG working in the framework of the United Nations Decade in Education for Sustainable Development which reflects the results of and prepares follow up to the Decade.We would also like to draw your attention to the latest news and announcements: first of all, we are supporting GUNI in its effort to distribute its latest report on higher education in the World. Secondly, and highly relevant for Envigogika, we announce a new call for papers for a thematic issue which will be focused on competences in environmental education and education for sustainable development and will be published as a follow-up to the international COPERNICUS Alliance conference to be held in Prague in the beginning of October[1]. We hope to meet some of you there soon!We wish you enjoyable reading, and sunny summer wherever you areOn behalf of the Envigogika editorial teamJana and Jiří Dlouhý [1] A further issue which will be comprised of regional sustainability case studies (working title "Social learning processes for regional sustainable development", see here is still under preparation. Shorter examples of regional development highlighting the roles of its actors are welcome to be included in non-research sections or into the related database.

  16. Implementation process of technology in Education: The case of Blackboard 9.1 in the University of Manchester

    Directory of Open Access Journals (Sweden)

    Mora Rodríguez, Rebeca

    2013-09-01

    Full Text Available Las tecnologías de la información y comunicación están cambiando los procesos de enseñanza y aprendizaje alrededor del mundo. Los Entornos Virtuales de Aprendizaje son una de las tecnologías más comunes que las universidades están adoptando en la actualidad. De acuerdo con la literatura, la implementación de cualquier tecnología en una organización afecta a los diferentes grupos que pertenecen a ella. De esta manera existen muchas teorías sobre cómo el proceso de implementación debe ser realizado con el fin de que la comunidad se adapte al nuevo sistema. Este artículo tiene la finalidad de presentar los resultados de una investigación que estudió la manera en se llevó a cabo el proceso de implementación de Blackboard 9.1 entre profesores y tecnólogos en la Universidad de Manchester. Dos cuestionarios fueron aplicados a ambos grupos. Las respuestas fueron analizadas siguiendo un enfoque cualitativo para las preguntas abiertas y un enfoque cuantitativo para las preguntas estructuradas. Se concluyó que el proceso de ejecución de Blackboard 9.1 fue manejado desde una perspectiva administrativa en vez de educativa, involucrando fuerzas políticas y económicas de la institución dentro del proceso. Adicionalmente, la investigación reveló que ni estudiantes, ni profesores, ni tecnólogos fueron consultados antes de que el proceso de ejecución de Blackboard 9.1 comenzara. Debido a que la investigación fue desarrollada como un estudio de caso, no puede ser generalizada. Sin embargo, el estudio puede servir para ilustrar una idea general sobre implementación de tecnología en educación.Information and communication technologies are changing the teaching and learning process around the world. Virtual learning environments are one of the most common technologies that universities are adopting nowadays. According to the literature, the implementation of any technology into an organization will affect the different groups within

  17. Advanced accelerator test facility-Final report for the period 9/1/2010 - 8/31/2013

    Energy Technology Data Exchange (ETDEWEB)

    Hirshfield, Jay [Yale Univ., New Haven, CT (United States)

    2014-10-27

    This final report summarizes results achieved in the Beam Physics Laboratory at Yale University during the period 9/1/2010 – 8/31//2013, under DoE grant DE-FG02-07 ER 41504. During the period covered by this report, notable progress in technical consolidation of facilities in the Yale Beam Physics Laboratory has occurred; and theory, design, and fabrication for future experiments have been carried out. In the period covered by this grant, 29 scientific publications based on this work and related topics have appeared in the archival literature. Titles, authors, and citations are listed in Section V of this report.

  18. Reasons 9-1-1 is called for cardiac arrest cases in which no resuscitation is attempted.

    Science.gov (United States)

    Meischke, Hendrika; Chavez, Devora; Feder, Sylvia; Rea, Tom; Albert, Tyler; Eisenberg, Mickey

    2009-01-01

    The goal of this investigation was to describe the reasons emergency medical services (EMS) is activated when resuscitation is not desired or when patients show signs of irreversible death. All medical incident report forms (MIRFs) indicating a cardiac arrest for which resuscitation was withheld were obtained from five participating fire departments. For each eligible case (N = 196), one of the emergency medical technicians (EMTs) present at the scene was interviewed and the dispatch tape of the 9-1-1 call was reviewed. Patient and caller characteristics were abstracted from the MIRFs and dispatch tapes. The EMTs were asked about the reasons for the call, whether the family expected this death, and the caller's emotional state when EMS arrived at the scene. In addition, EMS providers were asked open-ended questions about the services they provided for the patient and patient's family. Using chi-square statistics and t-tests, we compared two groups: 1) patients for whom resuscitation was not desired as indicated by a do-not-resuscitate (DNR) order, terminal illness, or hospice (n = 66) and 2) patients for whom resuscitation was not started because of signs of irreversible death (n = 130). Compared with callers for patients with signs of irreversible death, callers for patients for whom resuscitation was not desired were less likely to access EMS because they needed medical assistance (11% versus 30%) and more likely to call 9-1-1 because they thought it was "required by law" (30% versus 8%). Other common reasons in both groups for activating 9-1-1 were confusion regarding what to do and a request to confirm death. The most frequently reported service provided by EMTs for both groups was to "offer to contact a chaplain." In a third of patients for whom EMS did not initiate resuscitation, resuscitation was withheld primarily because it was not desired rather than because there was evidence of irreversible death. Efforts to improve education may prevent EMS activation

  19. IMPLEMENTATION PROCESS OF TECHNOLOGY IN EDUCATION: THE CASE OF BLACKBOARD 9.1 IN THE UNIVERSITY OF MANCHESTER

    Directory of Open Access Journals (Sweden)

    Rebeca Mora Rodríguez

    2013-01-01

    Full Text Available Las tecnologías de la información y comunicación están cambiando los procesos de enseñanza y aprendizaje alrededor del mundo. Los Entornos Virtuales de Aprendizaje son una de las tecnologías más comunes que las universidades están adoptando en la actualidad. De acuerdo con la literatura, la implementación de cualquier tecnología en una organización afecta a los diferentes grupos que pertenecen a ella. De esta manera existen muchas teorías sobre cómo el proceso de implementación debe ser realizado con el fin de que la comunidad se adapte al nuevo sistema. Este artículo tiene la finalidad de presentar los resultados de una investigación que estudió la manera en se llevó a cabo el proceso de implementación de Blackboard 9.1 entre profesores y tecnólogos en la Universidad de Manchester. Dos cuestionarios fueron aplicados a ambos grupos. Las respuestas fueron analizadas siguiendo un enfoque cualitativo para las preguntas abiertas y un enfoque cuantitativo para las preguntas estructuradas. Se concluyó que el proceso de ejecución de Blackboard 9.1 fue manejado desde una perspectiva administrativa en vez de educativa, involucrando fuerzas políticas y económicas de la institución dentro del proceso. Adicionalmente, la investigación reveló que ni estudiantes, ni profesores, ni tecnólogos fueron consultados antes de que el proceso de ejecución de Blackboard 9.1 comenzara. Debido a que la investigación fue desarrollada como un estudio de caso, no puede ser generalizada. Sin embargo, el estudio puede servir para ilustrar una idea general sobre implementación de tecnología en educación.

  20. Expanding (3+1)-dimensional universe from a lorentzian matrix model for superstring theory in (9+1) dimensions.

    Science.gov (United States)

    Kim, Sang-Woo; Nishimura, Jun; Tsuchiya, Asato

    2012-01-06

    We reconsider the matrix model formulation of type IIB superstring theory in (9+1)-dimensional space-time. Unlike the previous works in which the Wick rotation was used to make the model well defined, we regularize the Lorentzian model by introducing infrared cutoffs in both the spatial and temporal directions. Monte Carlo studies reveal that the two cutoffs can be removed in the large-N limit and that the theory thus obtained has no parameters other than one scale parameter. Moreover, we find that three out of nine spatial directions start to expand at some "critical time," after which the space has SO(3) symmetry instead of SO(9).

  1. The crystal structure of Cu9.1(1)TeSb3, a stuffed derivative of Cr3Si

    DEFF Research Database (Denmark)

    Søtofte, Inger; Makovicky, E.; Karup-Møller, Sven

    1998-01-01

    The intermetallic compound Cu9.1(1)TeSb3 prepared at 973 K is an ordered member of the solid solution Cu64Te31Sb5-Cu70Te8Sb22 which also exists, for more limited composition ranges, between 673 K and 1173 K. It is a stuffed derivative of the structure type A15 (Cr3Si). Te is surrounded by twelve ....../4-occupied Cu-positions in the vertices of a cubically-deformed icosahedron (Cu-Te = 2.614 Å) which itself is nested in an Sb-icosahedron (Cu-Sb = 2.777 Å (x2) and 2.603 Å). The Sb array corresponds to the Cr array in Cr3Si....

  2. Thermodynamics of complexes formation by ITC in methanol/water = 9/1 (v/v) solution: A case study

    Energy Technology Data Exchange (ETDEWEB)

    Fisicaro, Emilia, E-mail: emilia.fisicaro@unipr.it [University of Parma, Department of Pharmacy, Parco Area delle Scienze, 27/A, 43124 Parma (Italy); Compari, Carlotta; Bacciottini, Franco; Contardi, Laura [University of Parma, Department of Pharmacy, Parco Area delle Scienze, 27/A, 43124 Parma (Italy); Carcelli, Mauro; Rispoli, Gabriele; Rogolino, Dominga [University of Parma, Department of Chemistry, Parco Area delle Scienze, 17/A, 43124 Parma (Italy)

    2014-06-01

    Graphical abstract: Integrase strand transfert inhibitors chelate the metal ions in the active site of HIV integrase. - Highlights: • Development of inhibitors acting against those viral enzymes operating via a cooperative two-metal ion mechanism, such as HIV integrase (IN), requires optimizing the binding affinity to the target. • We have defined an experimental procedure for obtaining reliable thermodynamic data by ITC in methanol/water = 9/1 (v/v) as solvent. • Formation heats in mixed solvent of the complexes formed by a ligand, model of Raltegravir, with Mg(II), Mn(II), Co(II) and Zn(II) are here reported. - Abstract: Most enzymes that participate in the biochemistry of nucleic acids require divalent metal ion cofactors to promote activity. Development of potent inhibitors, acting against those viral enzymes operating via a cooperative two-metal ion mechanism, such as HIV integrase (IN) and RNase H, hepatitis C virus polymerase and influenza endonuclease, requires optimizing the binding affinity to the target, which is dictated by the binding free energy composed of both enthalpic and entropic contributions. They can be obtained by using isothermal titration microcalorimetry. We have defined an experimental procedure for obtaining reliable thermodynamic data in methanol/water = 9/1 0.1 M KCl as solvent, used to overcome solubility problems. In this way we have measured the heats of formation of the complexes formed by N-(4-fluorobenzyl)-5-hydroxy-2-isopropyl-1-methyl-6-oxo-1, 6-dihydroxypyrimidine-4-carboxylate (HL, a model of Raltegravir, the antiretroviral drug produced by Merck and Co.), and a series of divalent metal ions of biological interest (Mg(II), Mn(II), Co(II) and Zn(II)), whose speciation was previously determined by potentiometry.

  3. Interaction Research on the Antiviral Molecule Dufulin Targeting on Southern Rice Black Streaked Dwarf Virus P9-1 Nonstructural Protein

    Directory of Open Access Journals (Sweden)

    Zhenchao Wang

    2015-03-01

    Full Text Available ern rice black streaked dwarf virus (SRBSDV causes severe harm to rice production. Unfortunately, studies on effective antiviral drugs against SRBSDV and interaction mechanism of antiviral molecule targeting on SRBSDV have not been reported. This study found dufulin (DFL, an ideal anti-SRBSDV molecule, and investigated the interactions of DFL targeting on the nonstructural protein P9-1. The biological sequence information and bonding characterization of DFL to four kinds of P9-1 protein were described with fluorescence titration (FT and microscale thermophoresis (MST assays. The sequence analysis indicated that P9-1 had highly-conserved C- and N-terminal amino acid residues and a hypervariable region that differed from 131 aa to 160 aa. Consequently, wild-type (WT-His-P9-1, 23 C-terminal residues truncated (TR-ΔC23-His-P9-1, 6 N-terminal residues truncated (TR-ΔN6-His-P9-1, and Ser138 site-directed (MU-138-His-P9-1 mutant proteins were expressed. The FT and MST assay results indicated that DFL bounded to WT-His-P9-1 with micromole affinity and the 23 C-terminal amino acids were the potential targeting site. This system, which combines a complete sequence analysis, mutant protein expression, and binding action evaluating system, could further advance the understanding of the interaction abilities between antiviral drugs and their targets.

  4. M9.1 Cascadia Subduction Zone Earthquake Tsunami Inundation Modeling of Sequim Bay and Lopez Island, Washington

    Science.gov (United States)

    Lee, C. J.; Cakir, R.; Walsh, T. J.; LeVeque, R. J.; Adams, L. M.; Gonzalez, F. I.

    2016-12-01

    The Strait of Juan de Fuca and adjacent coastal zone are prone to tsunami hazard triggered by a M9+ Cascadia Subduction Zone (CSZ) earthquake. In addition to the numerous tsunami deposits observed on the outer coast, there is geological evidence for nine sandy or muddy tsunami layers deposited in last 2500-year period in a tidal marsh area of Discovery Bay, Northeastern Olympic Peninsula, Washington (Williams et al., 2005, The Holocene, v. 15, no. 1). Thus, it is important to assess the potential tsunami hazard due to a future M9+ CSZ earthquake event that may impact local communities in and near Discovery Bay area . In this study, we conducted tsunami simulations using Clawpack-GeoClaw and the earthquake source scenario M9.1 CSZ, designated as "L1" (Witter et al., 2011, Oregon DOGAMI Special Paper 43). A fine-resolution (1/3 arc-second) NOAA digital elevation model (DEM) was used to provide a high resolution tsunami inundation simulation in Sequim Bay (about 5 miles west of Discovery Bay), Clallam county and Lopez Island, San Juan County. The test gauges, set around major infrastructures and properties, provided estimates of wave height, wave velocity, and wave arrival time. The results will contribute to further improving mitigation planning and emergency response efforts of the counties.

  5. Oral administration of Bifidobacterium bifidum G9-1 alleviates rotavirus gastroenteritis through regulation of intestinal homeostasis by inducing mucosal protective factors.

    Directory of Open Access Journals (Sweden)

    Tomohiro Kawahara

    Full Text Available Human rotavirus (RV infection is a leading cause of dehydrating diarrhea in infants and young children worldwide. Since therapeutic approaches to RV gastroenteritis are limited to alleviation of dehydration with oral rehydration solutions, more direct approaches to palliate symptoms of RV gastroenteritis are required. Treatments with probiotics have been increasingly recognized as alternative safe and low cost treatments for moderate infectious diarrhea. In this study, Bifidobacterium bifidum G9-1 (BBG9-1, which has been used as an intestinal drug for several decades, was shown to have a remarkable protective effect against RV gastroenteritis in a suckling mice model. As well as prophylactic oral administration of BBG9-1 from 2 days before RV infection, therapeutic oral administration of BBG9-1 from 1 day after RV infection significantly alleviated RV-induced diarrhea. Therapeutic administration of BBG9-1 reduced various types of damage in the small intestine, such as epithelial vacuolization and villous shortening, and significantly diminished the infectious RV titer in mixtures of cecal contents and feces. It was also shown that therapeutic administration of BBG9-1 significantly increased the number of acidic mucin-positive goblet cells and the gene expression of mucosal protective factors including MUC2, MUC3, MUC4, TGFβ1 and TFF3 in the small intestine. This led to alleviation of low gut permeability shown as decreased gene expression levels of occludin, claudin-1 and villin-1 after RV infection. Furthermore, in the small intestine, therapeutic administration of BBG9-1 significantly palliated the decreased gene expression of SGLT-1, which plays an important role in water absorption. In the large intestine, administered BBG9-1 was shown to replicate to assimilate undigested nutrients, resulting in normalization of the abnormally high osmotic pressure. These results suggested that water malabsorption caused by RV infection was alleviated in

  6. Remaining Sites Verification Package for the 100-C-9:1 Main Process Sewer Collection Line, Waste Site Reclassification Form 2004-012

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2007-06-11

    The 100-C-9:1 main process sewer pipeline, also known as the twin box culvert, was a dual reinforced process sewer that collected process effluent from the 183-C and 190-C water treatment facilities, discharging at the 132-C-2 Outfall. For remedial action purposes, the 100-C-9:1 waste site was subdivided into northern and southern sections. The 100-C-9:1 subsite has been remediated to achieve the remedial action objectives specified in the Remaining Sites ROD. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  7. Nanoparticle-Based Delivery of Anaplasma marginale Membrane Proteins; VirB9-1 and VirB10 Produced in the Pichia pastoris Expression System

    Directory of Open Access Journals (Sweden)

    Bing Zhang

    2016-11-01

    Full Text Available Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale. Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris. When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm, 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.

  8. Long-term creep testing and microstructure evaluation of P91 steel weld joints

    Energy Technology Data Exchange (ETDEWEB)

    Jandova, D.; Kasl, J.; Kanta, V. [SKODA VYZKUM s.r.o., Plzen (Czech Republic)

    2007-06-15

    Trial weld joints were made from wrought and cast modified 9Cr-lMo-V steel using GTAW and SMAW methods. Creep testing was carried out at temperature range from 525 deg C to 625 deg C and stresses from 50 to 240 MPa. Time to rupture of welds made from tube segments and cast plates reached almost 30 000 hours and 20 000 hours respectively. Creep strength was evaluated according the Larson-Miller parametric equation and microstructure was investigated using both light and electron microscopy. Creep rupture strength of both weld joints tested at temperatures below 600 deg C falls into the {+-}20% scatter band of the creep rupture strength of the parent material. At 600 deg C and 625 deg C the creep strength dropped by 27% and 30% for the plate weld and the tube weld respectively. All ruptures occurred in fine grain and intercritically reheated heat affected zones either in the parent material or in the weld metal. Observation of thin foils prepared from selected regions of the weld joints revealed differences in precipitation processes and the structure recovery causing decrease of dislocation density in some regions. Fine ferritic grains with low density of fine carbonitride precipitate occurred in critical localities. Soft grains were deformed and cavities at grain boundaries initiated the crack propagation. (orig.)

  9. Different types of cracking of P91 steel weld joints after long-term creep tests

    Energy Technology Data Exchange (ETDEWEB)

    Jandova, D.; Kasl, J.; Chvostova, E. (SKODA VYZKUM s.r.o., Plzen (Czech Republic))

    2010-05-15

    This paper deals with creep testing and microstructural investigation of trial weld joints prepared of wrought and cast 9Cr-1Mo-V steels using GTAW & SMAW method. Creep testing was carried out at temperature range from 525 degC to 625 degC, the longest time to rupture of 45 811 hrs was achieved. The creep strengths of weld joints for 100 000 hrs were calculated. Different types of cracking were observed in dependency on conditions of creep test and the type of weld joint. Type 1 and Type 2 fractures occurred at high applied stress at relatively low temperatures in the tube weld joint and also in two speciments of the cast plate weld joint after creep test at the lowest temperature and the highest temperature. All other fractures were of the Type 4. Causes of different fracture location in tested weld joints were elucidated on the base of substructure evolution in individual zones - the weld metal, the heat affected zone and the base material. Two processes occur simultaneously, which result in the creep damage: (i) softening of solid solution as a result of Laves phase precipitation and (ii) formation and coalescence of cavities in the soft fine grained parts of heat affected zone. (orig.)

  10. A survey of factors associated with the successful recognition of agonal breathing and cardiac arrest by 9-1-1 call takers: design and methodology

    Directory of Open Access Journals (Sweden)

    Kasaboski Ann

    2009-07-01

    Full Text Available Abstract Background Cardiac arrest victims most often collapse at home, where only a modest proportion receives life-saving bystander cardiopulmonary resuscitation. As many as 40% of all sudden cardiac arrest victims have agonal or abnormal breathing in the first minutes following cardiac arrest. 9-1-1 call takers may wrongly interpret agonal breathing as a sign of life, and not initiate telephone cardiopulmonary resuscitation instructions. Improving 9-1-1 call takers' ability to recognize agonal breathing as a sign of cardiac arrest could result in improved bystander cardiopulmonary resuscitation and survival rates for out-of-hospital cardiac arrest victims. Methods/Design The overall goal of this study is to design and conduct a survey of 9-1-1 call takers in the province of Ontario to better understand the factors associated with the successful identification of cardiac arrest (including patients with agonal breathing over the phone, and subsequent administration of cardiopulmonary resuscitation instructions to callers. This study will be conducted in three phases using the Theory of Planned Behaviour. In Phase One, we will conduct semi-structured qualitative interviews with a purposeful selection of 9-1-1 call takers from Ontario, and identify common themes and belief categories. In Phase Two, we will use the qualitative interview results to design and pilot a quantitative survey. In Phase Three, a final version of the quantitative survey will be administered via an electronic medium to all registered call takers in the province of Ontario. We will perform qualitative thematic analysis (Phase One and regression modelling (Phases Two and Three, to determine direct and indirect relationship of behavioural constructs with intentions to provide cardiopulmonary resuscitation instructions. Discussion The results of this study will provide valuable insight into the factors associated with the successful recognition of agonal breathing and cardiac

  11. STRING v9.1

    DEFF Research Database (Denmark)

    Franceschini, A.; Simonovic, M.; Roth, A.

    2013-01-01

    for certain model organisms and functional systems. Currently, protein interactions and associations are annotated at various levels of detail in online resources, ranging from raw data repositories to highly formalized pathway databases. For many applications, a global view of all the available interaction...... data is desirable, including lower-quality data and/or computational predictions. The STRING database (http://string-db.org/) aims to provide such a global perspective for as many organisms as feasible. Known and predicted associations are scored and integrated, resulting in comprehensive protein...

  12. ZTF-8 interacts with the 9-1-1 complex and is required for DNA damage response and double-strand break repair in the C. elegans germline.

    Directory of Open Access Journals (Sweden)

    Hyun-Min Kim

    2014-10-01

    Full Text Available Germline mutations in DNA repair genes are linked to tumor progression. Furthermore, failure in either activating a DNA damage checkpoint or repairing programmed meiotic double-strand breaks (DSBs can impair chromosome segregation. Therefore, understanding the molecular basis for DNA damage response (DDR and DSB repair (DSBR within the germline is highly important. Here we define ZTF-8, a previously uncharacterized protein conserved from worms to humans, as a novel factor involved in the repair of both mitotic and meiotic DSBs as well as in meiotic DNA damage checkpoint activation in the C. elegans germline. ztf-8 mutants exhibit specific sensitivity to γ-irradiation and hydroxyurea, mitotic nuclear arrest at S-phase accompanied by activation of the ATL-1 and CHK-1 DNA damage checkpoint kinases, as well as accumulation of both mitotic and meiotic recombination intermediates, indicating that ZTF-8 functions in DSBR. However, impaired meiotic DSBR progression partially fails to trigger the CEP-1/p53-dependent DNA damage checkpoint in late pachytene, also supporting a role for ZTF-8 in meiotic DDR. ZTF-8 partially co-localizes with the 9-1-1 DDR complex and interacts with MRT-2/Rad1, a component of this complex. The human RHINO protein rescues the phenotypes observed in ztf-8 mutants, suggesting functional conservation across species. We propose that ZTF-8 is involved in promoting repair at stalled replication forks and meiotic DSBs by transducing DNA damage checkpoint signaling via the 9-1-1 pathway. Our findings define a conserved function for ZTF-8/RHINO in promoting genomic stability in the germline.

  13. X-RAY OBSERVATIONS OF THE SUPERNOVA REMNANT CTB 87 (G74.9+1.2): AN EVOLVED PULSAR WIND NEBULA

    Energy Technology Data Exchange (ETDEWEB)

    Matheson, H.; Safi-Harb, S. [Department of Physics and Astronomy, University of Manitoba, Winnipeg, Manitoba, R3T 2N2 (Canada); Kothes, R., E-mail: matheson@physics.umanitoba.ca, E-mail: samar@physics.umanitoba.ca, E-mail: roland.kothes@nrc-cnrc.gc.ca [Dominion Radio Astrophysical Observatory, National Research Council Herzberg, P.O. Box 248, Penticton, British Columbia, V2A 6J9 (Canada)

    2013-09-01

    Pulsar wind nebulae (PWNe) studies with the Chandra X-Ray Observatory have opened a new window to address the physics of pulsar winds, zoom on their interaction with their hosting supernova remnant (SNR) and interstellar medium, and identify their powering engines. We here present a new 70 ks, plus an archived 18 ks, Chandra ACIS observation of the SNR CTB 87 (G74.9+1.2), classified as a PWN with unusual radio properties and poorly studied in X-rays. We find that the peak of the X-ray emission is clearly offset from the peak of the radio emission by {approx}100'' and located at the southeastern edge of the radio nebula. We detect a point source-the putative pulsar-at the peak of the X-ray emission and study its spectrum separately from the PWN. This new point source, CXOU J201609.2+371110, is surrounded by a compact nebula displaying a torus-like structure and possibly a jet. A more extended diffuse nebula is offset from the radio nebula, extending from the point source to the northwest for {approx}250''. The spectra of the point source, compact nebula, and extended diffuse nebula are all well described by a power-law model with a photon index of 1.1 (0.7-1.6), 1.2 (0.9-1.4), and 1.7 (1.5-1.8), respectively, for a column density N{sub H} = 1.38 (1.21-1.57) Multiplication-Sign 10{sup 22} cm{sup -2} (90% confidence). The total X-ray luminosity of the source is {approx}1.6 Multiplication-Sign 10{sup 34} erg s{sup -1} at an assumed distance of 6.1 kpc, with {approx}2% and 6% contribution from the point source and compact nebula, respectively. The observed properties suggest that CTB 87 is an evolved ({approx}5-28 kyr) PWN, with the extended radio emission likely a ''relic'' PWN, as in Vela-X and G327.1-1.1. To date, however, there is no evidence for thermal X-ray emission from this SNR, and the SNR shell is still missing, suggesting expansion into a low-density medium (n{sub 0} < 0.2 D{sup -1/2}{sub 6.1} cm{sup -3}), likely

  14. MRN- and 9-1-1-Independent Activation of the ATR-Chk1 Pathway during the Induction of the Virulence Program in the Phytopathogen Ustilago maydis.

    Science.gov (United States)

    Tenorio-Gómez, María; de Sena-Tomás, Carmen; Pérez-Martín, Jose

    2015-01-01

    DNA damage response (DDR) leads to DNA repair, and depending on the extent of the damage, to further events, including cell death. Evidence suggests that cell differentiation may also be a consequence of the DDR. During the formation of the infective hypha in the phytopathogenic fungus Ustilago maydis, two DDR kinases, Atr1 and Chk1, are required to induce a G2 cell cycle arrest, which in turn is essential to display the virulence program. However, the triggering factor of DDR in this process has remained elusive. In this report we provide data suggesting that no DNA damage is associated with the activation of the DDR during the formation of the infective filament in U. maydis. We have analyzed bulk DNA replication during the formation of the infective filament, and we found no signs of impaired DNA replication. Furthermore, using RPA-GFP fusion as a surrogate marker of the presence of DNA damage, we were unable to detect any sign of DNA damage at the cellular level. In addition, neither MRN nor 9-1-1 complexes, both instrumental to transmit the DNA damage signal, are required for the induction of the above mentioned cell cycle arrest, as well as for virulence. In contrast, we have found that the claspin-like protein Mrc1, which in other systems serves as scaffold for Atr1 and Chk1, was required for both processes. We discuss possible alternative ways to trigger the DDR, independent of DNA damage, in U. maydis during virulence program activation.

  15. Metabolic versatility and antibacterial metabolite biosynthesis are distinguishing genomic features of the fire blight antagonist Pantoea vagans C9-1.

    Directory of Open Access Journals (Sweden)

    Theo H M Smits

    Full Text Available BACKGROUND: Pantoea vagans is a commercialized biological control agent used against the pome fruit bacterial disease fire blight, caused by Erwinia amylovora. Compared to other biocontrol agents, relatively little is currently known regarding Pantoea genetics. Better understanding of antagonist mechanisms of action and ecological fitness is critical to improving efficacy. PRINCIPAL FINDINGS: Genome analysis indicated two major factors Contribute to biocontrol activity: competition for limiting substrates and antibacterial metabolite production. Pathways for utilization of a broad diversity of sugars and acquisition of iron were identified. Metabolism of sorbitol by P. vagans C9-1 may be a major metabolic feature in biocontrol of fire blight. Biosynthetic genes for the antibacterial peptide pantocin A were found on a chromosomal 28-kb genomic island, and for dapdiamide E on the plasmid pPag2. There was no evidence of potential virulence factors that could enable an animal or phytopathogenic lifestyle and no indication of any genetic-based biosafety risk in the antagonist. CONCLUSIONS: Identifying key determinants contributing to disease suppression allows the development of procedures to follow their expression in planta and the genome sequence contributes to rationale risk assessment regarding the use of the biocontrol strain in agricultural systems.

  16. Radio Frequency Electromagnetic Radiation (RF-EMR) from GSM (0.9/1.8GHZ) Mobile Phones Induces Oxidative Stress and Reduces Sperm Motility in Rats

    Science.gov (United States)

    Mailankot, Maneesh; Kunnath, Anil P; Jayalekshmi, H; Koduru, Bhargav; Valsalan, Rohith

    2009-01-01

    INTRODUCTION: Mobile phones have become indispensable in the daily lives of men and women around the globe. As cell phone use has become more widespread, concerns have mounted regarding the potentially harmful effects of RF-EMR from these devices. OBJECTIVE: The present study was designed to evaluate the effects of RF-EMR from mobile phones on free radical metabolism and sperm quality. MATERIALS AND METHODS: Male albino Wistar rats (10–12 weeks old) were exposed to RF-EMR from an active GSM (0.9/1.8 GHz) mobile phone for 1 hour continuously per day for 28 days. Controls were exposed to a mobile phone without a battery for the same period. The phone was kept in a cage with a wooden bottom in order to address concerns that the effects of exposure to the phone could be due to heat emitted by the phone rather than to RF-EMR alone. Animals were sacrificed 24 hours after the last exposure and tissues of interest were harvested. RESULTS: One hour of exposure to the phone did not significantly change facial temperature in either group of rats. No significant difference was observed in total sperm count between controls and RF-EMR exposed groups. However, rats exposed to RF-EMR exhibited a significantly reduced percentage of motile sperm. Moreover, RF-EMR exposure resulted in a significant increase in lipid peroxidation and low GSH content in the testis and epididymis. CONCLUSION: Given the results of the present study, we speculate that RF-EMR from mobile phones negatively affects semen quality and may impair male fertility. PMID:19578660

  17. Radio frequency electromagnetic radiation (RF-EMR from GSM (0.9/1.8GHz mobile phones induces oxidative stress and reduces sperm motility in rats

    Directory of Open Access Journals (Sweden)

    Maneesh Mailankot

    2009-06-01

    Full Text Available INTRODUCTION: Mobile phones have become indispensable in the daily lives of men and women around the globe. As cell phone use has become more widespread, concerns have mounted regarding the potentially harmful effects of RF-EMR from these devices. OBJECTIVE: The present study was designed to evaluate the effects of RF-EMR from mobile phones on free radical metabolism and sperm quality. MATERIALS AND METHODS: Male albino Wistar rats (10-12 weeks old were exposed to RF-EMR from an active GSM (0.9/1.8 GHz mobile phone for 1 hour continuously per day for 28 days. Controls were exposed to a mobile phone without a battery for the same period. The phone was kept in a cage with a wooden bottom in order to address concerns that the effects of exposure to the phone could be due to heat emitted by the phone rather than to RF-EMR alone. Animals were sacrificed 24 hours after the last exposure and tissues of interest were harvested. RESULTS: One hour of exposure to the phone did not significantly change facial temperature in either group of rats. No significant difference was observed in total sperm count between controls and RF-EMR exposed groups. However, rats exposed to RF-EMR exhibited a significantly reduced percentage of motile sperm. Moreover, RF-EMR exposure resulted in a significant increase in lipid peroxidation and low GSH content in the testis and epididymis. CONCLUSION: Given the results of the present study, we speculate that RF-EMR from mobile phones negatively affects semen quality and may impair male fertility.

  18. MRN- and 9-1-1-Independent Activation of the ATR-Chk1 Pathway during the Induction of the Virulence Program in the Phytopathogen Ustilago maydis.

    Directory of Open Access Journals (Sweden)

    María Tenorio-Gómez

    Full Text Available DNA damage response (DDR leads to DNA repair, and depending on the extent of the damage, to further events, including cell death. Evidence suggests that cell differentiation may also be a consequence of the DDR. During the formation of the infective hypha in the phytopathogenic fungus Ustilago maydis, two DDR kinases, Atr1 and Chk1, are required to induce a G2 cell cycle arrest, which in turn is essential to display the virulence program. However, the triggering factor of DDR in this process has remained elusive. In this report we provide data suggesting that no DNA damage is associated with the activation of the DDR during the formation of the infective filament in U. maydis. We have analyzed bulk DNA replication during the formation of the infective filament, and we found no signs of impaired DNA replication. Furthermore, using RPA-GFP fusion as a surrogate marker of the presence of DNA damage, we were unable to detect any sign of DNA damage at the cellular level. In addition, neither MRN nor 9-1-1 complexes, both instrumental to transmit the DNA damage signal, are required for the induction of the above mentioned cell cycle arrest, as well as for virulence. In contrast, we have found that the claspin-like protein Mrc1, which in other systems serves as scaffold for Atr1 and Chk1, was required for both processes. We discuss possible alternative ways to trigger the DDR, independent of DNA damage, in U. maydis during virulence program activation.

  19. Flood-inundation maps for a 9.1-mile reach of the Coast Fork Willamette River near Creswell and Goshen, Lane County, Oregon

    Science.gov (United States)

    Hess, Glen W.; Haluska, Tana L.

    2016-04-13

    Digital flood-inundation maps for a 9.1-mile reach of the Coast Fork Willamette River near Creswell and Goshen, Oregon, were developed by the U.S. Geological Survey (USGS) in cooperation with the U.S. Army Corps of Engineers (USACE). The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected stages at the USGS streamgage at Coast Fork Willamette River near Goshen, Oregon (14157500), at State Highway 58. Current stage at the streamgage for estimating near-real-time areas of inundation may be obtained at http://waterdata.usgs.gov/or/nwis/uv/?site_no=14157500&PARAmeter_cd=00065,00060. In addition, the National Weather Service (NWS) forecasted peak-stage information may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation.In this study, areas of inundation were provided by USACE. The inundated areas were developed from flood profiles simulated by a one-dimensional unsteady step‑backwater hydraulic model. The profiles were checked by the USACE using documented high-water marks from a January 2006 flood. The model was compared and quality assured using several other methods. The hydraulic model was then used to determine eight water-surface profiles at various flood stages referenced to the streamgage datum and ranging from 11.8 to 19.8 ft, approximately 2.6 ft above the highest recorded stage at the streamgage (17.17 ft) since 1950. The intervals between stages are variable and based on annual exceedance probability discharges, some of which approximate NWS action stages.The areas of inundation and water depth grids provided to USGS by USACE were used to create interactive flood‑inundation maps. The availability of these maps with current stage from USGS streamgage and forecasted stream stages from the NWS provide emergency management

  20. Using New Constraints on Stress and Strength in Dynamic Rupture Models of the M 9.1-9.3 2004 Sumatra-Andaman Earthquake

    Science.gov (United States)

    Madden, E. H.; van Zelst, I.; Ulrich, T.; van Dinther, Y.; Gabriel, A. A.

    2016-12-01

    The influence of the initial stress, friction and fault geometry on earthquake rupture propagation has been shown in numerous studies. However, getting these conditions right for specific earthquakes remains a challenge. In addition, the close relationships between fault geometry, strength and tractions makes their unique determination difficult. Here, we present a series of 3D dynamic ruptures along the plate interface that hosted the 2004 M 9.1-9.3 Sumatra-Andaman earthquake. First, we constrain initial absolute stresses, dynamic strength and rock composition using a 2D seismo-thermo-mechanical (STM) model simulating the long-term earthquake cycle at the latitude of the earthquake's hypocenter. Slip instabilities that approximate earthquakes arise spontaneously in the STM model at different locations along the subduction zone interface. Thus, the STM model produces a range of initial conditions that are used to model several dynamic rupture events along the megathrust. The dynamic rupture models are performed with SeisSol, a software package based on an ADER-Discontinuous Galerkin scheme for solving the dynamic fault rupture and wave propagation problems with high-order accuracy in space and time. Use of an unstructured tetrahedral mesh allows for a realistic representation of the non-planar slab interface and bathymetry. The results emphasize the influence of stress and strength on rupture extent and propagation speed. Second, we fix the input parameters as those that best re-produce the earthquake's hypocentral location, magnitude, speed, and rupture extent along strike, but incorporate more complex fault geometry. The 30 m tsunami wave height reported near northern Sumatra suggests slip on landward and possibly also seaward dipping splay faults near the epicenter. This is supported by forethrust and backthrust imaging and mapping from deep seismic reflection surveys, bathymetric data and relocated seismicity. Rupture propagation and final surface displacements

  1. Factor VII R353Q genetic polymorphism is associated with altered warfarin sensitivity among CYP2C9 *1/*1 carriers.

    Science.gov (United States)

    Mlynarsky, Liat; Bejarano-Achache, Idit; Muszkat, Mordechai; Caraco, Yoseph

    2012-05-01

    Warfarin responsiveness is characterized by marked interindividual variability. A major portion of this variability is attributed to CYP2C9 and VKORC1 polymorphisms, but almost 50% is still unaccounted for. This paper reports the first prospective study on the association between factor VII R353Q polymorphism and warfarin responsiveness during induction. Genotyping for factor VII R353Q and 323D/I polymorphisms was performed in a cohort consisting of 374 patients (198 CYP2C9*1/*1) treated with warfarin who were prospectively followed from warfarin initiation. Compared with *1/*1-R/R and *1/*1-R/Q genotype carriers, *1/*1-Q/Q homozygotes achieved higher International Normalized Ratio (INR) values while consuming lower warfarin doses. The greater sensitivity was illustrated by 82.1% higher Warfarin Sensitivity Index During Induction (WSIDI) (0.14 ± 0.11 vs. 0.08 ± 0.50 mg⁻¹ Mann-Whitney, P = 0.043). Multiple regression analysis consisting of both genetic and nongenetic factors explained 26% of WSIDI variability, with R353Q genetic polymorphism having a modest yet significant effect and accounting for 1.7% of the overall variability. Moreover, the incidence of overanticoagulation (i.e., INR > 4) was 6.94-fold higher among *1/*1-Q/Q vs. *1/*1-R/R&R/Q carriers during warfarin induction (Pearson chi-square, P = 0.005). These findings were not accounted for by a chance difference in the distribution of VKORC1 genotypes. Analysis of these parameters among the entire cohort, including CYP2C9*2 and CYP2C9*3 variant allele carriers, did not reach statistical significance. Warfarin responsiveness during induction was unrelated to factor VII 323D/I genetic polymorphism. The response to warfarin during induction is influenced by factor VII R353Q polymorphism. The prospective use of this polymorphism, along with CYP2C9 and VKORC1, may enhance the accuracy of warfarin loading. However, the impact of R353Q polymorphism on overall warfarin response is subtle, and it is therefore

  2. Starting of H9ANFNb(P91) steel tubing production for energetics in domestic steel-works; Uruchomienie w krajowych hutach produkcji rur ze stali H9AMFNb(P91) przeznaczonych dla energetyki

    Energy Technology Data Exchange (ETDEWEB)

    Wiedermann, J. [Instytut Metalurgii Zelaza, Gliwice (Poland); Bieniek, K. [Huta Jednosc, Siemianowice Slaskie (Poland); Pogoda, K. [Huta Batory, Chorzow (Poland)

    1996-12-31

    The results of primary investigations and attempt of ferritic steel H9AMFNb production in domestic steel-works have been reported. The prototype series of tubes for energetic boilers have been tested and their mechanical properties determined. It has been found the applicability of the material for use in energetics. 9 refs, 4 figs, 3 tabs.

