WorldWideScience

Sample records for core introduction ci

  1. Introduction to the Core Curriculum in GIS

    OpenAIRE

    2015-01-01

    This short narrative introduces the Core Curriculum in GIS and provides a historical overview of the Core Curriculum Project, including the later Core Curriculum in GIScience and Core Curriculum for Technical Programs. Appended to this description is an original pamphlet advertising the Core Curriculum in GIS.

  2. As cores fisiológicas na ciência de Goethe: educação e fenomenologia

    OpenAIRE

    Jonas Bach Junior

    2016-01-01

    Resumo Este artigo apresenta o ponto de partida de Goethe para a formulação de sua Teoria das Cores. A observação fenomenológica das cores fisiológicas é base fundamental para uma concepção hologramática do fenômeno cromático. Com seu método de pesquisa, Goethe não reduziu o fenômeno a representações mecânicas ou geométricas, mas focou sua dimensão qualitativa. A complementariedade das cores fisiológicas é um princípio inerente tanto ao todo, quanto às partes da Teoria das Cores. A fenomenolo...

  3. Introduction to Open Core Protocol Fastpath to System-on-Chip Design

    CERN Document Server

    Schwaderer, W David

    2012-01-01

    This book introduces Open Core Protocol (OCP), not as a conventional hardware communications protocol but as a meta-protocol: a means for describing and capturing the communications requirements of an IP core, and mapping them to a specific set of signals with known semantics.  Readers will learn the capabilities of OCP as a semiconductor hardware interface specification that allows different System-On-Chip (SoC) cores to communicate.  The OCP methodology presented enables intellectual property designers to design core interfaces in standard ways. This facilitates reusing OCP-compliant cores across multiple SoC designs which, in turn, drastically reduces design times, support costs, and overall cost for electronics/SoCs. Provides a comprehensive introduction to Open Core Protocol, which is more accessible than the full specification; Designed as a hands-on, how-to guide to semiconductor design; Includes numerous, real “usage examples” which are not available in the full specification; Integrates coverag...

  4. Introduction

    DEFF Research Database (Denmark)

    Cromwell, Jennifer Adele; Choat, Malcolm

    2012-01-01

    Introduction to the section 'Thebes in Late Antiquity', which was organised by the authors (Choat and Cromwell)......Introduction to the section 'Thebes in Late Antiquity', which was organised by the authors (Choat and Cromwell)...

  5. Introduction

    DEFF Research Database (Denmark)

    Klitgård, Ebbe; Bayer, Gerd

    2011-01-01

    An introduction to "Narrative Developments from Chaucer to Defoe", including a review of recent research in the field.......An introduction to "Narrative Developments from Chaucer to Defoe", including a review of recent research in the field....

  6. Introduction

    DEFF Research Database (Denmark)

    2004-01-01

    The chapter gives an introduction to the book "Environmental planning and management : tools for a sustainable development".......The chapter gives an introduction to the book "Environmental planning and management : tools for a sustainable development"....

  7. Introduction

    DEFF Research Database (Denmark)

    Høgfeldt Hansen, Leif

    2016-01-01

    This introduction to South Korean architecture gives an overall view of the architecture done in the country in historic times as well as a general introduction to the culture of the country.......This introduction to South Korean architecture gives an overall view of the architecture done in the country in historic times as well as a general introduction to the culture of the country....

  8. As cores fisiológicas na ciência de Goethe: educação e fenomenologia

    Directory of Open Access Journals (Sweden)

    Jonas Bach Junior

    2016-03-01

    Full Text Available Resumo Este artigo apresenta o ponto de partida de Goethe para a formulação de sua Teoria das Cores. A observação fenomenológica das cores fisiológicas é base fundamental para uma concepção hologramática do fenômeno cromático. Com seu método de pesquisa, Goethe não reduziu o fenômeno a representações mecânicas ou geométricas, mas focou sua dimensão qualitativa. A complementariedade das cores fisiológicas é um princípio inerente tanto ao todo, quanto às partes da Teoria das Cores. A fenomenologia da natureza de Goethe é uma unidade dinâmica entre subjetividade e objetividade. Sua compreensão exige a execução de um processo de educação dos sentidos e de educação para uma cognição qualitativa.

  9. CI Implementation

    DEFF Research Database (Denmark)

    Jørgensen, Frances; Boer, Harry; Laugen, Bjørge Timenes

    2006-01-01

    There are a number of tools available for organizations wishing to measure and subsequently develop Continuous Improvement (CI). In this article, we review and evaluate a well-accepted CI development model, namely the CI Maturity Model (Bessant and Caffyn, 1997), against data collected from the 2...

  10. Introduction

    DEFF Research Database (Denmark)

    Jensen, Rasmus Thybo; Moran, Dermot

    2012-01-01

    An introduction to a special issue of Phenomenology and the Cognitive Sciences dedicated to empathy and the direct perception approach to other minds......An introduction to a special issue of Phenomenology and the Cognitive Sciences dedicated to empathy and the direct perception approach to other minds...

  11. Introduction

    DEFF Research Database (Denmark)

    Søbjerg, Lene Mosegaard

    2016-01-01

    Introduction to anthology which provides the theoretical basis of an Erasmus+ project involving marginalised young people, practitioners, students and academics in co-creating a teaching module for the social professions.......Introduction to anthology which provides the theoretical basis of an Erasmus+ project involving marginalised young people, practitioners, students and academics in co-creating a teaching module for the social professions....

  12. Introduction

    DEFF Research Database (Denmark)

    Nielsen, Kirsten

    2009-01-01

    The introduction begins with a definition of normativity. Thereafter follows a presentation of the 10 articles of the book. These articles represent three areas: Reception and transformation of the Bible in literature, Reception and transformation of the Bible in philosophy, Reception and transfo......The introduction begins with a definition of normativity. Thereafter follows a presentation of the 10 articles of the book. These articles represent three areas: Reception and transformation of the Bible in literature, Reception and transformation of the Bible in philosophy, Reception...

  13. Introduction

    DEFF Research Database (Denmark)

    Petersen, Nils Holger; Sandbeck, Lars; Solten, Therese Bering

    2013-01-01

    Introduction to the Special Issue of Literature and Theology publishing articles based on selected papers from the international conference of the International Society for Religion, Literature and Culture (ISRLC) conference held at the Theological Faculty of the University of Copenhagen 19...

  14. Introduction

    DEFF Research Database (Denmark)

    Barwell, Richard; Clarkson, Philip; Halai, Anjum;

    2016-01-01

    This chapter provides the introduction to this ICMI Study 21 volume. It includes: a discussion of the place of this study and its topic within ICME; a discussion of what is meant by the study title; and a brief historical account of research on this topic in mathematics education. The chapter also...

  15. Introduction

    DEFF Research Database (Denmark)

    Ashbee, Edward; Dumbrell, John

    2017-01-01

    The introduction sets a framework for subsequent chapters by considering theories of change and the extent to which there was consequential change during the Obama years. It draws upon earlier scholarship to suggest that although there certainly was no “transformation” (when new interests secure ...

  16. Introduction

    DEFF Research Database (Denmark)

    Gjerdrum Pedersen, Esben Rahbek; Thusgaard Pedersen, Janni

    2013-01-01

    An introduction is presented in which the editors discuss various reports within the issue on topics including the shared value concept in the education and business, the role of corporate foundations in establishing cross-sector partnerships, and the mechanisms of governance in the cross-sector ...

  17. Introduction

    DEFF Research Database (Denmark)

    Høst, Jeppe Engset

    2015-01-01

    This chapter introduces the notion and theme of market-based fisheries management. The introduction of market mechanisms to distribute and manage fishing quota has internationally occurred since the 1980s but is increasingly on the political agenda. As privatization and transferability are promoted...... for efficiency and fleet adaptation, and on the other, quota markets are accused of causing concentration and disturbing social relations....

  18. Introduction

    DEFF Research Database (Denmark)

    Schmidt, Johannes Dragsbæk; Rasiah, Rajah

    2010-01-01

    This is a very interesting book. It is topical and is one of the few volumes that attempts to treat Southeast Asia as an integrated whole. The editors are methodologically ambitious, and they skillfully integrate a very large amount of diverse material in their introduction. I imagine that the book...

  19. Introduction

    NARCIS (Netherlands)

    Doreian, Patrick; Stokman, Frans N.

    2001-01-01

    Introduction to: The proceedings of a conference that was held on the analysis of repeated cross sections at the University of Nijmegen on June 15±16, 2000. This two-days meeting was attended by 75 participants from seven different countries (AUS, B, F, GER, NL, USA, UK) and from a wide array of aca

  20. Introduction

    DEFF Research Database (Denmark)

    Nielsen, Kirsten

    2009-01-01

    of the story about Esau and Jacob. The rest of the introduction presents the six (revised) papers from the conference that are published in this special issue. The authors of these papers are Marie Vejrup Nielsen, James H. Thrall, Alyda Faber, Hans Jørgen Frederiksen, Stefanie Knauss og Hugh S. Pyper ....

  1. Introduction

    DEFF Research Database (Denmark)

    Schmidt, Johannes Dragsbæk; Berg, Torsten Rødel

    2012-01-01

    The chapter includes a discussion about the play by Henrik Ibsen from 1879, A Doll's House, how it still proves to be relevant today to gender relations not only in Denmark but in Nepal as well. The introduction explains how Ibsen's play inspired two theater directors from Denmark and Nepal...

  2. Introduction

    DEFF Research Database (Denmark)

    Nielsen, Kirsten

    2009-01-01

    and Culture". In the introduction, I give my definitions of reception, transformation, transgression and norm. Taking Harold Bloom and Julia Kristeva as my point of departure, I give an example of reception and transformation in the Bible, showing how the Book of Job can be read as a tranformation...

  3. CAIA level I an introduction to core topics in alternative investments

    CERN Document Server

    Anson, Mark J P; CAIA Association; Black, Keith H; Kazemi, Hossein

    2012-01-01

    The official study text for the Level I Chartered Alternative Investment Analyst (CAIA) exam The Chartered Alternative Investment Analyst (CAIA) designation is the financial industry's first and only globally recognized program that prepares professionals to deal with the ever-growing field of alternative investments. The second edition of CAIA Level I: An Introduction to Core Topics in Alternative Investments contains comprehensive insights on the alternative investment issues a potential Level I candidate would need to know about as they prepare for the exam. The information found here will help you build a solid foundation in alternative investment markets--with coverage of everything from the characteristics of various strategies within each alternative asset class to portfolio management concepts central to alternative investments. * Uses investment analytics to examine each alternative asset class * Examines quantitative techniques used by investment professionals * Addresses the unique attributes a...

  4. Ci PERMIT

    CERN Multimedia

    Relations with the Host States Service

    1999-01-01

    The Swiss Permanent Mission to the International Organisations at Geneva recalls that only the spouses and children of members of personnel resident in Switzerland and in possession of a legitimation card of types 'B', 'C', 'D' or 'E' issued by the Swiss Federal Department of Foreign Affairs are entitled to benefit from a Ci Permit.The 'demande d'attestation de permis Ci' (request for a Ci permit attestation) can be sent to the Mission only through Personnel Division (Administrative Services, Office 33/1-025).Additional information on access by family members of CERN officials to the Swiss labour market are available to you on the Web site of the Relations with the Host States Service (cf. document entitled 'Employment in Switzerland for spouses and children of CERN officials' dated March 1996).Relations with the Host States Servicehttp://www.cern.ch/relations/Tel. 72848

  5. Introduction

    DEFF Research Database (Denmark)

    Petersen, Nils Holger; Sandbeck, Lars; Solten, Therese Bering

    2013-01-01

    Introduction to the Special Issue of Literature and Theology publishing articles based on selected papers from the international conference of the International Society for Religion, Literature and Culture (ISRLC) conference held at the Theological Faculty of the University of Copenhagen 19-21 Oc......-21 October 2012 with the theme: Cultures of Transition: Presence, Absence,Memory. The conference was organised by Nils Holger Petersen, Lars Sandbeck and Therese Bering Solten who were invited as guest editors for a volume of Literature and Theology based on the conference....

  6. Introduction

    DEFF Research Database (Denmark)

    Høst, Jeppe Engset

    2015-01-01

    This chapter introduces the notion and theme of market-based fisheries management. The introduction of market mechanisms to distribute and manage fishing quota has internationally occurred since the 1980s but is increasingly on the political agenda. As privatization and transferability are promoted...... internationally, and by big players, it becomes even more crucial to understand its social and environmental implications. This chapter looks at the broader lines in the fisheries research and discusses the diverging views on market-based fisheries management. On one side market mechanisms are promoted...... for efficiency and fleet adaptation, and on the other, quota markets are accused of causing concentration and disturbing social relations....

  7. Introduction

    DEFF Research Database (Denmark)

    2015-01-01

    This chapter presents an introduction to the microfluidics field and microfluidic biochips. We discuss the main fluid propulsion principles used by modern microfluidic platforms, with a focus on “digital” microfluidic biochips, which are the topic of this book. Digital microfluidic biochips...... manipulate the fluids as small “droplets” using electrokinetics, i.e., electrowetting-on-dielectric. Several application areas for biochips are discussed, and the motivation behind the work presented in this book is introduced. At the end of the chapter, we outline the structure of the book and an overview...

  8. Introduction

    DEFF Research Database (Denmark)

    Peder Pedersen, Claus; Dehs, Jørgen

    2013-01-01

    Introduction to When Architects and Designers Write / Draw / Build / ? This anthology highlights the potentials and challenges for research in architecture and design. The included essays are based on papers given at a symposium held at the Aarhus School of Architecture in 2011 and contain a number...... of topical positions ranging from the activist and academic to practice-based and artistically-based research by international and Danish researchers. The anthology is aimed at architects and designers, as well as others with an interest in the discussion of the concept of research in the fields...

  9. Introduction

    Directory of Open Access Journals (Sweden)

    Laurel Brake

    2013-04-01

    mso-fareast-language:JA;} When W. T. Stead died on the 'Titanic' he was the most famous Englishman on board. A mass of contradictions and a crucial figure in the history of the British press, Stead was a towering presence in the cultural life of late-Victorian and Edwardian society. In this introduction, we consider Stead as a ‘mass of contradictions’ and offer a few ways in which his prodigious output and activity might be understood.

  10. Introduction

    Directory of Open Access Journals (Sweden)

    David Harris

    1990-11-01

    Full Text Available Since its foundation as an independent Institute within the University of London fifty-three years ago, the Institute of Archaeology has contributed to research in many aspects of the developing discipline in many different parts of the world. For the first thirty years of its existence it was exclusively a postgraduate research institution, and it has continued to give high priority to postgraduate studies since the introduction of undergraduate teaching in 1968. Today, one third of the 300 students enrolled at the Institute are postgraduates, over 50 of whom are research students registered for MPhil/PhD degrees. Most of the MA and MSc students also undertake their own research projects as part of the Master's degree. Institute postgraduates are thus involved in a multitude of diverse investigations, in Britain, continental Europe, Asia, Africa, Australasia and the Americas, and each year they make, collectively, a very substantial contribution to archaeological knowledge.

  11. Introduction

    DEFF Research Database (Denmark)

    Schmidt, Johannes Dragsbæk; Berg, Torsten Rødel

    2012-01-01

    The chapter includes a discussion about the play by Henrik Ibsen from 1879, A Doll's House, how it still proves to be relevant today to gender relations not only in Denmark but in Nepal as well. The introduction explains how Ibsen's play inspired two theater directors from Denmark and Nepal......, respectively to use it as point of departure for the creation of a trans-civilizational and intercultural dialogue. The intention of this chapter is to introduce the background of the collection of chapters, give broader perspectives about globalization and social change linked with debates about changing...... values and cultures in development and social policy and then enters the specific context and development trajectory in Nepal in recent years....

  12. Introduction

    OpenAIRE

    Ayeb, Habib

    2014-01-01

    En guise d’introduction, deux questions s’imposent : pourquoi un ouvrage sur les eaux du Jourdain ? Et pourquoi avoir adopté une formule qui privilégie essentiellement les données de base d’ordre quantitatives et chronologiques ? Disons d’entrée de jeu, pour répondre à la première interrogation, que malgré la médiatisation effrénée de la question de l’eau et des difficultés de partage des ressources hydrauliques dites internationales, aucun livre récent ne lui a été consacré en France. Le der...

  13. Introduction

    Science.gov (United States)

    Carotenuto, Luigi

    This chapter introduces the context, objectives and structure of the book. This book aims both to contribute to disseminate the knowledge about the scientific research conducted in space and to promote new exploitation of existing data in this field. While space experiments are characterised by a long time for preparation, high costs and few opportunities, significant scientific value is expected from the resulting data for almost scientific disciplines. In this context, ISS is a unique experimental environment for research. As part of its Seventh Framework Programme, the European Commission intends to support further exploitation and valorisation of space experimental data. This book was realised as part of the ULISSE project, co-funded by the European Union. The book intends to provide an introduction to space research with a focus on the experiments performed on the ISS and related disciplines. The book also intends to be a useful guide, not only for scientists but also for teachers, students and newcomers to space research activities.