  3. Rice black-streaked dwarf virus P6 self-interacts to form punctate, viroplasm-like structures in the cytoplasm and recruits viroplasm-associated protein P9-1

    Directory of Open Access Journals (Sweden)

    Yu Jialin

    2011-01-01

    Full Text Available Abstract Background Rice black-streaked dwarf virus (RBSDV, a member of the genus Fijivirus within the family Reoviridae, can infect several graminaceous plant species including rice, maize and wheat, and is transmitted by planthoppers. Although several RBSDV proteins have been studied in detail, functions of the nonstructural protein P6 are still largely unknown. Results In the current study, we employed yeast two-hybrid assays, bimolecular fluorescence complementation and subcellular localization experiments to show that P6 can self-interact to form punctate, cytoplasmic viroplasm-like structures (VLS when expressed alone in plant cells. The region from residues 395 to 659 is necessary for P6 self-interaction, whereas two polypeptides (residues 580-620 and 615-655 are involved in the subcellular localization of P6. Furthermore, P6 strongly interacts with the viroplasm-associated protein P9-1 and recruits P9-1 to localize in VLS. The P6 395-659 region is also important for the P6-P9-1 interaction, and deleting any region of P9-1 abolishes this heterologous interaction. Conclusions RBSDV P6 protein has an intrinsic ability to self-interact and forms VLS without other RBSDV proteins or RNAs. P6 recruits P9-1 to VLS by direct protein-protein interaction. This is the first report on the functionality of RBSDV P6 protein. P6 may be involved in the process of viroplasm nucleation and virus morphogenesis.

  4. AJBR 9_1_ 31 -35new

    African Journals Online (AJOL)

    Dr. S.B. OLALEYE

    Starch based hydrogel as artificial skin. 32. INTRODUCTION. The search for safe and effective anti malarial drug still remain a priority to health care givers in the ... Sodium Hydroxide – Avondate Laboratory. (supplies) and services Ltd Banbury Oxon England. Analytic equipment: Semi Automated Chemistry Analyser-ERBA.

  5. AJBR 9_1_ 67- 68new

    African Journals Online (AJOL)

    Dr. S.B. OLALEYE

    Bioscience,. Biotechnology and Biochemistry. 56 (5):759-762. Rai, M.K., Acharya, D.(1999). Screening of some Asteraceous plants for antimycotic activity. Compositae Newsletter. 34: 37-. 43. Rai , M.K., Varma, A., Pandey AK.(2004). Antifungal potential of Spilanthes calva after inoculation of Piriformospora indica. Mycoses.

  6. Microstructure and electrical properties of Aurivillius phase (CaBi2Nb2O9)1-x(BaBi2Nb2O9)x solid solution

    Science.gov (United States)

    Zhang, Hongtao; Yan, Haixue; Reece, Michael J.

    2010-07-01

    The microstructures and electrical properties of Aurivillius phase ferroelectric solid solutions of (CaBi2Nb2O9)1-x(BaBi2Nb2O9)x (0≤x≤1) have been studied. X-ray diffraction analyses revealed a bismuth layered structure for all compositions. Scanning electron microscope images showed randomly oriented and platelike grain morphology. The Curie point Tc or the maximum permittivity temperature Tm decreased with increasing x. The (CaBi2Nb2O9)1-x(BaBi2Nb2O9)x ceramics exhibited a ferroelectric-paraelectric phase transition at small x values (x ≤0.5), whereas a relaxor behavior was observed at high x values (x ≥0.8). The d33 value of CaBi2Nb2O9 ceramics was enhanced by Ba2+ doping on the A-sites (x ≤0.3). A combination of high d33 values and high Tc points (>700 °C) suggests that compositions with x ≤0.3 could be good candidates for high-temperature piezoelectric applications. The composition with x =0.8 is a relaxor ferroelectric with Tm around 320 °C at 1 MHz.

  7. SIM.T-K9.1: Canada/Peru bilateral comparison of standard platinum resistance thermometers from 0.01 °C to 419.527 °C

    Science.gov (United States)

    Hill, K. D.; Barrientos, A.; Guillen, E.

    2015-01-01

    The Consultative Committee for Thermometry has organized Key Comparison 9 (CCT-K9) as an updated replacement for CCT-K3. A comparison of the fixed-point temperature standards of Peru with those of Canada was carried out following a protocol that closely resembles CCT-K9. The comparison was limited to the fixed points of tin and zinc, with NRC the pilot laboratory and the eventual link to CCT-K9 (currently, CCT-K9 remains a work in progress). The comparison protocol required INDECOPI to select, characterize, and transport (i.e. hand carry) the SPRTs to NRC. Following the measurements at NRC, the SPRTs were returned and re-measured at INDECOPI to close the loop and assess any changes that occurred in the SPRTs over the course of the measurements. The following degrees of equivalence, D, and expanded uncertainties, U (k = 2), were obtained via this comparison. T / °C DINDECOPI / mK U / mK 419.527 1.58 4.6 231.928 -2.12 3.9 SIM.T-K9.1 has demonstrated the compatibility of the fixed points of INDECOPI with those maintained by NRC within the combined uncertainties, and therefore serves to verify the intended calibration and measurement capabilities envisioned for INDECOPI, Peru. The results can be linked to NMIs globally following CCT-K9, with NRC as the linking participant. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCT, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  8. Insertion and extension of acyclic, dideoxy, and ara nucleotides by herpesviridae, human alpha and human beta polymerases. A unique inhibition mechanism for 9-(1,3-dihydroxy-2-propoxymethyl)guanine triphosphate.

    Science.gov (United States)

    Reid, R; Mar, E C; Huang, E S; Topal, M D

    1988-03-15

    The ability of human alpha and beta DNA polymerases and herpes simplex virus type 2 (HSV-2) and human cytomegalovirus (HCMV) DNA polymerases to insert and extend several nucleotide analogs has been investigated using a variation of Sanger-Coulson DNA sequencing technology. The analogs included the triphosphates of two antiviral nucleosides with incomplete sugar rings: 9-(1,3-dihydroxy-2-propoxymethyl)guanine (dhpG) and 9-(2-hydroxyethoxymethyl)guanine (acyG or acyclovir), as well as dideoxy and arabinosyl nucleoside triphosphates. Three pairs of contrasting behaviors were found, each pair distinguishing the two human polymerases from the two viral ones: first, extension behavior with araNTPs; second, insertion/extension behavior with dhpGTP; and third, the relative preference for insertion of ddGTP versus acyGTP. The relative level of insertion of the nucleotide analogs by HCMV and HSV-2 DNA polymerases was dhpGTP greater than (acyGTP and araNTP) greater than ddGTP, whereas by human alpha polymerase it was araATP greater than ddGTP much greater than (acyGTP and dhpGTP) and by human beta polymerase it was (araATP and ddGTP) much greater than (acyGTP and dhpGTP). Evidence is presented for three mechanisms of inhibition by extendible nucleotides (of dhp and ara types) exhibiting frequent internalization: araATP acted as a simple pseudoterminator of alpha and beta polymerases, but was easily extended past singlet sites by Herpesviridae polymerases and only stalled at sites requiring two or more araATP insertions in a row. Herpesviridae polymerases stalled after adding dhpGMP and one additional nucleotide, suggesting that polymerase translocation problems may be a factor in polymerase inhibition by modified sugar nucleotide analogs. The amino acid sequence of the human alpha DNA polymerase, which is acyGTP resistant, was found to vary by one amino acid from the amino sequences of the Herpesviridae polymerases in a region of significant similarity and probable functional

  9. Probiotics (Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and Bifidobacterium longum MM-2) improve rhinoconjunctivitis-specific quality of life in individuals with seasonal allergies: a double-blind, placebo-controlled, randomized trial.

    Science.gov (United States)

    Dennis-Wall, Jennifer C; Culpepper, Tyler; Nieves, Carmelo; Rowe, Cassie C; Burns, Alyssa M; Rusch, Carley T; Federico, Ashton; Ukhanova, Maria; Waugh, Sheldon; Mai, Volker; Christman, Mary C; Langkamp-Henken, Bobbi

    2017-03-01

    Background: Rhinoconjunctivitis-specific quality of life is often reduced during seasonal allergies. The Mini Rhinoconjunctivitis Quality of Life Questionnaire (MRQLQ) is a validated tool used to measure quality of life in people experiencing allergies (0 = not troubled to 6 = extremely troubled). Probiotics may improve quality of life during allergy season by increasing the percentage of regulatory T cells (Tregs) and inducing tolerance.Objective: The objective of this study was to determine whether consuming Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and B. longum MM-2 compared with placebo would result in beneficial effects on MRQLQ scores throughout allergy season in individuals who typically experience seasonal allergies. Secondary outcomes included changes in immune markers as part of a potential mechanism for changes in MRQLQ scores.Design: In this double-blind, placebo-controlled, parallel, randomized clinical trial, 173 participants (mean ± SEM: age 27 ± 1 y) who self-identified as having seasonal allergies received either a probiotic (2 capsules/d, 1.5 billion colony-forming units/capsule) or placebo during spring allergy season for 8 wk. MRQLQ scores were collected weekly throughout the study. Fasting blood samples were taken from a subgroup (placebo, n = 37; probiotic, n = 35) at baseline and week 6 (predicted peak of pollen) to determine serum immunoglobulin (Ig) E concentrations and Treg percentages.Results: The probiotic group reported an improvement in the MRQLQ global score from baseline to pollen peak (-0.68 ± 0.13) when compared with the placebo group (-0.19 ± 0.14; P = 0.0092). Both serum total IgE and the percentage of Tregs increased from baseline to week 6, but changes were not different between groups.Conclusions: This combination probiotic improved rhinoconjunctivitis-specific quality of life during allergy season for healthy individuals with self-reported seasonal allergies; however, the associated mechanism is still

  10. The professional context of the indexer in the teaching of indexing 10.5007/1518-2924.2010v15n30p91

    Directory of Open Access Journals (Sweden)

    Mariângela Spotti Lopes Fujita

    2010-08-01

    Full Text Available It is proposed the search of teaching methodology with socio-cognitive approach to present teaching strategies that simulate the experience of professional context that is propitious to work out the tasks of subject analysis for the indexing of documents. Taking into account the contact of the learner indexers with the actual professional context, the proposals of Fourie Portfolio (2002 and Hjorland (2002 principle of the information science social context were applied in the discipline “Indexing” at UNESP Librarianship course in Marília, SP, Brazil. The results taken from this research on teaching strategies in documentary reading show that the methodological and theoretical knowledge, in socio-cognitive perspective, provide a view of a professional context in which the learner indexer is conscious of his strategies of documentary reading and can develop his previous professional knowledge in order to accomplish the indexing tasks compatible to the user informational demand.

  11. A COMPARATIVE STUDY OF GROOVE DESIGN AND WELDING PROCESS ON SHRINKAGE STRESS, RESIDUAL STRESS AND TENSILE PROPERTIES OF P91 STEEL

    OpenAIRE

    Vinay Kumar Pal*, Dr. L. P. Singh, C.Pandey

    2017-01-01

    Present research work deals with the selection of appropriate range of welding parameters and procedure that is used for conventional and narrow groove welding of thick sections at different welding process.The development of narrow gap welding procedure by P-GMAW process is carried out for joining of thick sections by appropriate reduction in number of weld passes and amount of weld metal. Study of the effect of variation in groove design and welding processes was performed by summarizing th...

  12. Study on the effect of post weld heat treatment parameters on the relaxation of welding residual stresses in electron beam welded P91 steel plates

    OpenAIRE

    Venkata, K. Abburi; Kumar, S.; Dey, H.C.; Smith, D. J.; Bouchard, P J; Truman, C.E

    2014-01-01

    Residual stresses are created by localised heating effects that occur during the welding process. Post weld heat treatment (PWHT) is the most convenient method for stress relief of welds. But PWHT cannot completely eliminate the residual stresses. So, it is essential to determine the influence of PWHT parameters like holding temperature and time on the stress relaxation for optimising the process. The selected material is modified 9Cr-1Mo (Grade 91) steel in the form of plates welded together...

  13. Los catalogos en linea de acceso publico en las bibliotecas argentinas con colecciones juridicas 10.5007/1518-2924.2006v11n22p91

    Directory of Open Access Journals (Sweden)

    Elsa Barber

    2006-12-01

    Full Text Available Se analizan las interfaces de usuario de los catálogos en línea de acceso público (OPACs en entorno web de las bibliotecas argentinas con colecciones jurídicas, a fin de elaborar un diagnóstico de situación sobre la descripción bibliográfica, el análisis temático, los mensajes de ayuda al usuario y la visualización de los datos bibliográficos. Se adopta una metodología cuali-cuantitativa, se utiliza como instrumento de recolección de datos la lista de funcionalidades del sistema que proporciona Hildreth (1982, se actualiza en función de los nuevos desarrollos y se obtiene un formulario que permite, mediante 38 preguntas cerradas, observar la frecuencia de aparición de las funcionalidades básicas propias de cuatro áreas: Área I - control de operaciones; Área II, subdividida en control de formulación de la búsqueda y punto de acceso; Área III - control de salida y Área IV - asistencia al usuario: información e instrucción. Se trabaja con la información correspondiente a 43 unidades. Los resultados demuestran que la mayoría de los OPACs relevados brindan prestaciones mínimas, por lo que se encuentran en una fase inicial de implementación y no responden, por lo tanto, a las necesidades de los usuarios.

  14. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    acquired in himself or herself that determines his or her behaviour and general attitudes to life and .... with freedom and intelligence and this puts him far above all other creatures in the physical world and makes him ... other animate and inanimate beings such as animals, trees and plant, which are there for satisfaction of ...

  15. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    the parent Churches, although more African music, and later dance, entered and mixed with the imported Church ... music and even dancing were being introduced quietly into church services, albeit altered to fit into rituals of ..... The classical deities and the cults that once supported them are being replaced by the high ...

  16. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Implication of gender discrimination in science technology and mathematics education. In G. M. Ekpo (Ed) Strategies for effective teaching and learning of science, technology and mathematics education (pp.22-27). Uyo: IVY Publishers. Orji, A. B. C. (1998). Effect of problem-solving and concept mapping instructional.

  17. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Understanding illegal mining and criminal extraction of natural resources in the. DRC. The DR Congo is fabulously endowed with mineral ores. It has $24 trillion worth of untapped deposit of raw mineral ores, the world largest reserve of cobalt and large quantities of the world's diamond, gold and copper (Morgan, 2009).

  18. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    (textile), basket and rope weaving, wood carving (art and craft), blacksmithing, pottery, soap and palm oil ... society, Esan devised methods and techniques for making various articles or products which they needed ..... processes invariably led to reduction of workers by the companies as machine now provided the labour ...

  19. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    underlying causes of the present security challenges remain joblessness, hunger and disease, illiteracy, social ... This is underscored by the recent global perspective on security as a struggle to secure the most basic ... Nigerian unemployed youths and war refugees across the border from Chad,. Mali, Sudan, Libya, etc ...

  20. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    ritualistic because dancing and rejoicing strengthened community solidarity and emphasized the corporate whole. Garrick Braide's Christ Army Church in Khana is a good example of a new religious movement, a brand of African Independent. Churches. It is one of the African prophet led churches otherwise called spiritual.

  1. Information Sharing from 9-1-1 Centers

    Science.gov (United States)

    2014-09-01

    lead to significant performance failures, unnecessary loss of life, and loss of property. After action reports of the Columbine High School ...NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS Approved for public release; distribution is unlimited INFORMATION...P. Simpson 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Naval Postgraduate School Monterey, CA 93943-5000 8. PERFORMING ORGANIZATION REPORT

  2. 9 + 1 = Fun! "Good Management Begins with Good People"

    Science.gov (United States)

    Vicars, Dennis

    2010-01-01

    All organizations are different in nature, culture, programs, and services. However, every truly successful enterprise ("successful" meaning their mission statement and strategic goals are followed and achieved) that the author has encountered: (1) Employs strategic leadership; (2) Is organized in a way to promote maximum individual staff…

  3. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    ... and video CDs, and broadcast media had enhancing effects on open and distance learning in Nigeria; .... Raise the literacy level in Nigeria. 2. Substantially ... Alexander (2000) describes online conferencing as a kind of virtual social space ...

  4. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Human capital constitutes the most valuable resource of a country; in its absence there will be the non performance of physical capital (tools, machinery, and .... and allows him to get returns and gives him opportunities for job mobility. .... Like in the Solow model, a part of the outcome sY(t), is saved each period but in this.

  5. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    helen@yahoo.com. Phone: +2348033399024. Abstract. This study ..... in Science Education for re-validation. Kolb Learning Style Inventory has in-built validity and reliability being a universal accepted instrument. In the same vein, the Biology ...

  6. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Printed materials: this is the major instructional mode until such a time teaching will become available. 2. Audio tapes, video tapes: - in addition to prints, some courses will be recorded an audio tapes/video tape to be played back over again till complete learning occurs. 3. CD-ROMs:- in addition to prints, CD-ROMs affords ...

  7. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Each of these denominations also tried to set up rural networks by providing schooling and health facilities. ... accepted; rituals are warm and emotional, stressing personal involvement and acceptance of spirit possession. ... played by indigenous agents and 'Bible women' in the transmission and transformation of Christian ...

  8. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    practices. Some of the vital hallmarks of the Garrick Braide's Christ Army Church is that it makes indigenous people feel at home during worship as locally composed songs, clapping, ecstatic dancing and use of indigenous liturgy in praising God. An opportunity and atmosphere that were not allowed in mission Christianity.

  9. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    men agreed that their religion/denomination encouraged the use of Family Planning. The study therefore encouraged .... involvement in reproductive initiatives, including family planning, is a major obstacle to a speedy fertility decline in ..... The difference in the result may be a function of the level of education, and place of ...

  10. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    intellectual standards set by the Seadogs and thus considered the original organization to be elitist. However, Soyinka would later point to individuals who became accustomed to exerting power in the rigidly hierarchical confraternity, and were unwilling to give it up, as to blame for the initial schism. As new groups formed,.

  11. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Lundgren, R. I., Gribble, J. N., Greene, M. E., Emrick, G. E. and Margarita de. Monroy (2005). Cultivating Men's Interest in Family Planning in Rural El. Salvador. Studies in Family Planning, 36(3): 173-188. National Population Commission (NPC) [Nigeria] & ICF Macro (2009). Nigeria. Demographic and Health Survey 2008.

  12. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    findings includes high level of youth unemployment, poverty and corruption as well as causing under development of Nigeria economy. Key words: Dominant Individuals, Budget performance: Introduction. A budget is a financial/and or quantitative statement prepared and approved prior to the defined period of time for ...

  13. The Information Manager Vol.9 (1)2009 Page 34

    African Journals Online (AJOL)

    generated the observed distributional patterns their location and provide scientific explanation for the evolution of such patterns. It deals with concepts needed to develop a sharp geographical mind capable of appreciating and solving important spatial problems. This article examines the importance and application of core ...

  14. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Such effects may include among other things, the depreciation (or appreciation) of the domestic currency. The exchange rate is arguably the most difficult macroeconomic variable to model empirically. The role of exchange rate and its effects on macroeconomic performance has continued to generate interest among ...

  15. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Abstract. The study investigated the effect of teachers' personality profile on students' academic performance in senior secondary modern physics in selected schools in Nsit. Ibom Local Government Area of Akwa Ibom State. The survey research design was adopted. Two resercher-made instruments namely: Teachers' ...

  16. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    In recent times, the instability that experienced in the financial system and banking ... the company specialized in investment banking, equity, fixed income sales, research, trading, investment management, private equity and private banking. .... Nzotta (2014) stated that the cash based nature of an economy does not only.

  17. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Review of Economics and Statistics Vol 74, No 3 pp 530-539. Nikbakht, L. (2009). Oil prices and exchange rates: The case of OPEC. Business. Intelligence Journal, January, 2009. Olomola, P. A. & A.V. Adejumo (2010). Oil price shock and Macroeconomics activities in Nigeria. International Research Journal of Finance and.

  18. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Abstract. It has been said that the rate of the velocity of the development of a people (state or continent) is directly proportional to the capability of its strategic human resource. Annually, large numbers of educated and professional Africans leave the continent in search of greener pastures abroad. Greater number of these ...

  19. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    Environment (e.g. school and home) is a factor that can affect a person's behavior (academic ... class from each of the selected schools was again selected through a random sampling technique. Thus ... STUDENTS' PERCEPTION OF FAMILY ROLES INFLUENCING THEIR ACADEMIC ACHIEVEMENT IN AGRICULTURE ...

  20. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    expelled from Abia State University for cheating and “cultism”, a reference to the voodoo-practicing confraternities ... were stockpiling machine guns and other weapons in their armoury. This enraged the. Black Axe ... beatings, in order to test their endurance, as well as ingestion of liquid mixed with blood. Male initiates may ...

  1. The Information Manager Vol.9 (1)2009 Page 15

    African Journals Online (AJOL)

    office technology and information systems. The secretarial students graduate from the universities do not have iota of fundamentals of information processing and computer literacy. They do not possess the basic skills required to utilize computer operating system such as word processing, e-mail and the internet. Those who ...

  2. The Information Manager Vol.9 (1)2009 Page 1

    African Journals Online (AJOL)

    disadvantages. The disadvantages usually have to do with the difficulties in controlling urban growth and with making available resources or infrastructures to sustain the increasing ... developing world, is the inadequate number of secondary schools in ... today comprises of two local government areas; namely, Zaria Local ...

  3. 4 CFR 9.1 - GAO Senior Executive Service.

    Science.gov (United States)

    2010-01-01

    ... measured on the basis of individual and organizational performance (including such factors as improvements... performance and success in meeting equal employment opportunity goals); (3) Assure that senior executives are...

  4. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    between government expenditure on education, health and economic growth. ... the economy. Human capital investment is crucial in the growth process of the Nigerian economy. Vision 20:2020 seeks to improve the educational system in terms ..... There is also the need to improve on the pay package of the health workers.

  5. The Information Manager Vol.9 (1)2009 Page 26

    African Journals Online (AJOL)

    These lacks are as a result of external factors to the library itself such as illiteracy, the absence of a reading culture, an education system inimical to reading, lack of books in local languages, lack of government policies supporting libraries, economic problems, fiscal austerity measures, inappropriate donor interventions, lack ...

  6. AFRREV, 9(1), S/NO 36, JANUARY, 2015

    African Journals Online (AJOL)

    EMILIA

    other animate and inanimate beings such as animals, trees and plant, which are there ... Scientifically, he has the genes of his ancestors in his system. ... ownership of public properties such lands, farm produce, marriage, children, house,.

  7. Abasic sites linked to dUTP incorporation in DNA are a major cause of spontaneous mutations in absence of base excision repair and Rad17-Mec3-Ddc1 (9-1-1) DNA damage checkpoint clamp in Saccharomyces cerevisiae.

    Science.gov (United States)

    Collura, Ada; Kemp, Patricia Auffret Van Der; Boiteux, Serge

    2012-03-01

    In Saccharomyces cerevisiae, inactivation of base excision repair (BER) AP endonucleases (Apn1p and Apn2p) results in constitutive phosphorylation of Rad53p and delay in cell cycle progression at the G2/M transition. These data led us to investigate genetic interactions between Apn1p, Apn2p and DNA damage checkpoint proteins. The results show that mec1 sml1, rad53 sml1 and rad9 is synthetic lethal with apn1 apn2. In contrast, apn1 apn2 rad17, apn1 apn2 ddc1 and apn1 apn2 rad24 triple mutants are viable, although they exhibit a strong Can(R) spontaneous mutator phenotype. In these strains, high Can(R) mutation rate is dependent upon functional uracil DNA N-glycosylase (Ung1p) and mutation spectra are dominated by AT to CG events. The results point to a role for Rad17-Mec3-Ddc1 (9-1-1) checkpoint clamp in the prevention of mutations caused by abasic (AP) sites linked to incorporation of dUTP into DNA followed by the excision of uracil by Ung1p. The antimutator role of the (9-1-1) clamp can either rely on its essential function in the induction of the DNA damage checkpoint or to another function that specifically impacts DNA repair and/or mutagenesis at AP sites. Here, we show that the abrogation of the DNA damage checkpoint is not sufficient to enhance spontaneous mutagenesis in the apn1 apn2 rad9 sml1 quadruple mutant. Spontaneous mutagenesis was also explored in strains deficient in the two major DNA N-glycosylases/AP-lyases (Ntg1p and Ntg2p). Indeed, apn1 apn2 ntg1 ntg2 exhibits a strong Ung1p-dependent Can(R) mutator phenotype with a spectrum enriched in AT to CG, like apn1 apn2 rad17. However, genetic analysis reveals that ntg1 ntg2 and rad17 are not epistatic for spontaneous mutagenesis in apn1 apn2. We conclude that under normal growth conditions, dUTP incorporation into DNA is a major source of AP sites that cause high genetic instability in the absence of BER factors (Apn1p, Apn2p, Ntg1p and Ntg2p) and Rad17-Mec3-Ddc1 (9-1-1) checkpoint clamp in yeast

  8. Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and Bifidobacterium longum MM-2 Ingestion Induces a Less Inflammatory Cytokine Profile and a Potentially Beneficial Shift in Gut Microbiota in Older Adults: A Randomized, Double-Blind, Placebo-Controlled, Crossover Study.

    Science.gov (United States)

    Spaiser, Samuel J; Culpepper, Tyler; Nieves, Carmelo; Ukhanova, Maria; Mai, Volker; Percival, Susan S; Christman, Mary C; Langkamp-Henken, Bobbi

    2015-01-01

    This study determined whether older adults who consumed a probiotic mixture would have a greater proportion of circulating CD4+ lymphocytes, altered cytokine production, and a shift in intestinal microbiota toward a healthier microbial community. Participants (70 ± 1 years [mean ± SEM]; n = 32) consumed a probiotic (Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and Bifidobacterium longum MM2) or a placebo twice daily for 3 weeks with a 5-week washout period between intervention periods. Blood and stools were collected before and after each intervention. The percentage of circulating CD4+ lymphocytes and ex vivo mitogen-stimulated cell cytokine production were measured. In stools, specific bacterial targets were quantified via quantitative polymerase chain reaction (qPCR) and community composition was determined via pyrosequencing. During the first period of the crossover the percentage of CD4+ cells decreased with the placebo (48% ± 3% to 31% ± 3%, p < 0.01) but did not change with the probiotic (44% ± 3% to 42% ± 3%) and log-transformed concentrations of interleukin-10 increased with the probiotic (1.7 ± 0.2 to 3.4 ± 0.2, p < 0.0001) but not the placebo (1.7 ± 0.2 to 2.1 ± 0.2). With the probiotic versus the placebo a higher percentage of participants had an increase in fecal bifidobacteria (48% versus 30%, p < 0.05) and lactic acid bacteria (55% versus 43%, p < 0.05) and a decrease in Escherichia coli (52% versus 27%, p < 0.05). Several bacterial groups matching Faeacalibactierium prausnitzii were more prevalent in stool samples with the probiotic versus placebo. The probiotic maintained CD4+ lymphocytes and produced a less inflammatory cytokine profile possibly due to the changes in the microbial communities, which more closely resembled those reported in healthy younger populations.

  9. Mammal assemblage of the agroecosystem constituents of the Várzea River Basin, Rio Grande do Sul, Brazil doi: 10.5007/2175-7925.2010v23n4p91

    Directory of Open Access Journals (Sweden)

    Felipe Bortolotto Peters

    2010-01-01

    Full Text Available We provide recent information on the richness of mammals along the agroecosystems of the Rio da Várzea Basin, Rio Grande do Sul, Brazil. We used different fi eld techniques to confi rm the occurrence of 46 mammal species in this area. Nine species are threatened in at least one of the three "red lists" at state, national and global levels. Adding the up-to-date results obtained in the fi eld to available data, mainly for conservation units, we present a richness of 85 species recorded for the basin. This number represents about 50% of mammals documented for Rio Grande do Sul state. The results suggest the importance of maintaining protected areas in altered regions, confi rming the relevance of inventories of local fauna as a fi rst approach to specifi c studies addressed to distribution, systematics, cytogenetics, physiology, population and community ecology.

  10. Residual stresses and deformation in dissimilar girth welds: numerical simulations and experimental verifications

    Energy Technology Data Exchange (ETDEWEB)

    Pasquale, P.; Burget, W.; Pfeiffer, W. [Fraunhofer-Institut fuer Werkstoffmechanik (IWM), Freiburg im Breisgau (Germany)

    2001-03-01

    Weld fabrication of dissimilar girth welds made of the austenitic steel X3 CrNiMoN 17-13, the ferritic 9% Cr-steel X10 CrMoVNb 9-1 and a Ni-weld metal was simulated numerically based on the application of the program system SYSWELD+. A three-dimensional (3D) and an axisymmetrical finite element model of the girth weld were established. According to the real dissimilar weld the model is divided into three different material zones, the austenitic, the ferritic and the Ni-weld metal zone neglecting the heat-affected zone in the ferritic base metal. The results obtained in this study are presented in terms of temperature distributions during welding and just after welding. The residual stresses calculated for the dissimilar girth welds are shown both for the axial and the circumferential orientations. The calculated residual stress distributions are compared to residual stresses measured by X-ray diffraction. It is shown that the calculated residual stresses are in good agreement with the residual stresses determined experimentally. Residual stress distributions in dissimilar girth welds are discussed on the basis of variable weld fabrication conditions and different boundary conditions selected for the numerical calculations. (orig.)

  11. Ramona hot nuclear bank of the Siemens 9x9-1X; Banco nuclear ramona Hot del combustible Siemens 9x9-1X

    Energy Technology Data Exchange (ETDEWEB)

    Alonso V, G. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1993-11-15

    With the purpose of making the transitory analyses of the Laguna Verde Nuclear Power station when Siemens fuel of the type 9x9-IX is used, proposed for the cycle 2 of the Unit 2, the data bank in hot condition for the Ramona code has been generated. (Author)

  12. Minutes of the Tank Waste Science Panel meeting July 9--1, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Strachan, D.M. (comp.)

    1992-04-01

    The fifth meeting of the Tank Waste Science Panel was held July 9--11, 1991, in Atlanta, Georgia. The subject areas included the generation, retention, and release of gases from Tank 241-SY-101 and the chemistry of ferrocyanide wastes.

  13. Samaru Journal of Information Studies Vol.9 (1)2009 Consultancy ...

    African Journals Online (AJOL)

    This paper examines the nature and prospects of consultancy as a suitable employment option for graduates of library and information science. Introduction. The library and information services as a profession is rapidly changing with lots of challenges and new expectations for the professionals; especially fresh graduates ...

  14. Ethiop. J. Sci. & Technol. 9(1) 31-44, 2016 31 Investigation of 1, 10 ...

    African Journals Online (AJOL)

    -alkyl-1, 10-Phenathrolinium based ionic liquids, [CnPhen][Tf2N] (n=1, 2, 4, 6, 8, 10), were investigated using the X-ray photoelectron spectroscopy and a good fitting is developed for C 1s, and N 1s that applies to each of the compounds ...

  15. Technical Support Document for Version 3.9.1 of the COMcheck Software

    Energy Technology Data Exchange (ETDEWEB)

    Bartlett, Rosemarie; Connell, Linda M.; Gowri, Krishnan; Halverson, Mark A.; Lucas, Robert G.; Richman, Eric E.; Schultz, Robert W.; Winiarski, David W.

    2012-09-01

    COMcheck provides an optional way to demonstrate compliance with commercial and high-rise residential building energy codes. Commercial buildings include all use groups except single family and multifamily not over three stories in height. COMcheck was originally based on ANSI/ASHRAE/IES Standard 90.1-1989 (Standard 90.1-1989) requirements and is intended for use with various codes based on Standard 90.1, including the Codification of ASHRAE/IES Standard 90.1-1989 (90.1-1989 Code) (ASHRAE 1989a, 1993b) and ASHRAE/IESNA Standard 90.1-1999 (Standard 90.1-1999). This includes jurisdictions that have adopted the 90.1-1989 Code, Standard 90.1-1989, Standard 90.1-1999, or their own code based on one of these. We view Standard 90.1-1989 and the 90.1-1989 Code as having equivalent technical content and have used both as source documents in developing COMcheck. This technical support document (TSD) is designed to explain the technical basis for the COMcheck software as originally developed based on the ANSI/ASHRAE/IES Standard 90.1-1989 (Standard 90.1-1989). Documentation for other national model codes and standards and specific state energy codes supported in COMcheck has been added to this report as appendices. These appendices are intended to provide technical documentation for features specific to the supported codes and for any changes made for state-specific codes that differ from the standard features that support compliance with the national model codes and standards. Beginning with COMcheck version 3.8.0, support for 90.1-1989, 90.1-1999, and the 1998 IECC and version 3.9.0 support for 2000 and 2001 IECC are no longer included, but those sections remain in this document for reference purposes.

  16. Samaru Journal of Information Studies Vol.9 (1)2009 A Bibliometric ...

    African Journals Online (AJOL)

    Abstract. This study examines the publication patterns of agricultural research scientists of the Institute for Agricultural. Research, Ahmadu Bello University, Zaria. Data collected were from database of the institute's publications and randomly selected peer reviewed journals, proceedings, seminars, theses, workshops and ...

  17. BN~r" .wU1!9 1\\ I

    Indian Academy of Sciences (India)

    email, postal and residential address, telephone numbers, academic qualifications starting from B.Sc 'onwards, teaching experience, courses taught, positions held and a statement indicating reasons for interest in participating in the course. Teachers applying for participation are also requested to indicate that necessary ...

  18. Kunhua et al., Afr J Tradit Complement Altern Med. (2012) 9(1):43 ...

    African Journals Online (AJOL)

    AJTCAM

    (20%), o-xylene (20%) and ethyl benzene (6-20%) and traces of toluene, trimethyl benzene, phenol, thiophene, pyridine and hydrogen sulfide. A large number of animal studies have ... Vegetable oils (e.g. olive oil and coconut oil) have been documented to have potentials of being used as clearing agents; however, ...

  19. 26 CFR 1.381(c)(9)-1 - Amortization of bond discount or premium.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Amortization of bond discount or premium. 1.381... bond discount or premium. (a) Carryover requirement. If, in a transaction to which section 381(a... transferor corporation which were issued at a discount or premium, then under the provisions of section 381(c...

  20. 9-1-1 responses for shopping cart and stroller injuries.

    Science.gov (United States)

    Vilke, Gary M; Stepanski, Barbara M; Ray, Leslie Upledger; Lutz, Margaret W; Murrin, Patricia A; Chan, Theodore C

    2004-10-01

    On average, 24,000 children a year are treated in the emergency departments (EDs) for shopping cart injuries, with over 650 children a year requiring hospital admission. The authors sought to evaluate the incidence and outcomes of children in the community evaluated by paramedics because they were injured in shopping cart or stroller-related incidences. Retrospective design in which prehospital patients records were searched for all patients under 14 years old who were injured in an incident involving a shopping cart or stroller and were responded to by paramedics. Records were reviewed for demographics, injury type, and disposition. During the 3 1/2 year study period, a total of 241 cases were identified with 120 being shopping cart-related and 121 stroller-related. The most frequent ages for stroller injuries were 0 to 6 months and for shopping cart injuries was one year of age. Falls were the most common mechanism of injury, 70.3% for shopping carts and 47.5% for strollers, with head injuries accounting for 53% and 59% of the primary injuries in each group. An additional 12% and 18% suffered primary facial injuries. 77% of patients were transported by paramedics to an ED for evaluation, with 19% of parents signing out against medical advice. 8.2% were admitted to the hospital and there were no deaths. Shopping cart and stroller-related injuries are a common mechanism of injury for pediatric patients responded to by paramedics. This is an area which continued parental education is needed.

  1. WIE SE GROND KOOP BOAS (RUT 4:9)? 1. INLEIDING EN ...

    African Journals Online (AJOL)

    London: Darton, Long- man & Todd. ELLIGER K & RUDOLPH W (REDS.) 1983. Biblia Hebraica Stuttgartensia. Stuttgart: Deutsche Bibelgesellschaft. GORDIS R. 1974. Love, marriage and business in the Book of Ruth: a chapter in Hebrew. Customary Law. In: H.N. Bream, R.D. Heim & C.A. Moore (eds.), A light unto my.

  2. Page 1 Nigerian Journal of Clinical Practice June 2006: Vol 9 (1): 91 ...

    African Journals Online (AJOL)

    plasma cells were binucleated with inconspicuous nucleoli. A few others showed accumulation of prominent cytoplasmic vacuoles. Bone marrow histology confirmed mild plasmacytosis. A comprehensive myeloma work-up was initiated. Total skeletal survey with chest thoracolumbar, pelvic X-ray were all normal. There was ...

  3. Ethiop. J. Sci. & Technol. 9(1) 15-30, 2016 15 Prevalence of ...

    African Journals Online (AJOL)

    ABSTRACT. Diarrheal diseases cause about 3 million deaths annually, mainly to children under five years of age. This study determined the prevalence of diarrhea causing intestinal protozoans and the associated risk factors in diarrheic children aged below five years in Bahir Dar town, Ethiopia. From November 2011 to ...

  4. afr. j. cln. exper. mkcrobol. 9(1):- 59-61

    African Journals Online (AJOL)

    Department of Medical Microbiology,. University of Ikorin ... Assessment for Chlarydia IgG with Enzyme-Linked Immunosorhent Assay (ELISA) using Immunocomb. (Organics, Israel) ... increase in wound size, failure of wound to heal and production of ...

  5. 78 FR 21879 - Improving 9-1-1 Reliability; Reliability and Continuity of Communications Networks, Including...

    Science.gov (United States)

    2013-04-12

    ... outages during the ``derecho'' windstorm that affected large portions of the United States in June 2012... (PSHSB or Bureau) January 10, 2013, report titled Impact of the June 2012 Derecho on Communications Networks and Services: Report and Recommendations (Derecho Report), which is available at http://www.fcc...

  6. The Central Point Source in G76. 9+ 1.0

    Indian Academy of Sciences (India)

    However, no pulsed radio emission was detected despite deep searches at 610 MHz and 1160 MHz – which can be understood to be due to temporal broadening of the pulses. Weak pulsed emission has indeed been seen at 2 GHz with the Green Bank Telescope (GBT), establishing the fact that scattering is responsible ...

  7. D7.9.1 (Final) Reports and recommendations for a collaboratory for kaleidoscope

    DEFF Research Database (Denmark)

    Derycke, Alain; Dirckinck-Holmfeld, Lone; Peter, Yvan

    2006-01-01

    The Shared Virtual laboratory (SVL) is one of the efforts of the Kaleidoscope, a European network of excellence, to promote and support scientific collaboration inside the networks of partners. It can be seen at this stage as a virtual place to facilitate collaboration around several research...

  8. 26 CFR 9.1 - Investment credit-public utility property elections.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Investment credit-public utility property... Investment credit—public utility property elections. (a) Applicability of prior election under section 46(f... respect to public utility property described in section 46(f)(5) by reason of sections 301 and 302 of the...

  9. 26 CFR 1.401(a)(9)-1 - Minimum distribution requirement in general.

    Science.gov (United States)

    2010-04-01

    ... or state and local government employees are subject to required minimum distribution rules. Q-2... employee under the plan for purposes of determining the distribution period under section 401(a)(9). (d... distributions commencing after an employee's death will be required to be made under the default provision set...

  10. 40 CFR 9.1 - OMB approvals under the Paperwork Reduction Act.

    Science.gov (United States)

    2010-07-01

    ... an amendment published at 75 FR 29431, May 26, 2010. Link to an amendment published at 75 FR 35986...-78 2060-0104 86.438-78 2060-0104 86.439-78 2060-0104 86.440-78 2060-0104 86.445-2006 2060-0104 86.446....15 2040-0230 435.43 2040-0230 435.45 2040-0230 Pharmaceutical Manufacturing Point Source Category 439...

  11. (Z)-9-(1,2-Dichloro-vin-yl)-9H-carbazole.

    Science.gov (United States)

    Ukai, Miho; Tabata, Hideyuki; Okuno, Tsunehisa

    2013-04-01

    There are two independent mol-ecules in the asymmetric unit of the title compound, C14H9Cl2N, in which the dihedral angles between the dichloro-vinyl unit (r.m.s. deviations = 0.0003 and 0.0009 Å), and the carbazole ring are 87.77 (3) and 72.90 (3)°.

  12. Arizona Public Service Company: the baghouse pilot program. Paper 81. 9. 1

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, E.; Vaklyes, J.; Osborn, D.; Singh, U.

    1981-01-01

    An evaluation of the precipitators and baghouses used at steam generators with boilers that are fueled by pulverized coal, is made. In order to prevent outages due to cleaning, the baghouse system was developed to replace precipitators. Fabric filters were used capable of reverse-air cleaning with mininmum of maintenance.

  13. 26 CFR 1.501(c)(9)-1 - Voluntary employees' beneficiary associations, in general.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Voluntary employees' beneficiary associations, in... Voluntary employees' beneficiary associations, in general. To be described in section 501(c)(9) an organization must meet all of the following requirements: (a) The organization is an employees' association, (b...

  14. 26 CFR 31.3121(a)(9)-1 - Payments to employees for nonwork periods.

    Science.gov (United States)

    2010-04-01

    ... for a period throughout which the employment relationship exists between the employer and the employee... is a woman to whom the payment is made before November 1956, or (2) The employee attains age 62, if the employee is a man to whom the payment is made after December 1974, or if the employee is a woman...

  15. Dial 9-1-1 for p53: Mechanisms of p53 Activation by Cellular Stress

    OpenAIRE

    Ljungman, Mats

    2000-01-01

    The tumor suppressor protein, p53, is part of the cell's emergency team that is called upon following cellular insult. How do cells sense DNA damage and other cellular stresses and what signal transduction pathways are used to alert p53? How is the resulting nuclear accumulation of p53 accomplished and what determines the outcome of p53 induction? Many posttranslational modifications of p53, such as phosphorylation, dephosphorylation, acetylation and ribosylation, have been shown to occur fol...

  16. Influência dos parâmetros de tratamento térmico pós-soldagem nas propriedades mecânicas e na microestrutura de um tubo da liga ASTM A 335 Gr P91 (9Cr1Mo)

    OpenAIRE

    Emerson Andre Pinto Bento

    2015-01-01

    A importância das indústrias de cana-de-açúcar no cenário nacional cresce exponencialmente, desde sua origem. Porém nas últimas três décadas este tipo de indústria deixou de ser tipicamente familiar e passou a produzir em grande escala açúcar, etanol, produtos químicos derivados, levedura e planta de CO2 (para indústria de bebida e ou alimentos), além da venda do excedente da energia que é gerada na própria indústria. Um dos principais equipamentos em uma usina de açúcar e álcool é a caldeira...

  17. CCDC 1438644: Experimental Crystal Structure Determination : 9-(1-(t-Butylperoxy)heptyl)-9H-carbazole

    KAUST Repository

    Wang, Xinbo

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  18. Minutes of the Tank Waste Science Panel meeting July 9--1, 1991. Hanford Tank Safety Project

    Energy Technology Data Exchange (ETDEWEB)

    Strachan, D.M. [comp.

    1992-04-01

    The fifth meeting of the Tank Waste Science Panel was held July 9--11, 1991, in Atlanta, Georgia. The subject areas included the generation, retention, and release of gases from Tank 241-SY-101 and the chemistry of ferrocyanide wastes.

  19. Next Generation 9-1-1: Policy Implications of Incident Related Imagery on the Public Safety Answering Point

    Science.gov (United States)

    2017-03-01

    communications center administrators and trainers have done little to prepare their personnel for the arrival of these technologies...Trident), football at Peter B’s, Texas Hold ‘Em mid-IR, countless cups of Starbucks coffee, and of course, Manny’s Cuban brew. Each of you made this...911- issues/standards.html. 2 PSAP, and educates and makes recommendations to communications center management, administration , and training center

  20. Pollution: Problems and Solutions. Grade Nine, Unit One, 9.1 Comprehensive Social Studies Curriculum for the Inner City.

    Science.gov (United States)

    Jamison, Sandra; Campbell, Bruce

    The ninth grade unit of the FICSS series (Focus on Inner City Social Studies -- see SO 008 271) studies the economic and political realities of the inner city. This document, the first unit of the 9th grade section, deals with the ecological crises involving pollution and its causes. Specific problems include air pollution, pesticides, herbicides,…

  1. Economies of Scale: 9-1-1 Center Consolidation as a Means to Strengthen the Homeland Security Enterprise

    Science.gov (United States)

    2014-03-01

    associated with the following jurisdictions/regions:  Barnstable County, Massachusetts20  City of Parma , Ohio21  Cities of Ashland and Wooster...provide 130EC oversight. Membership: The BOEC Advtsory Board shall c<’ns;st of the go,·crning official for each u:;er jurisdiction: MayN of Grc~ ham

  2. Adeniji et al., Afr. J. Infect. Dis. (2015) 9(1): 1 – 5 http://dx.doi.org ...

    African Journals Online (AJOL)

    AJTCAM

    Background: Poliovirus outbreaks are still reported in Nigeria despite renewed efforts to improve vaccine coverage, thus suggesting the existence of susceptible hosts. Also, there is anecdotal evidence of variation in vaccine coverage by region and specifically between urban and rural communities. Consequently, this study ...

  3. UNIVERSITY RESEARCH PROGRAM IN ROBOTICS, Final Technical Annual Report, Project Period: 9/1/04 - 8/31/05

    Energy Technology Data Exchange (ETDEWEB)

    James S. Tulenko; Carl D. Crane III

    2006-02-15

    The University Research Program in Robotics (URPR) Implementation Plan is an integrated group of universities performing fundamental research that addresses broad-based robotics and automation needs of the NNSA Directed Stockpile Work (DSW) and Campaigns. The URPR mission is to provide improved capabilities of robotics science and engineering to meet the future needs of all weapon systems and other associated NNSA/DOE activities.

  4. Time-to-event analysis as a framework for quantifying fish passage performance: Chapter 9.1

    Science.gov (United States)

    Castro-Santos, Theodore R.; Perry, Russell W.; Adams, Noah S.; Beeman, John W.; Eiler, John H.

    2012-01-01

    Fish passage is the result of a sequence of processes, whereby fish must approach, enter, and pass a structure. Each of these processes takes time, and fishway performance is best quantified in terms of the rates at which each process is completed. Optimal performance is achieved by maximizing the rates of approach, entry, and passage through safe and desirable routes. Sometimes, however, it is necessary to reduce rates of passage through less desirable routes in order to increase proportions passing through the preferred route. Effectiveness of operational or structural modifications for achieving either of these goals is best quantified by applying time-to-event analysis, commonly known as survival analysis methods, to telemetry data. This set of techniques allows for accurate estimation of passage rates and covariate effects on those rates. Importantly, it allows researchers to quantify rates that vary over time, as well as the effects of covariates that also vary over time. Finally, these methods are able to control for competing risks, i.e., the presence of alternate passage routes, failure to pass, or other fates that remove fish from the pool of candidates available to pass through a particular route. In this chapter, we present a model simulation of telemetered fish passing a hydroelectric dam, and provide step-by-step guidance and rationales for performing time-to-event analysis on the resulting data. We demonstrate how this approach removes bias from performance estimates that can result from using methods that focus only on proportions passing each route. Time-to-event analysis, coupled with multinomial models for measuring survival, provides a comprehensive set of techniques for quantifying fish passage, and a framework from which performance among different sites can be better understood.

  5. US Voluntary Observing Ship (VOS) - International Maritime Meteorological Tape (IMMT) data from SEAS version 9.1 E-Logbook Software

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The US Voluntary Observing Ships (VOS) report surface marine observations in both real-time (FM-13 ship format) and delayed-mode (International Maritime...

  6. Influence of heat treatment on microstructure and properties of GX12CrMoVNbN9-1 cast steel

    Directory of Open Access Journals (Sweden)

    G. Golański

    2010-07-01

    Full Text Available The paper presents results of research on the influence of multistage heat treatment on microstructure and properties of high-chromiummartensitic GX12CrMoVNbN9 – 1 (GP91 steel. The material under investigation were samples taken out from a test coupon. Heattreatment of GP91 cast steel was performed at the parameters of temperature and time typical of treatment for multi-ton steel casts. The research has proved that in the as-received condition (as-cast state GP91 cast steel was characterized by a coarse grain, martensitic microstructure which provided the required standard mechanical properties. The heat treatment of GP91 cast steel contributed to obtainment of a fine grain microstructure of high tempered martensite with numerous precipitations of carbides of diverse size. The GP91 cast steel structure received through heat treatment made it possible to obtain high plastic properties, particularly impact strength, maintaining strength properties on the level of the required minimum.

  7. Prehospital Trauma Triage Decision-making: A Model of What Happens between the 9-1-1 Call and the Hospital.

    Science.gov (United States)

    Jones, Courtney Marie Cora; Cushman, Jeremy T; Lerner, E Brooke; Fisher, Susan G; Seplaki, Christopher L; Veazie, Peter J; Wasserman, Erin B; Dozier, Ann; Shah, Manish N

    2016-01-01

    We describe the decision-making process used by emergency medical services (EMS) providers in order to understand how 1) injured patients are evaluated in the prehospital setting; 2) field triage criteria are applied in-practice; and 3) selection of a destination hospital is determined. We conducted separate focus groups with advanced and basic life support providers from rural and urban/suburban regions. Four exploratory focus groups were conducted to identify overarching themes and five additional confirmatory focus groups were conducted to verify initial focus group findings and provide additional detail regarding trauma triage decision-making and application of field triage criteria. All focus groups were conducted by a public health researcher with formal training in qualitative research. A standardized question guide was used to facilitate discussion at all focus groups. All focus groups were audio-recorded and transcribed. Responses were coded and categorized into larger domains to describe how EMS providers approach trauma triage and apply the Field Triage Decision Scheme. We conducted 9 focus groups with 50 EMS providers. Participants highlighted that trauma triage is complex and there is often limited time to make destination decisions. Four overarching domains were identified within the context of trauma triage decision-making: 1) initial assessment; 2) importance of speed versus accuracy; 3) usability of current field triage criteria; and 4) consideration of patient and emergency care system-level factors. Field triage is a complex decision-making process which involves consideration of many patient and system-level factors. The decision model presented in this study suggests that EMS providers place significant emphasis on speed of decisions, relying on initial impressions and immediately observable information, rather than precise measurement of vital signs or systematic application of field triage criteria.

  8. Modified 9% Cr steel (grade P9. 1): Low cycle fatigue and crack propagation rate of base material and welds at room and high temperature

    Energy Technology Data Exchange (ETDEWEB)

    Vanderschaeghe, A.; Gabrel-Cousaert, C.; Lecoq, J.

    1992-01-01

    The low-cycle fatigue properties of weldment have been studied at 550deg C. The base material behaves the best, the main difference between in three zones of the weldment lies in the behaviour in the plastic range. The authors have studied the threshold values and crack growth rates for weldment at 20deg C and 550deg C for R = 0,1. The results show an increase of the crack growth rate of a factor 3 between room temperature and 550deg C. Moreover at 550deg C the influence of the ratio R has been studied only for base material in the range of 0,05 to 0,7. For values of R up to 0,4 the threshold values are related to oxide induced closure theory. (orig.).

  9. Influence of stress relief annealing on the microstructure and properties of GX12CrMoVNbN9-1(GP91 cast steel

    Directory of Open Access Journals (Sweden)

    G. Golański

    2011-04-01

    Full Text Available The paper presents an effect of stress relief annealing, applied to casts after the repair by welding, on the microstructure and mechanical properties of quenched and tempered martensitic GX12CrMoVNbN9 – 1 cast steel (called GP91. The test pieces being the subject of research were taken out from a test coupon. Heat treatment of GP91 cast steel was carried out at the parameters of temperature and time appropriate for the treatment of multi-ton steel casts, while stress relief annealing was performed at the temperatures of 730 and 750oC.After quenching and tempering GP91 cast steel was characterized by the microstructure of high-tempered martensite with numerousprecipitations of carbides of diverse size. Mechanical properties of the investigated cast steel after heat treatment fulfilled the standard requirements. Stress relief annealing contributes to the processes of recovery and recrystallization of the matrix as well as the privileged precipitation of M23C6 carbides on grain boundaries. Changes in the microstructure of the examined cast steel cause deterioration in mechanical properties – the higher the temperature of stress relief annealing, the greater the deterioration.

  10. Effects of Electromagnetic Field Over a Human Body, Sar Simulation with and Without Nanotextile in the Frequency Range 0.9-1.8GHZ

    Science.gov (United States)

    Tomovski, Boyan; Gräbner, Frank; Hungsberg, Axel; Kallmeyer, Christian; Linsel, Mario

    2011-11-01

    Within only the last decade, usage of mobile phones and many other electronic devices with high speed wireless RF connection is rapidly increasing. Modern life requires reliable, quick and high-quality information connections, which explains the widely spreading craze for electronic mobile devices of various types. The vast technological advances we are witnessing in electronics, electro-optics, and computer science have profoundly affected our everyday lives. Meanwhile, safety concerns regarding the biological effects of electromagnetic (EM) radiation have been raised, in particular at a low level of exposure which we everyday experience. A variety of waves and signals have to be considered such as different sine waves, digital signals used in radio, television, mobile phone systems and other information transfer systems. The field around us has become rather complicated and the "air space is getting more and more dense with RF. The establishing of safety recommendations, law norms and rules augmented by adequate measurements is very important and requires quite an expertise. But as many scientific researches suggest, what we are currently witnessing is very likely to generate a great public danger and a bad influence over the human body. There are many health organisations warning the public for possible development of cancer, mental and physical disorders etc [7, 8]. These suggestions are quite serious and should not be neglected by the official bodies and the test laboratories. In the following work, the effects of electromagnetic field over a virtual model of a human head have been simulated in the frequency range from 900 MHz to 1800 MHz (commonly created in the real life by mobile GSM system) with the help of the program MEFiSTo 2D Classic [1]. The created virtual models using the 2D simulation & computation software proved that the use of new high tech nanotextile materials for shielding layers around the human body can reduce the effects of EM fields dramatically if chosen properly according to the area of application.

  11. Ramona cold nuclear bank of the Siemens 9x9-IX fuel; Banco nuclear Ramona Cold del combustible Siemens 9x9-1X

    Energy Technology Data Exchange (ETDEWEB)

    Alonso V, G. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1994-01-15

    With the purpose of making the transitory analyses of the Laguna Verde Nuclear Power station when Siemens fuel of the type 9x9-IX is used, proposed for the cycle 2 of the Unit 2, the data bank in cold condition for the Ramona code has been generated. (Author)

  12. Bering Sea Inner Front zooplankton data sets collected with CalVet net on four cruises from 6/3/1997 - 9/1/1998 (NODC Accession 0000103)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Zooplankton and other data were collected using CalVet net in Bering sea from ALPHA HELIX. Data were collected from 01 June 1997 to 01 September 1998 by University...

  13. 77 FR 45607 - 9-1-1 Resiliency and Reliability In Wake of, June 29, 2012, Derecho Storm In Central, Mid...

    Science.gov (United States)

    2012-08-01

    ... Resiliency and Reliability In Wake of, June 29, 2012, Derecho Storm In Central, Mid-Atlantic, [email protected] . SUPPLEMENTARY INFORMATION: Questions Regarding Derecho Impact, Effects, and Restoration... communications resiliency during strong storms like this? In what ways was the derecho an ``extraordinary'' event...

  14. 26 CFR 31.3401(a)(9)-1 - Remuneration for services performed by a minister of a church or a member of a religious order.

    Science.gov (United States)

    2010-04-01

    ... chaplain at N University. M devotes his entire time to performing his duties as chaplain which include the conduct of religious worship, offering spiritual counsel to the university students, and teaching a class..., conduct, and maintenance of religious organizations (including the religious boards, societies, and other...

  15. Global Near Real-Time Temperature and Salinity Profile Data from the GTSPP project from 9/1/1999 - 11/30/1999 (NODC Accession 0000059)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected using moored buoy, profiling floats, and XBT casts in a world wide distribution from 01 September 1999 to 30 November 1999....

  16. Development and testing of a high efficiency advanced coal combustor phase III industrial boiler retrofit. Quarterly technical progress report No. 9, 1 October 1993--31 December 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jennings, P.; Borio, R. [ABB/Combustion Engineering, Windsor, CT (United States); Scaroni, A.W.; Miller, B.G. [Penn State Univ., University Park, PA (United States); McGowan, J.G. [Univ. of Massachusetts, Amherst, MA (United States)

    1994-03-01

    This report documents the technical aspects of this project during the ninth quarter of the program. During this quarter, the natural gas baseline testing at the Penn State demonstration boiler was completed, results were analyzed and are presented here. The burner operates in a stable manner over an 8/1 turndown, however due to baghouse temperature limitations (300{degrees}F for acid dewpoint), the burner is not operated for long periods of time below 75% load. Boiler efficiency averaged 83.1% at the 100 percent load rate while increasing to 83.7% at 75% load. NO{sub x} emissions ranged from a low of 0.17 Lbs/MBtu to a high of 0.24 Lbs/MBtu. After the baseline natural gas testing was completed, work continued on hardware optimization and testing with the goal of increasing carbon conversion efficiency on 100% coal firing from {approx}95% to 98%. Several coal handling and feeding problems were encountered during this quarter and no long term testing was conducted. While resolving these problems several shorter term (less than 6 hour) tests were conducted. These included, 100% coal firing tests, 100% natural gas firing tests, testing of air sparges on coal to simulate more primary air and a series of cofiring tests. For 100% coal firing, the carbon conversion efficiency (CCE) obtained this quarter did not exceed the 95-96% barrier previously reached. NO{sub x} emissions on coal only ranged from {approx} 0.42 to {approx} 0.78 Lbs/MBtu. The burner has not been optimized for low NO{sub x} yet, however, due to the short furnace residence time, meeting the goals of 98% CCE and <0.6 Lbs/MBtu NO{sub x} simultaneously will be difficult. Testing on 100% natural gas in the boiler after coal firing indicated no changes in efficiency due to firing in a `dirty` boiler. The co-firing tests showed that increased levels of natural gas firing proportionately decreased NO{sub x}, SO{sub 2}, and CO.

  17. Geochemical analysis of the sealing system. Technical Report to work package 9.1.2. Preliminary safety case of the Gorleben site (VSG)

    Energy Technology Data Exchange (ETDEWEB)

    Xie, Mingliang; Herbert, Horst-Juergen

    2012-02-15

    The geochemical reaction simulation of ground water and brines with sealing materials for a proposed repository at the Gorleben site is a task under the framework of the VSG project. The calculations presented in this report are aimed to provide a preliminary evaluation of the geochemical stability of three potential engineering barrier materials foreseen in the shaft sealing system in case of groundwater and brine intrusion. The long-term stability of these materials is a key issue for the sealing function of the shaft seals. This is governed by many factors such as geotechnical, hydraulic and geochemical processes. In order to better understand the potential effect of geochemical processes on the long-term properties of these sealing materials, geochemical simulations of the potential interactions between groundwater and brine and shaft sealing materials were performed.

  18. 26 CFR 31.3121(b)(9)-1 - Railroad industry; services performed by an employee or an employee representative as defined in...

    Science.gov (United States)

    2010-04-01

    ... defined in section 3231, are excepted from employment. For definitions of employee and employee... Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Federal Insurance...

  19. 26 CFR 31.3306(c)(9)-1 - Railroad industry; services performed by an employee or an employee representative under the...

    Science.gov (United States)

    2010-04-01

    ... and engaged in the performance of services in connection with or incidental to railroad transportation...) he acts in the capacity of a general chairman or an assistant general chairman of a general committee... remuneration, including pay for time lost but excluding tips, paid for services rendered as an employee to one...

  20. University Research Program in Robotics - "Technologies for Micro-Electrical-Mechanical Systems in directed Stockpile Work (DSW) Radiation and Campaigns", Final Technical Annual Report, Project Period 9/1/06 - 8/31/07

    Energy Technology Data Exchange (ETDEWEB)

    James S. Tulenko; Carl D. Crane

    2007-12-13

    The University Research Program in Robotics (URPR) is an integrated group of universities performing fundamental research that addresses broad-based robotics and automation needs of the NNSA Directed Stockpile Work (DSW) and Campaigns. The URPR mission is to provide improved capabilities in robotics science and engineering to meet the future needs of all weapon systems and other associated NNSA/DOE activities.

  1. A 9.1 ka long continuous tree-ring width chronology as a base for analyses on the environmental and climatic evolution in the Alps during the Holocene

    Science.gov (United States)

    Nicolussi, K.; Joerin, U. E.; Patzelt, G.; Thurner, A.; Melvin, T. M.; Schluechter, C.

    2009-04-01

    An ultra-long tree-ring width chronology (9111 years long, 7109 B.C. to A.D. 2002) has been established based on the analysis and dating of 1432 sub-fossil/dry-dead wood samples and cores from 335 living trees. The material was collected from tree-line or near-tree-line sites (c. 2000 to 2400 m a.s.l.) mainly in the central eastern Alps. This tree-ring chronology is the longest continuous high-mountain chronology in the world. The subfossil/dry-dead samples belong to different conifer species: samples of the species stone pine (Pinus cembra L.) dominate the mixture by more than 80%, larch (Larix decidua Mill.) and spruce (Picea abies L.) samples have only minor fractions (16% and 2%, respectively). Additionally two floating tree-ring chronologies were established for the first section of the Holocene. The dating of these two series each some 600 year long is based on wiggle-matching of radiocarbon dates. Knowledge of the Holocene environmental and climatic evolution in the Alps has been improved using the absolutely dated Eastern Alpine Conifer Chronology (EACC). It was possible to dendrochronologically date wooden samples found on several Alpine glacier forefields. The samples analysed contain up to some 700 tree rings and usually date back into the early and middle Holocene. These wooden remains generally document multi-centennial to millennial long glacier retreat periods with glaciers extents smaller than at present. Tree remains found at several locations of the central Alps above the present tree line are indicating higher tree-line positions in the past. The sub-fossil stems with life-spans up to 300 years allowed the establishment of a dendrochronological record of the Holocene tree-line variability. Both records (glacier and tree-line) prove a long lasting Holocene climate optimum in the Alps around 7 ka BP. The abundance of sub-fossil samples through time at high elevated sites is influenced by Alpine forest history and is partly climatically controlled, as shown by comparisons of the sample depth record of the EACC with the Holocene glacier record. The similarity of variations over time between the sample depth record and the mid-Holocene GISP2 10Be record suggest a relationship between Holocene forest density at the Alpine tree-line and solar activity. This long tree-ring chronology will be used, along with the lastest dendroclimatological standardisation techniques, to establish estimates of the long-timescale variation of temperature in the high-altitude Alps over the Holocene.

  2. 9-(1H-Benzo[d]imidazol-2-yl-2,3,6,7-tetrahydro-1H,5H-pyrido[3,2,1-ij]quinoline

    Directory of Open Access Journals (Sweden)

    Gerardo García González

    2017-03-01

    Full Text Available The title compound, C19H19N3, is a 2-heteroaryl benzimidazole derivative obtained through a straightforward and efficient protocol starting from julolidine-9-carbaldehyde and 1,2-phenylendiamine. The mean planes of the heterocyclic moieties in the molecule, benzimidazole and julolidine, form a dihedral angle of 40.9 (1°. In the crystal, N—H...N hydrogen bonds link the imidazole rings, forming chains along the c-axis direction.

  3. (4R,11R-9-(1-hydroxypropan-2-yl-4,11-diphenyl-1,3,5,7,9-pentaazatricyclo[5.3.1.04,11]undecane-2,6-dithione

    Directory of Open Access Journals (Sweden)

    Meng Wang

    2011-08-01

    Full Text Available The asymmetric unit of the title compound, C21H23N5OS2, contains two independent chiral molecules. The two phenyl rings of one molecule form a dihedral angle of 51.95 (7° and the distance between their centroids is 4.345 (1 Å. In the other molecule, the phenyl rings form a dihedral angle of 58.79 (8° with a ring centroid–centroid distance of 4.435 (2 Å. An intramolecular O—H...N hydrogen bond occurs in each independent molecule. The crystal packing is stabilized by and intermolecular N—H...O and N—H...S hydrogen bonds and C—H...S interactions.

  4. ÿþM i c r o s o f t W o r d - a a m , 2 0 0 8 , v o l . 7 , N o . 2 , 9 1

    African Journals Online (AJOL)

    ÿþE m m a n u e l A m e h

    six siblings in a monogamous family. Trades in food stuffs, neither drinks alcohol nor insufflates tobacco. No significant family history. Physical examination showed no obvious respiratory distress and there was good social hearing. Normal nasal pyramid. There was a pale fleshy growth completely occluding the cavity of the.

  5. Google Scholar Out-Performs Many Subscription Databases when Keyword Searching. A Review of: Walters, W. H. (2009. Google Scholar search performance: Comparative recall and precision. portal: Libraries and the Academy, 9(1, 5-24.

    Directory of Open Access Journals (Sweden)

    Giovanna Badia

    2010-09-01

    Full Text Available Objective – To compare the search performance (i.e., recall and precision of Google Scholar with that of 11 other bibliographic databases when using a keyword search to find references on later-life migration. Design – Comparative database evaluation. Setting – Not stated in the article. It appears from the author’s affiliation that this research took place in an academic institution of higher learning. Subjects – Twelve databases were compared: Google Scholar, Academic Search Elite, AgeLine, ArticleFirst, EconLit, Geobase, Medline, PAIS International, Popline, Social Sciences Abstracts, Social Sciences Citation Index, and SocIndex. Methods – The relevant literature on later-life migration was pre-identified as a set of 155 journal articles published from 1990 to 2000. The author selected these articles from database searches, citation tracking, journal scans, and consultations with social sciences colleagues. Each database was evaluated with regards to its performance in finding references to these 155 papers.Elderly and migration were the keywords used to conduct the searches in each of the 12 databases, since these were the words that were the most frequently used in the titles of the 155 relevant articles. The search was performed in the most basic search interface of each database that allowed limiting results by the needed publication dates (1990-2000. Search results were sorted by relevance when possible (for 9 out of the 12 databases, and by date when the relevance sorting option was not available. Recall and precision statistics were then calculated from the search results. Recall is the number of relevant results obtained in the database for a search topic, divided by all the potential results which can be obtained on that topic (in this case, 155 references. Precision is the number of relevant results obtained in the database for a search topic, divided by the total number of results that were obtained in the database on that topic.Main Results – Google Scholar and AgeLine obtained the largest number of results (20,400 and 311 hits respectively for the keyword search, elderly and migration. Database performance was evaluated with regards to the recall and precision of its search results.Google Scholar and AgeLine also obtained the largest total number of relevant search results out of all the potential results that could be obtained on later-life migration (41/155 and 35/155 respectively. No individual database produced the highest recall for every set of search results listed, i.e., for the first 10 hits, the first 20 hits, etc. However, Google Scholar was always in the top four databases regardless of the number of search results displayed. Its recall rate was consistently higher than all the other databases when over 56 search results were examined, while Medline out-performed the others within the first set of 50 results.To exclude the effects of database coverage, the author calculated the number of relevant references obtained as a percentage of all the relevant references included in each database, rather than as a percentage of all 155 relevant references from 1990-2000 that exist on the topic. Google Scholar ranked fourth place, with 44% of the relevant references found. Ageline and Medline tied for first place with 74%.For precision, Google Scholar ranked eighth among the 12 databases when the complete set of search results was examined, but ranked third within the first 20 search results listed. Within the first 20, 55% of the search results were relevant. This precision rate put Google Scholar in third place, after Medline (80% and Academic Search Elite (70%.Google Scholar’s precision and recall statistics may have been positively affected by its search for a keyword in the full-text content of indexed articles, rather than just searching in the bibliographic records as is the case for the other 11 databases. The author re-calculated the recall and precision rates for a title search in Google Scholar using the same keywords, elderly and migration. Compared to the standard search on the same topic, there was almost no difference in recall or precision when a title search was performed and the first 50 results were viewed.Conclusion – Database search performance differs significantly from one field to another so that a comparative study using a different search topic might produce different search results from those summarized above. Nevertheless, Google Scholar out-performs many subscription databases – in terms of recall and precision – when using keyword searches for some topics, as was the case for the multidisciplinary topic of later-life migration. Google Scholar’s recall and precision rates were high within the first 10 to 100 search results examined. According to the author, “these findings suggest that a searcher who is unwilling to search multiple databases or to adopt a sophisticated search strategy is likely to achieve better than average recall and precision by using Google Scholar” (p. 16.The author concludes the paper by discussing the relevancy of search results obtained by undergraduate students. All of the 155 relevant journal articles on the topic of later-life migration were pre-selected based on an expert critique of the complete articles, rather than by looking at only the titles or abstracts of references as most searchers do. Instructors and librarians may wish to support the use of databases that increase students’ contact with high-quality research documents (i.e.., documents that are authoritative, well written, contain a strong analysis, or demonstrate quality in other ways. The study’s findings indicate that Google Scholar is an example of one such database, since it obtained a large number of references to the relevant papers on the topic searched.

  6. MINOR PARAMETERS NEEDED FOR INDIVIDUAL-DOSE CALCULATIONS: Final Report for Tasks 7.1, 7.2, 8.1, 8.2, 9.1, 9.2, and 9.3

    Energy Technology Data Exchange (ETDEWEB)

    Anspaugh, L. R.; Napier, Bruce A.

    2009-10-23

    This brief report documents the selection of parameters needed to support individual-dose calculations from 131I released into the environment with gaseous effluents from the Mayak Production Association.

  7. The Tyrolean Alps LTSER platform – providing scientific insights for better management of protected areas. eco.mont (Journal on Protected Mountain Areas Research)|eco.mont Vol. 9 No. 1 9 1|

    OpenAIRE

    Kerle, Sarah; Tappeiner, Ulrike

    2017-01-01

    In a fast-changing world, Long-Term Socio-Ecological Research (LTSER) promises to provide new understanding of society-nature interactions. Management of protected areas (PAs) relies heavily on such scientific knowledge to address complex issues. Since large areas within the Tyrolean Alps are under protection, close collaboration between scientists working in LTSER within the Tyrolean Alps and the managers of PAs would be very beneficial for appropriate area management.

  8. Arabidopsis CDS blastp result: AK063271 [KOME

    Lifescience Database Archive (English)

    Full Text Available proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (p58) (Transplantation antigen P91A) (Tum-P91A antigen) (Swiss-Prot:P14685) [Mus musculus] 1e-145 ...

  9. Cold distribution networks. Cold distribution by two-phase refrigerant fluid. Case of ice slurries; Reseaux de distribution de froid. Distribution de froid par fluide frigoporteur diphasique. Cas du coulis de glace stabilisee (2002 - 2004). Rapport final (1er juillet 2004). Programme energie. PRI 9.1

    Energy Technology Data Exchange (ETDEWEB)

    Lallemand, A. [Institut National des Sciences Appliquees (INSA), Centre de Thermique de Lyon (CETHIL), UMR 5008, 69 - Villeurbanne (France); Mercier, P. [CEA Grenoble, Groupement pour la Recherche sur les Echangeurs Thermiques (GRETH), 38 (France); Royon, L. [Paris-1 Univ., Lab. de Biorheologie et d' Hydrodynamique Physico-Chimique, 75 (France); Dumas, J.P. [L' Ecole Nationale Superieure en Genie des Technologies Industrielles, Lab. de Thermique Energetique et Procedes, 64 - Pau (France); Guilpart, J. [URGPAN/CEMAGRE, 33 - Bordeaux (France)

    2004-07-01

    This PRI aims to participate to the development of alternate solutions for refrigerant fluids, for the cold transport and more specially a two phase refrigerant fluid: the stabilized ice slurry. The research program presented three main axis: design, realization and characterization of stabilized ice slurry, experimental studies of transport and transfer properties, study of online measurement process of the solid content. A simulation has been realized to evaluate the energy efficiency of this refrigerant use. (A.L.B.)

  10. Is weight-based adjustment of automatic exposure control necessary for the reduction of chest CT radiation dose?

    Science.gov (United States)

    Prakash, Priyanka; Kalra, Mannudeep K; Gilman, Matthew D; Shepard, Jo-Anne O; Digumarthy, Subba R

    2010-01-01

    To assess the effects of radiation dose reduction in the chest CT using a weight-based adjustment of the automatic exposure control (AEC) technique. With Institutional Review Board Approval, 60 patients (mean age, 59.1 years; M:F = 35:25) and 57 weight-matched patients (mean age, 52.3 years, M:F = 25:32) were scanned using a weight-adjusted AEC and non-weight-adjusted AEC, respectively on a 64-slice multidetector CT with a 0.984:1 pitch, 0.5 second rotation time, 40 mm table feed/rotation, and 2.5 mm section thickness. Patients were categorized into 3 weight categories; 90 kg (n = 48). Patient weights, scanning parameters, CT dose index volumes (CTDIvol) and dose length product (DLP) were recorded, while effective dose (ED) was estimated. Image noise was measured in the descending thoracic aorta. Data were analyzed using a standard statistical package (SAS/STAT) (Version 9.1, SAS institute Inc, Cary, NC). Compared to the non-weight-adjusted AEC, the weight-adjusted AEC technique resulted in an average decrease of 29% in CTDIvol and a 27% effective dose reduction (p 91 kg weight groups, respectively, compared to 20.3, 27.9 and 32.8 mGy, with non-weight-adjusted AEC. No significant difference was observed for objective image noise between the chest CT acquired with the non-weight-adjusted (15.0 +/- 3.1) and weight-adjusted (16.1 +/- 5.6) AEC techniques (p > 0.05). The results of this study suggest that AEC should be tailored according to patient weight. Without weight-based adjustment of AEC, patients are exposed to a 17 - 43% higher radiation-dose from a chest CT.

  11. Gene : CBRC-PMAR-01-0365 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available protein 2 (BGL2) mRNA, complete cds /cds=p(91,1323) /gb=AF247828 /gi=11761732 /ug=Pma.6047 /len=3114 9e-18 41% MLYTLIYTLIYTLIYTL...IYTHIYTHIYTYKHSYIHVYIHTYIYTYIHSYIHLYTLIYTLIYTLINTHIYTYIYTHLYIHLYTLIYTLIYTL...IHTLFYIYTYIYTYIYTLIYTLIYALIYTLIYTLIYTYIYTYIYTLIYALIYTLIYTLMYTYIYTDIYRLIYALICTRIYIHSYRLVYTLIYEVIYTLIYTLIYTLIYTRI ...

  12. Pierre Gorce working on a helium pump.

    CERN Multimedia

    1975-01-01

    This type of pump was designed by Mario Morpurgo, to circulate liquid helium in superconducting magnets wound with hollow conductors. M. Morpurgo, Design and construction of a pump for liquid helium, CRYIOGENICS, February 1977, p. 91

  13. Preliminary analysing of experimental data for the development of high Cr Alloy Creep damage Constitutive Equations

    OpenAIRE

    An, Lili; Xu, Qiang; Xu, Donglai; Lu, Zhongyu

    2012-01-01

    This conference paper presents the current research of preliminary analysing of experimental data for the development of high Cr Alloy Creep damage Constitutive Equations (such as P91 alloy). Firstly, it briefly introduces the background of general creep deformation, rupture and continuum damage mechanics. Secondly, it illustrates the constitutive equations used for P91 alloy or its weldment, especially of the form and deficiencies of two kinds of most widely used typical creep damage constit...

  14. Crystal structures and supra-molecular features of 9,9-dimethyl-3,7-di-aza-bicyclo-[3.3.1]nonane-2,4,6,8-tetra-one, 3,7-di-aza-spiro-[bi-cyclo-[3.3.1]nonane-9,1'-cyclo-penta-ne]-2,4,6,8-tetra-one and 9-methyl-9-phenyl-3,7-di-aza-bicyclo-[3.3.1]nonane-2,4,6,8-tetra-one di-methyl-formamide monosolvate.

    Science.gov (United States)

    Vatsadze, Sergey Z; Manaenkova, Marina A; Vasilev, Evgeny V; Venskovsky, Nikolai U; Khrustalev, Victor N

    2017-07-01

    Compounds (I), C9H10N2O4, (II), C11H12N2O4, and (III), C14H12N2O4·C3H7NO represent 9,9-disubstituted-3,7-di-aza-bicyclo-[3.3.1]nonane-2,4,6,8-tetra-one deriv-atives with very similar mol-ecular geometries for the bicyclic framework: the dihedral angle between the planes of the imide groups is 74.87 (6), 73.86 (3) and 74.83 (6)° in (I)-(III), respectively. The dimethyl derivative (I) is positioned on a crystallographic twofold axis and its overall geometry deviates only slightly from idealized C2v symmetry. The spiro-cyclo-pentane derivative (II) and the phen-yl/methyl analog (III) retain only inter-nal Cs symmetry, which in the case of (II) coincides with crystallographic mirror symmetry. The cyclo-pentane moiety in (II) adopts an envelope conformation, with the spiro C atom deviating from the mean plane of the rest of the ring by 0.548 (2) Å. In compound (III), an N-H⋯O hydrogen bond is formed with the di-methyl-formamide solvent mol-ecule. In the crystal, both (I) and (II) form similar zigzag hydrogen-bonded ribbons through double inter-molecular N-H⋯O hydrogen bonds. However, whereas in (I) the ribbons are formed by two trans-arranged O=C-N-H amide fragments, the amide fragments are cis-positioned in (II). The formation of ribbons in (III) is apparently disrupted by participation of one of its N-H groups in hydrogen bonding with the solvent mol-ecule. As a result, the mol-ecules of (III) form zigzag chains rather than the ribbons through inter-molecular N-H⋯O hydrogen bonds. The crystal of (I) was a pseudo-merohedral twin.