  14. Introduction

    Directory of Open Access Journals (Sweden)

    Keagan LeJeune

    2007-12-01

    Full Text Available I heard many stories growing up, ghost stories, buried treasure stories, and stories about family members. I have even heard my share of outlaw legends. Most wouldn’t figure that a young boy in Louisiana would hear many stories of outlaw robbers or gun fights, but throughout America outlaw legends abound, especially the “good outlaw” or heroic criminal. Most, though, do not exactly fit the pattern people are used to seeing in old western movies, but if people learn how to look, the legends are here. In Louisiana, the outlaw might not be a cowboy but a boat captain, and the loot might not be a stagecoach box but bootlegged alcohol. The outlaw may be an oilfield or sawmill worker, an old trapper, or even a computer hacker, but the core story is the same. An underdog fights some oppressive force for the benefit of the common people. That doesn’t mean people are still afraid of these people or that they embrace the life of an outlaw, but they are still fascinated by them and tell their stories. One of my students once wrote an essay about heroes, and his hero was the group of people he grew up with, “river rats,” for him people who live on Louisiana’s rivers and swamps. One of the group’s characteristics he found so appealing was their ability to evade the law, to skirt the rules and regulations that the government established but that the group did not embrace, such as hunting licenses or boat permits. One of the most detailed portions of the essay, and I must admit one of the most fascinating, explained how some of his relatives had developed a method for growing marijuana under the government’s nose by placing the plants in hollow trees trunks located in the vast marsh. He even referred to these figures as “our own Robin Hoods;” after all, in his mind they are defying the rules of an oppressive system for the benefit of the common people.

  15. Introduction

    Science.gov (United States)

    de Laat, Cees; Develder, Chris; Jukan, Admela; Mambretti, Joe

    throughput. The second session groups 3 papers presenting methods, protocols and architectures that enhance capacities in the Networks. The paper titled: “NIC-assisted Cache-Efficient Receive Stack for Message Passing over Ethernet” presents the addition of multiqueue support in the Open-MX receive stack so that all incoming packets for the same process are treated on the same core. It then introduces the idea of binding the target end process near its dedicated receive queue. In general this multiqueue receive stack performs better than the original single queue stack, especially on large communication patterns where multiple processes are involved and manual binding is difficult. The authors of: “A Multipath Fault-Tolerant Routing Method for High-Speed Interconnection Networks” focus on the problem of fault tolerance for high-speed interconnection networks by designing a fault tolerant routing method. The goal was to solve a certain number of link and node failures, considering its impact, and occurrence probability. Their experiments show that their method allows applications to successfully finalize their execution in the presence of several faults, with an average performance value of 97% with respect to the fault-free scenarios. The paper: “Hardware implementation study of the Self-Clocked Fair Queuing Credit Aware (SCFQ-CA) and Deficit Round Robin Credit Aware (DRR-CA) scheduling algorithms” proposes specific implementations of the two schedulers taking into account the characteristics of current high-performance networks. A comparison is presented on the complexity of these two algorithms in terms of silicon area and computation delay. Finally we selected one paper for the special paper session: “A Case Study of Communication Optimizations on 3D Mesh Interconnects”. In this paper the authors present topology aware mapping as a technique to optimize communication on 3-dimensional mesh interconnects and hence improve performance. Results are presented

  16. Introduction

    Science.gov (United States)

    Cohen, E. G. D.

    deduced for irreversible processes (C. Jarzynski). The survey of non-equilibrium steady states in statistical mechanics of classical and quantum systems employs heat bath models and the random matrix theory input. The quantum heat bath analysis and derivation of fluctuation-dissipation theorems is performed by means of the influence functional technique adopted to solve quantum master equations (D. Kusnezov). Chapter II deals with an issue of relaxation and its dynamical theory in both classical and quantum contexts. Pollicott-Ruelle resonance background for the exponential decay scenario is discussed for irreversible processes of diffusion in the Lorentz gas and multibaker models (P. Gaspard). The Pollicott-Ruelle theory reappears as a major inspiration in the survey of the behaviour of ensembles of chaotic systems, with a focus on model systems for which no rigorous results concerning the exponential decay of correlations in time is available (S. Fishman). The observation, that non-equilibrium transport processes in simple classical chaotic systems can be described in terms of fractal structures developing in the system phase space, links their formation and properties with the entropy production in the course of diffusion processes displaying a low dimensional deterministic (chaotic) origin (J. R. Dorfman). Chapter III offers an introduction to the theory of dynamical semigroups. Asymptotic properties of Markov operators and Markov semigroups acting in the set of probability densities (statistical ensemble notion is implicit) are analyzed. Ergodicity, mixing, strong (complete) mixing and sweeping are discussed in the familiar setting of "noise, chaos and fractals" (R. Rudnicki). The next step comprises a passage to quantum dynamical semigroups and completely positive dynamical maps, with an ultimate goal to introduce a consistent framework for the analysis of irreversible phenomena in open quantum systems, where dissipation and decoherence are crucial concepts (R

  17. Introduction of biotin or folic acid into polypyrrole magnetite core-shell nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Nan, Alexandrina; Turcu, Rodica [National Institute of Research and Development for Isotopic and Molecular Technologies, Donath 65-103, Cluj-Napoca (Romania); Liebscher, Jürgen [National Institute of Research and Development for Isotopic and Molecular Technologies, Donath 65-103, Cluj-Napoca, Romania and Institute of Chemistry, Humboldt-University Berlin, Brook-Taylor 2, D-12489 Berlin (Germany)

    2013-11-13

    In order to contribute to the trend in contemporary research to develop magnetic core shell nanoparticles with better properties (reduced toxicity, high colloidal and chemical stability, wide scope of application) in straightforward and reproducible methods new core shell magnetic nanoparticles were developed based on polypyrrole shells functionalized with biotin and folic acid. Magnetite nanoparticles stabilized by sebacic acid were used as magnetic cores. The morphology of magnetite was determined by transmission electron microscopy TEM, while the chemical structure investigated by FT-IR.

  18. Improvement of Core Performance by Introduction of Moderators in a Blanket Region of Fast Reactors

    Directory of Open Access Journals (Sweden)

    Toshio Wakabayashi

    2013-01-01

    Full Text Available An application of deuteride moderator for fast reactor cores is proposed for power flattening that can mitigate thermal spikes and alleviate the decrease in breeding ratio, which sometimes occurs when hydrogen moderator is applied as a moderator. Zirconium deuteride is employed in a form of pin arrays at the inner most rows of radial blanket fuel assemblies, which works as a reflector in order to flatten the radial power distribution in the outer core region of MONJU. The power flattening can be utilized to increase core average burn-up by increasing operational time. The core characteristics have been evaluated with a continuous-energy model Monte Carlo code MVP and the JENDL-3.3 cross-section library. The result indicates that the discharged fuel burn-up can be increased by about 7% relative to that of no moderator in the blanket region due to the power flattening when the number of deuteride moderator pins is 61. The core characteristics and core safety such as void reactivity, Doppler coefficient, and reactivity insertion that occurred at dissolution of deuteron were evaluated. It was clear that the serious drawback did not appear from the viewpoints of the core characteristics and core safety.

  19. Introduction of Core Based Subjects in the Curriculum of Technical and Vocational Institutions in Ghana: Assessment of Its Effect on Practical Training Sessions

    Science.gov (United States)

    William, Otu

    2015-01-01

    Technical education among other things focuses on training the skill manpower needs of the youth in most countries of which Ghana is no exception. This study looks at Ghana Education Service technical and vocational sector reform programme introduced in 2010 with emphasis on the introduction of compulsory core based subjects and its effect on…

  20. Introduction to Agricultural Business Unit. Student Reference for Agricultural Science I Core Curriculum. [Volume 19, Number 20.

    Science.gov (United States)

    Timko, Joseph J.; Birkenholz, Robert J.

    This student reference on agricultural business, designed to accompany the lessons outlined in the 1984 instructor's guide, "Introduction to Agricultural Business," has seven lessons: (1) introduction to agribusiness; (2) careers in agribusiness; (3) agribusiness in the community; (4) the role of the employee in an agribusiness; (5)…

  1. CORE

    DEFF Research Database (Denmark)

    Krigslund, Jeppe; Hansen, Jonas; Hundebøll, Martin

    2013-01-01

    different flows. Instead of maintaining these approaches separate, we propose a protocol (CORE) that brings together these coding mechanisms. Our protocol uses random linear network coding (RLNC) for intra- session coding but allows nodes in the network to setup inter- session coding regions where flows...... intersect. Routes for unicast sessions are agnostic to other sessions and setup beforehand, CORE will then discover and exploit intersecting routes. Our approach allows the inter-session regions to leverage RLNC to compensate for losses or failures in the overhearing or transmitting process. Thus, we...... increase the benefits of XORing by exploiting the underlying RLNC structure of individual flows. This goes beyond providing additional reliability to each individual session and beyond exploiting coding opportunistically. Our numerical results show that CORE outperforms both forwarding and COPE...

  2. CORE

    DEFF Research Database (Denmark)

    Krigslund, Jeppe; Hansen, Jonas; Hundebøll, Martin

    2013-01-01

    different flows. Instead of maintaining these approaches separate, we propose a protocol (CORE) that brings together these coding mechanisms. Our protocol uses random linear network coding (RLNC) for intra- session coding but allows nodes in the network to setup inter- session coding regions where flows...... intersect. Routes for unicast sessions are agnostic to other sessions and setup beforehand, CORE will then discover and exploit intersecting routes. Our approach allows the inter-session regions to leverage RLNC to compensate for losses or failures in the overhearing or transmitting process. Thus, we...... increase the benefits of XORing by exploiting the underlying RLNC structure of individual flows. This goes beyond providing additional reliability to each individual session and beyond exploiting coding opportunistically. Our numerical results show that CORE outperforms both forwarding and COPE...

  3. (Human) Resourcing For CI

    DEFF Research Database (Denmark)

    Jørgensen, Frances; S., Jacob; Kofoed, Lise Busk

    2005-01-01

    More and more, the ability to compete in today’s market is viewed as being dependent on human capital. One of the most challenging aspects of human resource management involves supplying the organization with the human capital necessary to fulfill its objectives. This task becomes especially...... challenging in organizations involved in change processes such as Continuous Improvement (CI), as the technical skills traditionally valued are no longer adequate. These companies are faced with the question: “What competencies should our employees possess in order to contribute to our success, given...... the change processes in which we are engaged?” Without a clear picture of the types of competencies required to implement CI, it is impossible for companies to make informed decisions regarding recruitment, hiring, and training of their workforce. The objective of this paper is therefore to define...

  4. 现有IMS网络引入NFV方案研究%Research on the Introduction of NFV Solution to the Existing IMS Core Network

    Institute of Scientific and Technical Information of China (English)

    孔亚青; 韦素萍; 景建新; 钱科能; 陆舒滢

    2016-01-01

    在竞争激烈的移动互联网时代,以VoLTE为核心的融合通信将不可避免地成为运营商加速转型、应对互联网公司跨界竞争的重要业务形态。现有IMS网络升级改造为VoLTE业务控制核心网过程中,考虑适时引入NFV技术,积极主动应对网络向ICT融合的云架构转型,成为当前运营商发展的主题。结合NFV标准和产业发展情况,分析在现有IMS网络引入NFV的策略,探索IMS网络NFV的演进路线。%In the highly competitive mobile Internet era,converge communication with VoLTE as the core,inevitably become the impor-tant service form which is used by operators to accelerate the transformation,and to deal with cross-border competition in In-ternet company. During the upgrade from the existing IMS core network to VoLTE service control core network,the theme of the current operator development should be the introduction of NFV technology in good time,actively respond to the transfor-mation that IMS network architecture becomes cloud architecture of ICT integration. Based on the standards and industrial de-velopment of NFV,it analyzes the strategy of introducing NFV in existing IMS network,and explores the NFV evolution route of IMS core network.

  5. An adjustable contracted CI method

    Institute of Scientific and Technical Information of China (English)

    王育彬; 甘正汀; 苏克和; 文振翼

    1999-01-01

    A new contracted CI scheme——adjustable contracted CI scheme——is presented and programed. The efficiency of this scheme is tested by some example calculations. The result shows that the application of the new scheme is flexible and the correlation energy loss is lower than that of the original externally contracted CI method.

  6. Introduction to imprecise probabilities

    CERN Document Server

    Augustin, Thomas; de Cooman, Gert; Troffaes, Matthias C M

    2014-01-01

    In recent years, the theory has become widely accepted and has been further developed, but a detailed introduction is needed in order to make the material available and accessible to a wide audience. This will be the first book providing such an introduction, covering core theory and recent developments which can be applied to many application areas. All authors of individual chapters are leading researchers on the specific topics, assuring high quality and up-to-date contents. An Introduction to Imprecise Probabilities provides a comprehensive introduction to imprecise probabilities, includin

  7. Ciência E Capitalismo

    OpenAIRE

    Julia Paula Motta de Souza

    2010-01-01

    Este artigo reflete sobre as relações entre a ciência moderna e o capitalismo. Historicamente a ciência moderna nasce ligada ao capitalismo, pretendendo-se impor como saber hegemônico, livre de valores e baseada em quantificações. Na presente fase neoliberal do capitalismo, na qual se acentua a tendência a transformar tudo em mercadoria, a ciência vem sendo mercantilizada e as condições de trabalho dos pesquisadores vem s...

  8. A teoria das cores de newton: um exemplo do uso da história da ciência em sala de aula Newton’s color theory: an example of the use of the history of science in classroom situations

    Directory of Open Access Journals (Sweden)

    Cibelle Celestino Silva

    2003-01-01

    Full Text Available Neste artigo, discutiremos o trabalho sobre luz e cores de Newton publicado em 1672 para vermos exemplos de questões que podem ser abordadas em sala de aula através da História da Ciência. No entanto, alguns cuidados devem ser tomados para não apresentarmos uma visão distorcida do método científico e uma idéia mítica sobre a Ciência. Este estudo analisa o experimento principal de Newton cuja intenção era mostrar que a luz branca é uma mistura de raios com diferentes refrangibilidades. Embora atualmente essa teoria seja aceita e ensinada sem discussão, um estudo histórico crítico sobre ela levanta muitas questões que serão discutidas neste artigo.This paper analyses some features of Newton's theory of light and colors, especially as presented in his paper of 1672, as an example of the classroom use of History of Science. Although this theory is nowadays accepted and taught without discussion, it is not so simple as it seems and many questions arise from a critical study. Besides, an inadequate use of History of Science in Science Teaching may convey to the students a wrong conception of the scientific method.

  9. Common Core State Standards for Mathematics: Teacher Self-Learning Series. Module 1: Introduction to the Common Core State Standards in Mathematics--The Need, the Development Process, the Common Languages, and the Structure

    Science.gov (United States)

    Louisiana Department of Education, 2013

    2013-01-01

    This module provides background information and presents the new terminology used in the Common Core State Standards for Mathematics (CCSSM). Educators should complete this module to understand the need for common standards, determine information about who developed the Standards, and learn the terminology and the coding used in the CCSSM. An…

  10. VELoCiRaPTORS.

    Science.gov (United States)

    Lundgren, J.; Esham, B.; Padalino, S. J.; Sangster, T. C.; Glebov, V.

    2007-11-01

    The Venting and Exhausting of Low Level Air Contaminants in the Rapid Pneumatic Transport of Radioactive Samples (VELoCiRaPTORS) system is constructed to transport radioactive materials quickly and safely at the NIF. A radioactive sample will be placed inside a carrier that is transported via an airflow system produced by controlled differential pressure. Midway through the transportation process, the carrier will be stopped and vented by a powered exhaust blower which will remove radioactive gases within the transport carrier. A Geiger counter will monitor the activity of the exhaust gas to ensure that it is below acceptable levels. If the radiation level is sufficient, the carrier will pass through the remainder of the system, pneumatically braking at the counting station. The complete design will run manually or automatically with control software. Tests were performed using an inactive carrier to determine possible transportation problems. The system underwent many consecutive trials without failure. VELoCiRaPTORS is a prototype of a system that could be installed at both the Laboratory for Laser Energetics at the University of Rochester and the National Ignition Facility at LLNL.

  11. Main: 2CI2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 2CI2 大麦 Barley Hordeum vulgare l. Subtilisin-Chymotrypsin Inhibitor-2a Hordeum Vulg...DB; 1YPC; X-ray; I=20-83.|PDB; 2CI2; X-ray; I=1-83.|PDB; 2SNI; X-ray; I=1-83.|PDB; 3CI2...ecular weight: 9250 Da SSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQVPRVG barley_2CI2.jpg ...

  12. Main: 3CI2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3CI2 大麦 Barley Hordeum vulgare l. Subtilisin-Chymotrypsin Inhibitor-2a Hordeum Vulg...ray; I=20-83.|PDB; 1YPC; X-ray; I=20-83.|PDB; 2CI2; X-ray; I=1-83.|PDB; 2SNI; X-ray; I=1-83.|PDB; 3CI2; NMR;... Length: 83 AA, Molecular weight: 9250 Da SSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQVPRVG barley_3CI2.jpg ...