  15. Thermodynamic study of (alkyl esters+{alpha},{omega}-alkyl dihalides) III. H{sub m}{sup E}andV{sub m}{sup E} for 20 binary mixtures {l_brace}xC{sub u-1}H{sub 2u-1}CO{sub 2}C{sub 4}H{sub 9}+(1-x){alpha},{omega}-ClCH{sub 2}(CH{sub 2}){sub v-2}CH{sub 2}Cl{r_brace}, where u=1 to 4, {alpha}=1 and v={omega}=2 to 6

    Energy Technology Data Exchange (ETDEWEB)

    Ortega, J. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario Tafira, Universidad de Las Palmas de Gran Canaria, 35071-Las Palmas de Gran Canaria, Canary Islands (Spain)]. E-mail: jortega@dip.ulpgc.es; Marrero, E. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario Tafira, Universidad de Las Palmas de Gran Canaria, 35071-Las Palmas de Gran Canaria, Canary Islands (Spain); Toledo, F.J. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario Tafira, Universidad de Las Palmas de Gran Canaria, 35071-Las Palmas de Gran Canaria, Canary Islands (Spain)

    2006-09-15

    In this article, the experimental data of excess molar enthalpies H{sub m}{sup E} and excess molar volumes V{sub m}{sup E} are presented for a set of 20 binary mixtures comprised of the first four butyl alkanoates (methanoate to butanoate) and five {alpha},{omega}-dichloroalkanes (1,2-dichloroethane to 1,6-dichlorohexane), obtained at atmospheric pressure and at a temperature of 298.15K. The results indicate the existence of specific interactions between both kinds of compounds resulting in exothermic processes for most mixtures, except for those containing butyl methanoate which give rise to net endo/exothermic effects. The V{sub m}{sup E} are positive for mixtures of (butyl esters+1,2-dichloroethane or 1,3-dichloropropane) and negative for the remaining ones. The change in H{sub m}{sup E} with the dichloroethane chain length for a same ester is regular although the V{sub m}{sup E} presents an irregular variation. It can, therefore, be deuced from this that the mixing process involves both effects, exothermic/endothermic and expansion/contraction, simultaneously. The behaviour of the mixtures is interpreted on the basis of the results observed and attributed to different effects taking place among the molecules studied. To improve application of the UNIFAC model using the version of Dang and Tassios, average values were recalculated again for parameters of the ester/chloride interaction, distinguishing, during its application, the functional group of the acid part of the ester. In spite of this, the model does not adequately reproduce the systems' behaviour.

  16. Microstructures of friction surfaced coatings. A TEM study; Gefuege durch Reibauftragschweissen aufgetragener Beschichtungen. Eine TEM-Untersuchung

    Energy Technology Data Exchange (ETDEWEB)

    Akram, Javed; Kalvala, Prasad Rao; Misra, Mano [Utah Univ., Salt Lake City, UT (United States). Dept. of Metallurgical Engineering; Dilip, J. John Samuel [Louisville Univ., KY (United States). Dept. of Industrial Engineering; Pal, Deepankar; Stucker, Brent [Louisville Univ., KY (United States). Dept. of Industrial Engineering; 3D Sim, Park City, UT (United States)

    2016-05-15

    The microstructures of dissimilar metal welds between 9Cr-1Mo (Modified) (P91) and austenitic stainless steel (AISI 304) with Ni-based alloy interlayers (Inconel 625, Inconel 600 and Inconel 800H) are reported. These interlayers were deposited by the friction surfacing method one over the other on P91 alloy, which was finally friction welded to AISI 304. In this paper, the results of microstructural evolution in the friction surfaced coated interlayers (Inconel 625, 600, 800H) are reported. For comparative purposes, the microstructures of consumable rods (Inconel 625, 600, 800H) and dissimilar metal base metals (P91 and AISI 304) were also reported. Friction surfaced coatings exhibited dynamic recrystallization. In friction surfaced coatings, the carbide particles were found to be finer and distributed uniformly throughout the matrix, compared to their rod counterparts.

  17. XRD and TEM analysis of microstructure in the welding zone of 9Cr ...

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Under the condition of tungsten inert gas shielded welding (TIG) + shielded metal arc welding. (SMAW) technology, the microstructure in the welding zone of 9Cr–1Mo–V–Nb (P91) heat-resisting steel is studied by means of X-ray diffractometry (XRD) and transmission electron microscopy (TEM). The test.

  18. 40 CFR 721.840 - Alkyl substituted diaromatic hydrocarbons.

    Science.gov (United States)

    2010-07-01

    ... hydrocarbons. 721.840 Section 721.840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Specific Chemical Substances § 721.840 Alkyl substituted diaromatic hydrocarbons. (a) Chemical substance... alkyl substituted di-aro-matic hydrocarbons (PMN P-91-710) is subject to reporting under this section...

  19. Philosophy of Psychopharmacology

    African Journals Online (AJOL)

    models of disorder. At the same time, he argues that “…we have to go beyond a natural science perspective e on the way the body and the brain work, to include also a consideration of human practices and values.” (p. 91). This is clearly relevant to the controversies surrounding the nature and treatment of mood disorders ...

  20. 40 CFR 721.3680 - Ethylene oxide adduct of fatty acid ester with pentaerythritol.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Ethylene oxide adduct of fatty acid... New Uses for Specific Chemical Substances § 721.3680 Ethylene oxide adduct of fatty acid ester with... identified generically as ethylene oxide adduct of fatty acid ester with pentaerythritol (PMN P-91-442) is...

  1. 40 CFR 721.7000 - Polymer of disodium maleate, allyl ether, and ethylene oxide.

    Science.gov (United States)

    2010-07-01

    ... ether, and ethylene oxide. 721.7000 Section 721.7000 Protection of Environment ENVIRONMENTAL PROTECTION... ethylene oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as a polymer of disodium maleate, allyl ether, and ethylene oxide (P-91...

  2. 40 CFR 721.6110 - Alkyldi(alkyloxyhydroxypropyl) derivative, phosphoric acid esters, potassium salts.

    Science.gov (United States)

    2010-07-01

    ...) derivative, phosphoric acid esters, potassium salts. 721.6110 Section 721.6110 Protection of Environment...) derivative, phosphoric acid esters, potassium salts. (a) Chemical substance and significant new uses subject...) derivative, phosphoric acid esters, potassium salts (PMN P-91-818) is subject to reporting under this section...

  3. 40 CFR 721.4380 - Modified hydrocarbon resin.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Modified hydrocarbon resin. 721.4380... Substances § 721.4380 Modified hydrocarbon resin. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as a modified hydrocarbon resin (P-91-1418) is...

  4. 40 CFR 721.4660 - Alcohol, alkali metal salt.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Alcohol, alkali metal salt. 721.4660... Substances § 721.4660 Alcohol, alkali metal salt. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance generically identified as alcohol, alkali metal salt (PMN P-91-151) is...

  5. 40 CFR 721.3720 - Fatty amide.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Fatty amide. 721.3720 Section 721.3720... Fatty amide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as a fatty amide (PMN P-91-87) is subject to reporting under this section...

  6. 40 CFR 721.2025 - Substituted phenylimino carbamate derivative.

    Science.gov (United States)

    2010-07-01

    ... derivative. 721.2025 Section 721.2025 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Specific Chemical Substances § 721.2025 Substituted phenylimino carbamate derivative. (a) Chemical... as a substituted phenylimino carbamate derivative (PMN P-91-487) is subject to reporting under this...

  7. 40 CFR 721.4600 - Recovered metal hydroxide.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Recovered metal hydroxide. 721.4600... Substances § 721.4600 Recovered metal hydroxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as a recovered metal hydroxide (PMN P-91-809...

  8. A third component of the human cytomegalovirus terminase complex is involved in letermovir resistance.

    Science.gov (United States)

    Chou, Sunwen

    2017-12-01

    Letermovir is a human cytomegalovirus (CMV) terminase inhibitor that was clinically effective in a Phase III prevention trial. In vitro studies have shown that viral mutations conferring letermovir resistance map primarily to the UL56 component of the terminase complex and uncommonly to UL89. After serial culture of a baseline CMV laboratory strain under letermovir, mutation was observed in a third terminase component in 2 experiments, both resulting in amino acid substitution P91S in gene UL51 and adding to a pre-existing UL56 mutation. Recombinant phenotyping indicated that P91S alone conferred 2.1-fold increased letermovir resistance (EC50) over baseline, and when combined with UL56 mutation S229F or R369M, multiplied the level of resistance conferred by those mutations by 3.5-7.7-fold. Similarly a combination of UL56 mutations S229F, L254F and L257I selected in the same experiment conferred 54-fold increased letermovir EC50 over baseline, but 290-fold when combined with UL51 P91S. The P91S mutant was not perceptibly growth impaired. Although pUL51 is essential for normal function of the terminase complex, its biological significance is not well understood. Letermovir resistance mutations mapping to 3 separate genes, and their multiplier effect on the level of resistance, suggest that the terminase components interactively contribute to the structure of a letermovir antiviral target. The diagnostic importance of the UL51 P91S mutation arises from its potential to augment the letermovir resistance of some UL56 mutations at low fitness cost. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. The Copper(II) Adduct of the Unstructured Region of the Amyloidogenic Fragment Derived from theHuman Prion Protein is Redox-Active at Physiological pH

    Energy Technology Data Exchange (ETDEWEB)

    Shearer,J.; Soh, P.

    2007-01-01

    Prion diseases are caused by the misfolding and aggregation of the prion protein (PrP). Herein we provide evidence that the Cu{sup II} adduct of the unstructured amyloidogenic fragment of the human PrP (PrP(91-126)) is redox active under physiological conditions. We have identified that the relevant high-affinity Cu{sup II} binding region of PrP(91-126) is contained between residues 106 and 114. Both [Cu{sup II}(PrP(91-126))] and [Cu{sup II}(PrP(106-114))] have Cu{sup II} K{sub d} values of {approx}90 {mu}M. Furthermore, the smaller PrP fragment PrP(106-114) coordinates Cu{sup II} producing an electronic absorption spectrum nearly identical with [Cu{sup II}(PrP(91-126))] ({lambda}{sub max} {approx}610 nm ({var_epsilon} {approx}125 M{sup -1} cm{sup -1})) suggesting a similar coordination environment for Cu{sup II}. Cu K-edge X-ray absorption spectroscopy (XAS) reveals a nearly identical CuN(N/O){sub 2}S coordination environment for these two metallopeptides (2N/O at {approx}1.97 {angstrom}; 1S at {approx}2.30 {angstrom}; 1 imidazole N at {approx}1.95 {angstrom}). Both display quasireversible Cu{sup II}/Cu{sup I} redox couples at {approx}-350 mV vs Ag/AgCl. ESI-MS indicates that both peptides will coordinate Cu{sup I}. However, XAS indicates differential coordination environments between [Cu{sup I}(PrP(91-126))] and [Cu{sup I}(PrP(106-114))]. These data indicate that [Cu{sup I}(PrP(91-126))] contains Cu in a four coordinate (N/O){sub 2}S{sub 2} environment with similar (N/O)-Cu bond distances (Cu-(N/O) r = 2.048(4) {angstrom}), while [Cu{sup I}(PrP(106-114))] contains Cu in a four coordinate (N/O){sub 2}S{sub 2} environment with differential (N/O)-Cu bond distances (Cu-(N/O) r{sub 1} = 2.057(6) {angstrom}; r{sub 2} = 2.159(3) {angstrom}). Despite the differential coordination environments both Cu-metallopeptides will catalytically reduce O{sub 2} to O{sub 2}{sup {sm_bullet}-} at comparable rates.

  10. Dicty_cDB: Contig-U16469-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9 1 ( AC140550 ) Medicago truncatula clone mth2-54a24, complete se... 44 8.9 1 ( DL083628 ) Listeria innocua, genome and applications.... 44 8.9 1 ( DL081582 ) Listeria innocua, genome and applications. 44 8.9 1 ( AX415

  11. Dicty_cDB: Contig-U15575-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available COMPOSITIONS AND METHODS FOR CANCER. 48 2.0 1 ( DD164694 ) NOVEL COMPOSITIONS AND METHODS FOR CANCER. 48...Compositions and Methods Relating to STOP-1. 46 7.9 1 ( DJ354552 ) Compositions and Methods Relating to STOP-1...7.9 1 ( DJ033922 ) Methods of Using WISP Antagonists. 46 7.9 1 ( DJ033921 ) Methods of Using WISP Antagonists...7.9 1 ( DJ033920 ) Methods of Using WISP Antagonists. 46 7.9 1 ( DJ033919 ) Methods of Using WISP Antagonists...7.9 1 ( DJ033918 ) Methods of Using WISP Antagonists. 46 7.9 1 ( DJ033917 ) Methods of Using WISP Antagonists

  12. 40 CFR 721.3340 - Ethanol, 2,2′-(hexylamino)bis-.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Ethanol, 2,2â²-(hexylamino)bis-. 721... Substances § 721.3340 Ethanol, 2,2′-(hexylamino)bis-. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as ethanol, 2,2′-(hexylamino)bis- (PMN P-91-1346...

  13. Effectiveness of the Geneva Convention Relative to American POW’s (Prisoner of War)

    Science.gov (United States)

    1973-05-01

    city for public dis- play. This was done frequently following heavy bombings. This harassment led to several being beaten and some were stoned ...wright , Within Four Falls (London: Edward Arnold and Co., 1930), p. 91. 23. Aladar Kuncz, Black Monastery (London: Chatto and Windus, 1934), pp. 35-52...Kinkead, Eugene. In Every War But One. New York: W. W. Norton and Company, Inc., 1959. Kuncz, Aladar. Black Monastery . London: Chatte

  14. Lateral Coordination of Interdependent U.S. Army Information Tasks

    Science.gov (United States)

    2008-12-01

    Adapted from Richard L. Daft and Raymond A. Noe, Organizational Behavior (Mason, OH: South-Western, 2001), p. 91. 47 Department of the Army, Field Manual...Army_Doctrine_U pdate_FM501_FM30.pdf (accessed 8/20/08). Daft , Richard L. and Raymond A. Noe. Organizational Behavior. (Mason, OH: South-Western, 2001...army’s planning, organization, training, leadership style, tactics, weapons, and equipment. These activities in preparation for future war lie at the

  15. Properties of 13HMF steel for steam pipelines as a result of impact and cracking resistance investigations; Wlasnosci stali 13HMF na rurociagi pary swiezej w swietle badan udarnosci i odpornosci na pekanie

    Energy Technology Data Exchange (ETDEWEB)

    Bilous, W.; Wasiak, J.; Hajewska, E.; Szteke, W.; Wagner, T. [Institute of Atomic Energy, Otwock-Swierk (Poland)

    1996-12-31

    Long lasting and safe exploitation of steam pipelines in energetics depends strongly on mechanical properties of material used for tubing production. Most of pipelines installed in polish energetics is made of Cr-Mo-V type steel. The investigation results of such steel (13MHF) concerning the influence of exploitation time on impact and cracking resistance have been presented, discussed and compared with the imported steel P91. 3 refs, 7 figs, 3 tabs.

  16. Dicty_cDB: Contig-U05289-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available bean cDNA library from flowers,8... 44 4.9 1 ( EE259818 ) RFABI19TH Castor bean cDNA library from flowers,8...... 44 4.9 1 ( EE255361 ) RFAA772TH Castor bean cDNA library from flowers,8... 44 4.9 1 ( DW532064 ) EST_ssa...9 1 ( BH530504 ) BOGHB12TF BOGH Brassica oleracea genomic clone BO... 44 4.9 1 ( EE260329 ) RFAB854TH Castor

  17. Microstructure and Mechanical Properties of 9Cr-1Mo Steel Weld Fusion Zones as a Function of Weld Metal Composition

    Science.gov (United States)

    Arivazhagan, B.; Prabhu, Ranganath; Albert, S. K.; Kamaraj, M.; Sundaresan, S.

    2009-11-01

    Modified 9Cr-1Mo steel, designated as P91, is widely used in the construction of power plants and other sectors involving temperatures higher than 500 °C. Although the creep strength is the prime consideration for elevated temperature applications, notch toughness is also important, especially for welded components, as it is essential to meet the pressure test and other requirements at room temperature. P91 steel weld fusion zone toughness depends on factors such as welding process, chemical composition, and flux composition. Niobium and vanadium are the main alloying elements that significantly influence the toughness as well as creep strength. In the current work, weld metals were produced with varying amounts of niobium and vanadium by dissimilar joints involving P9 and P91 base metals as well as filler materials. Microstructural studies and Charpy V-notch impact testing were carried out on welds to understand the factors influencing toughness. Based on the results, it can be concluded that by reducing vanadium and niobium weld metal toughness can be improved.

  18. Dicty_cDB: Contig-U01563-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available U Lottia gigantea from female gon... 44 2.9 1 ( FC625928 ) CAXT4735.fwd CAXT Lottia gigantea from mantle... Lot... 44 2.9 1 ( FC625927 ) CAXT4735.rev CAXT Lottia gigantea from mantle Lot... 44... 2.9 1 ( FC625128 ) CAXT4288.fwd CAXT Lottia gigantea from mantle Lot... 44 2.9 1 ( FC624349 ) CAXT3877.rev ...CAXT Lottia gigantea from mantle Lot... 44 2.9 1 ( FC598185 ) CAXS11300.fwd CAXS ...95.rev CAXP Lottia gigantea from head, foo... 44 2.9 1 ( FC569842 ) CAWF8604.fwd CAWF Lottia gigantea from mantle

  19. DC-ARM Final Demonstration Report

    Science.gov (United States)

    2003-06-23

    59 9.1.6 Compartment Temperature Profiles .............................................................................. 59 9.1.7 Smoke Control Effectiveness...73 9.3.8 Smoke Control Effectiveness...Detection/Compartment Monitoring ................................................................................ 83 10.4 Automated Smoke Control ....................................................................................................... 84

  20. Dicty_cDB: Contig-U04916-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 034718 ) Gracilaria robusta plasmid Gro4970, complete sequ... 44 5.9 1 ( DL064443 ) Cancer Gene Determination... and Therapeutic Screeni... 44 5.9 1 ( DL064206 ) Cancer Gene Determination and Therapeutic Screeni... 44 5

  1. Dicty_cDB: Contig-U03528-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available attus norvegicus EST, 5'-end sequence, clone etn... 44 8.9 1 ( FG300900 ) 1108799246337 New World... Screwworm Larvae 9387 EST... 44 8.9 1 ( FG294179 ) 1108770703871 New World Screwworm Larvae

  2. Dicty_cDB: Contig-U02029-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e skin cDNA, RIKEN full... 46 2.9 1 ( FC634572 ) CAXT932.fwd CAXT Lottia gigantea from mantle... Lott... 46 2.9 1 ( FC634571 ) CAXT932.rev CAXT Lottia gigantea from mantle Lott... 46 2.9 1 ( F...C627603 ) CAXT5631.fwd CAXT Lottia gigantea from mantle Lot... 46 2.9 1 ( FC627602 ) CAXT5631.rev CAXT Lottia gigantea from mantle

  3. Integrating Syntax, Semantics, and Discourse DARPA Natural Language Understanding Program. Volume 2. Appendices.

    Science.gov (United States)

    1987-05-14

    Part fail. 1 2 (2) 1 9.0.0b Part ordered. 1 1 (2) 1 9.1.1 Sac received high usage during two 4 3,4,6,6 (7) 4 becce periods. 9.1.2 Ccs received a report...34during NP" to sa and analyzes "two becce periods" as qpos + npos + nvar. [9.1.21 "That" is analyzable as determiner or complementizer. [9.1.4] "Coast down

  4. Dicty_cDB: Contig-U01941-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BN Lottia gigantea 3,4,5,6.5d Lar... 44 9.1 1 ( FC619633 ) CAXT10103.fwd CAXT Lottia gigantea from mantle Lo...... 44 9.1 1 ( FC619632 ) CAXT10103.rev CAXT Lottia gigantea from mantle Lo... 44 9.1 1 ( FC602112 ) CAXS139

  5. Dicty_cDB: Contig-U15531-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 46 5.9 1 ( EE991104 ) Le_emtis_304H03_M13R29 Little skate (Leucoraja er... 46 5....9 1 ( EC812715 ) SEE00002945 Seculamonas ecuadoriensis Company (ST... 46 5.9 1 ( CV221849 ) Le_mx0_53c11_SP6 Little

  6. Dicty_cDB: Contig-U09376-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1540 ) S237P6228RD7.T0 PortugueseWaterDog Canis familiar... 44 8.9 1 ( BV422520 )...H211-264C24 in... 44 8.9 1 ( BX294128 ) Zebrafish DNA sequence from clone DKEYP-35F12 in ... 44 8.9 1 ( BV44

  7. Dicty_cDB: Contig-U05088-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Shoot tip (Normalized li... 44 6.9 1 ( EX314035 ) GQ02806.SP6_G17 GQ028 - Cambium / phloem scrappin... 44 6....9 1 ( EX313684 ) GQ02806.B7_G17 GQ028 - Cambium / phloem scrapping... 44 6.9 1 ( EV276953 ) GLMCY94TF JCVI-

  8. Dicty_cDB: Contig-U04551-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ES AND FOR IDENTIFY... 42 9.1 1 ( DD019106 ) METHODS FOR GENERATING DATABASES AND F...0417 ) METHODS FOR GENERATING DATABASES AND FOR IDENTIFY... 42 9.1 1 ( BD350416 ) METHODS FOR GENERATING DATABASES... Methods for generating databases and databases fo... 42 9.1 1 ( DD019107 ) METHODS FOR GENERATING DATABAS

  9. Dicty_cDB: Contig-U07081-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available OVEL ... 44 1.9 1 ( DD218782 ) STRUCTURAL AND CYTOSKELETON-ASSOCIATED PROTEINS. 44 1.9 1 ( DD025940 ) Method for diagnosing... a tumor in a patient determ... 44 1.9 1 ( DD025931 ) Method for diagnosing

  10. Dicty_cDB: Contig-U15490-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne:ddv54l17, 5' ... 44 7.9 1 ( AB198402 ) Uncultured bacterium gene for 16S rRNA, ITS and 2... 44 7.9 1 ( AY342346 ) Weissella kimchi...i 16S ribosomal RNA gene, partial... 44 7.9 1 ( AY342345 ) Weissella kimchii 16S ri

  11. Dicty_cDB: Contig-U04961-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 42 7.9 1 ( DN305530 ) PL05008B2C12 cDNA from sexually mature hermaphodi... 42 7....9 1 ( DN296868 ) PL04007B1B10 cDNA from sexually mature hermaphodi... 42 7.9 1 ( BU930829 ) AGENCOURT_10425

  12. Dicty_cDB: Contig-U01558-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ngth cDNA. 44 7.9 1 ( DI133367 ) Higher molecular weight entities and uses therefor. 44 7.9 1 ( DI126908 ) Higher... molecular weight entities and uses therefor. 44 7.9 1 ( DI124230 ) Higher molecular weight entities an

  13. Dicty_cDB: Contig-U01319-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TBAFC02, 5'end, expresse... 42 9.1 1 ( CD724273 ) oj32e11.y1 Human lacrimal gland, unamplified: oj ... 42 9....1 1 ( CD723380 ) oj21e02.y1 Human lacrimal gland, unamplified: oj ... 42 9.1 1 ( BX114300 ) RZPD Homo sapien

  14. Dicty_cDB: Contig-U06595-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ilus oremlandii OhILAs, ... 32 9.1 FJ563415_1( FJ563415 |pid:none) Rodriguezia arevaloi voucher Willi... 32 ...TCC ... 32 9.1 (Q8T305) RecName: Full=Paramyosin; &AJ439882_1( AJ439882 |pid:none) 32 9.1 FJ563162_1( FJ563162 |pid:none) Rodriguez

  15. 76 FR 45788 - Combined Notice of Filings

    Science.gov (United States)

    2011-08-01

    ...: Big Sandy LINK Implementation to be effective 9/1/2011. Filed Date: 07/14/2011. Accession Number...: ETNG Modifications for Big Sandy LINK Implementation to be effective 9/1/2011. Filed Date: 07/14/2011... Big Sandy LINK Implementation to be effective 9/1/2011. Filed Date: 07/14/2011. Accession Number...

  16. Dicty_cDB: Contig-U04953-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F-IH0-acg-j-24-0-CMRC.r1 Ceratitis capitata... 44 6.9 1 ( EY020973 ) CBAB520.g2:P T. versicolor self root extracts... rev... 44 6.9 1 ( EY020972 ) CBAB520.b2:P T. versicolor self root extracts rev... 44 6.9 1 ( CP000678

  17. AcEST: DK960339 [AcEST

    Lifescience Database Archive (English)

    Full Text Available uxilin-like clathrin uncoating factor SWA2... 29 9.1 >sp|Q96253|ATP5E_ARATH ATP s...... 29 9.1 sp|Q8IYR6|TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens GN=TMEFF1 PE... 29 9.1 sp|Q06677|SWA2_YEAST A

  18. Dicty_cDB: Contig-U05847-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YJ03 cDNA clone of Developmental Stages Libr... 44 1.9 1 ( CU558144 ) Spc_15YG16 cDNA clone of Developmental Stages... Lib... 44 1.9 1 ( CU558067 ) Spc_15YL16 cDNA clone of Developmental Stages Lib... 44 1.9 1 ( CR46359

  19. Dicty_cDB: Contig-U01951-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone MEST2... 44 6.9 1 ( GO168633 ) CAGA42923.fwd CAGA Alvinella pompejana Normalized... 44 6.9 1 ( GO1686...32 ) CAGA42923.rev CAGA Alvinella pompejana Normalized... 44 6.9 1 ( FD981134 ) RR3GW84TF RR3(NY) Raphanus r

  20. Dicty_cDB: Contig-U01123-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 46 2.9 1 ( CB284403 ) DF1148 Dermatophagoides farinae cDNA library Derm... 46 2.9 1 ( GO192862 ) CAGB13789.fwd CAGB Alvinella pompe...jana Normalized... 46 2.9 1 ( GO192861 ) CAGB13789.rev CAGB Alvinella pompejana Norm

  1. An evaluation of creep rupture strength of ferritic/austenitic dissimilar weld interfaces using cohesive zone modelling

    OpenAIRE

    Hu, Jia-nan; Fukahori, Takuya; Igari, Toshihide; Chuman, Yasuharu; Cocks, Alan C.F.

    2016-01-01

    Dissimilar metal welds between ferritic and austenitic alloys are used extensively in power generation plants. Failure of such welds can occur in the base metal, the heat-affected zone (HAZ), or the interface between the two materials, depending on the operating stress and temperature. Evaluation of the creep rupture properties of dissimilar weld joints of 2.25Cr-1Mo (P22) and 9Cr-1MoVNb (P91) ferritic steels with INCONEL 82 filler metal are described, with the primary focus on failure at the...

  2. Integrated modelling in materials and process technology

    DEFF Research Database (Denmark)

    Hattel, Jesper Henri

    2008-01-01

    processes from the viewpoint of combined materials and process modelling are presented: solidification of thin walled ductile cast iron, integrated modelling of spray forming and multiphysics modelling of friction stir welding. The fourth example describes integrated modelling applied to a failure analysis...... of premature rupture of a stellite weld on a P91 valve used in a power plant. For all four examples, the focus is put on modelling results rather than describing the models in detail. Proper comparison with experimental work is given in all examples for model validation as well as relevant references...

  3. Uso de fibras aramidas para melhoria de propriedades de compostos de borrachas nitrílicas

    OpenAIRE

    Fabiane Trombetta

    2012-01-01

    Elastômeros com resistência química e mecânica elevada em altas temperaturas têm sido utilizados em Bombas de Cavidade Progressiva (BCP) para levantamento artificial de petróleo e o uso de fibras aramidas é uma alternativa promissora para modificação da performance destes materiais. O objetivo deste estudo é avaliar o efeito de fibras aramidas nas propriedades da borracha Nitrílica (NBR) e da borracha Nitrílica Hidrogenada (HNBR). Os pré-dispersos de fibra de aramida, Rhenogran® P91-40/NBR e ...

  4. Creep strength and ductility of 9 to 12% chromium steels

    DEFF Research Database (Denmark)

    Hald, John

    2004-01-01

    The present paper focuses in on long-term creep properties of parent material of the new 9-12%Cr creep resistant steels, P91, E911 and P92 developed for use in advanced ultrasupercritical power plants. These steels have been at the center of activities in the ECCC Working Group 3A (WG3A) "Ferritic...... Steels", which covers creep data development and analysis for parent materials and welds of all ferritic creep resistant steels ranging from low alloy steels up to 12%Cr steels. The opinions stated in the paper represent the views of the author rather than the whole ECCC WG3A group....

  5. Dicty_cDB: Contig-U03062-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DJ060343 ) Method and nucleic acids for the improved treatme... 46 1.9 1 ( DJ060221 ) Method and nucleic acids for the improved... treatme... 46 1.9 1 ( DD392061 ) Method and nucleic acids for the improved... treatme... 46 1.9 1 ( DD391993 ) Method and nucleic acids for the improved treatme... 46 1.9 ...1 ( DD391787 ) Method and nucleic acids for the improved treatme... 46 1.9 1 ( DD391719 ) Method and nucleic acids for the improved

  6. Dicty_cDB: Contig-U12464-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH251-519B7, W... 44 9.9 1 ( AC211808 ) Echinops telfairi clone CH238-314L5, WORKING DRAF... 44 9.9 1 ( AC201694 ) Echinops telfair...atus clone R3-13O9, WORK... 44 9.9 1 ( AC192906 ) Echinops telfairi clone CH238-4...98J3, WORKING DRAF... 44 9.9 1 ( AC192655 ) Echinops telfairi clone CH238-500O6, WORKING DRAF... 44 9.9 1 (

  7. Dicty_cDB: Contig-U11589-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e cDNA... 46 2.9 1 ( CK280486 ) EST743208 Nicotiana benthamiana mixed tissue cDNA... 46 2.9 1 ( FK838422 ) K01142E09 Karen...ia brevis Multi-strain Library Kar... 46 2.9 1 ( EX958792 ) CAGO1119.rev CAGO Karenia brevis K...arbr Stressed (... 46 2.9 1 ( EX867877 ) AUAO2659.rev AUAO Karenia brevis Karbr Dark-phase... 46 2.9 1 ( CP0

  8. Dicty_cDB: Contig-U16574-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ense cDNA clone:RCE08355. 46 4.9 1 ( GO196559 ) CAGB16252.rev CAGB Alvinella pompejana Normalized... 46 4.9 ...1 ( GO180560 ) CAGA6735.fwd CAGA Alvinella pompejana Normalized ... 46 4.9 1 ( GO178630 ) CAGA5822.fwd CAGA Alvinella pompe...jana Normalized ... 46 4.9 1 ( GO176721 ) CAGA4935.fwd CAGA Alvinella pompe...jana Normalized ... 46 4.9 1 ( GO144566 ) CAGA30892.fwd CAGA Alvinella pompejana Normalized... 46 4

  9. Dicty_cDB: Contig-U04925-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ndosperm cDNA Library Zea ... 44 8.9 1 ( CN651522 ) Eg_PSSLS_09F04_T7 Echinococcus granulosus protosc... 44 8.9 1 ( CN65...1506 ) Eg_PSSLS_09D08_T7 Echinococcus granulosus protosc... 44 8.9 1 ( CN651450 ) Eg_PSSLS_08E07..._T7 Echinococcus granulosus protosc... 44 8.9 1 ( CN651437 ) Eg_PSSLS_08C10_T7 Echinococcus granulosus protosc... 44 8.9 1 ( CN65...1430 ) Eg_PSSLS_08B09_T7 Echinococcus granulosus protosc... 44 8.9 1 ( CN65...1388 ) Eg_PSSLS_07E07_T7 Echinococcus granulosus protosc... 44 8.9 1 ( CN651382 ) Eg_PSSLS_07

  10. Dicty_cDB: Contig-U04580-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nosize Bicyclus anynan... 46 1.9 1 ( FD779287 ) NADG-aaa01e12.g1 Rhodnius_prolixu...s_EST_NADG_Bacte... 46 1.9 1 ( FD779229 ) NADG-aaa13e09.g1 Rhodnius_prolixus_EST_NADG_Bacte... 46 1.9 1 ( FD...778983 ) NADG-aaa13e09.b1 Rhodnius_prolixus_EST_NADG_Bacte... 46 1.9 1 ( FD482290 ) NADI-aaa29b11.g1 Rhodnius_prolix...us_EST_NADI_5th_i... 46 1.9 1 ( FD481836 ) NADI-aaa32c09.b1 Rhodnius_prolix...us_EST_NADI_5th_i... 46 1.9 1 ( FD481321 ) NADI-aaa29b11.b1 Rhodnius_prolixus_EST_NADI_5th_i... 46 1.9 1 (

  11. Dicty_cDB: Contig-U12496-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E8.r CHORI-242 Sus scrofa genomic clone C... 44 9.1 1 ( FD687842 ) CBHY1281.fwd CBHY Mycosphaerella fijiensi...s MfEST5... 44 9.1 1 ( FD687633 ) CBHY1157.rev CBHY Mycosphaerella fijiensis MfEST5... 44 9.1 1 ( FD687295 )... CBHX6118.fwd CBHX Mycosphaerella fijiensis MfEST4... 44 9.1 1 ( FD682112 ) CBHX1...985.rev CBHX Mycosphaerella fijiensis MfEST4... 44 9.1 1 ( FD677743 ) CBHW1795.rev CBHW Mycosphaerella fijie...nsis MfEST4... 44 9.1 1 ( FD666344 ) CBHT1283.rev CBHT Mycosphaerella fijiensis MfEST3... 44 9.1 1 >( AC1155

  12. Dicty_cDB: Contig-U04742-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d_st... 44 5.9 1 ( FK196173 ) XABT208505.b1 Gateway compatible cien cDNA librar... 44 5.9 1 ( FK188490 ) XABT203720.b1 Gateway... compatible cien cDNA librar... 44 5.9 1 ( FK124579 ) XABT164580.b1 Gateway compatible cie...n cDNA librar... 44 5.9 1 ( FK093026 ) XABT144180.b1 Gateway compatible cien cDNA...shed cDNA librar... 44 5.9 1 ( FF751145 ) XABT59682.fwd Gateway compatible cien cDNA librar... 44 5.9 1 ( FF...745961 ) XABT56036.fwd Gateway compatible cien cDNA librar... 44 5.9 1 ( FF731311 ) XABT45775.fwd Gateway

  13. Dicty_cDB: Contig-U02054-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .5 Bee Brain Normalized/Subtracted ... 44 4.9 1 ( FK182950 ) XABT200294.b1 Gateway compatible cien cDNA libr...ar... 44 4.9 1 ( FK164285 ) XABT188902.b1 Gateway compatible cien cDNA librar... 44 4.9 1 ( FK143213 ) XABT175847.b1 Gateway... compatible cien cDNA librar... 44 4.9 1 ( FK099232 ) XABT147951.b1 Gateway...re progl... 44 4.9 1 ( FF809178 ) XABT99195.fwd Gateway compatible cien cDNA librar... 44 4.9 1 ( FF806596 ) XABT97489.fwd Gateway... compatible cien cDNA librar... 44 4.9 1 ( FF805523 ) XABT96394.fwd Gateway compatible

  14. Dicty_cDB: Contig-U13649-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available elium discoideum cDNA clone:ddv26j09, 5' ... 44 9.1 1 ( FK225100 ) XABT227160.b1 Gateway compatible cien cDN...A librar... 44 9.1 1 ( FK224979 ) XABT227048.b1 Gateway compatible cien cDNA librar... 44 9.1 1 ( FK222654 ) XABT225164.b1 Gateway... compatible cien cDNA librar... 44 9.1 1 ( FK214489 ) XABT219923.b1 Gateway... compatible cien cDNA librar... 44 9.1 1 ( FK202701 ) XABT212609.b1 Gateway compatible cien ...cDNA librar... 44 9.1 1 ( FK198885 ) XABT210235.b1 Gateway compatible cien cDNA librar... 44 9.1 1 ( FK186381 ) XABT202370.b1 Gateway

  15. Corrosion behaviour of welds and Ta in liquid lead

    Energy Technology Data Exchange (ETDEWEB)

    Heinzel, A., E-mail: Annette.heinzel@kit.edu; Müller, G.; Weisenburger, A.

    2016-02-15

    Four specimens, P91 welded by friction stir welding with and without post heat treatment, P91 electromagnetic pulse welded (EMP) and 14Cr ODS (explosive welding) were exposed at 550 °C for up to 2131 h to Pb containing 10{sup −6} wt% oxygen. After the exposure none of the samples showed dissolution attack, all were protected by an oxide layer at the surface. Nearly no effect on the oxidation due to welding was found in both friction stir welded specimens. Severe deformation and partial melting during explosive welding result in a slower oxide layer growth within the welding zone. The EMP sample was tested as delivered without post-heat treatment. No Pb penetrated into the tiny gap between the welded parts. After the test, the gap is filled up with oxides. Additionally, Ta, discussed as a pump impeller material, was exposed to Pb and PbBi at different temperatures (400–900 °C) and oxygen concentrations in liquid metal (saturated, 10{sup −6} wt%, 10{sup −8} wt% and reduced (<<10{sup −8} wt%). Only the Ta specimens exposed to Pb with highly reduced oxygen content showed nearly no attack. All the others exhibited oxide scale formation that becomes severe above 400 °C test temperature.

  16. Corrosion of Aluminized and Uncoated 9-12% Cr Boiler Steels in Simulated Biomass andWaste Combustion Conditions

    Science.gov (United States)

    Metsäjoki, Jarkko; Huttunen-Saarivirta, Elina; Lepistö, T.