  13. The core projects of International Biodiversity Observation Year (IBOY): introduction and suggestions%“国际生物多样性观察年(IBOY)”核心项目 ——内容介绍及建议

    Institute of Scientific and Technical Information of China (English)

    赵士洞; 任毅

    2001-01-01

    The core projects of the International Biodiversity Observation Year (IBOY) are introduced in the present paper. These projects address the following questions: 1) What biodiversity do we have and where is it? 2) How is biodiversity changing? 3) What goods and services does biodiversity provide? 4) How can we conserve biodiversity? Based on the introductions, the authors put forward some suggestions for development of biodiversity science in China.%生物多样性观察年(IBOY)的核心项目包括4个大的主题:1)全球生物多样性现状;2)生物多样性的变化方式;3)生物多样性对人类生活的价值;4)人类如何保护生物多样性。本文对这些主题内的不同课题进行了介绍,同时对我国生物多样性科学的发展提出了相应的建议。

  14. Introduction Introduzione

    Directory of Open Access Journals (Sweden)

    Gian Maria Varanini

    2007-12-01

    Full Text Available Introduction to City under siege (Italy, 13th-15th, ed. by Donata Degrassi and Gian Maria VaraniniIntroduzione a Città sotto assedio (Italia, secoli XIII-XV,

    a cura di Donata Degrassi e Gian Maria Varanini

  15. Presentation (Introduction)

    Science.gov (United States)

    Authier, Jacqueline; Meunier, Andre

    1977-01-01

    An introduction to this issue of "Langue Francaise," which is devoted to a study of the crisis in grammar instruction in French where French is the native language. The issue deals with grammar exercises from linguistic, psycholinguistic and pedagogical points of view. (Text is in French.) (AMH)

  16. Editorial introduction

    DEFF Research Database (Denmark)

    Hviid, Karen Pernille

    2008-01-01

    This editorial introduction frames the special issue by highlighting its choices: examining transitions in the educational process, so as to highlight common features of many educational phenomena, often considered separately; and conceptualise transitions as time-embedded processes. Such theoret......This editorial introduction frames the special issue by highlighting its choices: examining transitions in the educational process, so as to highlight common features of many educational phenomena, often considered separately; and conceptualise transitions as time-embedded processes....... Such theoretical choices raise methodological questions. among which, that of preserving the dynamics of education. Three main methodological options for doing so are considered: time construction (verbal or graphic); real-time data gathering; and focus on the individual-social articulation. Each of the papers...

  17. Introduction pages

    OpenAIRE

    2015-01-01

    Introduction Pages and Table of Contents Research ArticlesInsulin Requirements in Relation to Insulin Pump Indications in Type 1 DiabetesPDFGabriela GHIMPEŢEANU, Silvia Ş. IANCU, Gabriela ROMAN, Anca M. ALIONESCU259-263Comparative Antibacterial Efficacy of Vitellaria paradoxa (Shea Butter Tree) Extracts Against Some Clinical Bacterial IsolatesPDFKamoldeen Abiodun AJIJOLAKEWU, Fola Jose AWARUN264-268A Murine Effort Model for Studying the Influence of Trichinella on Muscular Activity of MicePDF...

  18. É o marketing uma ciência

    OpenAIRE

    Bulcão, Maria Cristina Correa

    1982-01-01

    Trata da controvérsia "é o Marketing uma Ciência?" apontando, como possibilidade para o desenvolvimento de uma Ciência de Marketing, uma abordagem do Marketing como Instituição Social, implicando, entre outras coisas, na transferência de seu objeto central de estudo da transação para o mercado.

  19. Introduction to grid computing

    CERN Document Server

    Magoules, Frederic; Tan, Kiat-An; Kumar, Abhinit

    2009-01-01

    A Thorough Overview of the Next Generation in ComputingPoised to follow in the footsteps of the Internet, grid computing is on the verge of becoming more robust and accessible to the public in the near future. Focusing on this novel, yet already powerful, technology, Introduction to Grid Computing explores state-of-the-art grid projects, core grid technologies, and applications of the grid.After comparing the grid with other distributed systems, the book covers two important aspects of a grid system: scheduling of jobs and resource discovery and monitoring in grid. It then discusses existing a

  20. Nietzsche e a Gaia ciência

    Directory of Open Access Journals (Sweden)

    Rodrigo de Souza Dantas Mendonça Pinto

    2007-12-01

    Full Text Available Este breve ensaio é uma interpretação da epígrafe escolhida por Nietzsche para seu livro gaia ciência.Através dela se pretende demonstrar em que medida a noção de 'gaia ciência', erigida a partir da compreensão do mundo como fenômeno essencialmente poético,nos leva a uma reflexão sobre o sentido e a articulação fundamental entre arte, sabedoria,conhecimento,ciêcia, filosofia,ética e educação. 

  1. Language Practices in the Ci-Classroom

    DEFF Research Database (Denmark)

    Mourtou, Eleni

    2014-01-01

    Prelingually deafened children are nowadays likely to receive a cochlear implant (ci). As these children do their language acquisition with a cochlear implant they require a constant rehabilitation and support. Educational staff is instructed on how to work with children with ci in form...... during the storytelling activity: repeat requests and questions. Whereas repeat requests are used in ci-therapy, questions have been shown to be instrumentalized for educational purposes in the setting of a school. I will reveal the educational/rehabilitational issues that are linked to these practices....

  2. Introduction to the ITIL service lifecycle

    CERN Document Server

    , AXELOS

    2012-01-01

    Introduction to the ITIL Service Lifecycle' introduces IT service management and ITIL. It summarises the best practices described in the 2011 editions' core guidance, explaining the basic concepts of ITIL and providing information on each stage of the service lifecycle.

  3. An Introduction to Binary Decision Diagrams

    DEFF Research Database (Denmark)

    Andersen, Henrik Reif

    1996-01-01

    This note is a short introduction to Binary Decision Diagrams (BDDs). It provides some background knowledge and describes the core algorithms. It is used in the course "C4340 Advanced Algorithms" at the Technical University of Denmark, autumn 1996.......This note is a short introduction to Binary Decision Diagrams (BDDs). It provides some background knowledge and describes the core algorithms. It is used in the course "C4340 Advanced Algorithms" at the Technical University of Denmark, autumn 1996....

  4. Observations and modelling of CO and [CI] in disks. First detections of [CI] and constraints on the carbon abundance

    CERN Document Server

    Kama, M; Carney, M; Hogerheijde, M; van Dishoeck, E F; Fedele, D; Baryshev, A; Boland, W; Güsten, R; Aikutalp, A; Choi, Y; Endo, A; Frieswijk, W; Karska, A; Klaassen, P; Koumpia, E; Kristensen, L; Leurini, S; Nagy, Z; Beaupuits, J -P Perez; Risacher, C; van der Marel, N; van Kempen, T A; van Weeren, R J; Wyrowski, F; Yıldız, U A

    2016-01-01

    The gas-solid budget of carbon in protoplanetary disks is related to the composition of the cores and atmospheres of the planets forming in them. The key gas-phase carbon carriers CO, C$^{0}$ and C$^{+}$ can now be observed in disks. The gas-phase carbon abundance in disks has not yet been well characterized, we aim to obtain new constraints on the [C]/[H] ratio in a sample of disks, and to get an overview of the strength of [CI] and warm CO emission. We carried out a survey of the CO$\\,6$--$5$ and [CI]$\\,1$--$0$ and $2$--$1$ lines towards $37$ disks with APEX, and supplemented it with [CII] data from the literature. The data are interpreted using a grid of models produced with the DALI code. We also investigate how well the gas-phase carbon abundance can be determined in light of parameter uncertainties. The CO$\\,6$--$5$ line is detected in $13$ out of $33$ sources, the [CI]$\\,1$--$0$ in $6$ out of $12$, and the [CI]$\\,2$--$1$ in $1$ out of $33$. With deep integrations, the first unambiguous detections of [C...

  5. ANALIZA NIEZAWODNOŚCI STACJI UZDATNIANIA WODY

    Directory of Open Access Journals (Sweden)

    Barbara TCHÓRZEWSKA-CIEŚLAK

    Full Text Available Systemy zbiorowego zaopatrzenia w wodę składają się z połączonych ze sobą elementów (podsystemów stanowiących integralna całość, współpracujących ze sobą w sposób ciągły w celu zapewnienia dla konsumentów wody o odpowiedniej jakości. W przypadku gdy jakość wody w źródle nie odpowiada normatywom stawianym wodzie przeznaczonej do spożycia przez ludzi, woda musi być poddana procesom uzdatniania. Niezawodność funkcjonowania stacji uzdatniania wody jest jednym z podstawowych elementów szeroko rozumianej analizy niezawodności i bezpieczeństwa całego systemu zbiorowego zaopatrzenia w wodę. Niezawodność dostawy wody polega na zapewnieniu stabilnych warunków, umożliwiających pokrycie bieżącego i perspektywicznego zapotrzebowania na wodę w odpowiedniej ilości i wymaganej jakości w dowolnym, dogodnym dla konsumentów wody czasie. W pracy przedstawiono podstawy analizy niezawodności, podano podstawowe miary oraz zasady wykorzystania struktur niezawodnościowych. Obliczenia wykonano dla stacji uzdatniania wody na podstawie schematu niezwodnościowego metodą jednoparametryczną. Na podstawie danych z eksploatacyjnych stacji uzdatniania wody (SUW wchodzącej w skład systemu zbiorowego zaopatrzenia w wodę miasta liczącego ok 80 tys. mieszkańców sporządzono schemat niewodności stacji oraz przeprowadzono obliczenia wskaźnika gotowości K. W metodzie wykorzystano podstawowe struktury niezawodnościowe. Wyznaczoną miarę niezawodności porównano z wartościami kryterialnymi.

  6. Aerobiologia: uma ciência para quem ?

    OpenAIRE

    Fabião, António; Fabião, André

    2006-01-01

    A aerobiologia pode ser definida como a ciência que estuda o material biológico e os organismos que se encontram na atmosfera, incluindo a sua libertação para a mesma, bem como a sua dispersão e transporte, deposição ou outra forma de remoção da atmos fera, e os seus impactes na vida vegetal, animal e humana. Trata-se de uma ciência interdisciplinar, com ligações a variadas áreas do conhecimento, incluindo a botânica, a ecologia, a meteorologia, a agricultura, a silvicultura e a alergologia c...

  7. Aerobiologia: uma ciência para quem ?

    OpenAIRE

    Fabião, António; Fabião, André

    2006-01-01

    A aerobiologia pode ser definida como a ciência que estuda o material biológico e os organismos que se encontram na atmosfera, incluindo a sua libertação para a mesma, bem como a sua dispersão e transporte, deposição ou outra forma de remoção da atmos fera, e os seus impactes na vida vegetal, animal e humana. Trata-se de uma ciência interdisciplinar, com ligações a variadas áreas do conhecimento, incluindo a botânica, a ecologia, a meteorologia, a agricultura, a silvicultura e a alergologia c...

  8. Language Practices in the Ci-Classroom

    DEFF Research Database (Denmark)

    Mourtou, Eleni

    2014-01-01

    Prelingually deafened children are nowadays likely to receive a cochlear implant (ci). As these children do their language acquisition with a cochlear implant they require a constant rehabilitation and support. Educational staff is instructed on how to work with children with ci in form...... of guidelines and workshops. This paper discusses language practices used in the setting of a school for cochlear-implanted children. These children encounter language and pronunciation problems that accompany prelingual deafness and hearing with a cochlear implant. I examine two practices, which are used...

  9. Modelling [CI] emission from turbulent molecular clouds

    CERN Document Server

    Glover, Simon C O; Micic, Milica; Molina, Faviola

    2014-01-01

    We use detailed numerical simulations of the coupled chemical, thermal and dynamical evolution of the gas in a turbulent molecular cloud to study the usefulness of the [CI] 609 micron and 370 micron fine structure emission lines as tracers of cloud structure. Emission from these lines is observed throughout molecular clouds, and yet the question of what we can learn from them about the physics of the clouds remains largely unexplored. We show that the fact that [CI] emission is widespread within molecular clouds is a simple consequence of the fact that the clouds are dominated by turbulent motions. Turbulence creates large density inhomogeneities, allowing radiation to penetrate deeply into the clouds. As a result, [CI] emitting gas is found throughout the cloud, rather than being concentrated at the edges. We examine how well we can use [CI] emission to trace the structure of the cloud, and show that the integrated intensity of the 609 micron line traces column density accurately over a wide range of visual ...

  10. Etyka (w) codzienności wychowania – od nieuchronności do możliwości

    OpenAIRE

    Walczak, Anna

    2016-01-01

    Codzienność wychowania jako skrzyżowanie światów życia pedagoga i wychowanka, będąca wieloznaczną i zróżnicowaną, zmienną, bo tworzącą się, racjonalną i nieracjonalną et cetera, nie pozwala na „przycięcie” w rozmiarze uniwersalnym zasad i przewidywanych efektów etycznego działania. Jest placem gry między nieuchronnością i możliwością etycznego działania pedagogicznego. Tym samym w artykule została podważona zasadność tworzenia kodeksu etycznego jako „dokumentu” uprawomocniające...

  11. Introduction to cosmology

    CERN Document Server

    Ryden, Barbara

    2002-01-01

    Introduction to Cosmology provides a rare combination of a solid foundation of the core physical concepts of cosmology and the most recent astronomical observations. The book is designed for advanced undergraduates or beginning graduate students and assumes no prior knowledge of general relativity. An emphasis is placed on developing the readers' physical insight rather than losing them with complex math. An approachable writing style and wealth of fresh and imaginative analogies from "everyday" physics are used to make the concepts of cosmology more accessible. The book is unique in that it not only includes recent major developments in cosmology, like the cosmological constant and accelerating universe, but also anticipates key developments expected in the next few years, such as detailed results on the cosmic microwave background.

  12.  Spis treści

    Directory of Open Access Journals (Sweden)

    Mieczysław Dobija

    2014-04-01

    Full Text Available  Od Zespołu Redakcyjnego ............................................................................... 5 Mieczysław Dobija – Rachunkowość w systemie pomiaru aktywności ekonomicznej państwa – Accounting as part of an economic activity measurement system ............... 7 Renata Dyląg, Ewelina Puchalska – Raportowanie zagadnień środowiskowych i społecznych – Reporting on social and environmental issues .............................................. 23 Jacek Gad – Sprawozdanie z wyniku całościowego jako źródło informacji na temat kapitałowych przychodów i kosztów – doświadczenia polskiego i niemieckiego rynku kapitałowego – Statement of comprehensive income as a source of information on capital income and expenses – experience of Polish and German capital markets...... 47 Piotr Luty – Ocena kondycji finansowej łączących się spółek na przykładzie jednostek z wybranych województw Polski Zachodniej – Assessment of financial position of merging companies based on selected provinces of Western Poland ............................................................................ 69 Irena Sobańska – Znaczenie dorobku naukowego Profesor Elżbiety Burzym dla rozwoju nauki i praktyki rachunkowości w Polsce – The importance of Professor Elżbieta Burzym’s contribution to the development of accounting theory, research and practice in Poland ........................ 83 Arleta Szadziewska – Rachunkowość jako źródło informacji na temat realizacji strategii społecznej odpowiedzialności biznesu – Accounting as a source of information for CSR strategy ............................. 95 Halina Waniak-Michalak – Informacja o pracy wolontariuszy w sprawozdaniach organizacji pożytku publicznego w Polsce – Information on volunteer labour in reports of public benefit organizations in Poland ............................................................................................................ 125

  13. Introduction pages

    Directory of Open Access Journals (Sweden)

    Radu E. Sestras

    2015-09-01

    Full Text Available Introduction Pages and Table of Contents Research ArticlesInsulin Requirements in Relation to Insulin Pump Indications in Type 1 DiabetesPDFGabriela GHIMPEŢEANU,\tSilvia Ş. IANCU,\tGabriela ROMAN,\tAnca M. ALIONESCU259-263Comparative Antibacterial Efficacy of Vitellaria paradoxa (Shea Butter Tree Extracts Against Some Clinical Bacterial IsolatesPDFKamoldeen Abiodun AJIJOLAKEWU,\tFola Jose AWARUN264-268A Murine Effort Model for Studying the Influence of Trichinella on Muscular Activity of MicePDFIonut MARIAN,\tCălin Mircea GHERMAN,\tAndrei Daniel MIHALCA269-271Prevalence and Antibiogram of Generic Extended-Spectrum β-Lactam-Resistant Enterobacteria in Healthy PigsPDFIfeoma Chinyere UGWU,\tMadubuike Umunna ANYANWU,\tChidozie Clifford UGWU,\tOgbonna Wilfred UGWUANYI272-280Index of Relative Importance of the Dietary Proportions of Sloth Bear (Melursus ursinus in Semi-Arid RegionPDFTana P. MEWADA281-288Bioaccumulation Potentials of Momordica charantia L. Medicinal Plant Grown in Lead Polluted Soil under Organic Fertilizer AmendmentPDFOjo Michael OSENI,\tOmotola Esther DADA,\tAdekunle Ajayi ADELUSI289-294Induced Chitinase and Chitosanase Activities in Turmeric Plants by Application of β-D-Glucan NanoparticlesPDFSathiyanarayanan ANUSUYA,\tMuthukrishnan SATHIYABAMA295-298Present or Absent? About a Threatened Fern, Asplenium adulterinum Milde, in South-Eastern Carpathians (RomaniaPDFAttila BARTÓK,\tIrina IRIMIA299-307Comparative Root and Stem Anatomy of Four Rare Onobrychis Mill. (Fabaceae Taxa Endemic in TurkeyPDFMehmet TEKİN,\tGülden YILMAZ308-312Propagation of Threatened Nepenthes khasiana: Methods and PrecautionsPDFJibankumar S. KHURAIJAM,\tRup K. ROY313-315Alleviate Seed Ageing Effects in Silybum marianum by Application of Hormone Seed PrimingPDFSeyed Ata SIADAT,\tSeyed Amir MOOSAVI,\tMehran SHARAFIZADEH316-321The Effect of Halopriming and Salicylic Acid on the Germination of Fenugreek (Trigonella foenum-graecum under Different Cadmium

  14. Cognitivismo e ciência cognitiva

    Directory of Open Access Journals (Sweden)

    Marcos Barbosa de Oliveira

    1990-01-01

    Full Text Available O objetivo da comunicação é caracterizar uma escola de pensamento-o cognitivismo-e a disciplina a que ela deu origem. Depois de um breve apanhado das origens do cognitivismo descrevem-se os princípios ontológicos e metodológicos que o definem. Mostra-se a seguir a relação que há entre os computadores e a idéia funcionalista de considerar a mente como um sistema cujos elementos são caracterizados por suas funções, e não por sua constituição material. Discute-se finalmente a natureza e o nome da disciplina gerada pelo cognitivismo, sugerindo-se que se trata de uma proto-ciência, a qual deve ser denominada "Estudos Cognitivos" de preferência a "Ciência Cognitiva".