    2011-04-01

    Coatings are seen a promising way to improve the corrosion resistance of relatively cheap power plant steels to enable higher steam temperatures than currently in use. In this research, 9-12% Cr steels P91 and HCM12A are coated with aluminium diffusion coating by a slurry method and exposed for 336 hours at 833 K and 883 K to atmospheres containing varying amounts of O2, H2O, HCl and SO2. Corrosion behaviour of the coated steels is compared to that of those steels in an uncoated condition. Characterization is performed by weighing, SEM + EDS and XRD. The results show that corrosion resistance of P91 and HCM12A is significantly improved by the aluminium diffusion coating at high temperatures in atmospheres containing HCl and SO2. The corrosion rate of the aluminized specimens slightly increases with increase in test temperature but remains virtually the same irrespective of the composition of the atmosphere. On the other hand, the corrosion rate of the uncoated specimens is dependent on both the atmosphere and the temperature. The steels undergo active oxidation that results in formation of non-protective, thick and layered scales in HCl containing atmospheres. SO2 addition slightly decreases the corrosion rate although it is anyway higher than that in SO2 containing atmosphere without HCl.

  17. Tempering-Induced Microstructural Changes in the Weld Heat-Affected Zone of 9 to 12 Pct Cr Steels and Their Influence on Sliding Wear

    Science.gov (United States)

    Velkavrh, Igor; Kafexhiu, Fevzi; Klien, Stefan; Diem, Alexander; Podgornik, Bojan

    2017-01-01

    Increasing amount of tribological applications is working under alternating high/low temperature conditions where the material is subjected to temperature fatigue mechanisms such as creep, softening due to annealing, and at the same time must withstand mechanical wear due to sliding contact with pairing bodies. Steam turbine valves, gate valves, valve heads, stems, seats and bushings, and contacting surfaces of the carrier elements are some examples of such applications. The purpose of the present study is to evaluate the potential of X20 and P91 steels as materials for applications operating under combined effect of mechanical wear and alternating high/low temperature conditions. It was focused on how the microstructural changes occurring in the weld zone affect the wear properties of the selected materials. Generally, with longer tempering time and higher tempering temperature, the number of carbide precipitates decreased, while their relative spacing increased. Before tempering, the morphology of the steel matrix (grain size, microstructure homogeneity) governed the wear resistance of both steels, while after tempering wear response was determined by the combination of the number and the size of carbide particles. After tempering, in X20 steel larger number of stable M23C6 carbides was observed as compared with P91 steel, resulting in lower wear rates. It was observed that for both steels, a similar combination of number density and size distribution of carbide particles provided the highest wear resistance.

  18. Long-term Stability of 9- to 12 % Cr Steels

    DEFF Research Database (Denmark)

    Hald, John

    2004-01-01

    In the recent 25 years creep rupture strength of 9- to 12 %Cr steels for steam pipes and turbines has been doubled by development of new alloys. This development has formed a basis for improved efficiency of fossil fired steam power plants by introduction of advanced steam temperatures...... of Mo with 1.8 % W combined with a slight amount of Boron led to steel P 92. The creep rupture strength of these new alloys are now secured with long-term tests up to 100,000 hours, which demonstrate improvements of 50% (P 91), 75 % (E 911) and 100 % (P 92) in strength compared to X 20CrMoV12 1....... and pressures. Newly developed steam pipe steels are based on modifications of well-established steels like the X 20CrMoV12 1. Balanced addition of V, Nb and N to a 9Cr 1 Mo steel led to the Modified 9 Cr steel P 91. Addition of 1% W to a 9Cr 1 MoVNbN base composition led to steel E 911 and partial replacement...

  19. Development of novel protective high temperature coatings on heat exchanger steels and their corrosion resistance in simulated coal firing environment; Developpement de revetements pour les aciers d'echangeurs thermiques et amelioration de leur resistance a la corrosion en environnement simulant les fumees de combustion et de charbon

    Energy Technology Data Exchange (ETDEWEB)

    Rohr, V.

    2005-10-15

    Improving the efficiencies of thermal power plants requires an increase of the operating temperatures and thus of the corrosion resistance of heat exchanger materials. Therefore, the present study aimed at developing protective coatings using the pack cementation process. Two types of heat exchanger steels were investigated: a 17% Cr-13% Ni austenitic steel and three ferritic-martensitic steels with 9 (P91 and P92) and 12% Cr (HCM12A). The austenitic steel was successfully aluminized at 950 C. For the ferritic-martensitic steels, the pack cementation temperature was decreased down to 650 C, in order to maintain their initial microstructure. Two types of aluminides, made of Fe{sub 2}Al{sub 5} and FeAl, were developed. A mechanism of the coating formation at low temperature is proposed. Furthermore, combining the pack cementation with the conventional heat treatment of P91 allowed to take benefit of higher temperatures for the deposition of a two-step Cr+Al coating. The corrosion resistance of coated and uncoated steels is compared in simulated coal firing environment for durations up to 2000 h between 650 and 700 C. It is shown that the coatings offer a significant corrosion protection and, thus, an increase of the component lifetime. Finally, the performance of coated 9-12% Cr steels is no longer limited by corrosion but by interdiffusion between the coating and the substrate. (author)

  20. Fundamental modelling of particle strengthened 9-12% Cr steels

    Energy Technology Data Exchange (ETDEWEB)

    Magnusson, Hans; Sandstroem, Rolf [Royal Inst. of Tech., Stockholm (Sweden). Dept. of Materials Science and Engineering; Royal Inst. of Tech., Stockholm (Sweden). Brinell Centre

    2010-07-01

    Creep strength of particle strengthened 9-12% Cr steels can be predicted by fundamental modelling. The creep strength is evaluated from the state of the microstructure during creep. Particle hardening at high temperatures can be predicted by taking dislocation climb across particles into account. Work hardening is calculated from immobile dislocations in subgrain interiors and at boundaries using the composite theory. Subgrain coarsening will lower the influence of the mechanically hard boundaries. Recovery in dislocation density is predicted through static recovery by climb and dynamic recovery by locking and dipole formation. Solid solution hardening is needed in order to explain the difference in creep strength between different 9-12% Cr steels. The accumulation of large atoms such as Mo and W will slow down the dislocation climb velocity, and thereby the microstructure recovery rate. 100000h rupture strength is predicted for X20, P91, P92 steels without any use of fitting parameters. The creep strength of P91 steel with different microstructure due to Al additions. Z-phase transformation and heat affected material is presented. (orig.)

  1. Dicty_cDB: Contig-U09024-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 ( ER966253 ) SOOAU08JR LargeInsertSoybeanGenLibBuild4 Glycine ... 44 8.9 1 ( ER966076 ) SOOAO83JR LargeInsertSoybeanGenLibBuild...4 Glycine ... 44 8.9 1 ( ER965865 ) SOOAP03JR LargeInsertSoybeanGenLibBuild4 Glycine ...... 44 8.9 1 ( ER965591 ) SOOAL41JR LargeInsertSoybeanGenLibBuild4 Glycine ... 44 ...8.9 1 ( ER965572 ) SOOAL76JR LargeInsertSoybeanGenLibBuild4 Glycine ... 44 8.9 1 ( ER965072 ) SOOA020JR LargeInsertSoybeanGenLibBuild...4 Glycine ... 44 8.9 1 ( ER965071 ) SOOA208JR LargeInsertSoybeanGenLibBuild4 Glycin

  2. Dicty_cDB: Contig-U06541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GH_MBb Gossypium hirsutum genomic ... 46 1.9 1 ( ES226393 ) MpSG_ag6_H04 Myzus pe...rsicae, tobacco lineage, aph... 46 1.9 1 ( ES222169 ) MpGVN_ag2_O17 Myzus persicae, line G006, PLRV fre... 4...6 1.9 1 ( ES221451 ) MpGV_ag3_J16 Myzus persicae, line G006, PLRV infe... 46 1.9 1 ( EG617027 ) REPROTRACTF0...95449F22 POSSUM_01-POSSUM-C-REPROTRAC... 46 1.9 1 ( EE570712 ) A01_A01fv4m1_pDNRf_531608 Myzus... persicae, line F0... 46 1.9 1 ( EE263373 ) F02_F02gf1c4_pDNRf_501665 Myzus persicae, line G0..

  3. 78 FR 54235 - Antidumping or Countervailing Duty Order, Finding, or Suspended Investigation; Opportunity To...

    Science.gov (United States)

    2013-09-03

    ... Narrow Woven Ribbons with Woven Selvedge A-570- 9/1/12-8/31/13 952 New Pneumatic Off-The-Road Tires A-570... Bars A-570-860........ 9/1/12-8/31/13 Ukraine: Solid Agricultural Grade Ammonium Nitrate A-823- 9/1/12... Selvedge C-570- 1/1/12-12/31/12 953 New Pneumatic Off-The-Road Tires C-570-913....... 1/1/12-12/31/12...

  4. 75 FR 53635 - Antidumping or Countervailing Duty Order, Finding, or Suspended Investigation; Opportunity To...

    Science.gov (United States)

    2010-09-01

    ... Shelving and Racks, A-570-941.. 3/5/09-8/31/10 New Pneumatic Off-The-Road Tires, A-570-912...... 9/1/09-8.......... 9/1/09-8/31/10 UKRAINE: Silicomanganese, A-823-805 9/1/09-8/31/10 Solid Agricultural Grade Ammonium...-942.. 1/7/09-12/31/09 New Pneumatic Off-The-Road Tires, C-570-913...... 1/1/09-12/31/09 Raw Flexible...

  5. 76 FR 54735 - Antidumping or Countervailing Duty Order, Finding, or Suspended Investigation; Opportunity To...

    Science.gov (United States)

    2011-09-02

    ... Narrow Woven Ribbons With Woven Selvedge, A-570- 9/1/10-8/31/11 952 New Pneumatic Off-The-Road Tires, A... Bars, A-570-860....... 9/1/10-8/31/11 ] Ukraine: Silicomanganese, A-823-805 9/1/10-8/31/11 Solid... Off-The-Road Tires, C-570-913...... 1/1/10-12/31/10 Raw Flexible Magnets, C-570-923 1/1/10-12/31/10...

  6. 77 FR 47834 - Combined Notice of Filings

    Science.gov (United States)

    2012-08-10

    ..., LLC. Description: Big Sandy Fuel Filing effective 9-1-2012 to be effective 9/1/2012. Filed Date: 7/31... Negotiated Rate to be effective 8/ 1/2012. Filed Date: 7/31/12. Accession Number: 20120731-5120. Comments Due...: Compliance with CP12-5-000 to be effective 9/1/2012. Filed Date: 7/31/12. Accession Number: 20120731-5129...

  7. Dicty_cDB: Contig-U01127-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BJ076721 ) Xenopus laevis cDNA clone:XL058i17, 3' end, singl... 44 5.9 1 ( FG291907 ) 1108800220021 New World... Screwworm Egg 9261 ESTs C... 44 5.9 1 ( FG291539 ) 1108793348396 New World Sc...rewworm Egg 9261 ESTs C... 44 5.9 1 ( FG286660 ) 1108770723740 New World Screwworm Egg 9261 ESTs C... 44 5.9

  8. Dicty_cDB: Contig-U05491-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 46 1.9 1 ( FG730884 ) G1145P321RL19.T0 Anolis carolinensis pooled norma... 46 1.9 1 ( FG545126 ) NADI-aaa83g02.b1 Rhodnius_prolix...us_EST_NADI_5th_i... 46 1.9 1 ( FG544101 ) NADI-aaa83g02.b2 Rhodnius_prolixus_EST_N

  9. Dicty_cDB: Contig-U14801-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CAZO Naegleria gruberi Flagellate Sta... 42 1.1 2 ( FD681213 ) CBHW4480.rev CBHW Mycosphaerella fiji...ensis MfEST4... 46 1.9 1 ( FD669540 ) CBHT4023.rev CBHT Mycosphaerella fijiensis MfEST3...... 46 1.9 1 ( FD669082 ) CBHT3400.rev CBHT Mycosphaerella fijiensis MfEST3... 46 1.9 1 ( AE017194 ) Bacillus

  10. Determining health expectancies

    National Research Council Canada - National Science Library

    Robine, Jean-Marie

    2003-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Jean-Marie Robine 9 1 Increase in Life Expectancy and Concentration of Ages at Death . . . . France Mesle´ and Jacques Vallin 13 2 Compression of Morbidity...

  11. 77 FR 53863 - Antidumping or Countervailing Duty Order, Finding, or Suspended Investigation; Opportunity To...

    Science.gov (United States)

    2012-09-04

    ...-The-Road Tires, A-570-912...... 9/1/11--8/31/12 Raw Flexible Magnets, A-570-922 9/1/11--8/31/12 Steel Concrete Reinforcing Bars, A-570-860....... 9/1/11--8/31/12 Ukraine: Silicomanganese,\\2\\A-823-805 9/1/11--8... Woven Selvedge, C-570- 1/1/11--12/31/11 953 New Pneumatic Off-The-Road Tires, C-570-913...... 1/1/11--12...

  12. Dicty_cDB: Contig-U14525-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) MUT08-E02.y1d-s SHGC-MUT Mytilus californianus cD... 44 5.9 1 ( ES402704 ) MUT07-L13.x1d-t SHGC-MUT Mytilus california...nus cD... 44 5.9 1 ( ES401815 ) MUT01-J08.y1d-s SHGC-MUT Mytilus californianus cD... 44 5.9 1 ( ...ES401708 ) MUT07-L13.y1d-s SHGC-MUT Mytilus californianus cD... 44 5.9 1 ( EG9626

  13. Dicty_cDB: Contig-U09547-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available S AND NUCLEIC ACIDS FOR THE ANALYSIS OF GEN... 46 2.9 1 ( DJ358571 ) METHODS AND NUCLEIC ACIDS FOR THE ANA...LYSIS OF GEN... 46 2.9 1 ( CS114314 ) Sequence 1072 from Patent WO2005054517. 46 2.

  14. Final Project Report, DynAX Innovations in Programming Models, Compilers and Runtime Systems for Dynamic Adaptive Event Driven Execution Models

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Guang [ET International, Inc., Newark, DE (United States); Meister, Benoit [Reservoir Labs, Inc. New York, NY (United States); Padua, David [Univ. of Illinois, Urbana-Champaign, IL (United States); Marquez, Andres [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2015-12-31

    This report contains a summary of the work done for the Dynax Project from 9/1/2012 to 8/31/2015. Much of the information presented is discussed in further detail in other STI annual and quarterly reports. Additionally, a NCE report was submitted covering work done from the period of 9/1/2015 to 12/31/2015.

  15. Dicty_cDB: Contig-U04598-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e R3-3010C20, W... 38 9.1 5 ( BX293980 ) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 36 9.1 16 ( ES880350 ) TlEST190 Toxasca...ris leonina adult worm cDNA libra... 40 9.2 2 ( ER295651 ) 1092343645632 Global-Oce

  16. Dicty_cDB: Contig-U14889-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1075 ) UM58TA08.5pR Populus female catkins cDNA library ... 44 6.9 1 ( DN491066 )... UM58TA08.3pR Populus female catkins cDNA library ... 44 6.9 1 ( BU881046 ) UM58TA08 Populus flower cDNA lib

  17. Dicty_cDB: Contig-U14899-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a contig VV78X021237.8, whole genome... 44 9.9 1 ( DJ060393 ) Method and nucleic acids for the improve...d treatme... 44 9.9 1 ( DJ060271 ) Method and nucleic acids for the improved treatme...

  18. Dicty_cDB: Contig-U02375-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Cryptomeria japonica cDNA clone: CMFL031_P02, 5'e... 44 4.9 1 ( EX314727 ) GQ02807.SP6_I05 GQ028 - Cambium / phloem scrap...pin... 44 4.9 1 ( EX314403 ) GQ02807.B7_I05 GQ028 - Cambium / phloem scrap

  19. A Course of Lectures on Statistical Mechanics

    Science.gov (United States)

    2010-06-01

    30 9 The Chemical Potential and Phase Changes 32 9.1 Colligative Properties of Solutions...seeking regions of lower particle densities. 9.1 Colligative Properties of Solutions These are properties that only depend on the concentration of a...coefficient of isothermal compressibility, 32 thermal conductivity, 26, 59 thermal expansion, 31 viscosity, 58 colligative properties of solutions, 33

  20. Dicty_cDB: Contig-U04991-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsitans morsitans EST, clone GMsg32b03... 44 8.9 1 ( EV252836 ) EST_cclu_evb_470026 ccluevb mixed_tissue Coregon...u... 44 8.9 1 ( EV252835 ) EST_cclu_evb_469642 ccluevb mixed_tissue Coregonu.

  1. Executive summary : preliminary analysis of cost, value, and risk.

    Science.gov (United States)

    2008-02-12

    Access to emergency services provided by 9-1-1 in todays world is evolving. The U.S. Department of Transportation (USDOT) understands that 9-1-1 will ultimately become part of a broader array of interconnected networks supporting emergency service...

  2. Dicty_cDB: Contig-U05380-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available patent US 6812339. 42 9.9 1 ( AC090889 ) Canis lupus familiaris clone RP81-156O18, complet... 42 9.9...VMRC18-337E3, WORKING... 42 9.9 1 ( AC188157 ) Canis lupus familiaris chromosome 14 clone XX-191... 42 9.9

  3. Dicty_cDB: Contig-U02738-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available UCRCS08_24H01_g Parent Washington Navel Orange Ca... 46 2.9 1 ( CX071912 ) UCRCS08_24H01_b Parent Washington...UCRCS08_12D10_b Parent Washington Navel Orange Ca... 46 2.9 1 ( CV717547 ) UCRCS08_0009C14_f Parent Washington

  4. Dicty_cDB: CHS239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available neering clone MHPN192d01. 42 9.9 1 AZ781723 |AZ781723.1 2M0021H18F Mouse 10kb plasm...end partial sequence. 42 9.9 1 CR029411 |CR029411.1 Forward strand read from insert in 5'HPRT insertion targeting and chromosome engi

  5. AcEST: BP915933 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9.1 tr|A4V047|A4V047_DROME Brother of odd with entrails limited, iso... 33 9.1 >tr|B4L9X7|B4L9X7_DROMO GI141...IITQPESGKPPNQPLHSPHEAMPSFLGSIPMRKRILPAPTLDLMDPHHHP 673 >tr|A4V047|A4V047_DROME Brother of odd with entrails limited

  6. Dicty_cDB: Contig-U15371-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AC232590 ) Brassica rapa subsp. pekinensis clone KBrH089C20,... 44 9.1 1 ( AC231466 ) Choloepus hoffmanni ...clone CH281-360O8, WORKING DR... 44 9.1 1 ( AC231461 ) Choloepus hoffmanni clone CH281-208D11, WORKING D...

  7. Dicty_cDB: Contig-U05251-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AP001173 ) Homo sapiens genomic DNA, chromosome 18p11.2 clon... 44 6.9 1 ( AC233243 ) Choloepus hoffman...ni clone CH281-674L9, WORKING DR... 44 6.9 1 ( AC231700 ) Choloepus hoffmanni clone CH

  8. Injury Prevention Research

    Centers for Disease Control (CDC) Podcasts

    2009-09-01

    Research provides the knowledge that we need to understand what is possible, what is not, and the best way to proceed in our intervention efforts.  Created: 9/1/2009 by National Center for Injury Prevention and Control (NCIPC).   Date Released: 9/1/2009.

  9. Final analysis of cost, value and risk : executive summary.

    Science.gov (United States)

    2009-03-05

    The U.S. Department of Transportation (USDOT) has taken a leadership position in assessing : Next Generation 9-1-1 (NG9-1-1) technologies and the development of a framework for national : deployment. USDOT understands that access to emergency service...

  10. CYP2C9 genotype does not affect risk of tobacco-related cancer in the general population

    DEFF Research Database (Denmark)

    Kaur-Knudsen, Diljit; Nordestgaard, B.G.; Bojesen, S.E.

    2010-01-01

    .9/1.1 in the Copenhagen City Heart Study and below/above 0.8/1.3 and 0.9/1.1 in the Copenhagen General Population Study for tobacco-related cancer and all cancer, respectively. Conclusion: Genetic variations in CYP2C9 do not affect risk of tobacco-related cancers. (C) 2010 Elsevier Ltd. All rights reserved...

  11. Dicty_cDB: Contig-U13910-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C811264 ) Sr_pASP6_07a17_SP6 S. ratti mixed stage pAMP Stro... 44 7.9 1 ( EX970702 ) CAGO5258.fwd CAGO Karen...ia brevis Karbr Stressed (... 44 7.9 1 ( EX970607 ) CAGO5207.fwd CAGO Karenia bre

  12. Dicty_cDB: SHK341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone: QtrA-17314, 5' end, expressed in brain temporal lobe. 44 3.9 1 CJ476759 |CJ476759.1 Macaca fascicularis...clone: QtrA-11229, 5' end, expressed in brain temporal lobe. 44 3.9 1 dna update 2006. 6.10 Homology

  13. A Statistical Discrimination Experiment for Eurasian Events Using a Twenty-Seven-Station Network

    Science.gov (United States)

    1980-07-08

    earthquakes. Bull. Seism. Soc. Am., 35, 57. Gutenberg, B., and C. F. Richter (1956). Magnitude and energy of earthquakes, Annali Geofisica , 9, 1...Magnitude and energy of earthquakes, Annali Geofisica , _9, 1. Hanks, T., and W. Thatcher (1972). A graphical representation of

  14. Dicty_cDB: Contig-U04285-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available protein... 46 0.017 2 ( DL338844 ) METHODS FOR ANALYZING GENES OF INDUSTRIAL YEASTS. 46 0.017 2 ( DJ205293...C compl... 46 1.9 1 ( DL265766 ) METHODS FOR ANALYZING GENES OF INDUSTRIAL YEASTS. 46 1.9 1 ( DJ132215

  15. Dicty_cDB: Contig-U15360-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) NADH-aaa04g01.g1 Rhodnius_prolixus_EST_NADH_T.cru... 44 7.9 1 ( FD777121 ) NAD...H-aaa04g01.b1 Rhodnius_prolixus_EST_NADH_T.cru... 44 7.9 1 ( EX721241 ) RaSFL 635 Rheum australe low-tempera

  16. AcEST: DK946281 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AUL Peptide deformylase OS=Brevundimonas sp. BAL3 Align length 46 Score (bit) 32.7 E-value 9.1 Report BLASTX...4W654_9CAUL Peptide deformylase OS=Brevundimonas sp. ... 33 9.1 >tr|B4W654|B4W654_9CAUL Peptide deformylase OS=Brevu

  17. Dicty_cDB: SHJ712 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone: QccE-13890, 5' end, expressed in cerebellum cortex. 44 1.9 1 CJ438634 |CJ438634.1 Macaca fascicularis...clone: QccE-15863, 5' end, expressed in cerebellum cortex. 44 1.9 1 CJ474282 |CJ474282.1 Macaca fascicularis

  18. Bestimmung der Reinraumtauglichkeit an Betriebsmitteln. Videoübertragung aus den Laboren des Fraunhofer IPA: Vortrag gehalten auf der Lounges 2014, Vision Pharma, Innovation Food, 03. bis 05. Juni 2014, Stuttgart; Vortrag Session 49: IPA-Session, 04.06.2014

    OpenAIRE

    Bürger, Frank; Wiesner, Lisa; Ringe, Ute

    2014-01-01

    Die geringe Abgabe partikulärer Kontaminationen von Betriebsmitteln wie Robotern und Automatisierungskomponenten ist in Produktions- und Forschungsbereiche mit hohen Reinheitsanforderungen von besonderer Bedeutung. Das Abgabeverhalten von Partikeln wird nach VDI 2083 Blatt 9.1 mit dem Begriff Reinraumtauglichkeit definiert. Ebenso ist in VDI 2083 Blatt 9.1 eine Methode zur Bestimmung der Reinraumtauglichkeit beschrieben.

  19. Dicty_cDB: SLJ612 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available from strain PEST of Anopheles gambiae (African malaria mosquito). 42 3.9 1 BH400617 |BH400617.1 AG-ND-135L10...from strain PEST of Anopheles gambiae (African malaria mosquito). 42 3.9 1 AC145271 |AC145271.1 Oryza

  20. Papas Chips VII : coloración de las Chips (reacción de Maillard) y su relación con la calidad

    OpenAIRE

    Ordoñez, Ceferina Rosario; Limongelli, Juan Carlos Héctor; Alonso, Sara Angela

    1981-01-01

    p.91-106 Se estudió la influencia del contenido de glúcidos reductores solubles y de aminoácidos libres en la coloración de las papas fritas chips y su relación como posible parámetro de determinación de calidad. Los índices de color se relacionaron con la actividad de un panel calificador. Como materia prima se utilizaron tubérculos de Solanum tuberosum L., cultivares de distintos orígenes y años agrícola, previa conservación en dos condiciones. Se estudió la influencia de las mismas sobr...

  1. Between humans and beasts: the fictional uncanny in The Great God Pan and Shame

    Directory of Open Access Journals (Sweden)

    Shirley de Souza Gomes Carreira

    2017-01-01

    Full Text Available http://dx.doi.org/10.5007/2175-8026.2017v70n1p91 The purpose of this work is to analyze two fictional works, Arthur Machen’s novella The Great God Pan and Salman Rushdie’s novel Shame, which contain unusual situations and events, examining them to discuss how the fantastic elements in both texts relate to the  context of production of the works, that is, respectively, the nineteenth century and the second half of the twentieth century. Machen promoted a break with the tradition of horror stories, then in vogue, and Rushdie introduced features of Magical Realism into the Indian Postcolonial Literature. Temporally distant, the two works resort to the same device, typical of fantastic fiction, the metamorphosis of characters, and, through it, the authors build a subliminal criticism of the political and social system dominant in their own time.

  2. 9 Cr-- 1 Mo steel material for high temperature application

    Science.gov (United States)

    Jablonski, Paul D; Alman, David; Dogan, Omer; Holcomb, Gordon; Cowen, Christopher

    2012-11-27

    One or more embodiments relates to a high-temperature, titanium alloyed, 9 Cr-1 Mo steel exhibiting improved creep strength and oxidation resistance at service temperatures up to 650.degree. C. The 9 Cr-1 Mo steel has a tempered martensite microstructure and is comprised of both large (0.5-3 .mu.m) primary titanium carbides and small (5-50 nm) secondary titanium carbides in a ratio of. from about 1:1.5 to about 1.5:1. The 9 Cr-1 Mo steel may be fabricated using exemplary austenizing, rapid cooling, and tempering steps without subsequent hot working requirements. The 9 Cr-1 Mo steel exhibits improvements in total mass gain, yield strength, and time-to-rupture over ASTM P91 and ASTM P92 at the temperature and time conditions examined.

  3. Dinomys branickii Peters, 1873 (Rodentia, Dinomyidae): consumo e preferência alimentar em cativeiro.

    OpenAIRE

    Raymundo Tomaz Melo dos Santos Neto; Valber Cleyton Leal da Costa; Áurea Martins Gabriel; Diva Anelie de Araújo Guimarães

    2017-01-01

    http://dx.doi.org/10.5007/2175-7925.2017v30n1p91 Dinomys branickii é uma espécie vulnerável que sofre pressão de atividades antrópicas como a caça e a destruição do habitat. A criação dessa espécie em cativeiro é uma alternativa viável para a implantação de projetos de conservação e para ampliar o conhecimento dos principais aspectos da sua biologia. O objetivo deste trabalho foi determinar o consumo e a preferência alimentar de um grupo de D. branickii em cativeiro. Para determinar a pre...

  4. Nomad Aesthetics of Capoeira and the Deterritorialization of ADHD

    DEFF Research Database (Denmark)

    Levin, Kasper

    an embodied and aesthetic deterritorialization of the established understanding of ADHD this paper will explore the relationship between the expressive movements of the Afro-Brazilian martial art, capoeira, and the state of the body established by the ADHD diagnosis. Primarily constituted through a classical...... mind / body dualism the ADHD diagnosis classifies the subjects as appearing “as if their mind is elsewhere” (Diagnostic and statistical manual of mental disorders : DSM-IV-TR., 2000, p. 85). In this context the embodied cultural resistance in capoeira aesthetics can be seen as an endeavor toward...... with this description the capoeira scholar Nestor Capoeira has pointed out that capoeira can be considered a “Brazilian nomadic and urban war machine” (Capoeira, 2002, p. 91). As an art of physical and cultural resistance against the oppressing forces of slavery, the expressive bodily aesthetics of capoeira resonates...

  5. Application of aluminum diffusion coatings to mitigate the KCl-induced high-temperature corrosion

    DEFF Research Database (Denmark)

    Kiamehr, Saeed; Lomholt, T. N.; Dahl, Kristian Vinter

    2017-01-01

    Pack cementation was used to produce Fe1−xAl and Fe2Al5 diffusion coatings on ferritic-martensitic steel P91 and a Ni2Al3 diffusion coating on pure nickel. The performance of diffusion coatings against high-temperature corrosion induced by potassium chloride (KCl) was evaluated by exposing......-ray diffractometry (XRD) before and after the exposures. It was found that all the diffusion coatings formed protective oxides under salt-free exposure in air. Under the salt deposit, Fe1−xAl showed local failure while on large parts of the sample a protective layer had formed. Fe2Al5 was attacked over the entire...

  6. Effect of hardness values on the creep rupture strength in a Mod.9Cr1Mo steel

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Y. S.; Ryu, S. H.; Kong, B. O.; Kim, J. T. [Doosan Heavy Industries and Construction, Changwon (Korea, Republic of)

    2003-07-01

    The modified 9Cr-1Mo steel identified as T91, P91 and F91 in the ASME specification has been widely used for the construction of modern power plants. The available data on the influence of process parameters during manufacturing and fabrication on its properties are not sufficient. In this study, the influence of various thermal cycles on the hardness and the creep rupture strength was analyzed in the base metal and the weldments made in tube and pipe of a Mod.9Cr-1Mo steel. The low hardness, 155Hv, showed low creep rupture strength below the allowable stresses of T91 base metal in the ASME specification. This low value was attributed to the fully recovered dislocation structure and the weakening of precipitation hardening associated with the abnormal thermal cycles.

  7. Effect of Post-Weld Heat Treatment on Creep Rupture Properties of Grade 91 Steel Heavy Section Welds

    Energy Technology Data Exchange (ETDEWEB)

    Li, Leijun

    2012-11-02

    This project will conduct a systematic metallurgical study on the effect of post-weld heat treatment (PWHT) on the creep rupture properties of P91 heavy section welds. The objective is to develop a technical guide for selecting PWHT parameters, and to predict expected creep-rupture life based on the selection of heat treatment parameters. The project consists of four interdependent tasks: Experimentally and numerically characterize the temperature fields of typical post-weld heat treatment procedures for various weld and joint configurations to be used in Gen IV systems. Characterize the microstructure of various regions, including the weld fusion zone, coarse-grain heat-affected zone, and fine-grain heat affected zone, in the welds that underwent the various welding and PWHT thermal histories. Conduct creep and creep-rupture testing of coupons extracted from actual and physically simulated welds. Establish the relationship among PWHT parameters, thermal histories, microstructure, creep, and creep-rupture properties.

  8. Heat treated 9 Cr-1 Mo steel material for high temperature application

    Energy Technology Data Exchange (ETDEWEB)

    Jablonski, Paul D.; Alman, David; Dogan, Omer; Holcomb, Gordon; Cowen, Christopher

    2012-08-21

    The invention relates to a composition and heat treatment for a high-temperature, titanium alloyed, 9 Cr-1 Mo steel exhibiting improved creep strength and oxidation resistance at service temperatures up to 650.degree. C. The novel combination of composition and heat treatment produces a heat treated material containing both large primary titanium carbides and small secondary titanium carbides. The primary titanium carbides contribute to creep strength while the secondary titanium carbides act to maintain a higher level of chromium in the finished steel for increased oxidation resistance, and strengthen the steel by impeding the movement of dislocations through the crystal structure. The heat treated material provides improved performance at comparable cost to commonly used high-temperature steels such as ASTM P91 and ASTM P92, and requires heat treatment consisting solely of austenization, rapid cooling, tempering, and final cooling, avoiding the need for any hot-working in the austenite temperature range.

  9. Publications

    Directory of Open Access Journals (Sweden)

    2004-04-01

    Full Text Available Fabienne Blaise–« Une polémique tragique : le second volet de l’Ajax de Sophocle », Revue des Études Grecques 112, 1999, p. 383-408.–Traduction de Wilhelm Dilthey, Conception du monde et analyse de l’homme depuis la Renaissance et la Réforme, Paris (Cerf, collection Passages, 1999 (471 p..Jean Celeyrette,–La Physique de N. Oresme. Introduction.–« Le statut des mathématiques dans la Physique d’Oresme », Oriens Occidens 3, 2000, p. 91-113.–Jean Celeyrette -Edmond mazet, « La Hiérarchie des de...

  10. Attachment Competences in Children With ADHD During the Social-Skills Training and Attachment (SOSTRA) Randomized Clinical Trial

    DEFF Research Database (Denmark)

    Storebø, Ole Jakob; Skoog, Maria; Darling Rasmussen, Pernille

    2015-01-01

    Objective: To investigate the effects of social-skills training and a parental training program on children with ADHD as measured by the children's attachment competences. Method: The SOSTRA trial is a randomized, parallel-group, outcome-assessor-blinded, superiority trial evaluating 8 weeks social......-skills training and parental training plus standard treatment versus standard treatment alone for 8- to 12-year old children with ADHD. Results: There were no significant differences in attachment competences at 6 months between the experimental (n = 25) and the control (n = 22) groups (odds ratio = 1.06, 95......% confidence interval = [0.31, 3.58], p = .91). In total, 17 children (36%) changed their entry status, 1 (2%) from secure to insecure attachment, while 16 (34%) changed from insecure to secure attachment. Conclusion: The experimental treatment does not seem to affect attachment competences compared...

  11. Prediction of material creep behaviour for strain based life assessment applications

    Energy Technology Data Exchange (ETDEWEB)

    Rantala, J.H.; Hurst, R.C. [EC JRC IAM, Petten (Netherlands); Bregani, F. [ENEL, Milan (Italy)

    1998-12-31

    In this work the idea of using constant load uniaxial creep test results instead of constant stress results for developing a CDM creep model for the P92 material is demonstrated. Due to limited availability of creep test results this work is based on incomplete test data and a general stress rupture line. In spite of these limitations a material creep model was developed for use in a FE analysis. Using P91 material as an example, a method is proposed to account for differences in strain evolution as a function of stress which normally manifests itself as lower strain values at low stresses in a normalised time-strain plot. This allows the CDM model to be used both in FE analysis and in strain-based life assessment engineering calculations. (orig.) 3 refs.

  12. Transition Metal Coatings for Energy Conversion and Storage; Electrochemical and High Temperature Applications

    Science.gov (United States)

    Falola, Bamidele Daniel

    sequestration easier. One complication of oxyfuel coal combustion is that corrosion problems can be exacerbated due to flue gas recycling, which is employed to dilute the pure O2 feed and reduce the flame temperature. Refractory metal diffusion coatings of Ti and Zr atop P91 steel were created and tested for their ability to prevent corrosion in an oxidizing atmosphere at elevated temperature. Using pack cementation, diffusion coatings of thickness approximately 12 and 20 microm are obtained for Ti and Zr, respectively. The effects of heating to 950°C for 24 hr in 5% O2 in He are studied in situ by thermogravimetric analyses (TGA), and ex situ by SEM analyses and depth profiling by EDX. For Ti-coated, Zr-coated and uncoated P91 samples, extended heating in an oxidizing environment causes relatively thick oxide growth, but extensive oxygen penetration greater than 2.7 mm below the sample surface, and eventual oxide exfoliation, are observed only for the uncoated P91 sample. For the Ti- and Zr-coated samples, oxygen penetrates approximately 16 and 56 microm, respectively, below the surface. in situ TGA verifies that Ti-and Zr-coated P91 samples undergo far smaller mass changes during corrosion than uncoated samples, reaching close to steady state mass after approximately four hours.

  13. Dicty_cDB: Contig-U05410-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CHA(XYZ) common wild sunflowe... 44 7.9 1 ( DY931301 ) CHAZ6223.b1_M19.ab1 CHA(XYZ) common wild sunflowe...CHA(XYZ) common wild sunflowe... 44 7.9 1 ( DY930366 ) CHAZ5361.b1_B22.ab1 CHA(XYZ) common wild sunflowe...CHA(XYZ) common wild sunflowe... 44 7.9 1 ( DY927572 ) CHAZ2273.b1_B18.ab1 CHA(XYZ) common wild sunflowe...CHA(XYZ) common wild sunflowe... 44 7.9 1 ( DY927491 ) CHAZ2191.b1_M20.ab1 CHA(XYZ) common wild sunflowe...CHA(XYZ) common wild sunflowe... 44 7.9 1 ( DY927140 ) CHAZ1832.b1_P02.ab1 CHA(XYZ) common wild sunflowe

  14. Laser welding and post weld treatment of modified 9Cr-1MoVNb steel.

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Z. (Nuclear Engineering Division)

    2012-04-03

    Laser welding and post weld laser treatment of modified 9Cr-1MoVNb steels (Grade P91) were performed in this preliminary study to investigate the feasibility of using laser welding process as a potential alternative to arc welding methods for solving the Type IV cracking problem in P91 steel welds. The mechanical and metallurgical testing of the pulsed Nd:YAG laser-welded samples shows the following conclusions: (1) both bead-on-plate and circumferential butt welds made by a pulsed Nd:YAG laser show good welds that are free of microcracks and porosity. The narrow heat affected zone has a homogeneous grain structure without conventional soft hardness zone where the Type IV cracking occurs in conventional arc welds. (2) The laser weld tests also show that the same laser welder has the potential to be used as a multi-function tool for weld surface remelting, glazing or post weld tempering to reduce the weld surface defects and to increase the cracking resistance and toughness of the welds. (3) The Vicker hardness of laser welds in the weld and heat affected zone was 420-500 HV with peak hardness in the HAZ compared to 240 HV of base metal. Post weld laser treatment was able to slightly reduce the peak hardness and smooth the hardness profile, but failed to bring the hardness down to below 300 HV due to insufficient time at temperature and too fast cooling rate after the time. Though optimal hardness of weld made by laser is to be determined for best weld strength, methods to achieve the post weld laser treatment temperature, time at the temperature and slow cooling rate need to be developed. (4) Mechanical testing of the laser weld and post weld laser treated samples need to be performed to evaluate the effects of laser post treatments such as surface remelting, glazing, re-hardening, or tempering on the strength of the welds.

  15. Forecasting the distribution of precipitate diameters in the presence of changes in the structure of the material

    Directory of Open Access Journals (Sweden)

    Zieliński A.

    2017-03-01

    Full Text Available The results of investigations on the microstructure of T23 and T24 low-alloy steels as well as P91 and P92 high-chromium steels in the as-received condition and after 70.000 h annealing at 550-650°C are presented. The quantitative analysis of the existing precipitates was performed for representative images of microstructure. The statistical analysis of collected data allowed the parameters of a selected theoretical statistical distribution to be estimated. A forecast of average precipitate diameter and standard deviation of such a distribution for the time of 100,000 hours at 550 and 600°C for T23 and T24 steels and at 600 and 650°C for P91 and P92 steels was calculated. The obtained results of investigations have made it possible to compare changes in the microstructure of various steel grades due to long-term impact of elevated temperature. They have also confirmed the possibility of using, in evaluating the degradation degree of materials in use, the forecasting methods that derive from mathematical statistics, in particular the theory of stochastic processes and forecast by analogy methods. The presented approach allows the development of a forecast of precipitate diameter probability density under the microstructure instability conditions for selected steel grades. The assessment of material condition that takes into consideration, but is not limited to, the precipitate diameter measurement is useful as an assessment component in estimating the time of safe service of power unit elements working under creep conditions.

  16. Dicty_cDB: Contig-U05298-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 46 2.3 1 ( FG717446 ) G1144P324RD5.T0 Anolis carolinensis pooled normal... 46 2.3 1 ( FG708970 ) G1144P315RP3.T0 Anolis caroline... CCHS2516.b1_G06.ab1 CCHS Espina Barnadesia spinos... 44 9.1 1 ( FG782479 ) G1147P354RC6.T0 Anolis carolinen...sis pooled normal... 44 9.1 1 ( FG781166 ) G1147P354RA17.T0 Anolis carolinensis pooled norma... 44 9.1 1 ( F

  17. Download this PDF file

    African Journals Online (AJOL)

    abp

    2013-02-12

    Feb 12, 2013 ... 30.9. 1. 30.9. 1. 30.9. 1. 30.9. Compressed Air Cylinder. 123.5. 2. 246.9. 2. 246.9. 2. 246.9. Oxygen Cylinder. 123.5. 2. 246.9. 2. 246.9. 2. 246.9. Total. 1,362.2. 3,534.6. 1,306.5. ASD: Atrial Septal Defect; MVR: Mitral Valve Replacement; OPCAB: Off Pump Coronary Artery Bypass Grafting, Qty: Quantity ...

  18. FloCon 2008 Proceedings

    Science.gov (United States)

    2008-01-01

    talked in past IETF, http://www3.ietf.org/proceedings/07jul/slides/ipfix-10. pdf . NTT Network Service System Laboratories, NTT Corporation 16 P rocessing...Dshield AS • CBL data • Mynetwatchman • Our own darknet project output • Other private outside data – If XO host involved, we will go through these... pdf . NTT Network Service System Laboratories, NTT Corporation 16 P rocessing T im e 19 .5 1 6 2 5 4 1 2 4 .4 4 2 1 9 1 9 1 6 .3 2 3 1 5 7 9 1 4 .3 2 2

  19. Department of Defense Strategy to Support Multi-Agency Bat Conservation Initiative within the State of Utah

    Science.gov (United States)

    2008-02-28

    9.1.2 PAST Agricultural Pasture 9.1.3 Agricultural HEDG Agricultural Hedgerow /Shelterbelt 9.2.0 Other OTHR Other (explain in remarks) Photo_N: A...Unknown Reproductive status was not determined. Bat_Age: Record the age of the bat as based on the calcification of the phalangeal joints (Figure...Agricultural Pasture 9.1.3 Agricultural HEDG Agricultural Hedgerow /Shelterbelt 9.2.0 Other OTHR Other (explain in remarks) Photo_N: A Y/N toggle to

  20. Gclust Server: 12144 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available HSA_5453808 Cluster Sequences - 210 NP_006170.1 neurotrophin 5 preproprotein ; no annotation 9 1.00e-28 0...length 210 Representative annotation NP_006170.1 neurotrophin 5 preproprotein ; no annotation Number of Sequences

  1. Hepatitis C Screening in the Behavioral Healthcare Setting

    Science.gov (United States)

    ... of Internal Medicine, 156 (4), 271– 278. 18 Campbell, J. V., Hagan, H., Latka, M. H., Garfein, ... estimate transmission diversity in viral epidemics. PLoS Computational Biology, 9 (1), e1002876. doi:10.1371/journal.pcbi. ...

  2. Indiast saab maailma rahvarohkeim riik / Tõnu Prei

    Index Scriptorium Estoniae

    Prei, Tõnu, 1950-

    2005-01-01

    ÜRO rahvastikuraporti andmeil on maakera elanike arv 2050. a. 9,1 miljardit, kusjuures poole 2,6-miljardilisest juurdekasvust annavad vaid 9 riiki - India, Pakistan, Nigeeria, Kongo, Bangladesh, Uganda, USA, Etioopia ja Hiina

  3. What Are Heart Disease and Stroke?

    Science.gov (United States)

    ... Disease Venous Thromboembolism Aortic Aneurysm More What Are Heart Disease and Stroke? Updated:Dec 8,2015 There are ... include: High blood pressure Smoking Diabetes High cholesterol Heart disease Atrial fibrillation (Abnormal heart rhythm) Call 9-1- ...

  4. Transient Ischemic Attack

    Medline Plus

    Full Text Available ... a major stroke. It's important to call 9-1-1 immediately for any stroke symptoms. Popular Topics TIA ... rights reserved. Unauthorized use prohibited. The content in this library is for educational purposes only, and therefore ...

  5. December 2004 Sumatra, Indonesia Images

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The December 26, 2004 magnitude 9.1 Sumatra, Indonesia earthquake (3.316 N, 95.854 E, depth 30 km) generated a tsunami that was observed worldwide and caused...

  6. 78 FR 69711 - Change in Postal Rates

    Science.gov (United States)

    2013-11-20

    ... Fee increases by an average of 9.1 percent. The maximum amount for Vendor Assisted Electronic Money..., with additional changes concerning the availability of Electronic USPS Delivery Confirmation...

  7. RI E-911 Fire Hydrants; e911Hydrants13q1

    Data.gov (United States)

    University of Rhode Island Geospatial Extension Program — These data were originally developed and designed for Rhode Island Enhanced 9-1-1 purposes only. These data represents every known fire hydrant in the state of Rhode...

  8. Preliminary analysis of cost, value, and risk.

    Science.gov (United States)

    2008-02-12

    The U.S. Department of Transportation (USDOT) understands that access to emergency services provided by 9-1-1 in todays world of evolving technology will ultimately occur within a broader array of interconnected networks comprehensively supporting...

  9. Vermont Historical E911 RDS Archive (road centerlines)

    Data.gov (United States)

    Vermont Center for Geographic Information — (Link to Metadata) Archive of past 9-1-1 data releases at rough yearly intervals chosen from availbable datasets from 1999 to present. For a historical overview on...

  10. Gclust Server: 11241 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(133) 649 similar to inorganic phosphate transporter 9 1.00e-45 28.57 22.22 0...length 649 Representative annotation similar to inorganic phosphate transporter Number of Sequences 9 Homologs

  11. Procurement tool kit.

    Science.gov (United States)

    2009-09-30

    Todays 9-1-1 emergency communications professionals face challenges on multiple frontsa : fundamental lack of resources, aging equipment operating past its intended lifecycle, emerging : consumer technology that has outpaced public safety answe...

  12. 77 FR 65858 - Initiation of Antidumping and Countervailing Duty Administrative Reviews and Request for...

    Science.gov (United States)

    2012-10-31

    ... Bayuquan Refractories Co., Ltd. The People's Republic of China: Certain New Pneumatic 9/1/11-8/31/12 Off... Refractories Co., of Haicheng City Yingkou Bayuquan Refractories Co., Ltd. Suspension Agreements None. During...

  13. Download this PDF file

    African Journals Online (AJOL)

    (9.1) years, 56% were females. The prevalence of MS ... metabolic rate (8). There is paucity of reports on the metabolic syndrome in developing countries including Nigeria. The prevalence rates of the metabolic syndrome among patients with.

  14. Experiment list: SRX1046540 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ional stages based on the expression of CELL SURFACE ANTIGENS. 27172272,25.5,41.9,1...PROGENITOR CELLS that have migrated to the THYMUS where they differentiate into T-LYMPHOCYTES. Thymocytes are classified into maturat

  15. Hypertensive Crisis

    Science.gov (United States)

    ... Peripheral Artery Disease Venous Thromboembolism Aortic Aneurysm More Hypertensive Crisis: When You Should Call 9-1-1 for ... the Facts About HBP • Know Your Numbers Introduction Hypertensive Crisis Monitoring Your Blood Pressure At Home • Understand Symptoms ...

  16. High prevalence of primary dyslipidaemia in black South African ...

    African Journals Online (AJOL)

    The prevalence of cardiovascular disease is projected to be 38.7% for the USA in ... Secondary dyslipidaemia associated with diabetes mellitus, hypothyroidism, ... A predominant triglyceride problem was seen in 578 (9.1%) patients with TG ...

  17. 48 CFR 15.604 - Agency points of contact.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Unsolicited Proposals 15.604 Agency points... responsible prospective contractors (see subpart 9.1), and organizational conflicts of interest (see subpart 9...

  18. Spatio-temporal analysis of wetland change in Port Harcourt ...

    African Journals Online (AJOL)

    information techniques between 1984 and 2015. Landsat images of 1984, 2000 and 2015 of 30m x 30m resolution were used. Supervised classification was used for image classification using Maximum Likelihood Algorithm in Erdas Imagine 9.1 ...

  19. Final analysis of cost, value, and risk.

    Science.gov (United States)

    2009-03-05

    USDOT understands that access to emergency services provided by 9-1-1 in todays world of evolving : technology will ultimately occur within a broader array of interconnected networks comprehensively : supporting emergency servicesfrom public ac...

  20. Dicty_cDB: VSF111 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available genomic DNA, chromosome 2, BAC clone:OJ1014_G06, WORKING DRAFT SEQUENCE, 1 ordered pieces. 40 3.9 1 AP004842...genomic DNA, chromosome 2, PAC clone:P0683H08, WORKING DRAFT SEQUENCE, 1 ordered piece. 40 3.9 1 AP005803...genomic DNA, chromosome 2, BAC clone:OSJNBa0060K08, WORKING DRAFT SEQUENCE, 1 ordered pieces. 40 3.9 1 AP006160...genomic DNA, chromosome 2, BAC clone:B1178F07, WORKING DRAFT SEQUENCE, 1 ordered piece. 40 3.9 1 AC115183...|AC115183.4 Rattus norvegicus clone CH230-58J14, WORKING DRAFT SEQUENCE, 3 unordered pieces. 38 16 1 AJ513068

  1. Forest and land use mapping using Remote Sensing and Geographical Information System: A case study on model system

    National Research Council Canada - National Science Library

    Prabhat Kumar Rai

    2013-01-01

    ...) image, Arc View ver. 3.2, and ERDAS IMAGINE ver. 9.1 in order to investigate the forest/vegetation types/land cover mapping of Forest Research Institute campus (FRI), Dehradun, India (as model system...

  2. Dicty_cDB: Contig-U02384-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 143 ) Haemophilus ducreyi strain 35000HP complete genome. 46 1.9 1 ( FG294264 ) 1108770706308 New World Scre...wworm Larvae 9387 EST... 36 2.0 3 ( FG299783 ) 1108793347126 New World Screwworm

  3. Magnetism in the New GCSE

    Science.gov (United States)

    French, M. M. J.

    2016-01-01

    The new 9-1 GCSE courses in Physics include reference to both permanent and induced magnets. In this article I briefly examine the origin of ferromagnetism, diamagnetism and paramagnetism and suggest a number of helpful classroom demonstrations.

  4. RI E-911 Road Centerlines; e911Roads13q1

    Data.gov (United States)

    University of Rhode Island Geospatial Extension Program — These data were originally developed and designed for Rhode Island Enhanced 9-1-1 purposes only. These data contain street center lines and address ranges for all...

  5. 75 FR 29722 - Foreign-Trade Zone 138-Columbus, OH Area; Site Renumbering Notice

    Science.gov (United States)

    2010-05-27

    ... purposes. (Note: Sites 7 through 11 have expired and those numbers will not be reused.) Under this revision...; and, Site 19 (1 acre, expires 9/1/2010)--located at 330 Oak Street, Columbus. For further information...

  6. Vision Based SLAM in Dynamic Scenes

    Science.gov (United States)

    2012-12-20

    which make most of previous algorithms fail. This work was accepted for publication at the IEEE Transaction of Pattern Analysis and Machine Intelligence (TPAMI), with impact factor 5.9, #1 in all engineering and AI.

  7. Measured effect of some socio-demographic factors

    African Journals Online (AJOL)

    Administrator

    symptoms: 13 (39.4%) of the respondents had minimal depression, 12 (36.4%) of them had mild depression, 3 (9.1%) .... understandably an upsetting time for women. It is opined that .... cancer: Psychosocial factors influencing risk perception,.

  8. Dicty_cDB: Contig-U11079-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone:dda30d08, 5' ... 347 0.0 3 ( FK059898 ) XABT123780.b1 Gateway compatible cien cDNA librar... 60 3e-04 ...1 ( ES499786 ) BIG_AF_7602 Brine Shrimp diapaused embryos (cysts... 52 0.063 1 ( FK181182 ) XABT199222.g1 Gateway...lsalevj mixed_tissue_mixed_st... 46 3.9 1 ( FK189356 ) XABT204292.g1 Gateway compatible cien cDNA librar... ...46 3.9 1 ( FK135868 ) XABT171372.g1 Gateway compatible cien cDNA librar... 46 3.9 1 ( FK121040 ) XABT162460.g1 Gateway... compatible cien cDNA librar... 46 3.9 1 ( FF798831 ) XABT91999.rev Gateway

  9. RI E-911 Sites; e911Sites13q1

    Data.gov (United States)

    University of Rhode Island Geospatial Extension Program — These data were originally developed and designed for Rhode Island Enhanced 9-1-1 purposes only. These data represent every known building or structure in the state...

  10. Organizational innovation: verifying a comprehensive model for catalyzing organizational development and change

    National Research Council Canada - National Science Library

    Steiber, Annika; Alänge, Sverker

    2015-01-01

    .... Previous research has identified a need for a more comprehensive framework that will aid in better understanding of the mechanisms catalyzing organizational development and change. Steiber and Alänge (Triple Helix 2(9):1–25, 2015...

  11. Gclust Server: 68539 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(231) 838 mec-9: MEChanosensory abnormality family member (mec-9) 1 1.00e-10 0...length 838 Representative annotation mec-9: MEChanosensory abnormality family member (mec-9) Number of Sequences

  12. Purification and characterization of a neurotoxin from the venom of Ophiophagus hannah (king cobra).

    Science.gov (United States)

    Chang, Long-Sen; Liou, Jau-Cheng; Lin, Shinne-Ren; Huang, Hsien-Bin

    2002-06-14

    A neurotoxin, Oh9-1, from the venom of Ophiophagus hannah was isolated by a combination of ion-exchange chromatography and reverse phase HPLC. Amino acid sequence analysis revealed that Oh9-1 consists of 57 amino acids and eight cysteine residues. This protein was mainly constituted with beta-sheet as evidenced by CD spectrum. Oh9-1 inhibited carbachol-induced muscle contraction in an irreversible manner and the dose for achieving 50% inhibition was approximately fourfold that of alpha-bungarotoxin. Since the residues in alpha-neurotoxins closely involve in the binding with acetylcholine receptors are not highly conserved in this toxin molecule, Oh9-1 represents a novel type of neurotoxin structurally distinct from alpha-neurotoxins.

  13. Incidencia, mortalidad y prevalencia de enfermedad renal crónica terminal en la región del Bajo Lempa, El Salvador: 10 años de registro comunitario

    Directory of Open Access Journals (Sweden)

    Ramón García-Trabanino

    2016-09-01

    Conclusiones: En esta región la incidencia de ERCT es elevada. Pocos reciben TSR. La mortalidad es alta, aun con TSR. Son mayormente varones adultos (9:1. Los determinantes sociales inciden en la alta mortalidad.

  14. SwissProt search result: AK103898 [KOME

    Lifescience Database Archive (English)

    Full Text Available hophosphate dikinase) (Cold-sensitive pyruvate, orthophosphate dikinase) PPDK_FLABI 0.0 ... ...AK103898 J033150I16 (Q39735) Pyruvate, phosphate dikinase, chloroplast precursor (EC 2.7.9.1) (Pyruvate, ort

  15. SwissProt search result: AK101783 [KOME

    Lifescience Database Archive (English)

    Full Text Available hophosphate dikinase) (Cold-sensitive pyruvate, orthophosphate dikinase) PPDK_FLABI 0.0 ... ...AK101783 J033065A07 (Q39735) Pyruvate, phosphate dikinase, chloroplast precursor (EC 2.7.9.1) (Pyruvate, ort

  16. SwissProt search result: AK065739 [KOME

    Lifescience Database Archive (English)

    Full Text Available hophosphate dikinase) (Cold-sensitive pyruvate, orthophosphate dikinase) PPDK_FLABR 0.0 ... ...AK065739 J013039L05 (Q39734) Pyruvate, phosphate dikinase, chloroplast precursor (EC 2.7.9.1) (Pyruvate, ort

  17. SwissProt search result: AK065739 [KOME

    Lifescience Database Archive (English)

    Full Text Available hophosphate dikinase) (Cold-sensitive pyruvate, orthophosphate dikinase) PPDK_FLABI 0.0 ... ...AK065739 J013039L05 (Q39735) Pyruvate, phosphate dikinase, chloroplast precursor (EC 2.7.9.1) (Pyruvate, ort

  18. A morphological study of the tooth roots of the Sima del Elefante mandible (Atapuerca, Spain): a new classification of the teeth-biological and methodological considerations

    National Research Council Canada - National Science Library

    PRADO-SIMÓN, LEYRE; MARTINÓN-TORRES, MARÍA; BACA, PILAR; GÓMEZ-ROBLES, AIDA; LAPRESA, MARÍA; CARBONELL, EUDALD; BERMÚDEZ DE CASTRO, JOSÉ MARIA

    2012-01-01

    ...), maximizing the amount of information that can be extracted from a given specimen. In this study, we present a three-dimensional evaluation of the dental roots of the Sima del Elefante mandible, ATE9-1 (Atapuerca, Spain...

  19. Tracks FAQs: How Do Heart Attack Hospitalization Rates In My Community Compare With Other Counties Or States?

    Centers for Disease Control (CDC) Podcasts

    2011-09-01

    In this podcast, CDC Tracking experts discuss how to compare heart attack hospitalization rates in your community with other counties or states. Do you have a question for our Tracking experts? Please e-mail questions to trackingsupport@cdc.gov.  Created: 9/1/2011 by National Center for Environmental Health, Division of Environmental Hazards and Health Effects, Environmental Health Tracking Branch.   Date Released: 9/1/2011.

  20. Coastal ecosystems

    Digital Repository Service at National Institute of Oceanography (India)

    Madhupratap, M.

    stream_size 2 stream_content_type text/plain stream_name Biodiversity_Western_Ghats_Inf_Kit_1994_3.9_1.pdf.txt stream_source_info Biodiversity_Western_Ghats_Inf_Kit_1994_3.9_1.pdf.txt Content-Encoding ISO-8859-1 Content-Type text.../plain; charset=ISO-8859-1 ...

  1. Transfer of Military Technology to Developing Countries: The Turkish Case

    Science.gov (United States)

    1989-06-01

    first Brazilian built ships laid down in 1972. b Stretched version of UK-designed Leander (Nilgiri) Class. uncertain data. Source: M. Brzoska and T...functioning weapon system (Brzoska, 1986, p. 284). Brazilian armored vehicles from Engesa, aircraft from Embraer, South Korean howitzers and ships...Speed Cinema Recording Technology 8.7.7 Microdensitometer Technology 9.0 TELECOMMUNICATIONS TECHNOLOGY 9.1 Telecommunications Systems Technology 9.1.1

  2. Cultural Resource Investigation of Submerged Anomalies, Breton Sound Disposal Area, Plaquemines Parish, Louisiana. Phase 2.

    Science.gov (United States)

    1993-09-01

    Gulf ports and the mouth of the Mississippi River. These ships carried such products as silk, tobacco, rice, indigo , sassafras, quinine, and lumber...Owe883G4sms . . Kid ,.. =*1e029134"�. 5 :: 10295,:!49746;.0 N 𔃻 82 9 1 8- 4 9 7 5 64 6.. v a 283 4 i. g g A) i-. .~ 1 8 2 9 1 1 Q 4 9 7 6 2 . 5 7 ; .5 i

  3. Dicty_cDB: Contig-U16406-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( DI089722 ) DNA Probe Derived from 23S rRNA Gene for Detectio... 54 0.008 1 ( DI062367 ) DNA Probe Derived ...roplast DNA, complete... 46 1.9 1 ( DI081176 ) DNA Probe Derived from 23S rRNA Gene for Detectio... 46 1.9 1...from 23S rRNA Gene for Detectio... 54 0.008 1 ( ET629122 ) bext_c_1 Bulleidia extructa W1219 genomic library

  4. A prospective analysis of 33 genitourinary injuries. | Dakum ...

    African Journals Online (AJOL)

    Genitourinary organs injured were the urethra in 15(45.5%), penis 7(21.2%), scrotum 4 (12.1%), bladder 3(9.1%), ureter 3(9.1%), testis 1(3.0%). Aetiology was iatrogenic (8), road traffic accidents (7), industrial accidents (3), assault (3), collapsed building (2), falls (2) and self-inflicted injuries (2). The musculoskeletal system ...

  5. Pharmacological and pharmaceutical properties of freeze-dried formulations of egg albumin, indomethacin, olive oil, or fatty acids.

    Science.gov (United States)

    Tsuji, Y; Kakegawa, H; Miyataka, H; Matsumoto, H; Satoh, T

    1993-07-01

    Formulations consisting of egg albumin, indomethacin (IND), and olive oil or fatty acids, were prepared by vigorous stirring using a high-speed homogenizer and subsequent freeze-drying. To confirm the anti-inflammatory properties and ulcerogenic effects of the formulations, we examined the action of the formulations on carrageenan-induced edema in rats as well as their ulcerogenic actions in the same species. Compared with IND alone, albumin-IND-olive oil (9:1:4.3), albumin-IND-linolenic acid (9:1:4.3), albumin-IND-linolic acid (9:1:4.3), albumin-IND-oleic acid (9:1:4.3), albumin-IND-stearic acid (9:1:4.3), and albumin-IND-tristearin (9:1:4.3) formulations all exhibited a more potent inhibitory effect on carrageenan-induced edema. In addition, the inhibitory effects on edema formation of an albumin-IND (9:1) complex was as strong as that of IND alone. These results suggested that the bioavailability of IND was increased by olive oil, fatty acid, and tristearin as absorbefacient agents. The increase in the bioavailability was evident from the fact that the mean plasma levels, maximum plasma levels (Cmax), and area under plasma concentration-time curve (AUC) values after oral administration of the albumin-IND-olive oil (9:1:4.3) formulation was significantly greater than that after administration of the drug alone. With respect to their ulcerogenic properties, the formulations were significantly less active than IND alone, suggesting that a reduction in the ulcerogenic activity of IND was by produced complexation with egg albumin.

  6. Dicty_cDB: Contig-U16543-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available wering ... 46 1.7 1 ( FL692363 ) CCGA2651.b1 CCGA Panicum virgatum apex + stem (H)... 46 1.7 1 ( AC011267 ) ... 1 ( FL700376 ) CCGA6776.g1 CCGA Panicum virgatum apex + stem (H)... 44 6.9 1 ( FL698837 ) CCGA6010.g1 CCGA Panicum virgatum apex... + stem (H)... 44 6.9 1 ( FL698138 ) CCGA5654.g1 CCGA Panicum virgatum apex + stem (H).

  7. Dicty_cDB: CHS394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 95546.1 Molgula tectiformis cDNA, gonad clone:mtgd025l22, 5' end. 44 7.9 1 CA929806 |CA929806.1 MTU2CA.P3.A01 Aspen apex... cDNA Library Populus tremuloides cDNA, mRNA sequence. 44 7.9 1 CA929196 |CA929196.1 MTU2CA.P10.C05 Aspen apex

  8. [Analysis of community composition in dental plaque of elder people with root caries].

    Science.gov (United States)

    Ma, Shan-fen; Liang, Jing-ping; Jiang, Yun-tao; Zhu, Cai-lian

    2011-10-01

    To analyze the community in dental plaque of elder people with root caries. Total DNAs were extracted from the root caries dental plaques of nine elders over 60 years of age. Polymerase chaid reaction-based denaturing gradient gel electrophoresis (PCR-DGGE) was used to analyze the microbial composition, DGGE bands were excised from the gels for sequencing and identification. The dominant genus in root caries dental plaque of elder people were: Acinetobacte [0.9% (1/114)], Actinobaculum [1.8% (2/114)], Actinomyces [15.8% (18/114)], Aggregatibacter [0.9% (1/114)], Capnocytophaga [14.0% (16/114)], Corynebacterium [0.9% (1/114)], Haemophilus [0.9% (1/114)], Mobiluncus [0.9% (1/114)], Naxibacter [0.9% (1/114)], Neisseriaceae [10.5% (12/114)], Porphyromonas [0.9% (1/114)], Prevotella [12.3% (14/114)], Selenomonas [6.1% (7/114)], Staphylococcus [1.8% (2/114)], Oralis streptococcus [6.1% (7/114)], Mutans streptococcu [7.9% (9/114)], Tannerella [0.9% (1/114)], Treponema [1.8% (2/114)], Veillonella [10.5% (12/114)] and two uncultured unknown genus [1.8% (2/114)]. Uncultred genotypes accounted for 19.30% of the total. Gram-positive bacteria genotype accounted for 31.6% (36/114), and Gram-negative bacteria genotype accounted for 66.7% (76/114). There were many bacteria genotypes in root caries dental plaque in the elderly, which were widely distributed. Gram-negative bacteria accounted for the majority. Genotype-specific pathogenic bacteria were not found.

  9. The role of alloy composition, environment and stresses for the oxidation resistance of modern 9% Cr steels for fossil power stations

    Directory of Open Access Journals (Sweden)

    M. Schütze

    2004-03-01

    Full Text Available In recent years a new group of ferritic-martensitic chromium steels for the use in fossil power stations has been developed with chromium contents between 9 and 12%. Typical representatives of these steels are P91, E911 and Nf616, which are nowadays widely used in the more advanced power plants. In the development phase the focus was on the mechanical properties of these steels but when taking them to practical operation conditions it turned out that much of the life-time of the materials and components is determined by their oxidation properties. Oxidation resistance is first of all a function of alloy composition. For the steels of this group it is chromium, silicon, manganese and molybdenum that decide their oxidation performance and since the contents especially of the four elements can be significantly different for the different steels there can be clear differences in oxidation behaviour. One of the most important issues from this point of view is how the concentrations of these elements change in the metal subsurface zone during operation/oxidation since if their level drops below a critical level oxidation resistance of the steels will be lost. In the work to be reported the influence of alloy composition and metal subsurface zone concentration as a function of oxidation time up to 10000 h was investigated in dry air and air up to 10% water vapour at 650 °C. The investigations comprised several of the advanced commercial 9% Cr steels including P91, E911, Nf616 and six laboratory melts of Nf616 with different amounts of silicon. As the results of the investigations show humidity, which is omnipresent in combustion environments, can dramatically accelerate oxidation. Silicon as an alloying element reduces the detrimental effect of water vapour significantly while molybdenum has a negative effect. The effects of the key alloying elements in these steels was quantified for conditions with and without water vapour in the environment

  10. Molecular characterization of Paecilomyces fumosoroseus (Deuteromycotina: Hyphomycetes isolates Caracterização molecular de isolados de Paecilomyces fumosoroseus (Deuteromycotina: Hyphomycetes

    Directory of Open Access Journals (Sweden)

    Andréia Cristiane Souza Azevedo

    2000-12-01

    Full Text Available ITS and RAPD analyses were used to investigate molecular variations within samples of Paecilomyces isolates and to resolve five morphologically atypical isolates resembling P. fumosorosus, obtained from whitefly in Northern Paraná State. The ITS4-ITS5 amplicon was 700 base pairs (bp long in all isolates. The five isolates of Paecilomyces not assigned to species produced restriction profiles identical to all the reference strains of P. fumosoroseus. The extent of fingerprint variability observed by RAPD was sufficient to discriminate all the isolates. The genetic similarity among unidentified isolates and strains of P. fumosoroseus was even higher than that observed among reference strains of this species, allowing us to conclude that isolates CNPso-P77, CNPso-P78, CNPso-P80, CNPso-P85 and CNPso-P91 are P. fumosoroseus.As análises de RAPD (Polimorfismo de DNA Amplificado ao Acaso e ITS (Sequências Internas Transcritas foram utilizadas para investigar a variabilidade molecular entre isolados de Paecilomyces e para identificar cinco isolados morfologicamente atípicos, obtidos a partir de mosca branca no Norte do Estado do Paraná, que possuíam alguma semelhança com P. fumosoroseus. O produto da amplificação com os primers ITS4 e ITS5 apresentou 700 pares de bases para todos os isolados investigados. Os cinco isolados não identificados deram origem a padrões de restrição idênticos a todas as linhagens de P. fumosoroseus utilizadas como referência. A variabilidade observada nos perfis de RAPD foi suficiente para discriminar todos os isolados. A similaridade genética entre os isolados não identificados e as linhagens de P. fumosoroseus foi maior do que aquela observada entre as linhagens referência desta espécie. Este fato permitiu concluir que os isolados CNPso-P77, CNPso-P78, CNPso-P80, CNPso-P85 and CNPso-P91 pertencem à espécie P. fumosoroseus.

  11. Both Met(109) and Met(112) are Utilized for Cu(II) Coordination to the Amyloidogenic Fragment of the Human Prion Protein

    Energy Technology Data Exchange (ETDEWEB)

    Shearer, J.; Soh, P; Lentz, S

    2008-01-01

    The prion protein is a ubiquitous neuronal membrane protein. Misfolding of the prion protein has been implicated in transmissible spongiform encephalopathies (prion diseases). It has been demonstrated that the human prion protein (PrP) is capable of coordinating at least five Cu{sup II} ions under physiological conditions; four copper binding sites can be found in the octarepeat domain between residues 61 and 91, while another copper binding site can be found in the unstructured 'amyloidogenic' domain between residues 91 and 126 PrP(91-126). Herein we expand upon a previous study (J. Shearer, P. Soh, Inorg. Chem. 46 (2007) 710-719) where we demonstrated that the physiologically relevant high affinity Cu{sup II} coordination site within PrP(91-126) is found between residues 106 and 114. It was shown that Cu{sup II} is contained within a square planar (N/O){sub 3}S coordination environment with one His imidazole ligand (H(111)) and one Met thioether ligand (either M(109) or M(112)). The identity of the Met thioether ligand was not identified in that study. In this study we perform a detailed investigation of the Cu{sup II} coordination environment within the PrP fragment containing residues 106-114 (PrP(106-114)) involving optical, X-ray absorption, EPR, and fluorescence spectroscopies in conjunction with electronic structure calculations. By using derivatives of PrP(106-114) with systematic Met {yields} Ile 'mutations' we show that the Cu{sup II} coordination environment within PrP(106-114) is actually comprised of a mixture of two major species; one CuII(N/O){sub 3}S center with the M(109) thioether coordinated to Cu{sup II} and another Cu{sup II}(N/O){sub 3}S center with the M(112) thioether coordinated to Cu{sup II}. Furthermore, deletion of one or more Met residues from the primary sequence of PrP(106-114) both reduces the Cu{sup II} affinity of the peptide by two to seven fold, and renders the resulting Cu{sup II} metallopeptides redox

  12. A Structural Hinge in Eukaryotic MutY Homologues Mediates Catalytic Activity and Rad9-Rad1-Hus1 Checkpoint Complex Interactions

    Energy Technology Data Exchange (ETDEWEB)

    P Luncsford; D Chang; G Shi; J Bernstein; A Madabushi; D Patterson; A Lu; E Toth

    2011-12-31

    The DNA glycosylase MutY homologue (MYH or MUTYH) removes adenines misincorporated opposite 8-oxoguanine as part of the base excision repair pathway. Importantly, defects in human MYH (hMYH) activity cause the inherited colorectal cancer syndrome MYH-associated polyposis. A key feature of MYH activity is its coordination with cell cycle checkpoint via interaction with the Rad9-Rad1-Hus1 (9-1-1) complex. The 9-1-1 complex facilitates cell cycle checkpoint activity and coordinates this activity with ongoing DNA repair. The interdomain connector (IDC, residues 295-350) between the catalytic domain and the 8-oxoguanine recognition domain of hMYH is a critical element that maintains interactions with the 9-1-1 complex. We report the first crystal structure of a eukaryotic MutY protein, a fragment of hMYH (residues 65-350) that consists of the catalytic domain and the IDC. Our structure reveals that the IDC adopts a stabilized conformation projecting away from the catalytic domain to form a docking scaffold for 9-1-1. We further examined the role of the IDC using Schizosaccharomyces pombe MYH as model system. In vitro studies of S. pombe MYH identified residues I261 and E262 of the IDC (equivalent to V315 and E316 of the hMYH IDC) as critical for maintaining the MYH/9-1-1 interaction. We determined that the eukaryotic IDC is also required for DNA damage selection and robust enzymatic activity. Our studies also provide the first evidence that disruption of the MYH/9-1-1 interaction diminishes the repair of oxidative DNA damage in vivo. Thus, preserving the MYH/9-1-1 interaction contributes significantly to minimizing the mutagenic potential of oxidative DNA damage.

  13. Popliteal versus tibial retrograde access for subintimal arterial flossing with antegrade-retrograde intervention (SAFARI) technique.

    Science.gov (United States)

    Hua, W R; Yi, M Q; Min, T L; Feng, S N; Xuan, L Z; Xing, J

    2013-08-01

    This study aimed to ascertain differences in benefit and effectiveness of popliteal versus tibial retrograde access in subintimal arterial flossing with the antegrade-retrograde intervention (SAFARI) technique. This was a retrospective study of SAFARI-assisted stenting for long chronic total occlusion (CTO) of TASC C and D superficial femoral lesions. 38 cases had superficial femoral artery lesions (23 TASC C and 15 TASC D). All 38 cases underwent SAFARI-assisted stenting. The ipsilateral popliteal artery was retrogradely punctured in 17 patients. A distal posterior tibial (PT) or dorsalis pedis (DP) artery was retrogradely punctured in 21 patients, and 16 of them were punctured after open surgical exposure. SAFARI technical success was achieved in all cases. There was no significant difference in 1-year primary patency (75% vs. 78.9%, p = .86), secondary patency (81.2% vs. 84.2%, p = .91) and access complications (p = 1.00) between popliteal and tibial retrograde access. There was statistical difference in operation time between popliteal (140.1 ± 28.4 min) and tibial retrograde access with PT/DP punctures after surgical vessel exposure (120.4 ± 23.0 min, p = .04). The SAFARI technique is a safe and feasible option for patients with infrainguinal CTO (TASC II C and D). The PT or DP as the retrograde access after surgical vessel exposure is a good choice when using the SAFARI technique. Copyright © 2013 European Society for Vascular Surgery. Published by Elsevier Ltd. All rights reserved.

  14. Higher-order harmonics coupling in different free-electron laser codes

    Science.gov (United States)

    Giannessi, L.; Freund, H. P.; Musumeci, P.; Reiche, S.

    2008-08-01

    The capability for simulation of the dynamics of a free-electron laser including the higher-order harmonics in linear undulators exists in several existing codes as MEDUSA [H.P. Freund, S.G. Biedron, and S.V. Milton, IEEE J. Quantum Electron. 27 (2000) 243; H.P. Freund, Phys. Rev. ST-AB 8 (2005) 110701] and PERSEO [L. Giannessi, Overview of Perseo, a system for simulating FEL dynamics in Mathcad, , in: Proceedings of FEL 2006 Conference, BESSY, Berlin, Germany, 2006, p. 91], and has been recently implemented in GENESIS 1.3 [See ]. MEDUSA and GENESIS also include the dynamics of even harmonics induced by the coupling through the betatron motion. In addition MEDUSA, which is based on a non-wiggler averaged model, is capable of simulating the generation of even harmonics in the transversally cold beam regime, i.e. when the even harmonic coupling arises from non-linear effects associated with longitudinal particle dynamics and not to a finite beam emittance. In this paper a comparison between the predictions of the codes in different conditions is given.

  15. Association of brief health literacy screening and blood pressure in primary care.

    Science.gov (United States)

    Willens, David E; Kripalani, Sunil; Schildcrout, Jonathan S; Cawthon, Courtney; Wallston, Ken; Mion, Lorraine C; Davis, Corinne; Danciu, Iona; Rothman, Russell L; Roumie, Christianne L

    2013-01-01

    Health literacy impacts health outcomes. However, the relationship to blood pressure is inconsistent. This study aimed to determine whether health literacy, assessed by clinic staff, is associated with blood pressure among patients with hypertension. The design was a cross-sectional study of a large sample of primary care patient encounters in 3 academic medical center clinics in Nashville, Tennessee. Health literacy was assessed using the Brief Health Literacy Screen, with higher scores indicating higher health literacy. Blood pressure was extracted from the electronic health record. Using 23,483 encounters in 10,644 patients, the authors examined the association of health literacy with blood pressure in multivariable analyses, adjusting for age, gender, race, education, and clinic location. Independent of educational attainment, 3-point increases in health literacy scores were associated with 0.74 mmHg higher systolic blood pressure (95% CI [0.38, 1.09]) and 0.30 mmHg higher diastolic blood pressure (95% CI [0.08, 0.51]). No interaction between education and health literacy was observed (p = .91). In this large primary care population of patients with hypertension, higher health literacy, as screened in clinical practice, was associated with a small increase in blood pressures. Future research is needed to explore this unexpected finding.

  16. Cultivation of microalgae in dairy farm wastewater without sterilization.

    Science.gov (United States)

    Ding, Jinfeng; Zhao, Fengmin; Cao, Youfu; Xing, Li; Liu, Wei; Mei, Shuai; Li, Shujun

    2015-01-01

    The present study investigated the feasibility of cultivating microalgae in dairy farm wastewater. The growth of microalgae and the removal rate of the nutrient from the wastewater were examined. The wastewater was diluted 20, 10 and 5 times before applied to cultivate microalgae. A 5 dilution yielded 0.86 g/L dry weight in 6 days with a relative growth rate of 0.28 d(-1), the 10×dilution gave 0.74 g/L and a relative growth rate of 0.26 d(-1) while the 20×dilution 0.59 g/L and a relative growth rate 0.23 d(-1). The nutrients in the wastewater could be removed effectively in different diluted dairy wastewater. The greatest dilution (20×) showed the removal rates: ammonia, 99.26%; P, 89.92%; COD, 84.18%. A 10×dilution removal% was: ammonia 93; P 91 and COD 88. The 5× dilution removal% was: ammonia 83; P 92; COD 90.

  17. O diário escondido da Serafina: a hipertextualidade na literatura infantil contemporânea

    Directory of Open Access Journals (Sweden)

    Elaine Cristina da Silva Martins

    2015-12-01

    Full Text Available http://dx.doi.org/10.5007/1807-9288.2015v11n2p91 Este artigo tem como objetivo analisar as características hipertextuais na literatura infantil. Como corpus de análise, foi escolhido o livro O diário escondido da Serafina. Partiu-se do conceito desenvolvido por Neitzel (2009 de que uma obra hipertextual é aquela que apresenta quatro princípios que cooperam para a sua textualidade múltipla: reversibilidade, rede e nós, interação e engastes. Como resultado, indica-se que os aspectos gráficos (layout do livro analisado permitem a quebra da linearidade do texto e colaboram para ampliar as possibilidades de entrada do leitor nas suas malhas. Além disso, a grande quantidade de textos espraiados no interior da narrativa também auxilia a produtividade propondo diálogos entre diversos textos, apontando para a construção de um texto plural.