  15. Model of the Recurrent Nova CI Aql

    Science.gov (United States)

    Lederle, C.; Kimeswenger, S.

    CI Aql was observed with the Innsbruck 60cm telescope in VRIC from June to October 2001. To reproduce the resulting light curves, a geometrical model of the double star system was realized in MATLAB-code. Already existing and rather basic routines were used to implement difficult ray-tracing and rendering tasks. For the geometrical model itself an extended rim of the accretion disk and the illumination of the other components by the white dwarf turned out to be very important.

  16. Para além da ciência: por uma gaia ciência

    OpenAIRE

    Galvão, Túlio Madson de Oliveira

    2012-01-01

    Em A gaia ciência Nietzsche irá abordar a ciência, especificamente a sua finalidade, sob uma perspectiva crítica, apontando a necessidade de um conhecimento científico mais humano e menos mecanicista, uma ciência mais próxima à arte, que ao invés de descobrir verdades, se ocupe em criar novos valores, visões e perspectivas. Ao longo da obra fica evidente a intenção do filósofo em não apenas criticar a ciência, mas também, conceber um novo método, uma nova ciência, uma gaya scienza, em alus...

  17. Para além da ciência: por uma gaia ciência

    OpenAIRE

    Galvão, Túlio Madson de Oliveira

    2012-01-01

    Em A gaia ciência Nietzsche irá abordar a ciência, especificamente a sua finalidade, sob uma perspectiva crítica, apontando a necessidade de um conhecimento científico mais humano e menos mecanicista, uma ciência mais próxima à arte, que ao invés de descobrir verdades, se ocupe em criar novos valores, visões e perspectivas. Ao longo da obra fica evidente a intenção do filósofo em não apenas criticar a ciência, mas também, conceber um novo método, uma nova ciência, uma gaya scienza, em alus...

  18.  Spis treści

    Directory of Open Access Journals (Sweden)

    ANNA BARTOSZEWICZ

    2015-03-01

    Full Text Available  Od Zespołu Redakcyjnego – Editorial .......................................................................................................... 7 Anna Bartoszewicz – Praktyczna realizacja Programu zapewnienia i poprawy jakości w komórkach audytu wewnętrznego na wybranych przykładach – Implementation of Quality Assurance and Improvement Program by internal audit teams on selected examples ................................................................ 9 Anna Białek-Jaworska, Natalia Nehrebecka – Struktura kapitałowa przedsiębiorstw w świetle wyników badań – Capital structure of companies in the light of research results ..................... 29 Magda Chraścina – Determinanty tworzenia rezerw oraz ich skutki bilansowo- -wynikowe na przykładzie spółek notowanych na Giełdzie Papierów Wartościowych w Warszawie – Determinants of creating provisions and their effect on the balance sheet and income statement on the example of companies listed on the Warsaw Stock Exchange .................................................................................................. 53 Małgorzata Garstka – Dobry obyczaj jako norma kształtująca zachowanie księgowych – Good practice as a norm shaping the behavior of accountants ...................... 73 Przemysław Kabalski, Joanna Szwajcar – Feminizacja studiów w zakresie rachunkowości w Polsce – przyczyny i skutki – Feminization of accounting studies in Poland – causes and consequences .. 85 Anna Kasperowicz – Znaki i kody rachunkowości w procesie komunikacji – Accounting signs and codes in the communication process .......................... 107 Marcin Kędzior – Dobrowolne stosowanie MSSF przez spółki giełdowe w wybranych krajach Europy Zachodniej – Voluntary adoption of IFRS by listed companies in selected Western European countries ................................................................................................. 123 Ewelina Zarzycka

  19. Proteomics Core

    Data.gov (United States)

    Federal Laboratory Consortium — Proteomics Core is the central resource for mass spectrometry based proteomics within the NHLBI. The Core staff help collaborators design proteomics experiments in a...

  20. Proteomics Core

    Data.gov (United States)

    Federal Laboratory Consortium — Proteomics Core is the central resource for mass spectrometry based proteomics within the NHLBI. The Core staff help collaborators design proteomics experiments in...

  1. Kuhn e as ciências sociais

    Directory of Open Access Journals (Sweden)

    Jesus de Paula Assis

    1993-12-01

    Full Text Available No texto, são expostos os motivos básicos pelos quais o vocabulário emprestado de Thomas Kuhn - notadamente o termo paradigma - e o modelo de desenvolvimento científico exposto pelo autor em seu A estrutura das revoluções científicas foram tomados de empréstimo em textos que discutem a epistemologia das ciências sociais. A conclusão é que as supostas aplicações do modelo kuhniano às ciências sociais se baseiam em leitura que não encontra qualquer apoio no autor e, principalmente, obscurecem as implicações mais amplas de sua obra.The article shows for what reasons the vocabulary and the model for scientific growth of Thomas Kuhn were borrowed by epistemologists of the social sciences. The conclusion is that the texts produced in this vein are based in a shallow understanding of the author's main implications.

  2. Ascoltando il cuore quando ci parla

    Directory of Open Access Journals (Sweden)

    Maria Grazia Soldati

    2011-04-01

    Full Text Available La scrittura di sé è approccio educativo, di cura, in cui la posta in gioco è la possibilità di attivare parti di sé inespresse, scommette sul desiderio di un divenire, di un modo di essere in cui sia possibile stare nel presente in modo creativo, di pensarlo e trasfigurarlo con narrazioni ed incontri tra persone. Oggi c’è una povertà di relazioni umane, c’è una perdita di linguaggio: accade quindi che le singolarità si spengono. Ma ognuno di noi ha una singolarità parlante, che ha bisogno di essere ascoltata. È un bisogno simbolico prima che psicologico. E questo spiega la necessità di spazi dove la propria storia di vita sia ascoltata, perché nel nostro presente ci sia tanto interesse per il biografico C’è la necessità di pratiche che aiutano a cercare forme di vita che siano più vive e più desiderabili. C’è la necessità di contesti dove sperimentare un percorso che cerchi le parole per dirsi, per cercare un legame soggettivo tra sé e ciò che si dice, si scrive, in un percorso di comunicazione, di auto-conoscenza, di comprensione.

  3. Wycena należności kredytowycha standardy sprawozdawczości finansowej

    Directory of Open Access Journals (Sweden)

    Izabela Emerling

    2009-12-01

    Full Text Available Jednym z najistotniejszych obszarów działalności banków komercyjnych jest działalność kredytowa, której sposób ujęcia w księgach rachunkowych i sprawozdaniach finansowych determinuje obraz sytuacji majątkowej i finansowej odzwierciedlony w sprawozdawczości finansowej banku komercyjnego. Podstawowym celem artykułu jest zbadanie ujęcia w sprawozdaniach finansowych banków komercyjnych różnych form działalności kredytowej i ich metod wyceny. Zastosowanie różnych metod wyceny bilansowej wierzytelności kredytowych wpływa na obraz sytuacji majątkowej i finansowej banku komercyjnego.

  4. Natureza e ciências sociais

    Directory of Open Access Journals (Sweden)

    Gloria Maria Vargas

    2003-12-01

    Full Text Available A construção do sentido do termo natureza abrange diferentes áreas do conhecimento e tem sido objeto de reflexão tanto das ciências naturais quanto sociais. Nos desdobramentos do conhecimento produzido sobre esta temática existem diversas abordagens que, da perspectiva das ciências sociais, podem ser identificadas. O propósito deste artigo é considerar algumas dessas abordagens e relacioná-las com as novas práticas sociais que determinam formas de intervenção inéditas sobre a natureza, e que colocam questões para estas ciências, enquanto produtoras de conhecimento sobre o tema. De igual forma, explicita-se a substituição deste termo pelo de ambiente e, posteriormente, o aparecimento do desenvolvimento sustentável, como parte do cabedal conceitual com que a problemática em torno das relações naturezasociedade é abordada nas ciências sociais.La construcción del sentido del término naturaleza abarca diferentes áreas del conocimiento y ha sido objeto de reflexión tanto de las ciencias naturales como sociales. Los desdoblamientos del conocimiento producido sobre este tema muestran que existen diversos abordajes que pueden ser identificados desde la perspectiva de las ciencias sociales. El objetivo de este artículo es considerar algunos de esos abordajes y relacionarlos con las nuevas prácticas sociales que determinan formas de intervención inéditas sobre la naturaleza y que sugieren cuestionamientos para estas ciencias, como productoras de conocimiento sobre este tema. De igual manera, se explicita la substitución de este término por el de ambiente e, posteriormente, el aparecimiento del término desarrollo sostenible como parte del acervo conceptual con que es abordada la problemática alrededor de las relaciones naturaleza-sociedad en las ciencias sociales.The construction of the term nature involves different areas of knowledge and has been the object of inquiry of both natural and social sciences. The knowledge

  5. Doubly contracted CI method and applications

    Institute of Scientific and Technical Information of China (English)

    WANG; Yubin; HAN; Huixian; ZHAI; Gaohong; SUO; Bin; WEN; Zh

    2004-01-01

    [1]Buenker, R. J., Peyerrimhoff, S. D., Theor. Chim. Acta, 1968, 12:5803.[2]Hanrath, M., Engels, B., New algorithms for an individually selecting MR-CI program, Chem. Phys., 1997, 225: 197-202.[3]Werner, H. -J, Knowles, P. J., An efficient internally contracted multiconfiguration-reference configuration interaction method, J.Chem. Phys., 1988, 89: 5803-5814.[4]Dobbyn, A. J., Knowles, P. J., Harrison, R. J., Parallel internally contracted multireference configuration interaction, J. Comput.Chem., 1998, 19: 1215-1228.[5]Siegbahn, P. S. M., The externally contracted CI method applied to N2, Int. J. Quantum Chem., 1983, 23: 1869-1889.[6]Lee, T. J., Theory for externally contracted configuration interaction energy gradients, J. Chem. Phys., 1987, 87: 2825-2831.[7]Wang Yubin, Gan Zhengting, Su Kehe et al., An adjustable contracted CI method, Science in China, Series B, 1999, 42: 649-655.[8]Wenzel, W., Steiner, M. M., Wilson, K. G., Multireference Basis-Set Reduction, Int. J. Quantum Chemistry, 1996, S30: 113-118.[9]Walter, D., Carter, E. A., Multi-reference weak pairs local configuration interaction: efficient calculations of bond breaking,Chem. Phys. Letters, 2001, 346: 177-185.[10]Wang Yubin, Hong Xingji, Liu Jun, et al., Structures and potential energy surfaces of lithium isocyanide and its isomers, Theochem,1996, 369: 173-182.[11]Bian Wensheng, Werner J, Global ab initio potential energy surface for the ClH2 reactive system, J. Chem. Phys., 2000, 112:220-229.[12]Yang Minghui, Zhang, D. H., Collins, M. A. et al., Ab initio potential-energy surfaces for the reactions OH+H2 ←→H2O+H, J.Chem. Phys., 2001, 115: 174-178.[13]Zhai Gaohong, Wang Yubin, Shi Ting et al., Global many-body potential energy surface of ground state H2O+, Chemical Journal of Chinese Universities, 2003, 24: 2039-2043.[14]Paldus, J., Boyle, M. J., Unitary group approach to the many-electron correlation problem via graphical methods of spin

  6. Filosofia da ciência e ensino da ciência: uma analogia

    Directory of Open Access Journals (Sweden)

    Alberto Villani

    2001-01-01

    Full Text Available Neste trabalho, inicialmente explicitaremos nossa compreensão do debate entre Kuhn, Popper, Lakatos e Feyerabend na Conferencia Internacional sobre Filosofia da Ciência (1965, delineando as diferenças nas posições de nossos filósofos. Em seguida apresentaremos um quadro das posições sobre o ensino de ciências, assim como nos parecem caracterizar os último 30 anos de pesquisas na área. Finalmente tentaremos uma aproximação dos dois campos, procurando salientar as implicações que a problemática filosófica teve e tem para uma maior compreensão do ensino de ciências e matemática.

  7. Formas de autonomia da ciência

    Directory of Open Access Journals (Sweden)

    Marcos Barbosa de Oliveira

    2011-01-01

    Full Text Available Na primeira parte deste ensaio, distinguimos três formas que a autonomia da ciência assume ao longo de sua história: a galileana, a vannevariana e a neoliberal. A galileana foi reivindicada por Galileu em seu conflito com a Igreja Católica. O termo "vannevariana" vem de Vannevar Bush, responsável pelo relatório Science, the endless frontier, que teve um papel fundamental na conformação das práticas científicas no período pós Segunda Guerra. A autonomia vannevariana diz respeito aos rumos da pesquisa científica. A autonomia neoliberal consiste na liberdade de cada cientista procurar financiamento para as pesquisas que deseja realizar em qualquer fonte, pública ou privada, tendo em vista apenas seu auto-interesse (intelectual e/ou econômico. Na segunda parte do ensaio, utilizamos o arcabouço conceitual e histórico proporcionado por essas distinções para discutir a questão: que forma de autonomia deve ser reivindicada pela ciência nos dias de hoje? O procedimento consiste em determinar, para cada uma das três formas, o que deve ser mantido e o que deve ser abandonado. A conclusão a que se chega é a de que a autonomia neoliberal deve ser descartada, a vannevariana restringida, e a galileana preservada.In the first part of this article, three forms that the autonomy of science has assumed in the course of its history are distinguished: the Galilean one, the Vannevarian one, and the neoliberal one. The Galilean form was claimed by Galileo in his conflict with the Catholic Church. The term "Vannevarian" comes from Vannevar Bush, responsible for the report, Science, the endless frontier, which played a crucial role in the configuration of scientific practices in the post World War II period. Vannevarian autonomy has to do with the directions of scientific research. Neoliberal autonomy consists in each scientist's freedom to search for funds for the research he intends to carry out from any source, public or private, in view only

  8. Static Code Analysis with Gitlab-CI

    CERN Document Server

    Datko, Szymon Tomasz

    2016-01-01

    Static Code Analysis is a simple but efficient way to ensure that application’s source code is free from known flaws and security vulnerabilities. Although such analysis tools are often coming with more advanced code editors, there are a lot of people who prefer less complicated environments. The easiest solution would involve education – where to get and how to use the aforementioned tools. However, counting on the manual usage of such tools still does not guarantee their actual usage. On the other hand, reducing the required effort, according to the idea “setup once, use anytime without sweat” seems like a more promising approach. In this paper, the approach to automate code scanning, within the existing CERN’s Gitlab installation, is described. For realization of that project, the Gitlab-CI service (the “CI” stands for "Continuous Integration"), with Docker assistance, was employed to provide a variety of static code analysers for different programming languages. This document covers the gene...

  9. Numerical investigation on the effects of EGR on CI engine characteristics using soyabean biodiesel

    Science.gov (United States)

    Datta, Ambarish; Mandal, Bijan Kumar

    2016-07-01

    In this work an attempt has been made to numerically investigate the effect of soyabean biodiesels on an unmodified CI engine and then to study and reduce the NOx emission by the introduction of exhaust gas recirculation (EGR) technique at the rates of 10% and 20%. Compared to no EGR condition for the neat biodiesel, the NOx emission is reduced by 44% and 70% with 10% and 20% EGR respectively. But the increase in the EGR rate deteriorates the engine performance and increases the emissions, other than NOx. Thus, EGR helps in reducing NOx emission but its rate of introduction has to be bounded by a limit.

  10. Ice cores

    DEFF Research Database (Denmark)

    Svensson, Anders

    2014-01-01

    Ice cores from Antarctica, from Greenland, and from a number of smaller glaciers around the world yield a wealth of information on past climates and environments. Ice cores offer unique records on past temperatures, atmospheric composition (including greenhouse gases), volcanism, solar activity......, dustiness, and biomass burning, among others. In Antarctica, ice cores extend back more than 800,000 years before present (Jouzel et al. 2007), whereas. Greenland ice cores cover the last 130,000 years...

  11. Ice cores

    DEFF Research Database (Denmark)

    Svensson, Anders

    2014-01-01

    Ice cores from Antarctica, from Greenland, and from a number of smaller glaciers around the world yield a wealth of information on past climates and environments. Ice cores offer unique records on past temperatures, atmospheric composition (including greenhouse gases), volcanism, solar activity......, dustiness, and biomass burning, among others. In Antarctica, ice cores extend back more than 800,000 years before present (Jouzel et al. 2007), whereas. Greenland ice cores cover the last 130,000 years...

  12. Introduction to IBS

    Science.gov (United States)

    ... the Day Art of IBS Gallery Contact Us Introduction to IBS Details What is IBS? Last Updated: ... tax-deductible donation. Make Donation What is IBS? Introduction to IBS Symptoms of IBS What Causes IBS? ...

  13. Transformer core

    NARCIS (Netherlands)

    Mehendale, A.; Hagedoorn, Wouter; Lötters, Joost Conrad

    2010-01-01

    A transformer core includes a stack of a plurality of planar core plates of a magnetically permeable material, which plates each consist of a first and a second sub-part that together enclose at least one opening. The sub-parts can be fitted together via contact faces that are located on either side

  14. Transformer core

    NARCIS (Netherlands)

    Mehendale, A.; Hagedoorn, Wouter; Lötters, Joost Conrad

    2008-01-01

    A transformer core includes a stack of a plurality of planar core plates of a magnetically permeable material, which plates each consist of a first and a second sub-part that together enclose at least one opening. The sub-parts can be fitted together via contact faces that are located on either side

  15. Introduction to graph theory

    CERN Document Server

    Trudeau, Richard J

    1994-01-01

    Preface1. Pure Mathematics Introduction; Euclidean Geometry as Pure Mathematics; Games; Why Study Pure Mathematics?; What's Coming; Suggested Reading2. Graphs Introduction; Sets; Paradox; Graphs; Graph diagrams; Cautions; Common Graphs; Discovery; Complements and Subgraphs; Isomorphism; Recognizing Isomorphic Graphs; Semantics The Number of Graphs Having a Given nu; Exercises; Suggested Reading3. Planar Graphs Introduction; UG, K subscript 5, and the Jordan Curve Theorem; Are there More Nonplanar Graphs?; Expansions; Kuratowski's Theorem; Determining Whether a Graph is Planar or

  16. Studies on II-VI and III-V semiconductor nanostructures. Introduction of the core/shell/shell structure and development of CdSe nanocrystals in an automatized procedure; Untersuchungen an II-VI und III-V Halbleiternanostrukturen. Einfuehrung der Core/shell/shell-Struktur und Darstellung von CdSe-Nanokristallen in einem automatisierten Verfahren

    Energy Technology Data Exchange (ETDEWEB)

    Mekis, I.

    2005-11-15

    The work in this dissertation is focused on the development and characterization of fluorescent II-VI and III-V-Nanomaterials. Highly luminescent and photostable Nanocrystals with narrow size distributions were prepared. It was shown that nearly monodisperse CdSe-Nanocrystals could be prepared from Cd(Ac){sub 2} and TOPSe in a mixture of TOPO/TOP/HDA/TDPA. Nearly monodisperse CdSe/CdS-Core/shell-Nanocrystals have been prepared in a one-pot-synthesis by injection of H{sub 2}S-Gas into a freshly prepared crude solution of CdSe. The passivation of the CdSe-core with an inorganic shell of CdS resulted in the drastic improvement of the photoluminescence-efficiency of the colloidal solution. Reproducible room-temperature quantum yields reached up to a value of 85%. Photostability investigations have proved the enhanced stability of CdSe/CdS-Nanocrystals compared to CdSe-Nanocrystals under illumination with UV-Light. A novel type of luminescent semiconductor nanocrystal structure has been developed, consisting of a CdSe core and two anorganic shells. Highly fluorescent and nearly monodisperse CdSe/CdS/ZnS- and CdSe/ZnSe/ZnS-Core/shell/shell-nanocrystals have been prepared via organometallic- and acetate-precursors. The Core/she ll/shell particles reached reproducible room-temperature quantum yields up to 85%. Photostability investigations among CdSe-core, CdSe/CdS-Core/shell- and CdSe/CdS/ZnS- Core/shell/-shell-nanocrystals under illumination with UV-light have proved the highest photostability of the Core/shell/shell-particles. The photostabilities of CdSe/ZnSe/ZnS-and CdSe/ZnS-nanocrystals were compared under illumination with intense laser-beam in air. Another part of this work focused on the development of an automated synthesis procedure of CdSe-nanocrystals by constructing and implementing a flow-reactor system. The size and structure of prepared nanocrystals depended considerably on the Cd:Se-precursorratio and the flow-rate. The preparation of CdSe using Cd(Ac)2

  17. Volume 1 - Introduction

    Science.gov (United States)

    An introduction to the Emissions Inventory Improvement Program (EIIP) materials. Describes EIIP development, use of EIIP, inventory staff training, and planning, development, documentation, and reporting of inventories.

  18. Introduction to Part 3

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2015-01-01

    A brief contextualising discussion of Western Music History and its relations to Theological Aesthetical Thought since Carolingian Times as an introduction to 3 music articles in Part 3 of the volume.......A brief contextualising discussion of Western Music History and its relations to Theological Aesthetical Thought since Carolingian Times as an introduction to 3 music articles in Part 3 of the volume....

  19. Introduction to surveillance studies

    CERN Document Server

    Petersen, JK

    2012-01-01

    Introduction & OverviewIntroduction Brief History of Surveillance Technologies & TechniquesOptical SurveillanceAerial Surveillance Audio Surveillance Radio-Wave SurveillanceGlobal Positioning Systems Sensors Computers & the Internet Data Cards Biochemical Surveillance Animal Surveillance Biometrics Genetics Practical ConsiderationsPrevalence of Surveillance Effectiveness of Surveillance Freedom & Privacy IssuesConstitutional Freedoms Privacy Safeguards & Intrusions ResourcesReferences Glossary Index

  20. Ice Cores

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Records of past temperature, precipitation, atmospheric trace gases, and other aspects of climate and environment derived from ice cores drilled on glaciers and ice...

  1. Core BPEL

    DEFF Research Database (Denmark)

    Hallwyl, Tim; Højsgaard, Espen

    extensions. Combined with the fact that the language definition does not provide a formal semantics, it is an arduous task to work formally with the language (e.g. to give an implementation). In this paper we identify a core subset of the language, called Core BPEL, which has fewer and simpler constructs......, does not allow omissions, and does not contain ignorable elements. We do so by identifying syntactic sugar, including default values, and ignorable elements in WS-BPEL. The analysis results in a translation from the full language to the core subset. Thus, we reduce the effort needed for working...... formally with WS-BPEL, as one, without loss of generality, need only consider the much simpler Core BPEL. This report may also be viewed as an addendum to the WS-BPEL standard specification, which clarifies the WS-BPEL syntax and presents the essential elements of the language in a more concise way...

  2. Core BPEL

    DEFF Research Database (Denmark)

    Hallwyl, Tim; Højsgaard, Espen

    extensions. Combined with the fact that the language definition does not provide a formal semantics, it is an arduous task to work formally with the language (e.g. to give an implementation). In this paper we identify a core subset of the language, called Core BPEL, which has fewer and simpler constructs......, does not allow omissions, and does not contain ignorable elements. We do so by identifying syntactic sugar, including default values, and ignorable elements in WS-BPEL. The analysis results in a translation from the full language to the core subset. Thus, we reduce the effort needed for working...... formally with WS-BPEL, as one, without loss of generality, need only consider the much simpler Core BPEL. This report may also be viewed as an addendum to the WS-BPEL standard specification, which clarifies the WS-BPEL syntax and presents the essential elements of the language in a more concise way...

  3. Core benefits

    National Research Council Canada - National Science Library

    Keith, Brian W

    2010-01-01

    This SPEC Kit explores the core employment benefits of retirement, and life, health, and other insurance -benefits that are typically decided by the parent institution and often have significant governmental regulation...

  4. Wrap it in rap! - Music Making with Adolescent CI Users

    DEFF Research Database (Denmark)

    Petersen, Bjørn; Sørensen, Stine Derdau; Pedersen, Ellen Raben

    2015-01-01

    participated in a short intensive training program involving group-based music making activities (e.g. rapping and singing) and self-administered computer based listening exercises. Testing of music and speech discrimination was carried out before and after the program for the CI users and in two sessions......The purpose of this study was to examine 1) the potential effects of an intensive musical ear training program on the perception of music and speech in prelingually hearing impaired adolescent cochlear implant (CI) users and 2) these adolescents’ music engagement. Eleven adolescent CI users...... participants significantly outperformed the CI users in all music and speech discrimination tests except melodic contour. Despite their poor music discrimination abilities, the CI users reported levels of music engagement and enjoyment that were comparable to the NH group. The CI participants showed high...

  5. Nowe zasady działalności firm audytorskich

    Directory of Open Access Journals (Sweden)

    Kazimierz Sawicki

    2009-03-01

    Full Text Available W artykule przedstawiono zmiany, stanowiące implementację Dyrektywy 2006/43/WE Unii Europejskiej w części dotyczącej funkcjonowania firm audytorskich w Polsce. Zgłoszono uwagi popierające nowe rozwiązania, jak też zawierające wątpliwości dotyczące skuteczności ich stosowania w praktyce.

  6. CI og det døvblinde barn

    DEFF Research Database (Denmark)

    Dammeyer, Jesper Herup

    2005-01-01

    I den følgende artikel præsenterer jeg en diskussion af temaer omkring CI til døve og døvblinde børn og et treårigt psykologisk forskningsprojekt omkring CI.......I den følgende artikel præsenterer jeg en diskussion af temaer omkring CI til døve og døvblinde børn og et treårigt psykologisk forskningsprojekt omkring CI....

  7. Do estilo em ciência e em história das ciências

    Directory of Open Access Journals (Sweden)

    Michel Paty

    2012-08-01

    Full Text Available Ao considerar o conhecimento científico como uma forma de pensamento simbólico, entende-se com isso não simples sistemas de signos, mas conteúdos de pensamento (expressos por conceitos ligados entre si e que fazem sentido, que são, no espaço das representações mentais, os substitutos do "dado objetivo" que se supõe subjazer à experiência que fazemos do "mundo" pelos sentidos e, nesse nível indissociavelmente, pelo entendimento. Esse pensamento simbólico adquire densidade e consistência pela "tecelagem" realizada graças ao trabalho dos pensamentos individuais que se comunicam, social e culturalmente, inscritos no tempo da história. Da tensão dinâmica entre o sujeito do conhecimento, que busca a inteligibilidade (pela operação de sua razão, e a objetividade dos conteúdos que ele se propõe (inicialmente dados, depois modificados ou produzidos, resulta o movimento do pensamento científico e a transformação dos conhecimentos. Esse trabalho do pensamento simbólico é marcado por um estilo próprio a cada um, mas que em parte pode ser comum em contextos, escolas ou tradições. Em ciência e em história das ciências, o estilo intervém em dois níveis: o da abordagem "objetal" da produção das obras pelos cientistas e o da abordagem "reflexiva" da história epistemológica e da filosofia, que se interrogam sobre a significação tanto dos próprios conteúdos de conhecimento quanto do pensamento racional, simbólico, cuja função é manifestá-los.By considering scientific knowledge as a form of symbolic thought, we do not mean by the latter simply systems of signs, but thought contents (expressed by concepts related between them and providing meaning ; they are, in the space of mental representations, the substitutes of the «objectively given» that one supposes to underly the experience of the «world» done through the senses and the understanding, both being indissociable at this level. This symbolic thought gets

  8. Introduction to renewable energy

    CERN Document Server

    Nelson, Vaughn C

    2011-01-01

    IntroductionEnergy and SocietyTypes of EnergyRenewable EnergyAdvantages/DisadvantagesEconomicsGlobal WarmingOrder of Magnitude EstimatesGrowth (Exponential)SolutionsEnergyIntroductionDefinition of Energy and PowerHeatThermodynamicsEnergy Dilemma in Light of the Laws of ThermodynamicsUse of Fossil FuelsNuclearFinite ResourceSummarySunSolar PowerElectromagnetic SpectrumEnergy Balance of the EarthEarth-Sun MotionInsolationSolar ResourceGreenhouse EffectHeat Transfer and StorageIntroductionConductionConvectionRadiationThermal MassSeasonal Heating or CoolingThermal ComfortSolar Heating and CoolingB

  9. Introduction to Pathogenic Protozoa

    Science.gov (United States)

    2011-06-01

    1 1 Introduction Mary K. Klassen-Fischer and Ronald C. Neafie Introduction Protozoa Protozoa are single-celled eukaryotic animals first dis...phylogeny of protozoa , see Table 1.1. A recent trend is to replace the term “ protozoa ” with “protista.” For these topics we retain “pro- tozoa” and...JUN 2011 2. REPORT TYPE 3. DATES COVERED 00-00-2011 to 00-00-2011 4. TITLE AND SUBTITLE Introduction to Pathogenic Protozoa 5a. CONTRACT

  10. On {P2,Ci| i≥3 -covered Graphs%关于{P2, Ci| i≥3}-覆盖图

    Institute of Scientific and Technical Information of China (English)

    马润年

    2000-01-01

    Let G be a graph. If each edge of G belongs to a P2,Ci | i≥3 -factor, then graph G is called P2, Ci | i≥3-covered graph. In this paper, it is proved that a connected nonbipartitegraph G is a P2, Ci | i≥3 -covered graph if and only if i(G-S) |S|-1 for all S V(G), = S = V(G).%设G是一个图,若对于G的任意一边G都有P2, Ci | i≥3 -因子含有这条边,则称G是 P2, Ci| i≥3 -覆盖图.本文给出连通非二分图G是P2, Ci | i≥3 -覆盖图的充要条件为任给S V(G), V(G) = S = 有 i (G-S) |S|-1成立.

  11. 指向课程核心技能训练的文科实验性教学设计研究*--以《公共政策概论》为例%On the Design of Experimental Teaching of Liberal Arts for Curriculum-oriented Core Skills Training---A Case Study of the Introduction to Public Policy

    Institute of Scientific and Technical Information of China (English)

    闻待

    2015-01-01

    实验性教学是当今大学教学改革的一个重要内容。对于大学文科教学来说,实验性教学通过提供一种低成本、无风险的模拟情境,沟通了基础理论与核心技能,使得内隐知识显性化,提高了学生学习的兴趣,有助于学生认识复杂社会、提升问题解决能力。本文以文科类课程为例,探讨了文科实验性教学设计如何指向课程核心技能的训练,并以《公共政策概论》课程为例探讨了实验性教学的具体设计。%Experimental teaching is an important content in the current teaching reform of college education .For the teaching of liberal arts in college ,experimental teaching links up the basic theory and core skills by providing stimulant situation of low cost and no risks ,making implicit knowledge become explicit ,improving students’ interest ,helping students to understand the complex society and enhancing the ability to solve problems .In this paper ,the author takes a curriculum of the liberal arts as an example ,discussing how experimental teaching design of liberal arts orients to the training of curriculum core skills ,and takes the course of Introduction to Public Policy as an example to dis‐cuss the detailed design of experimental teaching .

  12. Role of apolipoprotein CI in lipid metabolism and bacterial sepsis

    NARCIS (Netherlands)

    Berbée, Jimmy Fransiscus Paulus

    2007-01-01

    The research described in this thesis focussed on the role of apolipoproteins in lipid metabolism, inflammation and bacterial sepsis, with specific emphasis on apoCI. From studies in human APOC1¬-transgenic and apoc1-/- mice, we were able to identify apoCI as a potent inhibitor of triglyceride hydro

  13. Introduction: Invertebrate Neuropeptides XIV

    Science.gov (United States)

    This publication represents an introduction to the thirteenth in a series of special issues of the Peptides journal dedicated to invertebrate neuropeptides. The issue addresses a number of aspects of invertebrate neuropeptide research including identification of novel invertebrate neuropeptide sequ...

  14. Introduction: Invertebrate Neuropeptides XV

    Science.gov (United States)

    This publication represents an introduction to the fifteenth in a series of special issues of the Peptides journal dedicated to invertebrate neuropeptides. The issue addresses a number of aspects of invertebrate neuropeptide research including identification of novel invertebrate neuropeptide seque...

  15. Introduction: Invertebrate Neuropeptides XIII

    Science.gov (United States)

    This publication represents an introduction to the thirteenth in a series of special issues of the Peptides journal dedicated to invertebrate neuropeptides. The issue addresses a number of aspects of invertebrate neuropeptide research including identification of novel invertebrate neuropeptide sequ...

  16. Introduction to graph theory

    CERN Document Server

    Wilson, Robin J

    1985-01-01

    Graph Theory has recently emerged as a subject in its own right, as well as being an important mathematical tool in such diverse subjects as operational research, chemistry, sociology and genetics. This book provides a comprehensive introduction to the subject.

  17. Introduction: Invertebrate Neuropeptides XVI

    Science.gov (United States)

    This publication represents an introduction to the sixteenth in a series of special issues of the Peptides journal dedicated to invertebrate neuropeptides. The issue addresses a number of aspects of invertebrate neuropeptide research including identification of novel invertebrate neuropeptide seque...

  18. TENCompetence: an introduction

    NARCIS (Netherlands)

    Koper, Rob

    2006-01-01

    Koper, E. J. R. (2006). TENCompetence: an introduction. Presentation at TENCompetence Open Meeting. March, 30-31, 2006, Sofia, Bulgaria. Retrieved June 30th, 2006, from http://dspace.learningnetworks.org

  19. Introduction to commutative algebra

    CERN Document Server

    Atiyah, Michael

    1994-01-01

    This book grew out of a course of lectures given to third year undergraduates at Oxford University and it has the modest aim of producing a rapid introduction to the subject. It is designed to be read

  20. Introduction: perspectives on Porter

    NARCIS (Netherlands)

    F.A.J. van den Bosch (Frans)

    1997-01-01

    textabstractIntroduction. Relevance of Strategy research: focus on Michael Porter's contributions Strategy is a fascinating field of enquiry, both for managers looking for a sustainable competitive advantage and for academic researchers looking for the reasons behind superior firm performance.

  1. Introduction to numerical analysis

    CERN Document Server

    Hildebrand, F B

    1987-01-01

    Well-known, respected introduction, updated to integrate concepts and procedures associated with computers. Computation, approximation, interpolation, numerical differentiation and integration, smoothing of data, other topics in lucid presentation. Includes 150 additional problems in this edition. Bibliography.