  18. Adult response to olanzapine or clozapine treatment is altered by adolescent antipsychotic exposure: a preclinical test in the phencyclidine hyperlocomotion model.

    Science.gov (United States)

    Shu, Qing; Hu, Gang; Li, Ming

    2014-04-01

    This study examined how repeated olanzapine (OLZ) or clozapine (CLZ) treatment in adolescence alters sensitivity to the same drug in adulthood in the phencyclidine (PCP) hyperlocomotion model. Male adolescent Sprague-Dawley rats (postnatal day (P) 44-48) were first treated with OLZ (1.0 or 2.0 mg/kg, subcutaneously (sc)) or CLZ (10.0 or 20.0 mg/kg, sc) and tested in the PCP (3.2 mg/kg, sc)-induced hyperlocomotion model for five consecutive days. Then a challenge test with OLZ (0.5 mg/kg) or CLZ (5.0 mg/kg) was administered either during adolescence (~P 51) or after the rats matured into adults (~P 76 and 91). During adolescence, repeated OLZ or CLZ treatment produced a persistent inhibition of PCP-induced hyperlocomotion across the five test days. In the challenge test during adolescence, rats previously treated with OLZ did not show a significantly stronger inhibition of PCP-induced hyperlocomotion than those previously treated with vehicle (VEH). In contrast, those previously treated with CLZ showed a weaker inhibition than the VEH controls. When assessed in adulthood, the enhanced sensitivity to OLZ and the decreased sensitivity to CLZ were detected on ~P 76, even on ~P 91 in the case of OLZ. These findings suggest that adolescent OLZ or CLZ exposure can induce long-term alterations in antipsychotic response that persist into adulthood.

  19. Para uma sociologia do carisma na atualidade: ensaio para leitura do carisma de Samora Machel.

    Directory of Open Access Journals (Sweden)

    Hélio Bento Maúngue

    2014-07-01

    Full Text Available http://dx.doi.org/10.5007/1806-5023.2014v11n1p91   O presente artigo é uma analisa sobre os usos e apropriações feitas da personalidade e qualidades carismáticas de Samora Machel. Pretendemos demonstrar que depois de morto o seu carisma prevalece e perdura no cotidiano, bem como que a relação emocional entre o líder e o povo continua. Apontamos que, nos dias atuais políticos, artistas, bem como cidadãos em geral fazem uso e apropriam-se, de modo racional e calculista, do carisma samoriano para obter benesses. Apontamos também que ainda hoje é Samora que as pessoas apelam e chamam para a resolução da grande maioria dos problemas da sociedade moçambicana. Assim, desencadeia-se um uso e apropriação político, socioeconômico e sociocultural do carisma samoriano. Tal uso e apropriação tornam o carisma um fenômeno objetivado e rotinizado.

  20. Simultaneous nutrient removal, optimised CO2 mitigation and biofuel feedstock production by Chlorogonium sp. grown in secondary treated non-sterile saline sewage effluent.

    Science.gov (United States)

    Lee, Kwan Yin; Ng, Tsz Wai; Li, Guiying; An, Taicheng; Kwan, Ka Ki; Chan, King Ming; Huang, Guocheng; Yip, Ho Yin; Wong, Po Keung

    2015-10-30

    The phycoremediation process has great potential for effectively addressing environmental pollution. To explore the capabilities of simultaneous algal nutrient removal, CO2 mitigation and biofuel feedstock production from spent water resources, a Chlorogonium sp. isolated from a tilapia pond in Hong Kong was grown in non-sterile saline sewage effluent for a bioremediation study. With high removal efficiencies of NH3-N (88.35±14.39%), NO3(-)-N (85.39±14.96%), TN (93.34±6.47%) and PO4(3-)-P (91.80±17.44%), Chlorogonium sp. achieved a CO2 consumption rate of 58.96 mg L(-1) d(-1), which was optimised by the response surface methodology. Under optimised conditions, the lipid content of the algal biomass reached 24.26±2.67%. Overall, the isolated Chlorogonium sp. showed promising potential in the simultaneous purification of saline sewage effluent in terms of tertiary treatment and CO2 sequestration while delivering feedstock for potential biofuel production in a waste-recycling manner. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Taping across the upper trapezius muscle reduces activity during a standardized typing task - an assessor-blinded randomized cross-over study.

    Science.gov (United States)

    Takasaki, Hiroshi; Delbridge, Blane Michael; Johnston, Venerina

    2015-02-01

    Clinically, taping is believed to alter muscle activity. The purpose of this study was to investigate: (1) whether taping across the upper trapezius (UT) muscle influenced the level of UT and lower trapezius (LT) muscle activity and the ratio of these activities (UT/LT ratio) during a static typing task; and (2) if the activity of these muscles varied with the application of tensioned taping. Forty-two healthy participants performed a 15-min typing task on three separate occasions under one of three conditions: taping applied perpendicular to the UT fibers with tension; taping without tension; and no taping. Activity of the UT and LT muscles was assessed using surface electromyography. Between conditions, significant differences were found in the change of the normalized amplitude in the UT activity (p=.027) and UT/LT ratio (p=.024) but not in the LT activity (p=.93). Compared with the no taping condition, the UT activity was less in both the tensioned taping (p=.009) and the non-tensioned taping (p=.004). There was no difference between the two taping conditions in the change of the UT (p=.91) activity and the UT/LT ratio (p=.92). In conclusion, both tensioned and non-tensioned taping across the UT muscle reduces its activity during a typing task. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Tensile properties of shielded metal arc welded dissimilar joints of nuclear grade ferritic steel and austenitic stainless steel

    Science.gov (United States)

    Karthick, K.; Malarvizhi, S.; Balasubramanian, V.; Krishnan, S. A.; Sasikala, G.; Albert, Shaju K.

    2016-12-01

    In nuclear power plants, modified 9Cr-1Mo ferritic steel (Grade 91 or P91) is used for constructing steam generators (SG's) whereas austenitic stainless steel (AISI 316LN) is a major structural member for intermediate heat exchanger (IHX). Therefore, a dissimilar joint between these materials is unavoidable. In this investigation, dissimilar joints were fabricated by Shielded Metal Arc Welding (SMAW) process with Inconel 82/182 filler metals. Transverse tensile properties and Charpy V-notch impact toughness for different regions of dissimilar joints of modified 9Cr-1Mo ferritic steel and AISI 316LN austenitic stainless steel were evaluated as per the standards. Microhardness distribution across the dissimilar joint was recorded. Microstructural features of different regions were characterized by optical and scanning electron microscopy. The transverse tensile properties of the joint is found to be inferior to base metals. Impact toughness values of different regions of dissimilar metal weld joint (DMWJ) is slightly higher than the prescribed value. Formation of a soft zone at the outer edge of the HAZ will reduce the tensile properties of DMWJ. The complex microstructure developed at the interfaces of DMWJ will reduce the impact toughness values.

  3. Attachment Competences in Children With ADHD During the Social-Skills Training and Attachment (SOSTRA) Randomized Clinical Trial.

    Science.gov (United States)

    Storebø, Ole Jakob; Skoog, Maria; Rasmussen, Pernille Darling; Winkel, Per; Gluud, Christian; Pedersen, Jesper; Thomsen, Per Hove; Simonsen, Erik

    2015-10-01

    To investigate the effects of social-skills training and a parental training program on children with ADHD as measured by the children's attachment competences. The SOSTRA trial is a randomized, parallel-group, outcome-assessor-blinded, superiority trial evaluating 8 weeks social-skills training and parental training plus standard treatment versus standard treatment alone for 8- to 12-year old children with ADHD. There were no significant differences in attachment competences at 6 months between the experimental (n = 25) and the control (n = 22) groups (odds ratio = 1.06, 95% confidence interval = [0.31, 3.58], p = .91). In total, 17 children (36%) changed their entry status, 1 (2%) from secure to insecure attachment, while 16 (34%) changed from insecure to secure attachment. The experimental treatment does not seem to affect attachment competences compared with standard treatment alone. Children in the SOSTRA trial improved their attachment competences significantly at 6-month follow-up. © 2014 SAGE Publications.

  4. Race and risk of metastases and survival after radical prostatectomy: Results from the SEARCH database.

    Science.gov (United States)

    Freedland, Stephen J; Vidal, Adriana C; Howard, Lauren E; Terris, Martha K; Cooperberg, Matthew R; Amling, Christopher L; Kane, Christopher J; Aronson, William J

    2017-11-01

    Black race is associated with prostate cancer (PC) diagnosis and poor outcome. Previously, the authors reported that black men undergoing radical prostatectomy (RP) in equal-access hospitals had an increased risk of biochemical disease recurrence (BCR), but recurrences were equally aggressive as those occurring in white men. The authors examined the association between race and long-term outcomes after RP. Data regarding 1665 black men (37%) and 2791 white men (63%) undergoing RP were analyzed. Using Cox models, the authors tested the association between race and BCR, BCR with a prostate-specific antigen (PSA) doubling time race was associated with increased BCR (P = .003) and reduced overall death (P = .017). On multivariable analysis, black race was not found to be associated with BCR (hazard ratio [HR], 1.07; P = .26), aggressive recurrence (HR, 1.14; P = .42), metastasis (HR, 1.24; P = .21), PC-specific death (HR, 1.03; P = .91), or overall death (HR, 1.03; P = .67). Among men undergoing RP at equal-access centers, although black men were found to have an increased risk of BCR, they had similar risks of aggressive disease recurrence, metastasis, and PC-specific death compared with white men, and the risk of BCR was found to be similar after controlling for risk parameters. Longer follow-up is needed to confirm these findings. Cancer 2017;123:4199-4206. © 2017 American Cancer Society. © 2017 American Cancer Society.

  5. POTENCIAL FARMACOINDUSTRIAL DE Trichoderma harzianum PARA FINS FARMACOTERAPÊUTICOS

    Directory of Open Access Journals (Sweden)

    Luís Fernando Albarello Gellen

    2014-12-01

    Full Text Available Linhagens de Trichoderma estão bem difundidas nos processos de controle de fitopatógenos, além disto, para promoção do desenvolvimento e crescimento das culturas onde são inoculados, estes benefícios dão-se pela gama de processos desempenhados por este organismo, os processos são classificados em parasitismo, antibiose e competição, além de secretarem produtos enzimáticos com ações degradantes, compostos voláteis e antimicrobianos. Por meio de testes de produção enzimática, confronto em placa, metabólitos voláteis e sensibilização do agente, os isolados de Trichoderma harzianum mostraram-se como um potente produtor de substâncias antimicrobianas e antifúngicas perante Sthaphylococcus aureus, Streptococcus pyogenes, E. coli, Pseudomonas aeruginosa, E. faecalis e Rhodotorula sp., Candida albicans, Candida parapsilosis e Candida lusitaniae. Palavras-chave: antimicrobianos, antifúngicas, metabólitos, sensibilização. DOI: http://dx.doi.org/10.18561/2179-5746/biotaamazonia.v4n4p91-96

  6. Influence of heat and moisture exchanger respiratory load on transcutaneous oxygenation in laryngectomized individuals: a randomized crossover study.

    Science.gov (United States)

    Zuur, J Karel; Muller, Sara H; Sinaasappel, Michiel; Hart, Guus A M; van Zandwijk, Nico; Hilgers, Frans J M

    2007-12-01

    High-resistance heat and moisture exchangers (HMEs) have been reported to increase transcutaneous oxygenation (tcpO(2)) values in laryngectomized individuals and to negatively influence patient compliance. The goal of the present study was to validate earlier published results on short-term transcutaneous oxygenation changes by high-resistance HMEs. We conducted a randomized crossover study, monitoring the influence of an HME on tcpO(2) over a 2-hour time interval in 20 subjects. No evidence of an immediate HME effect (95% CI: -14.9-13.3 mm Hg, p = .91), or a time-dependent HME effect (95% CI: -.121 - .172 mm Hg/minute, p = .74), on tcpO(2) was found. After fitting the statistical model without time dependency, again no evidence of HME presence was seen (95% CI: -.5 mm Hg - 3.6 mm Hg, p = .15). In contrast to earlier suggestions, there is no evidence of increased tcpO(2) levels by high-resistance HMEs in laryngectomized individuals. Thus, using such HMEs has no added clinical value in this respect.

  7. Creep rupture behavior of advanced 9-12%Cr steel weldment

    Energy Technology Data Exchange (ETDEWEB)

    Masuyama, F.; Matsui, M.; Komai, N. [Mitsubishi Heavy Ind. Ltd., Nagasaki (Japan). Res. and Dev. Center

    2000-07-01

    In order to apply advanced 9-12%Cr steel such as Mod.9Cr-1Mo (P91), 9Cr-0.5Mo-1.8 W (P92), and 12Cr-0.4Mo-2 W (P122) for use in high temperature and high pressure components, creep rupture strength of weldments and failure behavior are very important. The work reported here employed P92 steel and P122 steel to carry out uniaxial creep rupture tests on cross weld samples from SMAW and SAW welded joints of plate and pipe. The creep rupture strength of the weldments of these advanced steels was accordingly determined, with the respective results compared to each other and to base metal strength. The failure mode of the weldment in terms of stress and temperature was also clarified on the basis of the long-term creep rupture data. Furthermore, it is suggested that creep strain measurement for weldments is useful in predicting long-term creep rupture life. (orig.)

  8. 'FOURCRACK' - An investigation of the creep performance of advanced high alloy steel welds

    Energy Technology Data Exchange (ETDEWEB)

    Allen, D.J. [E.On-Uk, Materials and Welding Section, Power Technology, Ratcliffe on Soar, Nottingham NG11 0EE (United Kingdom)]. E-mail: David.Allen@eon-uk.com; Harvey, B. [Mitsui Babcock (United Kingdom); Brett, S.J. [RWE npower (United Kingdom)

    2007-01-15

    Creep failure by 'Type IV' cracking in the weld heat-affected zone (HAZ) is likely to be the life-limiting failure mechanism in high-alloy steel components for advanced power plant. A UK collaborative project, 'FOURCRACK', has therefore been carried out to investigate and compare the cross-weld creep rupture performance of several casts of the advanced steels E911, P92, and P122, and the established steel P91. The experimental matrix included both stress and temperature variations while minimising the testing required to characterise the comparative performance of different welded materials. The results clarify the interplay between weld metal and HAZ failure mechanisms, the relationships between parent material and cross-weld creep strength, and the relative merits of the alternative steels. Finally, problems which arise in the assessment of cross-weld creep test data are discussed, and recommendations put forward to address the risks of biased assessment when failure can take place in different locations within the weldment.

  9. Ultrasound in Prenatal Diagnostics and Its Impact on the Epidemiology of Spina Bifida in a National Cohort from Denmark with a Comparison to Sweden

    Directory of Open Access Journals (Sweden)

    Charlotte Rosenkrantz Bodin

    2018-01-01

    Full Text Available Objectives. The aim of this study was to assess the incidence, the prenatal detection rate by ultrasound, and the pregnancy outcome of spina bifida (SB in Denmark (DK in 2008–2015 and to compare results to national data from Sweden. Methods. Data were retrieved from the Danish Fetal Medicine Database, which includes International Classification of Diseases- (ICD- 10 codes for pre- or postnatally diagnoses and pregnancy outcome. Missing data were obtained from the National Patient Register. Livebirth data with myelomeningocele (MMC in Sweden were obtained from different databases. Results. There were 234 cases with SB in DK in 2008–2015. The incidence of SB was 4.9 : 10,000; 89% were detected with ultrasound prior to week 22; 90% of these pregnancies were terminated (ToP; 91% were isolated malformations of which 11% showed abnormal karyotype. The incidence of newborns with MMC was 1.3 : 10,000 in Sweden. Conclusions. Ultrasound screening has a major impact on the epidemiology of SB. The prenatal detection rate of SB was high, and most SB cases were isolated and had a normal karyotype. Among women with a prenatal fetal diagnosis of SB, 90% chose to have ToP. The incidence of newborns with SB was higher in Sweden than in DK.

  10. Prematurity and Severity Are Associated With Toxoplasma gondii Alleles (NCCCTS, 1981–2009)

    Science.gov (United States)

    McLeod, Rima; Boyer, Kenneth M.; Lee, Daniel; Mui, Ernest; Wroblewski, Kristen; Karrison, Theodore; Noble, A. Gwendolyn; Withers, Shawn; Swisher, Charles N.; Heydemann, Peter T.; Sautter, Mari; Babiarz, Jane; Rabiah, Peter; Meier, Paul; Grigg, Michael E.

    2012-01-01

    Background. Congenital toxoplasmosis is a severe, life-altering disease in the United States. A recently developed enzyme-linked immunosorbent assay (ELISA) distinguishes Toxoplasma gondii parasite types (II and not exclusively II [NE-II]) by detecting antibodies in human sera that recognize allelic peptide motifs of distinct parasite types. Methods. ELISA determined parasite serotype for 193 congenitally infected infants and their mothers in the National Collaborative Chicago-based Congenital Toxoplasmosis Study (NCCCTS), 1981–2009. Associations of parasite serotype with demographics, manifestations at birth, and effects of treatment were determined. Results. Serotypes II and NE-II occurred in the United States with similar proportions during 3 decades. For persons diagnosed before or at birth and treated in infancy, and persons diagnosed after 1 year of age who missed treatment in infancy, proportions were similar (P = .91). NE-II serotype was more common in hot, humid regions (P = .02) but was also present in other regions. NE-II serotype was associated with rural residence (P toxoplasmosis in North America. NE-II serotype was more prevalent in certain demographics and associated with prematurity and severe disease at birth. Both type II and NE-II infections improved with treatment. Clinical Trials Registration. NCT00004317. PMID:22499837

  11. Serpentes encontradas mortas em rodovias do estado de Santa Catarina, Brasil

    Directory of Open Access Journals (Sweden)

    Tobias Saraiva Kunz

    2009-08-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2009v22n2p91 Estradas causam diversos impactos aos ecossistemas, incluindo perda e fragmentação de hábitat, alteração da paisagem natural e morte de animais, sendo que pouco se sabe sobre o impacto destas mortes sobre as populações. A fauna de serpentes do Estado de Santa Catarina é a menos estudada do Sul do Brasil, não havendo estudos abordando serpentes atropeladas. Neste trabalho apresentamos dados sobre serpentes encontradas mortas em diversas estradas do Estado entre os anos de 2003 e 2008. Foram registrados 165 exemplares pertencentes a 38 espécies que correspondem a 50% das serpentes com ocorrência esperada para o Estado de Santa Catarina. As quatro espécies mais freqüentes foram Philodryas patagoniensis (N= 22; 13,33%, Liophis miliaris (n = 21; 12,72%, P. aestiva (n = 13; 7,87% e Bothrops jararaca (n = 12; 7,27%, que somadas representam cerca de 41% das serpentes encontradas mortas. Amplia-se ao sul a distribuição de Imantodes cenchoa em cerca de 60km.

  12. Preparing for the Complexities of Teaching: Modeling Conceptual Thinking in Post-Observation Conferences

    Directory of Open Access Journals (Sweden)

    Jane K. Harvey

    2015-06-01

    Full Text Available http://dx.doi.org/10.5007/2175-8026.2015v68n1p91 In order for teacher educators to prepare teachers for complexities of language teaching, their nature needs to be understood. Vygotskian sociocultural theory ofers a useful framework for construing such complexities. Vygotsky distinguished between everyday and scientiic concepts, and saw the interaction of the two as conceptual thinking, the basis for higher order cognitive skills. Johnson (2009 frames learning to teach as the development of conceptual thinking and considers the nature of the dialogue in teacher education activities as crucial to this development. Drawing on longitudinal data from a semester-long case study of the dialogic interactions between a teacher and teacher educator, this study illustrates how the teacher educator modeled conceptual thinking in her language. We propose a taxonomy of conceptualizations about language teaching that may help teacher educators be more purposeful in designing activities for and interacting with novice teachers.

  13. Isokinetic strength training of the hemiparetic knee: effects on function and spasticity.

    Science.gov (United States)

    Sharp, S A; Brouwer, B J

    1997-11-01

    To determine whether isokinetic training can improve the strength of the hemiparetic knee musculature, functional mobility, and physical activity and to evaluate its effect on spasticity in long-term stroke survivors. Nonrandomized self-controlled trial. A volunteer sample of 15 community-dwelling stroke survivors of at least 6 months. A 6-week (3 days/week, 40 minutes/day) program consisting of warm-up, stretches, reciprocal knee extension and flexion isokinetic strengthening, and cool-down for the paretic limb. Peak isokinetic hamstring and quadriceps torque, quadriceps spasticity, gait velocity, timed Up and Go, timed stair climb, and the Human Activity Profile (HAP) scores were recorded at baseline, after training, and 4 weeks after training cessation (follow-up). Paretic muscle strength improved after training (p .87). Gait velocity increased after training (p .37; p > .91), although subjects perceived gains in their physical abilities at follow-up (p strengthening program for stroke survivors. The psychological benefit associated with physical activity is significant.

  14. Rhizobium ipomoeae sp. nov., isolated from a water convolvulus field.

    Science.gov (United States)

    Sheu, Shih-Yi; Chen, Zih-Han; Young, Chiu-Chung; Chen, Wen-Ming

    2016-04-01

    A bacterial strain, designated shin9-1T, was isolated from a water sample taken from a water convolvulus field in Taiwan and characterized using a polyphasic taxonomical approach. Cells of strain shin9-1T were aerobic, Gram-stain-negative, rod-shaped and surrounded by a thick capsule and formed cream-coloured colonies. Growth occurred at 10-45 °C (optimum, 30 °C), with 0-3.0% NaCl (optimum, 0.5%) and at pH 7.0-9.0 (optimum, pH 7.0). Strain shin9-1T did not form nodules on a legume plant, Macroptilium atropurpureum, and the nodulation genes nodA, nodC and the nitrogenase reductase gene nifH were not detected by PCR. Phylogenetic analyses based on 16S rRNA and three housekeeping gene sequences (recA, atpD and rpoB) showed that strain shin9-1T belonged to the genus Rhizobium. Strain shin9-1T had the highest level of 16S rRNA gene sequence similarity with respect to Rhizobium daejeonense L61T (97.6 %). The major fatty acid of strain shin9-1T was C18:1ω7c. The polar lipid profile consisted of phosphatidylethanolamine, phosphatidylglycerol, phosphatidylcholine, diphosphatidylglycerol, phosphatidylmonomethylethanolamine and several uncharacterized lipids. The DNA G+C content was 58.3 mol%. The DNA-DNA relatedness of strain shin9-1T with respect to recognized species of the genus Rhizobium was less than 70%. Phenotypic characteristics of the novel strain also differed from those of the most closely related species of the genus Rhizobium. On the basis of the phylogenetic inference and phenotypic data, strain shin9-1T should be classified as a representative of a novel species, for which the name Rhizobium ipomoeae sp. nov. is proposed. The type strain is shin9-1T (=LMG 27163T=KCTC 32148T).

  15. CERN Technical Training: Autumn 2007 Course Catalogue

    CERN Multimedia

    2007-01-01

    The following course sessions are scheduled in the framework of the CERN Technical Training Program 2007. You may find the full updated Technical Training course programme in our web-catalogue. OFFICE SOFTWARE CERN EDMS MTF en pratique F 4.9 1/2 d WORD 2007 (Short Course III) - How to work with long documents E/F 14.9 1/2 d FrontPage 2003 - niveau 1 E/F 17-18.9 2 d WORD 2007 - Niveau1: ECDL F 20.-21-9 2 d ACCESS 2007 - Level 1: ECDL E 20-21.9 2 d EXCEL 2007 (Short Course I) - How to work with Formulae E/F 21.9 1/2 d CERN EDMS Introduction E 24.9 1 d Java 2 Enterprise Edition - Part 1: Web Applications E 24-25.9 2 d Outlook 2007 (Short Course II) - Calendar, Tasks and Notes E/F 28.9 1/2 d Outlook 2007 (Short Course III) - Meeting and Delegation ...

  16. Clinical haematology of the great bustard (Otis tarda).

    Science.gov (United States)

    Jimenez, A; Barrera, R; Sanchez, J; Cuenca, R; Rodriguez, J; Andres, S; Mane, M C

    1991-12-01

    The haematological parameters of healthy great bustards (Otis tarda L.) have been determined. The values obtained were red cell count (3.0 x 10(12) +/- 0.2 x 10(12/)1), white cell count (33.0 x 10(9) +/- 2.6 x 10(9)/1), haematocrit value (0.51 +/- 0.01 1/1), haemoglobin (13.0 +/- 0.3 g/dl), mean corpuscular volume (178.7 +/- 12.5 fl), mean cell haemoglobin concentration (25.0 +/- 0.6 g/dl), mean corpuscular haemoglobin (42.5 +/- 3.2 pg), differential white cell count: heterophils (22.5 x 10(9) +/- 0.7 x 10(9)/1), lymphocytes (6.0 x 10(9)+/-0.7 x 10(9)/1), eosinophils (2.7 x 10(9) +/- 0.3 x 10(9)/1) and monocytes (1.8 x 10(9)+/-0.2 x 10(9)/1).

  17. Single Common Powertrain Lubricant (SCPL) Development. Part 2

    Science.gov (United States)

    2014-04-01

    9.0 Intake 8.6 7.3 8.6 7.3 Valve Tulip Deposits, Merits Miscellanous Scuffing % Area Piston Carbon, Demerits Piston Lacquer, Demerits Ratings Piston...9.5 9.0 9.0 9.19 Intake 7.8 8.7 7.1 8.0 7.1 6.2 6.0 7.3 7.28 Cylinder NumberRatings Valve Tulip Deposits, Merits Piston Carbon, Demerits Piston...0.00 Exahust 9.0 9.1 9.1 9.0 9.0 9.0 9.0 9.1 9.04 Intake 7.0 7.6 7.7 6.8 6.8 8.7 7.1 7.0 7.34 Cylinder NumberRatings Valve Tulip Deposits, Merits Piston

  18. Parasitic Disease in the U.S. Navy

    Science.gov (United States)

    1989-07-21

    Protozoal (007)* 80 1.9 (1.5, 2.4) Amebiasis (006) 78 1.9 (1.5,2.3) Malaria (084) 52 1.2 (0.9, 1.6) Other infestation (134)t 47 1.1 (0.8, 1.5) Toxoplasmosis ...N-30) (-1127) (N-78) (N-112) (N-106) (N-52) Toxoplasmosis 65.0 0.0 0.0 0.0 0.0 0.0 Other intestinal helmlnthiasis 0.0 33.0 0.0 0.0 0.0 0.0 Amebiasis...Press, 1980. 8. Haenszel W. Loveland D, Sirken, MG. Lung- cancer mortality as related to residence and smoking histo- ries. J Natl Cancer Instit 1962

  19. [Ultrasonographic findings in ocular toxocariasis].

    Science.gov (United States)

    Morais, Fábio Barreto; Maciel, Ana Lúcia; Arantes, Tiago Eugênio Farias e; Muccioli, Cristina; Allemann, Norma

    2012-01-01

    To evaluate ophthalmic ultrasound findings in the three presentation forms of ocular toxocariasis (peripheral or posterior pole granulomas and chronic endophthalmitis), in patients with confirmed diagnosis of ocular toxocariasis. 11 patients (11 eyes) with clinical and confirmed diagnosis of active ocular toxocariasis, presented positive ELISA test, were analyzed, prospectively, in the study. The patients were submitted to an ocular ultrasound examination (10-MHz transducer, contact technique). In the series of 11 patients, mean age was 7.9 years-old (range from 2 to 17 y), 73% male, referring previous contact with dogs (91%), and with the soil (50%), no referral of appetite perversion. In the analyses of compromised eyes (11 eyes), the ophthalmoscopic examination revealed the following distribution of the 3 forms of ocular toxocariasis: 7 cases (63.6%), posterior pole granuloma; 1 (9.1%), chronic endophthalmitis; 2 (18.2%), peripheral granuloma; and 1 (9.1%), posterior pole granuloma associated with chronic endophthalmitis. Visual acuity impairment: no light perception (3 eyes, 27.3%); hand motion (4 eyes, 36.4%); counting fingers at 10 cm (1 eye, 9.1%); 20/200 (1 eye, 9.1%); 20/70 (1 eye, 9.1%); undefined (1 eye, 9.1%). Serology was positive to Toxocara canis (ELISA test) in 100% of the cases. Ophthalmoscopy was difficult or impossible in 64% of the cases due to the media opacity. Ultrasound findings noted were vitreous membranes with retinal attachment (100%); parietal lesions (granulomas) with high (80%) or medium (20%) reflectivity. The most consistent ultrasound finding in the eye with toxocariasis was a high-reflectivity retinal mass, located in posterior pole or periphery, which may be calcified, and which has as main characteristic the adherence of vitreous membranes. In addition to clinical history, systemic evaluation and serology, the ultrasound can help in the diagnosis of ocular toxocariasis, especially in media opacities.

  20. Isolation, identification, and pathogenicity of O142 avian pathogenic Escherichia coli causing black proventriculus and septicemia in broiler breeders.

    Science.gov (United States)

    Wang, Xiaobo; Cao, Chunguang; Huan, Haixia; Zhang, Liuli; Mu, Xiaohui; Gao, Qingqing; Dong, Xianglei; Gao, Song; Liu, Xiufan

    2015-06-01

    Avian colibacillosis, characterized by black proventriculus and caused by avian pathogenic Escherichia coli (APEC) with an uncommon O142 serogroup, was diagnosed in young broiler breeders. Colonization and persistence assays performed in 7-day-old broilers showed that the bacterial load of the APEC 4d/9-1 O142 proventricular isolate in the lung was about 10-fold higher than that of the APEC 4d/9-1 O142 heart blood isolate (P<0.01), and about 100-fold higher in the heart blood, livers, spleens, kidneys, and proventriculi of inoculated broilers (P<0.001). When 32 common virulence genes of APEC were tested, the two isolates had nearly identical profiles, except that only the APEC 4d/9-1 O142 proventricular isolate carried the feoB gene. Furthermore, 100% mortality was observed in both 1-day-old Arbor Acres (AA) broilers and 1-day-old specific-pathogen-free (SPF) chickens inoculated with 10(6) colony-forming units of the APEC 4d/9-1 O142 proventricular isolate. However, black proventriculus was only observed in the dead AA broilers, consistent with the clinical occurrence of the disease. This implies that the black proventriculi seen in the dead birds, caused by the APEC 4d/9-1 O142 proventricular isolate, was breed-specific. Both the APEC 4d/9-1 O142 proventricular and heart blood isolates belong to phylogroup B2. However, the former was assigned to ST131 and the latter to ST2704 with multilocus sequence typing, demonstrating the genetic heterogeneity of these two bacterial isolates, although they were derived from the same dead broiler. These results suggest that the O142 APEC isolate was the main pathogenic agent for black proventriculi in 7-day-old broiler breeders. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. CDC Vital Signs-Heart Age

    Centers for Disease Control (CDC) Podcasts

    2015-09-01

    This podcast is based on the September 2015 CDC Vital Signs report. Your heart age is the age of your heart and blood vessels as a result of your risk factors for heart attack and stroke. If you smoke or have high blood pressure, your heart age will be much higher than your actual age. Learn what you can do to lower your heart age and keep it low.  Created: 9/1/2015 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 9/1/2015.

  2. Heart Age PSA (:60)

    Centers for Disease Control (CDC) Podcasts

    2015-09-01

    This 60 second public service announcement is based on the September 2015 CDC Vital Signs report. Your heart age is the age of your heart and blood vessels as a result of your risk factors for heart attack and stroke. If you smoke or have high blood pressure, your heart age will be much higher than your actual age. Learn what you can do to lower your heart age and keep it low.  Created: 9/1/2015 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 9/1/2015.

  3. Where and Why Users Check In

    Science.gov (United States)

    2014-07-28

    frequently and repeatedly to the same venue. Figure 2 shows the activity of three users on Do- lores Park Cafe in San Francisco. User A,B,C (bottom 3...over-time. Figure 2: Three users’ activity profiles at Dolores Park Cafe 2009.9.1 2009.12.1 2010.3.1 2010.6.1 V N E -O p a 2009.9.1 2009.12.1 2010.3.1...San Francisco New York 303 second st. Plaza Tasti D lite (ice cream) Chinatown (restaurant) Cafe 28 Golf smith (shop) or others Moschino Botique

  4. Estudo da adaptação marginal de amalgamas de prata sob a influencia de ligas, triturações e brunidura

    OpenAIRE

    Jose Roberto Lovadino

    1985-01-01

    Resumo: O objetivo desse trabalho foi verificar o nivel de adaptação da superfície da parede lateralde corpos de prova onfeccionados em amâlgamas de prata. Foram realizados corpos de prova através de três ligas de prata _diferentes, cujosnomes comerciais foram Novo True Dentalloy, Novaloy e Sybraloy. - Essas ligas foram trituradas mecanicamente e manualmente, conforme Especificação n9 1 da Associação Dentaria Americana e condéns adas com condensadór tipo Hollemback n 9 1, sob pressão de 1 kgf...

  5. Dicty_cDB: SSF813 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 473 |AW568473.1 si59c03.y1 Gm-r1030 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-r1030-3197 5' similar...sequence. 44 1.9 1 BF595000 |BF595000.1 su74b05.y1 Gm-c1055 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: ...e Gm-r1070-9043 3', mRNA sequence. 44 1.9 1 BI786258 |BI786258.1 sai34g12.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  6. Characterization of 13 microsatellite loci for the deep-sea coral, Lophelia pertusa (Linnaeus 1758), from the western North Atlantic Ocean and Gulf of Mexico

    Science.gov (United States)

    Morrison, C.L.; Eackles, M.S.; Johnson, R.L.; King, T.L.

    2008-01-01

    A suite of 13 polymorphic tri- and tetranucleotide microsatellite loci were isolated from the ahermatypic deep-sea coral, Lophelia pertusa. Among 51 individuals collected from three disjunct oceanic regions, allelic diversity ranged from six to 38 alleles and averaged 9.1 alleles per locus. Observed heterozygosity ranged from 9.1 to 96.8% and averaged 62.3% in the Gulf of Mexico population. For some loci, amplification success varied among collections, suggesting regional variation in priming site sequences. Four loci showed departures from Hardy-Weinberg equilibrium in certain collections which may reflect nonrandom mating. ?? 2008 Blackwell Publishing Ltd.

  7. Acute gouty bursitis: report of 15 cases.

    Science.gov (United States)

    Canoso, J J; Yood, R A

    1979-01-01

    Fifteen cases of acute gouty bursitis were seen among 136 crystal-proved cases of gout. Bursal aspirate yielded yellow or pink fluid in 10, chalky white fluid in 1, and a small amount of bloody fluid in 4. Monosodium urate crystals were present in all. Bursal fluid leucocyte counts averaged 2.9 X 10(9)/1 compared with synovial fluid leucocyte counts that averaged 25.5 X 10(9)/1 in cases of articular gout (P less than 0.05). Gouty, septic, and idiopathic (traumatic) bursitis share clinical features, and detailed bursal fluid analysis is crucial for diagnosis. PMID:496446

  8. Dicty_cDB: Contig-U05002-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CccABb Cajanus cajan genomic clon... 46 1.2 1 ( FI202347 ) CccaBa003-G11TV CccABa Cajanus cajan genomic...46 1.2 1 ( FI200787 ) CccaBa030-K10TR CccABa Cajanus cajan genomic clon... 46 1.2 1 ( ER936979 ) AF__Bb0006H15f...44 4.9 1 ( FI244612 ) CccaBb025-P9JF CccABb Cajanus cajan genomic clone... 44 4.9 1 ( FH240475 ) CHO_OF3106xc15f1

  9. Dicty_cDB: Contig-U16540-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1.4 T32497( T32497 )hypothetical protein C08G9.2 - Caenorhabditis eleg... 38 1.4 JS0209( JS0209 ) antistasin precursor - Mexican...none) Human DNA sequence from clone XXb... 36 5.4 A28806( A28806 )antistasin A - Mexican leech 35 7.0 AK1223...555 |pid:none) Caenorhabditis briggsae notch-like... 35 7.0 B28806( B28806 )antistasin B - Mexican... from MA... 35 9.1 S13904( S13904 )antistasin - Mexican leech 35 9.1 >(Q54QX2) RecName: Full=Probable spore

  10. Paramedic-Initiated Home Care Referrals and Use of Home Care and Emergency Medical Services.

    Science.gov (United States)

    Verma, Amol A; Klich, John; Thurston, Adam; Scantlebury, Jordan; Kiss, Alex; Seddon, Gayle; Sinha, Samir K

    2017-11-15

    We examined the association between paramedic-initiated home care referrals and utilization of home care, 9-1-1, and Emergency Department (ED) services. This was a retrospective cohort study of individuals who received a paramedic-initiated home care referral after a 9-1-1 call between January 1, 2011 and December 31, 2012 in Toronto, Ontario, Canada. Home care, 9-1-1, and ED utilization were compared in the 6 months before and after home care referral. Nonparametric longitudinal regression was performed to assess changes in hours of home care service use and zero-inflated Poisson regression was performed to assess changes in the number of 9-1-1 calls and ambulance transports to ED. During the 24-month study period, 2,382 individuals received a paramedic-initiated home care referral. After excluding individuals who died, were hospitalized, or were admitted to a nursing home, the final study cohort was 1,851. The proportion of the study population receiving home care services increased from 18.2% to 42.5% after referral, representing 450 additional people receiving services. In longitudinal regression analysis, there was an increase of 17.4 hours in total services per person in the six months after referral (95% CI: 1.7-33.1, p = 0.03). The mean number of 9-1-1 calls per person was 1.44 (SD 9.58) before home care referral and 1.20 (SD 7.04) after home care referral in the overall study cohort. This represented a 10% reduction in 9-1-1 calls (95% CI: 7-13%, p home care referral and 0.79 (SD 6.27) after home care referral, representing a 7% reduction (95% CI: 3-11%, p home care records were included in the analysis, the reductions in 9-1-1 calls and ambulance transports to ED were attenuated but remained statistically significant. Paramedic-initiated home care referrals in Toronto were associated with improved access to and use of home care services and may have been associated with reduced 9-1-1 calls and ambulance transports to ED.

  11. Kwajalein, Marshall Island, Bucholz. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F

    Science.gov (United States)

    1973-06-08

    J 107!> FOM1210 WS jUI. 64 O,|S,5 lOLI ) PA ls[IVIO S O010 F$0 THIS lORM A01 00S00)i| A .-.-- - -’* q t if DATA PROCESSING BRANCH EXTREME VALUES...1 994] 94.9 99.4 So 960 99~ loli 99,v 99, Y 99,’ Z919, 9, 9 0:9 9,0 99,0 9 , 00 , ¢,010 9.1,{0 400o 96.5 9,1 99,Z 99&4 . ,9 99, 71 eo . 9 ,9 4 le * A 9

  12. Drug: D08079 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08079 Drug Inositol (DCF); Inosital (TN) C6H12O6 180.0634 180.1559 D08079.gif Vita... 4 2 5 1 5 2 6 1 #Down 6 3 7 1 7 3 8 1 #Up 8 5 9 1 9 5 10 1 #Up 10 7 11 1 #Up 11 9 12 1 #Down 12 7 9 1 InChI=1S/C6H12O6/c7-1-2(8)4(10)6(12)5(11)3(1)9/h1-12H/t1-,2-,3-,4+,5-,6- ...