  2. MOOC Introduction to Dutch

    NARCIS (Netherlands)

    den Hollander, Franciscus; Piersma, Kristien

    2015-01-01

    Interview met Margriet Hidding, Birgit Lijmbach en Jeroen van Engen, medewerkers van het Talencentrum en de makers van de Massive Open Online Course (MOOC) Introduction to Dutch over het grote succes van deze cursus

  3. Ciência das Redes: Aspectos Epistemológicos

    OpenAIRE

    Cavalcante, Gustavo Vaconcelos

    2011-01-01

    Na época da escrita deste documento observa-se o alvorecer de uma nova ciência - A “Ciência das Redes”. Esta ciência, que por sua própria natureza já nasce com característica transdisciplinar, vem procurar buscar respostas aos desafios do novo milênio. A Ciência das Redes encontra-se ainda em sua infância e necessita demonstrar a sua robustez como ciência e para isso a busca de seus fundamentos epistemológicos é condição fundamental. O objetivo central deste trabalho é o de buscar bases epis...

  4. Introduction to remote sensing

    CERN Document Server

    Cracknell, Arthur P

    2007-01-01

    Addressing the need for updated information in remote sensing, Introduction to Remote Sensing, Second Edition provides a full and authoritative introduction for scientists who need to know the scope, potential, and limitations in the field. The authors discuss the physical principles of common remote sensing systems and examine the processing, interpretation, and applications of data. This new edition features updated and expanded material, including greater coverage of applications from across earth, environmental, atmospheric, and oceanographic sciences. Illustrated with remotely sensed colo

  5. Stochastic processes an introduction

    CERN Document Server

    Jones, Peter Watts

    2009-01-01

    Some Background on ProbabilityIntroduction Probability Conditional probability and independence Discrete random variables Continuous random variables Mean and variance Some standard discrete probability distributions Some standard continuous probability distributions Generating functions Conditional expectationSome Gambling ProblemsGambler's ruin Probability of ruin Some numerical simulations Duration of the game Some variations of gambler's ruinRandom WalksIntroduction Unrestricted random walks The probability distribution after n steps First returns of the symmetric random walkMarkov ChainsS

  6. Introduction to probability

    CERN Document Server

    Roussas, George G

    2006-01-01

    Roussas's Introduction to Probability features exceptionally clear explanations of the mathematics of probability theory and explores its diverse applications through numerous interesting and motivational examples. It provides a thorough introduction to the subject for professionals and advanced students taking their first course in probability. The content is based on the introductory chapters of Roussas's book, An Intoduction to Probability and Statistical Inference, with additional chapters and revisions. Written by a well-respected author known for great exposition an

  7. General introduction to glucosinolates

    DEFF Research Database (Denmark)

    Halkier, Barbara Ann

    2016-01-01

    will be presented a general introduction to glucosinolates ranging from the evolution of glucosinolates to the many roles glucosinolates have for humans as well as an overview of the current knowledge on the orchestration of the glucosinolate biosynthetic pathway. The latter includes an introduction to the genes...... to the plasma membrane. Examples of how the knowledge gained from basic research has been translated into applied glucosinolate research through pathway and transport engineering will be presented....

  8. Plasma physics an introduction

    CERN Document Server

    Fitzpatrick, Richard

    2014-01-01

    Plasma Physics: An Introduction is based on a series of university course lectures by a leading name in the field, and thoroughly covers the physics of the fourth state of matter. This book looks at non-relativistic, fully ionized, nondegenerate, quasi-neutral, and weakly coupled plasma. Intended for the student market, the text provides a concise and cohesive introduction to plasma physics theory, and offers a solid foundation for students wishing to take higher level courses in plasma physics.

  9. Teoria wielości rzeczywistości Leona Chwistka. Rys krytyczny

    Directory of Open Access Journals (Sweden)

    Hubert Bożek

    2014-12-01

    Full Text Available The purpose of this paper is to offer a logico‑philosophical critical overview of the theory of multiple realities (TWR. The paper is divided into three sections. In the first section I present a brief history of the development of some ideas, which combined together form the conceptual framework of the theory in question, whose main thesis is that there is more than one reality. In the second part I present (and try to address some interpretations of TWR, which can be described as: ontological; epistemological; esthetical; logical ad mixed interpretations. When doing so, a special emphasis is laid on the presentation of an explication of TWR based on theory of models, an explication authored by Teresa Kostyrko. This explication rests on a conditional recognition of the particular ‘realities’ of Chwistek’s theory as proper models (i.e. those, which fulfill the condition of the identity of meaning of theory’s fundamental notions of the theories of reality, with the provision that such models are indeed constructible. In the last section of my paper I propose a preliminary appraisal of the TWR as well as a way to reengineer this theory in order to avoid some of its difficulties. By appealing to Kostyrko’s idea on one hand and the spirit Quinean ontological relativism on the other, I wish to argue as follows: (1 ‘reality’ is the name of the set comprising all meanings of the term ‘reality’; (2 under particular conditions these meanings can be arranged in a theory, which possesses a proper model (scientific discourse, some forms of the common talk; (3 model proper designate by definition classes of objects, which we regard as existent on the grounds of a given theory. The above set of theses forms the core of a concept, which I propose to call the ‘manifold reality’ in order to differentiate it from TWR, the development of which theory it is, as well as its modification towards a new kind of ontology.

  10. Ciência das Redes: Aspectos Epistemológicos

    Directory of Open Access Journals (Sweden)

    Gustavo Vaconcelos Cavalcante

    2011-04-01

    Full Text Available Na época da escrita deste documento observa-se o alvorecer de uma nova ciência - A “Ciência das Redes”. Esta ciência, que por sua própria natureza já nasce com característica transdisciplinar, vem procurar buscar respostas aos desafios do novo milênio. A Ciência das Redes encontra-se ainda em sua infância e necessita demonstrar a sua robustez como ciência e para isso a busca de seus fundamentos epistemológicos é condição fundamental. O objetivo central deste trabalho é o de buscar bases epistemológicas e transdisciplinares para a Ciência das Redes. Para alcançar este objetivo foi utilizado como fundamentação para a construção de um modelo epistemológico: o conceito de “Rizoma” oriundo dos trabalhos filosóficos de Gilles Deleuze e Felix Guattari, o “Pensamento Complexo” baseado na obra de Edgar Morin e as propriedades oriundas da Ciência das Redes

  11.  Dylematy harmonizacji rachunkowości

    Directory of Open Access Journals (Sweden)

    Jerzy Gierusz

    2015-06-01

    Full Text Available Harmonizacja rachunkowości finansowej jest procesem przynoszącym wiele korzyści, ale także generującym poważne zagrożenia. Wśród pozytywnych stron harmonizacji wymienić należy: wzmocnienie funkcji alokacyjnej rynków kapitałowych, wzrost zaufania inwestorów do sprawozdań finansowych, rozszerzenie możliwości pozyskiwania kapitału pożyczkowego, obniżenie kosztów funkcjonowania korporacji międzynarodowych. Towarzyszące harmonizacji zjawiska niepożądane to: wyeliminowanie porównywalności sprawozdań finansowych na poziomie krajowym, przekreślenie znacznej części dorobku szkoły kontynentalnej rachunkowości, ustanowienie monopolu w tworzeniu standardów, zanik normatywnego nurtu badań w rachunkowości.

  12. Filosofia das ciências sociais: temas atuais

    Directory of Open Access Journals (Sweden)

    Harold Kincaid

    2014-12-01

    Full Text Available A filosofia das ciências sociais, concebida da maneira adequada, tem algo a oferecer aos que praticam as ciências sociais. Os cientistas sociais adotam em suas pesquisas, ainda que de forma implícita, alguma filosofia de sua ciência. Para evitar impasses, é melhor explicitar essa filosofia e ser criticamente consciente dos seus méritos. A filosofia das ciências sociais, por sua vez, não pode ser praticada sem um envolvimento íntimo com a pesquisa social. O artigo esboça alguns desenvolvimentos da filosofia da ciência pós-positivista e suas implicações para a filosofia das ciências sociais. Essa perspectiva geral é então aplicada a alguns debates das ciências sociais: a natureza da causalidade; o lugar dos mecanismos na pesquisa social e da legitimidade de explicações puramente macrossociológicas; a distinção entre pesquisa qualitativa e quantitativa; a distinção entre evidência observacional e evidência experimental; a polêmica entre o individualismo e o holismo metodológicos na explicação sociológica.

  13. Psicanálise e ciência

    Directory of Open Access Journals (Sweden)

    Regina Coeli Aguiar Castelo Prudente

    Full Text Available Embora Freud tenha sido um cientista, formado no espírito científico de sua época, as relações da psicanálise com a ciência nunca foram fáceis. Desde o “Projeto”, de 1895, até seus últimos textos, Freud nunca abandonou seu propósito de fazer com que a psicanálise fosse reconhecida como ciência. Jacques Lacan, a partir de sua teoria dos discursos, afirma que a psicanálise é um novo campo do saber que mantém conexões com o campo de saber da ciência, mas com ele se confunde. O sujeito da psicanálise é o mesmo sujeito da ciência - o sujeito do desejo - mas Freud subverte o cogito cartesiano ao descobrir o inconsciente.

  14. Para quê serve a ciência?

    OpenAIRE

    Novelli, Pedro Geraldo Aparecido [UNESP

    2010-01-01

    A ciência é uma forma de conhecimento e é também uma forma do conhecimento. Contudo, a ciência parece se apresentar como a forma de conhecer e do conhecer. Essa postura faz com que a ciência se afirme no mundo como algo singular obtendo inclusive força de instituição com reconhecimento oficial e sustentação em instâncias informais. A ciência sobreviveu a uma história de perseguição, rejeição e condenação colocando-se nos tempos modernos como o referencial por excelência para o estabelecimento...

  15. Biophysics an introduction

    CERN Document Server

    Cotteril, Rodney

    2002-01-01

    Biophysics: An Introduction, is a concise balanced introduction to this subject. Written in an accessible and readable style, the book takes a fresh, modern approach with the author successfully combining key concepts and theory with relevant applications and examples drawn from the field as a whole. Beginning with a brief introduction to the origins of biophysics, the book takes the reader through successive levels of complexity, from atoms to molecules, structures, systems and ultimately to the behaviour of organisms. The book also includes extensive coverage of biopolymers, biomembranes, biological energy, and nervous systems. The text not only explores basic ideas, but also discusses recent developments, such as protein folding, DNA/RNA conformations, molecular motors, optical tweezers and the biological origins of consciousness and intelligence.

  16. "Highly recommended introduction"

    DEFF Research Database (Denmark)

    Christiansen, Ask Vest

    2009-01-01

    by detachment, normatively and morally. Besides researching the actual abuse, individually and in aggregate, they also study structural circumstances that promote the use of drugs in sports; besides evaluations of the efficacy of the anti-doping efforts, they consider the effects of various anti-doping schemes...... on the integrity and privacy of the athletes. Ask Vest Christiansen, himself an internationally renowned scholar in the field, has read a recent, thus detached, introduction to drug use in sports, An Introduction to Drugs in Sport: Addicted to Winning by Ivan Waddington and Andy Smith (Routledge). Christiansen...... finds much to appreciate in the book, and a couple of disconcerting mistakes and misjudgments notwithstanding, he recommends the book as a solid introduction to the problem of doping – knowledgeable, well written and easy to read....

  17. Core Java

    CERN Document Server

    Horstmann, Cay S

    2013-01-01

    Fully updated to reflect Java SE 7 language changes, Core Java™, Volume I—Fundamentals, Ninth Edition, is the definitive guide to the Java platform. Designed for serious programmers, this reliable, unbiased, no-nonsense tutorial illuminates key Java language and library features with thoroughly tested code examples. As in previous editions, all code is easy to understand, reflects modern best practices, and is specifically designed to help jumpstart your projects. Volume I quickly brings you up-to-speed on Java SE 7 core language enhancements, including the diamond operator, improved resource handling, and catching of multiple exceptions. All of the code examples have been updated to reflect these enhancements, and complete descriptions of new SE 7 features are integrated with insightful explanations of fundamental Java concepts.

  18. Statistics a complete introduction

    CERN Document Server

    Graham, Alan

    2013-01-01

    Statistics: A Complete Introduction is the most comprehensive yet easy-to-use introduction to using Statistics. Written by a leading expert, this book will help you if you are studying for an important exam or essay, or if you simply want to improve your knowledge. The book covers all the key areas of Statistics including graphs, data interpretation, spreadsheets, regression, correlation and probability. Everything you will need is here in this one book. Each chapter includes not only an explanation of the knowledge and skills you need, but also worked examples and test questions.

  19. Introduction to adaptive arrays

    CERN Document Server

    Monzingo, Bob; Haupt, Randy

    2011-01-01

    This second edition is an extensive modernization of the bestselling introduction to the subject of adaptive array sensor systems. With the number of applications of adaptive array sensor systems growing each year, this look at the principles and fundamental techniques that are critical to these systems is more important than ever before. Introduction to Adaptive Arrays, 2nd Edition is organized as a tutorial, taking the reader by the hand and leading them through the maze of jargon that often surrounds this highly technical subject. It is easy to read and easy to follow as fundamental concept

  20. Introduction to combinatorial analysis

    CERN Document Server

    Riordan, John

    2002-01-01

    This introduction to combinatorial analysis defines the subject as ""the number of ways there are of doing some well-defined operation."" Chapter 1 surveys that part of the theory of permutations and combinations that finds a place in books on elementary algebra, which leads to the extended treatment of generation functions in Chapter 2, where an important result is the introduction of a set of multivariable polynomials.Chapter 3 contains an extended treatment of the principle of inclusion and exclusion which is indispensable to the enumeration of permutations with restricted position given

  1. Introduction to magnetochemistry

    CERN Document Server

    Earnshaw, Alan

    2013-01-01

    Introduction to Magnetochemistry provides an introduction to the more important aspects of magnetochemistry. The measurement of magnetic moment has been one of the most consistently useful to coordination chemists. For teaching purposes it provides a simple method of illustrating the ideas of electronic structure, and in research it can provide fundamental information about the bonding and stereochemistry of complexes. The book contains six chapters covering topics such as free atoms and ions, transition metal complexes, crystal field theory, second and third row transition metal complexes, a

  2. Introduction to fuzzy systems

    CERN Document Server

    Chen, Guanrong

    2005-01-01

    Introduction to Fuzzy Systems provides students with a self-contained introduction that requires no preliminary knowledge of fuzzy mathematics and fuzzy control systems theory. Simplified and readily accessible, it encourages both classroom and self-directed learners to build a solid foundation in fuzzy systems. After introducing the subject, the authors move directly into presenting real-world applications of fuzzy logic, revealing its practical flavor. This practicality is then followed by basic fuzzy systems theory. The book also offers a tutorial on fuzzy control theory, based mainly on th

  3. Introduction to information processing

    CERN Document Server

    Dietel, Harvey M

    2014-01-01

    An Introduction to Information Processing provides an informal introduction to the computer field. This book introduces computer hardware, which is the actual computing equipment.Organized into three parts encompassing 12 chapters, this book begins with an overview of the evolution of personal computing and includes detailed case studies on two of the most essential personal computers for the 1980s, namely, the IBM Personal Computer and Apple's Macintosh. This text then traces the evolution of modern computing systems from the earliest mechanical calculating devices to microchips. Other chapte

  4. Introduction to nonimaging optics

    CERN Document Server

    Chaves, Julio

    2015-01-01

    Introduction to Nonimaging Optics covers the theoretical foundations and design methods of nonimaging optics, as well as key concepts from related fields. This fully updated, revised, and expanded Second Edition: Features a new and intuitive introduction with a basic description of the advantages of nonimaging opticsAdds new chapters on wavefronts for a prescribed output (irradiance or intensity), infinitesimal étendue optics (generalization of the aplanatic optics), and Köhler optics and color mixingIncorporates new material on the simultaneous multiple surface (SMS) design method in 3-D, int

  5. Applied energy an introduction

    CERN Document Server

    Abdullah, Mohammad Omar

    2012-01-01

    Introduction to Applied EnergyGeneral IntroductionEnergy and Power BasicsEnergy EquationEnergy Generation SystemsEnergy Storage and MethodsEnergy Efficiencies and LossesEnergy industry and Energy Applications in Small -Medium Enterprises (SME) industriesEnergy IndustryEnergy-Intensive industryEnergy Applications in SME Energy industriesEnergy Sources and SupplyEnergy SourcesEnergy Supply and Energy DemandEnergy Flow Visualization and Sankey DiagramEnergy Management and AnalysisEnergy AuditsEnergy Use and Fuel Consumption StudyEnergy Life-Cycle AnalysisEnergy and EnvironmentEnergy Pollutants, S

  6. Introduction to UAV systems

    CERN Document Server

    Fahlstrom, Paul

    2012-01-01

    Unmanned aerial vehicles (UAVs) have been widely adopted in the military world over the last decade and the success of these military applications is increasingly driving efforts to establish unmanned aircraft in non-military roles. Introduction to UAV Systems, 4th edition provides a comprehensive introduction to all of the elements of a complete Unmanned Aircraft System (UAS). It addresses the air vehicle, mission planning and control, several types of mission payloads, data links and how they interact with mission performance, and launch and recovery concepts. This

  7. Introduction to quantum electronics

    CERN Document Server

    Unger, Hans Georg

    1970-01-01

    Introduction to Quantum Electronics is based on a one-semester lecture of electrical engineering for German students. The book is an introduction to the fundamentals of lasers and masers and a presentation of the principles of physics, their theory, and methods of analysis that seek to analyze, explain, and quantify related important phenomena. The properties of a laser is then discussed, the author comparing it to the properties of the maser. Although masers are based on the same physical properties as that of the lasers, masers amplify microwaves by induced emission. How the laser is amplif

  8. Introduction to the Project

    DEFF Research Database (Denmark)

    Kuhn, Johan M.; Malchow-Møller, Nikolaj; Sørensen, Anders

    In this note a short introduction to the project “Employment Effects of Entrepreneurs” is presented. First, we describe the purpose of the project; second, we present the background; third, we briefly describe the three papers that constitute the output of the project, and fourth, we discuss two ...... important qualifications for the understanding of the contributions and results established in the project.......In this note a short introduction to the project “Employment Effects of Entrepreneurs” is presented. First, we describe the purpose of the project; second, we present the background; third, we briefly describe the three papers that constitute the output of the project, and fourth, we discuss two...

  9. Fall Protection Introduction, #33462

    Energy Technology Data Exchange (ETDEWEB)

    Chochoms, Michael [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-06-23

    The proper use of fall prevention and fall protection controls can reduce the risk of deaths and injuries caused by falls. This course, Fall Protection Introduction (#33462), is designed as an introduction to various types of recognized fall prevention and fall protection systems at Los Alamos National Laboratory (LANL), including guardrail systems, safety net systems, fall restraint systems, and fall arrest systems. Special emphasis is given to the components, inspection, care, and storage of personal fall arrest systems (PFASs). This course also presents controls for falling object hazards and emergency planning considerations for persons who have fallen.

  10. Game theory an introduction

    CERN Document Server

    Barron, E N

    2013-01-01

    An exciting new edition of the popular introduction to game theory and its applications The thoroughly expanded Second Edition presents a unique, hands-on approach to game theory. While most books on the subject are too abstract or too basic for mathematicians, Game Theory: An Introduction, Second Edition offers a blend of theory and applications, allowing readers to use theory and software to create and analyze real-world decision-making models. With a rigorous, yet accessible, treatment of mathematics, the book focuses on results that can be used to

  11. Introduction to plasma dynamics

    CERN Document Server

    Morozov, A I

    2013-01-01

    As the twenty-first century progresses, plasma technology will play an increasing role in our lives, providing new sources of energy, ion-plasma processing of materials, wave electromagnetic radiation sources, space plasma thrusters, and more. Studies of the plasma state of matter not only accelerate technological developments but also improve the understanding of natural phenomena. Beginning with an introduction to the characteristics and types of plasmas, Introduction to Plasma Dynamics covers the basic models of classical diffuse plasmas used to describe such phenomena as linear and shock w

  12. La ciència ficció : un pont entre les ciències i les Humanidades

    OpenAIRE

    2006-01-01

    La hipòtesi vol contestar la pregunta següent: pot la ciència-ficció ajudar a construir un nexe d'unió afavorint una lectura ètica de la ciència i la tecnologia? Esbrinant els motius dels distanciament entre ciències i Humanidades, veient en particular com és tractada l'ètica en la literatura de ciència-ficció i cercant punts de connexió entre ambdós mons. La hipótesis pretende contestar la siguiente pregunta: ¿puede la ciencia-ficción ayudar a construir un nexo de unión favoreciendo una l...

  13. Implications of CI therapy for Visual Deficit Training

    Directory of Open Access Journals (Sweden)

    Edward eTaub

    2014-10-01

    Full Text Available We address here the question of whether the techniques of CI therapy, a family of treatments that has been employed in the rehabilitation of movement and language after brain damage might apply to the rehabilitation of such visual deficits as unilateral spatial neglect and visual field deficits. CI therapy has been used successfully for the upper and lower extremities after chronic stroke, cerebral palsy (CP, multiple sclerosis (MS, other CNS degenerative conditions, resection of motor areas of the brain, focal hand dystonia, and aphasia. Treatments making use of similar methods have proven efficacious for amblyopia.The CI therapy approach consists of four major components: intensive training, training by shaping, a transfer package to facilitate the transfer of gains from the treatment setting to everyday activities, and strong discouragement of compensatory strategies.CI therapy is said to be effective because it overcomes learned nonuse, a learned inhibition of movement that follows injury to the CNS. In addition, CI therapy produces substantial increases in the grey matter of motor areas on both sides of the brain. We propose here that these mechanisms are examples of more general processes: learned nonuse being considered parallel to sensory nonuse following damage to sensory areas of the brain, with both having in common diminished neural connections (DNC in the nervous system as an underlying mechanism. CI therapy would achieve its therapeutic effect by strengthening the diminished neural connections. Use-dependent cortical reorganization is considered to be an example of the more general neuroplastic mechanism of brain structure repurposing (BSR. If the mechanisms involved in these broader categories are involved in each of the deficits being considered, then it may be the principles underlying efficacious treatment in each case may be similar. The lessons learned during CI therapy research might then prove useful for the treatment of

  14. Diophantine geometry an introduction

    CERN Document Server

    Hindry, Marc

    2000-01-01

    This is an introduction to diophantine geometry at the advanced graduate level. The book contains a proof of the Mordell conjecture which will make it quite attractive to graduate students and professional mathematicians. In each part of the book, the reader will find numerous exercises.

  15. Introduction to Rocket Propulsion

    Science.gov (United States)

    1991-12-01

    Von Braun; 1966. 4. Introduction to Ordnance Technology; IHSP 76-129; 1976. 5. Physics; D. Halliday and R. Resnick ; 1963. 6. Physics Tells Why: 0...to Luke Sky- walker in Star Wars when he said "Don’t get cocky." We never plan for EVERYTHING, though we like to think we do. As we’ve said, rocket

  16. Introduction: The Transparency Issue

    NARCIS (Netherlands)

    Teurlings, J.; Stauff, M.

    2014-01-01

    Besides giving an overview on the individual contributions, this introduction to the special issue on transparency delineates a conceptual context for a critical analysis of the contemporary discourse on transparency and the media mechanisms related to it. It focuses on three ambivalences inherent t

  17. Introduction to solitons

    Indian Academy of Sciences (India)

    Miki Wadati

    2001-11-01

    As an introduction to the special issue on nonlinear waves, solitons and their significance in physics are reviewed. The soliton is the first universal concept in nonlinear science. Universality and ubiquity of the soliton concept are emphasized.

  18. Introduction to number theory

    CERN Document Server

    Vazzana, Anthony; Garth, David

    2007-01-01

    One of the oldest branches of mathematics, number theory is a vast field devoted to studying the properties of whole numbers. Offering a flexible format for a one- or two-semester course, Introduction to Number Theory uses worked examples, numerous exercises, and two popular software packages to describe a diverse array of number theory topics.

  19. Introduction to topology

    CERN Document Server

    Mendelson, Bert

    1990-01-01

    Highly regarded for its exceptional clarity, imaginative and instructive exercises, and fine writing style, this concise book offers an ideal introduction to the fundamentals of topology. It provides a simple, thorough survey of elementary topics, starting with set theory and advancing to metric and topological spaces, connectedness, and compactness. 1975 edition.

  20. Introduction: perspectives on Porter

    NARCIS (Netherlands)

    F.A.J. van den Bosch (Frans)

    1997-01-01

    textabstractIntroduction. Relevance of Strategy research: focus on Michael Porter's contributions Strategy is a fascinating field of enquiry, both for managers looking for a sustainable competitive advantage and for academic researchers looking for the reasons behind superior firm performance. Strat

  1. Writing the introduction.

    Science.gov (United States)

    Peh, W C; Ng, K H

    2008-10-01

    The introduction section of a scientific paper aims to introduce a specific topic and to stimulate the reader's interest. It provides background information about what has already been done by others, supported by a limited number of relevant references. The reader should be informed about the purpose of the paper, what it will address, and how it relates to previous work.

  2. Introduction and New Aspects

    DEFF Research Database (Denmark)

    2013-01-01

    This chapter provides a brief introduction to biochromophores encountered in nature, and how their π-conjugated structures determine their excitation energies, i.e., their colour. Perturbations of electronic structure by a microenvironment such as water or charge sites are discussed. These may lead...

  3. Introduction into TENCompetence: Technologies

    NARCIS (Netherlands)

    Koper, Rob

    2005-01-01

    This video is recorded during the kick-off meeting of the TENCompetence Project at 8 December 2005 in Valkenburg a/d Geul, The Netherlands (Hotel Rooding). It contains the third 16 minutes of the introduction into the project and defines the technical requirements and the integration of existing

  4. Introduction to Relational Programming.

    Science.gov (United States)

    1981-06-01

    such as Russell’s "rami- tied type theory." In most other respects our notation follows that of Carnap 11] and Whitehead and Russell [8]. There is no... Carnap , R. Introduction to Symbolic Logic and its Applica- tions, Dover, 1958. [2] Childs, D.L. Feasibility of a set-theoretic data structure based on a

  5. Introduction to Shakespeare: English.

    Science.gov (United States)

    Hargraves, Richard

    The "Introduction to Shakespeare" course in the Quinmester Program involves the careful study of the tragedy "Romeo and Juliet" and the comedy "The Taming of the Shrew," emphasizing language, development of character and theme. The course also includes the study of biographical data relevant to the evolution of Shakespeare's literary genius, and…

  6. Chemical Safety – Introduction

    CERN Multimedia

    DG Unit

    2009-01-01

    A course of "Chemical Safety – Introduction" will be held in English on 29 May 2009, 9:30-12:00. There are some places left. If you are interested in participating, please register on the Training Catalogue. You will then receive an invitation by email.

  7. Labour and Passion. : Introduction

    NARCIS (Netherlands)

    Hermes, Joke

    2014-01-01

    Abstract In this introduction to the themed section on ‘Labour and passion’, it is argued that work has bled into all areas of life. Political economists and media production researchers have shown how both paid and unpaid labour are singularly important and build upon one another. The set of articl

  8. Introduction to the Project

    DEFF Research Database (Denmark)

    Kuhn, Johan M.; Malchow-Møller, Nikolaj; Sørensen, Anders

    In this note a short introduction to the project “Employment Effects of Entrepreneurs” is presented. First, we describe the purpose of the project; second, we present the background; third, we briefly describe the three papers that constitute the output of the project, and fourth, we discuss two...... important qualifications for the understanding of the contributions and results established in the project....

  9. An Introduction to Psycholinguistics

    Science.gov (United States)

    Jodai, Hojat

    2011-01-01

    This paper is written to have a preliminary introduction about psycholinguistics. Psycholinguistics or psychology of language is the study of the interrelation between linguistic factors and psychological aspects. The main subject of research in psycholinguistics is the study of cognitive processes that underlie the comprehension and production of…

  10. Introduction to International Trade.

    Science.gov (United States)

    Crummett, Dan M.; Crummett, Jerrie

    This set of student and teacher guides is intended for use in a course to prepare students for entry-level employment in such occupational areas in international trade as business/finance, communications, logistics, and marketing. The following topics are covered in the course's five instructional units: introduction to careers in international…

  11. Introduction: perspectives on Porter

    NARCIS (Netherlands)

    F.A.J. van den Bosch (Frans)

    1997-01-01

    textabstractIntroduction. Relevance of Strategy research: focus on Michael Porter's contributions Strategy is a fascinating field of enquiry, both for managers looking for a sustainable competitive advantage and for academic researchers looking for the reasons behind superior firm performance. Strat

  12. Historiography: an introduction.

    Science.gov (United States)

    Rose, F Clifford

    2002-03-01

    This introduction precedes the four papers given in October 2000 in Copenhagen on analysing problems in the history of the neurosciences. The term historiography can be defined in different ways but means the study, and not simply the writing, of history. Although it goes back two millennia, it is a rapidly developing field as illustrated by the subsequent contributions.

  13. Introduction to quantum mechanics

    OpenAIRE

    Villaseñor, Eduardo J. S.

    2008-01-01

    The purpose of this contribution is to give a very brief introduction to Quantum Mechanics for an audience of mathematicians. I will follow Segal's approach to Quantum Mechanics paying special attention to algebraic issues. The usual representation of Quantum Mechanics on Hilbert spaces is also discussed.

  14. Introduction and Overview.

    Science.gov (United States)

    Jorgensen, Corinne

    2001-01-01

    Provides an introduction to articles in this special "Perspectives" issue of "Journal of the American Society for Information Science and Technology." The articles, taken collectively, contain significant elements of a research agenda in image indexing and retrieval for the next decade. Articles focus on user, representation, and system issues.…

  15. An Introduction to Malware

    DEFF Research Database (Denmark)

    Sharp, Robin

    2007-01-01

    These notes intended for use in DTU course 02233 on Network Security give a short introduction to the topic of malware. The most important types of malware are described, together with their basic principles of operation and dissemination, and defences against malware are discussed....

  16. An Introduction to Malware

    DEFF Research Database (Denmark)

    Sharp, Robin

    2013-01-01

    These notes, intended for use in DTU course 02233 on Network Security, give a short introduction to the topic of malware. The most important types of malware are described, together with their basic principles of operation and dissemination, and defenses against malware are discussed....

  17. Socialist Core Values:the Soul of Classroom Theoretical Teaching System of the Course Introduction of Marxism and Mao Zedong Thoughts%社会主义核心价值观:“概论”课课堂理论教学体系之魂

    Institute of Scientific and Technical Information of China (English)

    陈梅

    2015-01-01

    培育和践行社会主义核心价值观,已经成为当代中国特色社会主义建设事业凝魂聚气、强基固本的基础工程,“概论”课是其主渠道、主阵地。无论从中国特色社会主义旗帜的明确内涵、教科书理论体系设置内容的重点方面,还是从贯彻落实中央有关文件的重要内容规定,做好“三进”工作方面,社会主义核心价值观应该成为内容丰富而学时较少的“概论”课课堂理论教学体系之魂。教学体系紧紧围绕培育和践行社会主义核心价值观,就其重大意义、曲折失误、必由之路、总依据、实现途径和制度保障等七个方面以讲座形式构建。%Cultivating and implementing core socialist values has become the foundation-laying and solidifying project of the socialist cause in contemporary China and the course Introduction of Marxism and Mao Zedong Thoughts has been a major channel as well as a chief frontier in this regard. Whether from the definite connotation of the socialism with Chinese characteristics and the key points of textbooks layout, or from the implementation of CCP′s documents and "three in" ( In the classroom, in the textbook, in the students minds) , core socialist values should be the soul of the theoretical course in classroom teaching featured with numerous content instructed in fewer teaching hours. In this case, the teaching system should be constructed based on seven aspects: its significance, setbacks, inevitable routes, general basis, methods, and systematic guarantee.

  18. Observational Approach to Molecular Cloud Evolution with the Submillimeter CI Lines

    Science.gov (United States)

    Oka, T.; Yamamoto, S.; Mt. Fuji Submillimeter-Wave Telescope Group

    Neutral carbon atoms (CI) play important role both in chemistry and cooling processes of interstellar molecular clouds. It is thus crucial to explore its large area distribution to investigate formation processes and thermal balance of molecular clouds. We have constructed a 1.2 m submillimeter-wave telescope at the summit of Mt.Fuji. The telescope was designed for the exclusive use of surveying molecular clouds in two submillimeter CI lines, 3P1--3P0 (492 GHz) and 3P2--3P1 (809 GHz), of atomic carbon. It has been operated successfully during 4 observing seasons since July 1998 in a remote way from the Hongo campus of the University of Tokyo. We have already revealed large-scale CI 492 GHz distributions of many giant molecular clouds, including Orion MC, Taurus MC, DR15, DR21, NGC2264, M17, W3, W44, W51, Rosette MC, covering more than 40 square degrees of the sky. The distribution of CI 492 GHz emission is found to be different from those of the 13CO or C18O emission in some clouds. We found the spatial order of C+/CO/C from UV sources. This is the general property of the cloud illuminated by intense UV radiation, whereas it is apparently inconsistent with the standard photodissociation region (PDR) picture. We also found CI-rich areas (C/CO˜1) in several dark clouds without strong UV sources. These results are discussed in relation to formation processes of molecular clouds and dense cloud cores.

  19. CI-990 (PD 131112): A new quinolone prodrug.

    Science.gov (United States)

    Qadri, S M; Ueno, Y; Saldin, H; Burdette, J M; Lee, G C

    1993-03-01

    In vitro susceptibility of 1021 strains of recent clinical isolates was determined against the new fluoroquinolone CI-990 (PD 131112) and compared with CI-960, ciprofloxacin, fleroxacin, lomefloxacin, norfloxacin, perfloxacin, sparfloxacin, and temafloxacin. The minimum inhibitory concentrations (MIC) of CI-990 in mg/L required for >90% isolates were 0.03-0.5 for members of Enterobacteriaceae, 0.12-2.0 for Pseudomonas aeruginosa, 0.03-1.0 for Aeromonas hydrophilia, 1.0-2.0 for Acinetobacter calcoaceticus, 0.5-2.0 for Brucella melitensis, 0.06-1.0 for staphylococci, and 1.0-2.0 for enterococci. Its antibacterial activity was comparable or superior to other fluroquinolones tested against most gram-negative and gram-positive bacteria, including enterococci.