  13. Drug: D07622 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 8 2 3 2 9 1 4 3 4 1 5 3 10 1 6 4 11 1 7 4 5 1 8 5 12 1 9 1 2 1 10 5 6 1 11 6 7 1 12 13 14 1 13 13 15 1 14 13 16 2 InChI=1S/C6H12...D07622 Drug Carmellose (JP16/INN); Croscarmellose (INN); Carboxymethylcellulose; CMC; Intrasite gel (TN) C6H...12O6. C2H4O2 240.0845 240.2078 D07622.gif Laxative, bulk-forming; Pharmaceutic aid

  14. Evaluation of JPL Version-5.9.12 Temperature Profiles, Ocean Skin Temperature, Surface Emissivity, and Cloud Cleared Radiances

    Science.gov (United States)

    Susskind, Joel; Blaisdell, John; Iredell, Lena

    2011-01-01

    Slide presentation discusses: (1) Modifications to JPL 5.9.12 compared to V5.9.1, (2) Some results showing that V5.9.12 O, with original water vapor sounding channels, is preferable to V5.9.12 N with Antonia Gambacorta s new water vapor channels. (3) Comparison of V5.9.12, V5.9.12 AO, V5.9.1, and V5.0, (4) Accuracy and yield of channel by channel Quality Controlled clear-column radiances R(sub i) and (5) Plans for Version-7.

  15. 75 FR 21169 - Approval and Promulgation of Air Quality Implementation Plans; New Mexico; Revisions to New...

    Science.gov (United States)

    2010-04-23

    ... on ``6PD'' (Multimedia) and select ``Air'' before submitting comments. E-mail: Mr. Guy Donaldson at...'' system, which means EPA will not know your identity or contact information unless you provide it in the....150 Enforceability of Design 9/1/2007 4/23/2010, [Insert FR page number Concept and Scope and where...

  16. Desegregating health statistics and health research in South Africa

    African Journals Online (AJOL)

    'racial' and ethnic groUps.l2.S--I In reality, 'racial' and ethnic differences in disease are more likely to be the consequence of racism and ethnic discrimination.9.1. 0 Indeed, South Africa provides the clearest example of how discrimination resutts in differential exposure to environmental risks and differential access to health ...

  17. Gclust Server: 11503 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(77) 814 rib-2: related to mammalian RIB-affecting EXT gene family member (rib-2) 9 1.00e-50 0...Representative annotation rib-2: related to mammalian RIB-affecting EXT gene family member (rib-2) Number of Sequences

  18. Privately Contracted Military Firms in the Twenty-First Century: Reclassifying, Redefining, and Reforming the Way We Fight

    Science.gov (United States)

    2012-06-01

    Revolutionary War 2 9 1 to 6 War of 1812 n.a. 38 n.a. Mexican -American War 6 33 1 to 6 Civil War 200 1,000 1 to 5 Spanish-American War n.a. 35...contractors into a hostile area unsupported to deliver kitchen supplies. 165 Voluntary Principles on Security and Human Rights, http

  19. Gclust Server: 11555 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available fucosyltransferase/ transferase, transferring glycosyl groups 9 1.00e-99 57.14 22.22 0.0 0.0 0.0 0.0 Show 11555...fucosyltransferase/ transferase, transferring glycosyl groups Number of Sequences 9 Homologs 9 Clustering threshold

  20. aifes'e'ations 0f aggressive atypical kaposi's sarcoma hiv disease ...

    African Journals Online (AJOL)

    and 9 female, giving an M: F ratio approximately 4:1. ... clinical features manifested by the patients were fever (100%), weight loss (86.8%) skin nodules .... females. The upper limb accounted for 4 cases (9.1% of all sites) with no sex bias. Four cases of multiple sites were seen in only males. Three cases of lymph nodes (2-.

  1. Evaluating Low Back Pain Patients for Prolapsed Interverbral Disc in ...

    African Journals Online (AJOL)

    Of the six hundred and three patients (267 males, 336 females) who were evaluated, risk factors were recorded in 39.5% patients, 35.3% patients had sciatica while straight leg raising test was performed in 52.2% patients. Investigations performed in these patients included plain roentograms (38.5%), CT scan (9.1%) and ...

  2. Preparation and characterization of artemether inclusion complexes ...

    African Journals Online (AJOL)

    commercial brands, showing 3.9-, 1.8- and 1.6-fold increases, respectively, over a period of 15 min. Conclusion: Inclusion complexation of artemether ... of natural cyclodextrins – alpha (α), beta (β), and gamma (γ) with six, seven and eight ... 0.427 nm for alpha and gamma cyclodextrins respectively [2,3]. Inclusion complex ...

  3. some perspectives of hosts and guests on coastal tourism ...

    African Journals Online (AJOL)

    Games viewing. • Eco-tourism. • Festivals. • Badagry of the Slave Route. • Usma11 da-Fotlio Tomb. • Bussa Fails. • Mungo Park death place. • Wildlife of' lores! reserves. • Ecological diversity and. __ polari_sati9_1~-~.!' cu ltu~. • Mountain Kenya. • Safari tourism (Wildlife) and Faun'1. • Mornbassa coasts and cultural. Cu llural.

  4. 77 FR 45380 - Announcement Regarding States Triggering “On” and “Off” in the Emergency Unemployment...

    Science.gov (United States)

    2012-07-31

    ... Emergency Unemployment Compensation 2008 (EUC08) Program and the Federal-State Extended Benefits (EB... regarding states triggering ``on'' and ``off'' in the Emergency Unemployment Compensation 2008 (EUC08... average, seasonally adjusted total unemployment rate for Nevada (11.7%), New Jersey (9.1%), and Rhode...

  5. A multifaceted hospital-wide intervention increases hand hygiene ...

    African Journals Online (AJOL)

    Hospital-acquired infections remain a global concern, with prevalence rates in the USA ranging from 3.5% to 9.9%,[1] almost one-third of infections being preventable. In South Africa (SA), about one in seven patients entering health facilities may be at risk of developing a hospital- acquired infection. This results in significant ...

  6. Applying the knowledge creation model to the management of ...

    African Journals Online (AJOL)

    user

    The contribution of evaluation to socialization and externalization of tacit knowledge: The case of the World Bank. Evaluation, 10(3), 263-283. Mclean, E. R. 2004. Measuring e-commerce success: Applying the DeLone & McLean information systems success model. International Journal of Electronic Commerce, 9(1), 31-47.

  7. AcEST: BP915681 [AcEST

    Lifescience Database Archive (English)

    Full Text Available en 175 OS=Plasmodium falciparum (isolate Camp / Malaysia) Align length 209 Score (bit) 36.6 E-value 0.097 Re...0 9.1 >sp|P19214|EBA1_PLAFC Erythrocyte-binding antigen 175 OS=Plasmodium falciparum (isolate Camp / Malaysia

  8. STATUS AND UTILISATION OF Moringa oleifera Lam: A REVIEW ...

    African Journals Online (AJOL)

    ACSS

    (Received 28 May, 2017; accepted 12 February, 2018). ABSTRACT. Moringa oleifera (Moringaceae) is a medium-size .... News have been established to improve the production, uses especially for human nutrition, and to ...... Journal of Disaster Risk Studies 9(1): a383. https://doi.org/10.4102/jamba.v9i1. 383. Tiwari, J.K. ...

  9. Psychotic experiences co-occur with sleep problems, negative affect and mental disorders in preadolescence

    DEFF Research Database (Denmark)

    Jeppesen, Pia; Clemmensen, Lars; Munkholm, Anja

    2014-01-01

    were examined by multivariable binomial regression analyses, adjusting for gender and onset of puberty. RESULTS: The weighted life time prevalence of PE at age 11-12 years was 10.9% (CI 9.1-12.7). The majority of children with PE (n = 172) either had a diagnosable DSM-IV-mental disorder (31.4%) or self...

  10. Awareness and Utilization of Emergency Contraceptives Among ...

    African Journals Online (AJOL)

    This study assessed awareness and utilization of emergency contraceptive among 463 second cycle primary school female evening students (with age ≥ 15 years) in ... Having prior information on family planning (FP) and school grade level were identified to be positively associated [(AOR = 1.9 (1.0 - 3.4), (AOR = 2.1 (1.1 ...

  11. Shoot regeneration and plantlet formation by cascade huckleberry, mountain huckleberry, and in oval-leaf bilberry on a zeatin-containing nutrient medium

    Science.gov (United States)

    A plant regeneration protocol was developed for Cascade huckleberry (Vaccinium deliciosum Piper), mountain huckleberry (V. membranaceum Douglas ex Hooker) and for oval-leaf bilberry (V. ovalifolium Smith) clones. The effects of zeatin concentrations (0, 4.6, 9.1 and 13.7 µM) and explant type (leaf a...

  12. Dicty_cDB: AFF389 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available la spiralis adult pAMP1 v1 Trichinella spiralis cDNA 5' similar to SW:CRTC_CAEEL P2...63O4.TV RPCI-11 Homo sapiens genomic clone RPCI-11-163O4, genomic survey sequence. 40 5.9 1 BQ540867 |BQ540867.1 ps73f05.y1 Trichinel

  13. Adaptation of glass columns for clean-up RP-HPLC determination of ...

    African Journals Online (AJOL)

    SD 0.1), 10.7 (SD 0.3) and 9.1 (SD 0.3) minutes, respectively for AFB1, AFB2, AFG1 and AFG2. Florisil powder that had been dried for 12 hours at 100 oC, then hydrated with water at 5% (w/v) before packing on glass columns gave slightly ...

  14. Urinary salicyate excretion in subjects eating a variety of diets shows that am ounts of bioavailable salicylates in foods are low.

    NARCIS (Netherlands)

    Janssen, P.L.T.M.K.; Hollman, P.C.H.; Reichman, E.; Venema, D.P.; Staveren, van W.A.; Katan, M.B.

    1996-01-01

    Intake of acetylsalicylic acid reduces the risk of cardiovascular disease and is associated with a decreased risk for colorectal cancer. Amounts of salicylates in foods are thus of interest, but data are scarce and controversial. We gave 58 mumol (10.5 mg) pure acetylsalicylic acid or 66 mumol (9.1

  15. World Heart Day

    Centers for Disease Control (CDC) Podcasts

    2009-09-01

    For World Heart Day, learn more about what heart-healthy steps you can take in the workplace.  Created: 9/1/2009 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 9/9/2009.

  16. National Cholesterol Education Month

    Centers for Disease Control (CDC) Podcasts

    2009-09-01

    Do you know your cholesterol numbers? Your doctor can do a simple test to check your cholesterol levels and help you make choices that lower your risk for heart disease and stroke.  Created: 9/1/2009 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 9/9/2009.

  17. Comparison of CO2 Lidar Backscatter with Particle Size Distribution and GOES-7 Data in Hurricane Juliette

    Science.gov (United States)

    Jarzembski, Maurice; Pueschel, R. F.; Srivastava, Vandana; McCaul, E. W., Jr.; Cutten, Dean R.; Jedlovec, Gary J.; Atkinson, R. J.

    1999-01-01

    Backscatter measurements using 9.1 and 10.6 micron continuous wave lidars were obtained along with particle size distributions in 1995 Hurricane Juliette at altitude approximately 11.7 km. Agreement between lidar backscatter and cloud particle size distribution was excellent. Measurements also correlated well with concurrent GOES-7 infrared images of cloud top height.

  18. Grain Boundary Segregation and Stress Corrosion Cracking of Aluminum Alloys

    Science.gov (United States)

    1976-11-01

    34 Atlas of Electrochemical Equilibria in Aqueous Solutions," pu.bl. by Pergarnon Press, 1966, p. 140. I9 * 1 * S +-9 SIi TAPbL E 1. Detailed chernical...SUPPLF24ENTARY DISTRIBUTION LIST Technical and Sumary Reports Dr. T. E. Beck Dr. D. J. Duquette Electrochemical Technology Corporation Department of Metallurgical

  19. Using Blackboard to Increase Student Learning and Assessment Outcomes in a Congressional Simulation

    Science.gov (United States)

    Mathews, A. Lanethea; LaTronica-Herb, Alexandra

    2013-01-01

    This article explores the integration of a multiweek legislative simulation with the Blackboard (9.1) Platform in an effort to understand how technology may increase student engagement, collaborative learning, and assessment. We consider the ways in which classroom technologies--blogs and online peer and self assessment tools, in particular--can…

  20. Assessment of knowledge and practices for disposal of unfinished ...

    African Journals Online (AJOL)

    Of 386 respondents reported to store medications in their households, 66.6% eventually disposed of the drugs in domestic trash in events of expiry or when drugs became unwanted. Burying (9.1%), throwing/flushing down toilets (19.7%) and burning (4.6%) were less encountered. Public awareness that improper disposal ...

  1. Experiment list: SRX389615 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX389615 mm9 Histone H3K4me1 Blood HAFTL NA 20693267,77.2,9.1,16449 GSM1285931: H3K4Me1-48hours...ells || time after induction=48 hours || chip antibody=H3K4Me1 (037-050, Diagenode) http://dbarchive.bioscie

  2. ORIGINAL ARTICLE Undiagnosed Diabetes Mellitus and ...

    African Journals Online (AJOL)

    2018-01-01

    Jan 1, 2018 ... pre-diabetes and risk factors associated with diabetes in Tanzania and Uganda. Global health action. 2016;9(1):31440. 5. Buowari OY. Diabetes mellitus in developing countries and case series. Diabetes Mellitus-. Insights and Perspectives: InTech; 2013. 6. Stein DJ, Phillips KA, Bolton D, Fulford K, Sadler.

  3. Production of alkaline protease and larvicidal biopesticides by an ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-08-27

    Aug 27, 2009 ... Moreover, optimal AP yield was attained by using strong aeration at 9:1 (air : medium) ratio. Similarly, the highest .... were kept on slants and stored at 4ºC for further characterization. The isolated bacilli that showed ..... populations and the transmission of malaria in Maroua, a large city in a savannah region.

  4. Spirituality in narratives of meaning

    African Journals Online (AJOL)

    2013-01-23

    Jan 23, 2013 ... Seifert, L.S., 2002, 'Toward a psychology of religion, spirituality, meaning-search, and aging: Past research and a practical application', Journal of Adult Development. 9(1), 61–70. http://dx.doi.org/10.1023/A:1013829318213. Smith S.E., Willms, D.G. & Johnson, N.A., 1997, Nurtured by Knowledge: Learning ...

  5. Gclust Server: 11756 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 38 Cluster Sequences Related Sequences(26) 190 basic helix-loop-helix (bHLH) family protein 9 1.00e-25...Sequences(26) Sequence length 190 Representative annotation basic helix-loop-helix (bHLH) family protein Number of

  6. Frequently Encountered Animal Diseases at Animal Hospital Birnin ...

    African Journals Online (AJOL)

    Other moderately occurring, disorders included dystocia & post partum complications 14(2.2%) each, mal-directed horn/hooves 12(1.9%), tick infestation 10(1.6%), coccidiosis 9(1.4%), fracture 8(1.3%), hernia, PPR, pregnancy toxemia & castration 7(1.1%) each. Poisoning, infectious coryza, arthritis, rumen impaction ...

  7. InterProScan Result: FK939882 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FK939882 FK939882_3_ORF1 19E5D6D1D6796163 PFAM PF00995 Sec1 9.1e-29 T IPR001619 Sec1-like protein Biological... Process: vesicle docking involved in exocytosis (GO:0006904)|Biological Process: vesicle-mediated transport (GO:0016192) ...

  8. SARTORIAL ELEGANCE - A REVIEWER'S VIEW

    African Journals Online (AJOL)

    Like European and American patients, our patients do not appear to like doctors to be informally dressed in blue denims and training shoes.9-1l. Considering the results of this scientific evaluation of what was an empirically derived University of Pretoria dress code for students performing clinical duties, we will continue to.

  9. Citizen science and remote sensing for crop yield gap analysis

    NARCIS (Netherlands)

    Beza, Eskender Andualem

    2017-01-01

    The world population is anticipated to be around 9.1 billion in 2050 and the challenge is how to feed this huge number of people without affecting natural ecosystems. Different approaches have been proposed and closing the ‘yield gap’ on currently available agricultural lands is one of

  10. Afrimedic Vol. 5, No. 1

    African Journals Online (AJOL)

    HENRY

    support of the observation of Cushing et al that germ cell tumours are infrequent in childhood. Paediatric germ cell tumours were more common overall in females than males in this study, with a female to male ratio of 2.9:1. The female predominance observed in this study is in agreement with the 2.2:1 female to male ratio ...

  11. Ion Source Development for a Compact Proton Beam Writing System III

    Science.gov (United States)

    2013-06-28

    generation lithographies (NGLs) will utilize any one or more of EUV (extreme ultraviolet ), X-ray, electron or ion beam technologies for producing sub...and provide a reliable sealed gas feed system. A piece of glass was pre-cleaned by piranha etching (H2SO4 : H2O2 = 9 : 1) and prebaked at 200 °C for

  12. Evaluating Voltage Regulation Compliance of MIL-PRF-GCS600A (Army) for Vehicle On-Board Generators and Assessing Overall Vehicle Bus Compliance

    Science.gov (United States)

    2012-08-16

    Characterization • Back EMF Measurement and Characterization • Rotor Inertia • Spinning Losses (Iron Loss, Friction, Windage) – Spin Down Test...Speed (rpm) UNCLASSIFIED UNCLASSIFIED Electrical and Mechanical Response Estimation 16 August 2012 1.87 1.88 1.89 1.9 1.91 1.92 1.93 1.94 1.95

  13. 3Hthymidine incorporation of rhizosphere bacteria influenced by plant N-status

    DEFF Research Database (Denmark)

    Christensen, H.; Christensen, S.

    1994-01-01

    The effect of plant-root N-status on bacterial growth in the rhizosphere was studied with 5-week-old wheat plants grown in soil with low N content obtained by mixing 9:1 gravel:sandy loam. As a consequence of N limitation, significant increase in3Hthymidine (Tdr) incorporation rate occured 3 days...

  14. The Predictability of Near-Coastal Currents Using a Baroclinic Unstructured Grid Model

    Science.gov (United States)

    2011-12-28

    K2 2 1.9 1.7 -15 -10.5 ADCIRC computed values are recorded in Tables 8 and (), respectively. Also included in Fables 8 and 9 arc the percent errors...Sugiyama G (2003b) COAMPS version 3 model description—general theory and equations. NRL Publication NRL/PU/7500-03- 448. Naval Research Laboratory

  15. The Genus Culex, Subgenus Eumelanomyia Theobald in Southeast Asia and Adjacent Areas

    Science.gov (United States)

    1972-01-01

    tergal surface; subapical lobe short or elon or sma 1; distimere slender, sickle shaped and long; B ate; proximal division with 3 stout rods...Nok, 1 P. Tak: Huey Lan Saeng, 6d, 69, 12 p. Nakhon Ratchasima: Pak Chong; Musk Lek; Ban Tha Ma Prang; Khlong Pai; Khao Suan Horn; 7~r, 9?, 1 P, 7 p

  16. Metabolic acidosis improves airway conductance in patients with asthma.

    NARCIS (Netherlands)

    Brijker, F.; Elshout, F.J.J. van den; Bosch, F.H.; Heijdra, Y.F.; Folgering, H.T.M.

    2009-01-01

    The objective was to investigate whether acute metabolic acidosis could cause bronchodilation in patients with asthma. Twelve patients with asthma (8 females, mean age 39 (+/- SD 12) years, forced expiratory volume in 1 second [FEV(1)] 93 [+/-9] % predicted, PC(20) 1.9 (+/-1.0) mg/mL) participated

  17. A versatile characterization of poly(N-isopropylacrylamideco-N,N!-methylene-bis-acrylamide) hydrogels for composition, mechanical strength, and rheology

    CSIR Research Space (South Africa)

    Chetty, A

    2013-01-01

    Full Text Available -linker (MBA) content in the copolymer was investigated in the concentration range of 1.1–9.1 mol% (R:90–10; R = mol NIPAAm/mol MBA) on the rheological behaviour and mechanical strength of the hydrogels. Both storage and loss modulus decreased with decreasing...

  18. RETINOPATHY OF PREMATURITY IN INFANTS WITH BIRTH ...

    African Journals Online (AJOL)

    hi-tech

    2000-10-10

    %). 0.67. Maternal hypertension. 1 (7.7%). 14 (25.5%). 0.15. Premature rupture of membranes. 5 (38.5%). 5 (9.1%). 0.33. Tables 1 and 2 respectively show the neonatal and maternal risk factors associated with the disease.

  19. Induction and purification of chitinase in Brassica napus L. ssp. oleifera infected with Phoma lingam

    DEFF Research Database (Denmark)

    Rasmussen, U.; Giese, H.; Dalgaard Mikkelsen, J.

    1992-01-01

    A pathogen-induced chitinase (EC 3.2.1.14) was isolated from cotyledons of oilseed rape (Brassica napus cv. Bienvenu) 8 d after inoculation with Phoma lingam. The purified chitinase has a molecular weight of 30 kDa, and an isoelectric point of approx. 9.1. A partial amino-acid sequence obtained a...

  20. AcEST: DK948841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available finition tr|A8S931|A8S931_9FIRM Putative uncharacterized protein OS=Faecalibacter...nthase, 5-methyltetrahydrofo... 34 9.1 >tr|A8S931|A8S931_9FIRM Putative uncharacterized protein OS=Faecaliba

  1. 76 FR 4150 - Reports, Forms and Recordkeeping Requirements; Agency Information Collection Activity Under OMB...

    Science.gov (United States)

    2011-01-24

    ... myriad of issues posed by implementing new technologies in 9-1-1 services in a systematic, prioritized fashion, with active involvement of its constituency. The results of the proposed annual RFIs would be... and State emergency communications agencies, professional and industry associations, ``traditional...

  2. Flight test guidelines for homebuilt and experimental aircraft

    CSIR Research Space (South Africa)

    White, WJ

    2013-04-01

    Full Text Available and Control Checks ................................................ 90 8.10.1 Stability Definitions .................................................................................... 91 8.10.2 Static Longitudinal Stability Testing... ........................................................... 92 8.10.3 Lateral-Directional Stability Control Tests .................................................. 94 Chapter 9 Envelope Expansion ......................................................................................... 97 9.1 Introduction...

  3. Download this PDF file

    African Journals Online (AJOL)

    Administrator

    symptoms: 13 (39.4%) of the respondents had minimal depression, 12 (36.4%) of them had mild depression, 3 (9.1%) had moderate depression, and 5 (15.2%) ... functions are as important as its physical determinant of feminine attractiveness. .... participating in the study was a voluntary exercise that would not affect their ...

  4. Risk and Protective Factors for Children of Adolescents: Maternal Depression and Parental Sense of Competence

    Science.gov (United States)

    Knoche, Lisa L.; Givens, Jami E.; Sheridan, Susan M.

    2007-01-01

    We investigated the relationship between depression and parental sense of competence to child cognitive outcomes for a sample of 49 adolescent mothers and their young children ("Mean age" = 9 1/2 months) enrolled in a student parenting program. Cognitive development of the infants and toddlers was assessed using the Bayley Scales of Infant…

  5. Experiment list: SRX067488 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available arcinoma Hepatocellular 21828198,93.7,9.1,38972 GSM733737: Bernstein HepG2 H3K4me3 source_name=HepG2 || biom...aterial_provider=ATCC || lab=Broad || lab description=Bernstein - Broad Institute || datatype=ChipSeq || dat

  6. Gclust Server: 11423 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available transporter protein, essential for bacteroid development protein 9 1.00e-19 14.29 0.0 0.0 0.0 25.81 0...transporter protein, essential for bacteroid development protein Number of Sequences 9 Homologs 9 Clustering

  7. Gclust Server: 12247 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(1) 186 EDA3 (embryo sac development arrest 3) 9 1.00e-45 100.0 0.0 0.0 0.0 0.0 0...186 Representative annotation EDA3 (embryo sac development arrest 3) Number of Sequences 9 Homologs 9 Clustering

  8. Gclust Server: 12014 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 12014 Rsp_RSP_0267=ctrC Cluster Sequences Related Sequences(3) 279 Hydroxyneurospor...ene dehydrogenase 9 1.00e-50 0.0 0.0 0.0 60.0 0.0 0.0 Show 12014 Cluster ID 12014 Sequence ID Rsp_RSP_0267=c

  9. Advanced road scene image segmentation and pavement evaluation using neural networks.

    Science.gov (United States)

    2010-01-01

    The current project, funded by MIOH-UTC for the period 9/1/2009-8/31/2010, continues our : efforts in designing an image processing based pavement inspection system for the : assessment of highway surface conditions. One of the most important tasks i...

  10. Photosynthetic response of mountain grassland species to drought stress is affected by UV-induced accumulation of epidermal flavonols

    Czech Academy of Sciences Publication Activity Database

    Rapantová, Barbora; Klem, Karel; Holub, Petr; Novotná, Kateřina; Urban, Otmar

    2016-01-01

    Roč. 9, 1-2 (2016), s. 31-40 ISSN 1803-2451 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : Agrostis capillaris * CO2 assimilation * drought stress * flavonols * grassland * Holcus mollis * Hypericum maculatum * precipitation * Rumex obtusifolius * UV radiation Subject RIV: EH - Ecology, Behaviour

  11. Supplementary Environmental Baseline Studies and Evaluation of the St. Mary’s River 1980. Great Lakes-St. Lawrence Seaway Navigation Season Extension Program

    Science.gov (United States)

    1981-07-01

    TIC FILE CO" piological Services Program FWSWOBS 80182.1 JULY 1981 SSUPPLEMENTARY ENVIRONMENTAL (N BASELINE STUDIES & EVALUATION I! OF THE ST. MARY’S...Iowa darter 4 4 Johnny darter 704 7 7 718 Logperch 48 9 1 58 Yellow perch 135 185 154 5 479 Wa] leye 46 9 9 64 Mottled sculpin 289 6 295 Slimy sculpin

  12. Teachers' awareness of students' potentials and its implications on ...

    African Journals Online (AJOL)

    Nigeria as a developing nation needs such talent and their encouragement in all its ramifications can not be under-rated. Teacher's role in this aspect is therefore very crucial, and the need to understand them better will go a long way in helping things. The Nigerian Journal of Guidance and Counselling Vol. 9(1) 2004: 94- ...

  13. Dicty_cDB: SHE557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CV752175.1 SJL6-009_A06_SJL6-009A06-T3_039.ab1 SJL Schistosoma japonicum cDNA, mRNA sequence. 44 3.9 1 CV752026...|CV752026.1 SJL6-007_B08_SJL6-007B08-T3_063.ab1 SJL Schistosoma japonicum cDNA, mRNA sequence. 44 3.9 1 CV739281...CV739281 |CV739281.1 SJAL_019_73.T3 SJL Schistosoma japonicum cDNA, mRNA sequence. 44 3.9 1 CV739266 |CV739266...|CV739266.1 SJAL_019_64.T3 SJL Schistosoma japonicum cDNA, mRNA sequence. 44 3.9 1 CV581768 |CV581768.1...sjmi-1-002_E12_sjmi-1-002E12-T3 Schistosoma japonicum miracidium cDNA Schistosoma japonicum cDNA, mRNA sequence

  14. institutionalising gender and women's studies at the university

    African Journals Online (AJOL)

    USER

    Keywords: Ghana, Gender centre, Institutionalizing gender, Advocacy, Women's studies & Gender sensitization. Introduction .... struggle for setting a distinctive African identity to provide answers to critical questions of nation building. This mission was ..... Editorial: "Rethinking Universities II": Feminist Africa (9), 1-4. Britwum ...

  15. Rising trend in maternal mortality at the university of Maiduguri ...

    African Journals Online (AJOL)

    Results: The maternal mortality ratio (MMR) was 1074/100,000 live births. The main causes of maternal mortality were eclampsia in 34.6% of cases, haemorrhage (9.1%), HIV(17.8%) and puerperal infections (7.5%). There was rising trend in maternal mortality ratio over the study period. Factors contributing to maternal ...

  16. Review

    African Journals Online (AJOL)

    2016-01-01

    mail: darshanraj22@gmail.com doi: http://dx.doi.org/10.4314/jfas.v8i1.9. 1. INTRODUCTION. The Mannich reaction is an organic MCR reaction which consists of an amino alkylation of an acidic proton placed next to a carbonyl ...

  17. Full text

    African Journals Online (AJOL)

    IndexCopernicus Portal System

    identify the factors associated with incisional. Electronic PDF security powered by IndexCopernicus.com .... Cigarette smoking. 4. 9.1. Cancer. 2. 4.5. Wound sepsis has continued to be an important risk factor [24]. It was contributory in. 79.5% of our patients. Perhaps the usual reduced immune state of pregnancy and the.

  18. AcEST: DK953902 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ult : TrEMBL tr_hit_id A8ABH9 Definition tr|A8ABH9|A8ABH9_IGNH4 Putative uncharacterized protein OS=Ignicoccus hospital...d protein OS=Lyngb... 33 9.1 >tr|A8ABH9|A8ABH9_IGNH4 Putative uncharacterized protein OS=Ignicoccus hospital

  19. The Aerodynamics of a Slightly Yawing Supersonic Cone

    Science.gov (United States)

    1945-07-10

    39) (390 and vih whore (In ?)* - A(u + u» cot 9), (1*0) A- 2u*/((7 - iXc8- tP) - (7 * Dff»aj. [Horo c2 is givon by Eq. (12).] Finally, tho...simplified approximate treatments have been suggested by H. Lewy, and by . ’ .’i Karush and Critchfield.^ The latter suggest

  20. Perceptions on diabetes care provision among health providers in rural Tanzania : a qualitative study

    NARCIS (Netherlands)

    Mwangome, M.N.; Geubbels, Eveline; Klatser, P.R.; Dieleman, M.A.

    2016-01-01

    Diabetes prevalence in Tanzania was estimated at 9.1% in 2012 among adults aged 24–65 years — higher than the HIV prevalence in the general population at that time. Health systems in lower- and middle-income countries are not designed for chronic health care, yet the rising burden of

  1. pH-dependent inhibition of K2P3.1 prolongs atrial refractoriness in whole hearts

    DEFF Research Database (Denmark)

    Skarsfeldt, Mark A; Jepps, Thomas A; Bomholtz, Sofia H

    2016-01-01

    In isolated human atrial cardiomyocytes, inhibition of K2P3.1 K(+) channels results in action potential (action potential duration (APD)) prolongation. It has therefore been postulated that K2P3.1 (KCNK3), together with K2P9.1 (KCNK9), could represent novel drug targets for the treatment of atrial...

  2. Colonoscopic features of early intestinal tuberculosis

    African Journals Online (AJOL)

    1991-03-02

    Mar 2, 1991 ... The colonoscopic findings in 11 patients with early tuber- culous colitis included erythema alone in 1 patient (9,1%), mucosal nodules indistinguishable from small adenoma in 8. (72,7%), aphthous ulcers in 3 (27,3%), and a deformed ileo- caecal valve in 3 (27,3%). The caecum was the principal site.

  3. Colonoscopic features of early intestinal tuberculosis - Report of 11 ...

    African Journals Online (AJOL)

    The colonoscopic findings in 11 patients with early tuberculous colitis included erythema alone in 1 patient (9,1%), mucosal nodules indistinguishable from small adenoma in 8 (72,7%), aphthous ulcers in 3 (27,3%), and a deformed ileocaecal valve in 3 (27,3%). The caecum was the principal site of disease and the ileum ...

  4. ORIGINAL ARTICLE

    African Journals Online (AJOL)

    User

    (LDL-c) was assessed over the 12-month period. Percentage changes in atherogenic index expressed as TC/. HDL-c and LDL-c/HDL-c was also estimated. NVP elicited a 10.2% increase in weight compared to EFV and this was associated with CBV combination use. EFV further elicited a 9.1% increase in TC, 1.2% in-.

  5. Growth response of eight tropical turfgrass species to salinity

    African Journals Online (AJOL)

    PRECIOUS

    2009-11-02

    Nov 2, 2009 ... Irrigation seawater of different salinity levels (0, 24, 48 and 72 dSm-1) were applied to experimental plants grown in a plastic pots filled with a mixture of sand and peat (9:1). The results were analyzed using SAS and treatment means were compared using LSD Test. The results indicated that Paspalum.

  6. A Review of Green Strategies to Prevent or Mitigate Microbiologically Influenced Corrosion

    Science.gov (United States)

    2007-01-01

    glutaraldehyde) Nitrate (start jan . 99) -9.1-1 SRB-FA M SRB-MPN__________ ____ M NRB1 Detection limit FA Method: 1 e=05 cellslcm2 I’ NRB2 Detection limit...of metal corrosionsulfide films exposed to air. Corrosion 42:650-654. by bacteria. Biofouling 3:1 -11. Hernandez G, Kucera V, Thierry D, Pedersen A

  7. 40 CFR 75.83 - Calculation of Hg mass emissions and heat input rate.

    Science.gov (United States)

    2010-07-01

    ... heat input rate. 75.83 Section 75.83 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Calculation of Hg mass emissions and heat input rate. The owner or operator shall calculate Hg mass emissions and heat input rate in accordance with the procedures in sections 9.1 through 9.3 of appendix F to...

  8. Henry Carr on the Girl-Child and Women Education in Southern ...

    African Journals Online (AJOL)

    ... on the influence of non-indigenous educators. Again, Henry Carr was among the pioneers of Nigeria's educational system from its foundation stage. A system which had a consequential factor in the social, economic and political development of Nigeria. SOPHIA: An African Journal of Philosophy Vol. 9 (1) 2006: pp. 38-44 ...

  9. Adesalu (7)

    African Journals Online (AJOL)

    DELL

    was sputter coated with 20 nm of gold or gold- palladium. All scanning electron microscope observations were .... and by the very fine striae. Frustules in girdle view are rectilinear while frustules in valve view are ..... acidity, acidification and recovery of lakes and rivers .Diatom Monographs 9: 1-169. Lange-Bertalot, H. and ...

  10. Forecasting Maintenance Shortcomings of a Planned Equipment Density Listing in Support of Expeditionary Missions

    Science.gov (United States)

    2017-06-01

    representation of an Equipment Density Listing (EDL) used in support of a deploying MEU. The goal of this thesis is to provide results that can be...without external support. The sample data used in this research is an accurate representation of an Equipment Density Listing (EDL) used in support...8 E. LITERATURE REVIEW .........................................................................9 1. Improving Life

  11. The Significance of Dehydroepiandrosterone for Fatigue in primary Sjögren’s Syndrome and Systemic Lupus Erythematosus

    NARCIS (Netherlands)

    Hartkamp, A.

    2014-01-01

    Fatigue is a prevalent and debilitating symptom in patients with the chronic inflammatory autoimmune diseases primary Sjögren’s syndrome (pSS) and systemic lupus erythematosus (SLE). Both diseases have a female preponderance (women to men ratio 9:1). Doctors recognize the existence of fatigue and

  12. Analysis of knowledge, attitude and practices of small ruminant ...

    African Journals Online (AJOL)

    Furthermore, the mean scores of farmers' knowledge was highest in identification of sick animal (9.1) and lowest in vaccination (1.3) while the mean scores of farmers' skill was highest in feeding of animals (4.3) and lowest in health management (2.5). Majority (73.2%) of the farmers had indifferent attitude towards small ...

  13. Experiment list: SRX005632 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX005632 ce10 RNA polymerase RNA polymerase II Adult Young adult NA 4652073,25.9,1...5.8,1045 chip antibody=POL II || growth stage=L4/Young adult || strain=TJ356 http://dbarchive.biosciencedbc.

  14. The Evaluation of School Guidance and Counselling Services in ...

    African Journals Online (AJOL)

    This paper sought to establish the status of the Zimbabwean School Guidance and Counselling Services (SGC services) evaluation from school counsellors' perspectives. A descriptive survey design was used. A questionnaire was administered to 314 participants. The SAS/STAT version 9.1 was used to analyse the data.

  15. Effects of high amphetamine dose on mood and cerebral glucose metabolism in normal volunteers using positron emission tomography (PET)

    NARCIS (Netherlands)

    Vollenweider, FX; Maguire, RP; Leenders, KL; Mathys, K; Angst, J

    1998-01-01

    The effects of high euphorigenic doses of D-amphetamine (0.9-1.0 mg/kg p.o.) on regional cerebral glucose metabolism (rCMRglu) and psychological measures were investigated in 10 healthy human volunteers using a within-subject design and [F-18]-fluorodeoxygrucose positron emission tomography

  16. Biological Control of the weed Sesbania exaltata using a microsclerotia formulation of the bioherbicide Colletotrichum truncatum

    Science.gov (United States)

    The fungus Colletotrichum truncatum, grown on rice grain for 3 to 4 weeks at 22 to 24°C, produced a fungus-infested rice mixture containing microsclerotia and conidia (spores) in a ratio of ~9:1, respectively. Greenhouse tests showed that this formulation at various concentrations, from 0.4 to 50 m...

  17. Cosmogenic 10 Be: A critical view on its widespread dominion in ...

    Indian Academy of Sciences (India)

    The radionuclide 10Be (half-life 9 1:5 my), produced naturally in the Earth's atmosphere by nuclear interactions of cosmic rays, was sought in ocean sediments in the late fifties, considering its potential usefulness as a radiotracer for dating sediments. 10Be was discovered independently by two groups, one in India and the ...

  18. Pregnancy outcome and factors affecting vaginal delivery of twins at ...

    African Journals Online (AJOL)

    The average gestational age of admission was 32 } 5.8 weeks and the average duration of hospital stay for preterm labor was 12.6 } 9.1 days. Other pregnancy complications observed were severe hypertension (14.5%, anemia (9.4%), postpartum hemorrhage (8.5%), puerperal fever (5.1%), abruptio placentae, and diabetic ...

  19. NCBI nr-aa BLAST: CBRC-OPRI-01-0614 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0614 ref|YP_002763059.1| hypothetical protein GAU_3547 [Gemmatimonas aura...ntiaca T-27] dbj|BAH40589.1| hypothetical protein [Gemmatimonas aurantiaca T-27] YP_002763059.1 9.1 26% ...

  20. Biomass conversion to high value chemicals: from furfural to chiral hydrofuroins in two steps.

    Science.gov (United States)

    Kabro, Anzhelika; Escudero-Adán, Eduardo C; Grushin, Vladimir V; van Leeuwen, Piet W N M

    2012-08-03

    Catalytic asymmetric transfer hydrogenation of rac-furoin and furil produces hydrofuroin with up to 99% ee and 9:1 dr. This reaction provides an exceptionally easy access to optically active hydrofuroins in two straightforward steps from biomass-derived furfural (global production 200,000-300,000 t annually) using benzoin condensation.