  20. Using the Web for Competitive Intelligence (CI) Gathering

    Science.gov (United States)

    Rocker, JoAnne; Roncaglia, George

    2002-01-01

    Businesses use the Internet as a way to communicate company information as a way of engaging their customers. As the use of the Web for business transactions and advertising grows, so too, does the amount of useful information for practitioners of competitive intelligence (CI). CI is the legal and ethical practice of information gathering about competitors and the marketplace. Information sources like company webpages, online newspapers and news organizations, electronic journal articles and reports, and Internet search engines allow CI practitioners analyze company strengths and weaknesses for their customers. More company and marketplace information than ever is available on the Internet and a lot of it is free. Companies should view the Web not only as a business tool but also as a source of competitive intelligence. In a highly competitive marketplace can any organization afford to ignore information about the other players and customers in that same marketplace?

  1. Em torno do conceito de ciência

    OpenAIRE

    Fonseca,Maria de Jesus

    1996-01-01

    A comunicação que ora se apresenta surge no âmbito da iniciativa "VIVA A CIÊNCIA" - 1994, promovida pela Secretaria de Estado da Ciência e Tecnologia e já em 2º edição. São objectivos deste projecto a divulgação da ciência e da tecnologia tornando "visível a importância da ciência e da tecnologia numa sociedade que já se habituou aos seus benefícios, mas que ainda teme e se interroga sobre os seus efeitos futuros."1 Nesse sentido, pretende-se que esta semana constitua, a nível nacional, u...

  2. Cinema, ciência e percepção.

    Directory of Open Access Journals (Sweden)

    Márcio Barreto

    Full Text Available Resumo O cinema invoca a questão dos limites da percepção humana, pois modula o tempo em imagens tão reais quanto artificiais, revelando algo mais próximo de uma nova dimensão da realidade do que de sua representação. No início do século XX, a ciência modifica o real percebido através das lentes dos microscópios e das teorias da física moderna; o parentesco entre cinema e ciência está principalmente naquilo que excede o campo perceptivo e é explorado neste artigo para mostrar como a tensão entre o caráter estático da fotografia e a fluidez fugitiva do tempo revela a ciência sem seus estereótipos habituais.

  3. Ocena Przydatności Testerów Szorstkości w Procesie Eksploatacji Nawierzchni Lotniskowych

    Directory of Open Access Journals (Sweden)

    Wesołowski Mariusz

    2016-12-01

    Full Text Available Poprawność oceny szorstkości nawierzchni lotniskowych jest ważnym elementem bezpieczeństwa wykonywania operacji lotniczych. Zagraniczne oraz krajowe dokumenty normatywne określają wymagane wartości współczynników tarcia dla: projektowanych (nowych nawierzchni lotniskowych, użytkowanych i/lub będących przedmiotem planowania prac remontowych oraz minimalne (graniczne dla eksploatowanych nawierzchni lotniskowych. Ponadto, dokumenty te definiują ogólne wymagania dotyczące urządzeń pomiarowych stosowanych do określania szorstkości nawierzchni lotniskowych. Akceptowalny poziom powtarzalności pomiaru współczynnika tarcia nie jest warunkiem wystarczającym do zaakceptowania urządzenia do wykonywania pomiarów szorstkości nawierzchni elementów funkcjonalnych lotnisk. Dlatego warunkiem dopuszczenia urządzenia do wykonywania pomiarów współczynnika tarcia powinno być przeprowadzenie badań w celu określenia jego przydatności do tego typu pomiarów. Badania te powinny obejmować m.in. ocenę urządzenia w odniesieniu do urządzeń dopuszczonych do wykonywania pomiarów, z wykorzystaniem aparatu statystycznego. Na końcową ocenę przydatności urządzenia składa się ponadto całokształt problemów technicznych związanych z procesem eksploatacji poprzez przygotowanie urządzenia do pomiarów, jego kalibrację (sprawdzenie przed pomiarami, a skończywszy na samych pomiarach.

  4. Persistência da veia ciática

    OpenAIRE

    Cardoso,Bárbara Borges; Alvarenga,Camila Oliveira; Miyahara,Maíra de Souza; Burihan,Marcelo Calil; Lima,Maria Raphaella Queiroz Alves de; Kuwahara,Mariana Cardoso; Silva,Rafael Capobianco Maia e

    2010-01-01

    CONTEXTO: Durante um período da vida embrionária, a veia ciática é a principal coletora do membro inferior. Na embriogênese vascular, há diferenciação dos angioblastos em um plexo vascular primitivo, com posterior remodelagem e expansão. Consequentemente, durante esse processo, podem ocorrer anomalias. Quando ocorre persistência da veia ciática, esta pode se comunicar com a veia safena parva ou com a veia poplítea durante seu percurso, anastomosando-se com a veia perfurante superior e com a v...

  5. Introduction to ultrasonic motors

    Energy Technology Data Exchange (ETDEWEB)

    Sashida, Toshiiku; Kenjo, Takashi.

    1993-01-01

    The ultrasonic motor, invented in 1980, utilizes the piezoelectric effect in the ultrasonic frequency range to provide the motive force. (In conventional electric motors the motive force is electromagnetic.) The result is a motor with unusually good low-speed high-torque and power-to-weight characteristics. It has already found applications in camera autofocus mechanisms, medical equipment subject to high magnetic fields, and motorized car accessories. Its applications will increase as designers become more familiar with its unique characteristics. This book is the result of a collaboration between the inventor and an expert in conventional electric motors: the result is an introduction to the general theory presented in a way that links it to conventional motor theory. It will be invaluable both to motor designers and to those who design with and use electric motors as an introduction to this important new invention.

  6. Introduction to computer networking

    CERN Document Server

    Robertazzi, Thomas G

    2017-01-01

    This book gives a broad look at both fundamental networking technology and new areas that support it and use it. It is a concise introduction to the most prominent, recent technological topics in computer networking. Topics include network technology such as wired and wireless networks, enabling technologies such as data centers, software defined networking, cloud and grid computing and applications such as networks on chips, space networking and network security. The accessible writing style and non-mathematical treatment makes this a useful book for the student, network and communications engineer, computer scientist and IT professional. • Features a concise, accessible treatment of computer networking, focusing on new technological topics; • Provides non-mathematical introduction to networks in their most common forms today;< • Includes new developments in switching, optical networks, WiFi, Bluetooth, LTE, 5G, and quantum cryptography.

  7. Geometric Complexity Theory: Introduction

    CERN Document Server

    Sohoni, Ketan D Mulmuley Milind

    2007-01-01

    These are lectures notes for the introductory graduate courses on geometric complexity theory (GCT) in the computer science department, the university of Chicago. Part I consists of the lecture notes for the course given by the first author in the spring quarter, 2007. It gives introduction to the basic structure of GCT. Part II consists of the lecture notes for the course given by the second author in the spring quarter, 2003. It gives introduction to invariant theory with a view towards GCT. No background in algebraic geometry or representation theory is assumed. These lecture notes in conjunction with the article \\cite{GCTflip1}, which describes in detail the basic plan of GCT based on the principle called the flip, should provide a high level picture of GCT assuming familiarity with only basic notions of algebra, such as groups, rings, fields etc.

  8. Introduction to Sporadic Groups

    Directory of Open Access Journals (Sweden)

    Luis J. Boya

    2011-01-01

    Full Text Available This is an introduction to finite simple groups, in particular sporadic groups, intended for physicists. After a short review of group theory, we enumerate the 1+1+16=18 families of finite simple groups, as an introduction to the sporadic groups. These are described next, in three levels of increasing complexity, plus the six isolated ''pariah'' groups. The (old five Mathieu groups make up the first, smallest order level. The seven groups related to the Leech lattice, including the three Conway groups, constitute the second level. The third and highest level contains the Monster group M, plus seven other related groups. Next a brief mention is made of the remaining six pariah groups, thus completing the 5+7+8+6=26 sporadic groups. The review ends up with a brief discussion of a few of physical applications of finite groups in physics, including a couple of recent examples which use sporadic groups.

  9. Introduction to Abelian varieties

    CERN Document Server

    Murty, V Kumar

    1993-01-01

    The book represents an introduction to the theory of abelian varieties with a view to arithmetic. The aim is to introduce some of the basics of the theory as well as some recent arithmetic applications to graduate students and researchers in other fields. The first part contains proofs of the Abel-Jacobi theorem, Riemann's relations and the Lefschetz theorem on projective embeddings over the complex numbers in the spirit of S. Lang's book Introduction to algebraic and abelian functions. Then the Jacobians of Fermat curves as well as some modular curves are discussed. Finally, as an application, Faltings' proof of the Mordell conjecture and its intermediate steps, the Tate conjecture and the Shafarevich conjecture, are sketched. - H. Lange for MathSciNet.

  10. Mind a brief introduction

    CERN Document Server

    Searle, John R

    2004-01-01

    "The philosophy of mind is unique among contemporary philosophical subjects," writes John Searle, "in that all of the most famous and influential theories are false." One of the world's most eminent thinkers, Searle dismantles these theories as he presents a vividly written, comprehensive introduction to the mind. He begins with a look at the twelve problems of philosophy of mind--which he calls "Descartes and Other Disasters"--problems which he returns to throughout the volume, as he illuminates such topics as materialism, consciousness, the mind-body problem, intentionality, mental causation, free will, and the self. The book offers a refreshingly direct and engaging introduction to one of the most intriguing areas of philosophy.

  11. Introduction to microarray technology.

    Science.gov (United States)

    Dufva, Martin

    2009-01-01

    DNA microarrays can be used for large number of application where high-throughput is needed. The ability to probe a sample for hundred to million different molecules at once has made DNA microarray one of the fastest growing techniques since its introduction about 15 years ago. Microarray technology can be used for large scale genotyping, gene expression profiling, comparative genomic hybridization and resequencing among other applications. Microarray technology is a complex mixture of numerous technology and research fields such as mechanics, microfabrication, chemistry, DNA behaviour, microfluidics, enzymology, optics and bioinformatics. This chapter will give an introduction to each five basic steps in microarray technology that includes fabrication, target preparation, hybridization, detection and data analysis. Basic concepts and nomenclature used in the field of microarray technology and their relationships will also be explained.

  12. Introduction to noncommutative algebra

    CERN Document Server

    Brešar, Matej

    2014-01-01

    Providing an elementary introduction to noncommutative rings and algebras, this textbook begins with the classical theory of finite dimensional algebras. Only after this, modules, vector spaces over division rings, and tensor products are introduced and studied. This is followed by Jacobson's structure theory of rings. The final chapters treat free algebras, polynomial identities, and rings of quotients. Many of the results are not presented in their full generality. Rather, the emphasis is on clarity of exposition and simplicity of the proofs, with several being different from those in other texts on the subject. Prerequisites are kept to a minimum, and new concepts are introduced gradually and are carefully motivated. Introduction to Noncommutative Algebra is therefore accessible to a wide mathematical audience. It is, however, primarily intended for beginning graduate and advanced undergraduate students encountering noncommutative algebra for the first time.

  13. Introduction to modern magnetohydrodynamics

    CERN Document Server

    Galtier, Sébastien

    2016-01-01

    Ninety-nine percent of ordinary matter in the Universe is in the form of ionized fluids, or plasmas. The study of the magnetic properties of such electrically conducting fluids, magnetohydrodynamics (MHD), has become a central theory in astrophysics, as well as in areas such as engineering and geophysics. This textbook offers a comprehensive introduction to MHD and its recent applications, in nature and in laboratory plasmas; from the machinery of the Sun and galaxies, to the cooling of nuclear reactors and the geodynamo. It exposes advanced undergraduate and graduate students to both classical and modern concepts, making them aware of current research and the ever-widening scope of MHD. Rigorous derivations within the text, supplemented by over 100 illustrations and followed by exercises and worked solutions at the end of each chapter, provide an engaging and practical introduction to the subject and an accessible route into this wide-ranging field.

  14. Introduction to linear elasticity

    CERN Document Server

    Gould, Phillip L

    2013-01-01

    Introduction to Linear Elasticity, 3rd Edition, provides an applications-oriented grounding in the tensor-based theory of elasticity for students in mechanical, civil, aeronautical, and biomedical engineering, as well as materials and earth science. The book is distinct from the traditional text aimed at graduate students in solid mechanics by introducing the subject at a level appropriate for advanced undergraduate and beginning graduate students. The author's presentation allows students to apply the basic notions of stress analysis and move on to advanced work in continuum mechanics, plasticity, plate and shell theory, composite materials, viscoelasticity and finite method analysis. This book also:  Emphasizes tensor-based approach while still distilling down to explicit notation Provides introduction to theory of plates, theory of shells, wave propagation, viscoelasticity and plasticity accessible to advanced undergraduate students Appropriate for courses following emerging trend of teaching solid mechan...

  15. Introduction to heat transfer

    CERN Document Server

    SUNDÉN, B

    2012-01-01

    Presenting the basic mechanisms for transfer of heat, Introduction to Heat Transfer gives a deeper and more comprehensive view than existing titles on the subject. Derivation and presentation of analytical and empirical methods are provided for calculation of heat transfer rates and temperature fields as well as pressure drop. The book covers thermal conduction, forced and natural laminar and turbulent convective heat transfer, thermal radiation including participating media, condensation, evaporation and heat exchangers.

  16. Introduction to superstring theory

    Energy Technology Data Exchange (ETDEWEB)

    Nunez, Carmen [Instituto de Astronomia y Fisica del Espacio, Buenos Aires (Argentina)], e-mail: carmen@iafe.uba.ar

    2009-07-01

    This is a very basic introduction to the AdS/CFT correspondence. The first lecture motivates the duality between gauge theories and gravity/string theories. The next two lectures introduce the bosonic and supersymmetric string theories. The fourth lecture is devoted to study Dp-branes and finally, in the fifth lecture I discuss the two worlds: N=4 SYM in 3+1 flat dimensions and type IIB superstrings in AdS{sub 5} x S5. (author)

  17. Introduction to minimax

    CERN Document Server

    Dem'yanov, V F; Louvish, D

    2014-01-01

    This user-friendly text offers a thorough introduction to the part of optimization theory that lies between approximation theory and mathematical programming, both linear and nonlinear. Written by two distinguished mathematicians, the expert treatment covers the essentials, incorporating important background materials, examples, and extensive notes.Geared toward advanced undergraduate and graduate students of mathematical programming, the text explores best approximation by algebraic polynomials in both discrete and continuous cases; the discrete problem, with and without constraints; the gene

  18. Introduction to Plasma Physics

    Science.gov (United States)

    Gurnett, Donald A.; Bhattacharjee, Amitava

    2017-03-01

    Preface; 1. Introduction; 2. Characteristic parameters of a plasma; 3. Single particle motions; 4. Waves in a cold plasma; 5. Kinetic theory and the moment equations; 6. Magnetohydrodynamics; 7. MHD equilibria and stability; 8. Discontinuities and shock waves; 9. Electrostatic waves in a hot unmagnetized plasma; 10. Waves in a hot magnetized plasma; 11. Nonlinear effects; 12. Collisional processes; Appendix A. Symbols; Appendix B. Useful trigonometric identities; Appendix C. Vector differential operators; Appendix D. Vector calculus identities; Index.

  19. Introduction to neutron scattering

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, W.E. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1996-11-01

    We give here an introduction to the theoretical principles of neutron scattering. The relationship between scattering- and correlation-functions is particularly emphasized. Within the framework of linear response theory (justified by the weakness of the basic interaction) the relation between fluctuation and dissipation is discussed. This general framework explains the particular power of neutron scattering as an experimental method. (author) 4 figs., 4 refs.

  20. Introduction to Extra Dimensions

    Energy Technology Data Exchange (ETDEWEB)

    Rizzo, Thomas G.; /SLAC

    2010-04-29

    Extra dimensions provide a very useful tool in addressing a number of the fundamental problems faced by the Standard Model. The following provides a very basic introduction to this very broad subject area as given at the VIII School of the Gravitational and Mathematical Physics Division of the Mexican Physical Society in December 2009. Some prospects for extra dimensional searches at the 7 TeV LHC with {approx}1 fb{sup -1} of integrated luminosity are provided.

  1. Introduction to parallel programming

    CERN Document Server

    Brawer, Steven

    1989-01-01

    Introduction to Parallel Programming focuses on the techniques, processes, methodologies, and approaches involved in parallel programming. The book first offers information on Fortran, hardware and operating system models, and processes, shared memory, and simple parallel programs. Discussions focus on processes and processors, joining processes, shared memory, time-sharing with multiple processors, hardware, loops, passing arguments in function/subroutine calls, program structure, and arithmetic expressions. The text then elaborates on basic parallel programming techniques, barriers and race

  2. Introduction to cosmology

    CERN Document Server

    Roos, Matts

    2015-01-01

    The Fourth Edition of Introduction to Cosmology provides a concise, authoritative study of cosmology at an introductory level. Starting from elementary principles and the early history of cosmology, the text carefully guides the student on to curved spacetimes, special and general relativity, gravitational lensing, the thermal history of the Universe, and cosmological models, including extended gravity models, black holes and Hawking's recent conjectures on the not-so-black holes.

  3. Introduction to microprocessors

    CERN Document Server

    Aspinall, D

    1977-01-01

    Introduction to Microprocessors introduces the practicing engineer to microprocessors and covers topics ranging from components for information processing to hardware structures and addressing modes, along with support software and structured programming. General principles are illustrated with examples from commercial microprocessors.Comprised of 10 chapters, this book begins with an overview of digital information processing systems and their components, including logic circuits and large scale integration (LSI) digital circuits. A basic microprocessor structure is then described, and case s

  4. Introduction to electronics

    CERN Document Server

    Korneff, Theodore

    1966-01-01

    Introduction to Electronics focuses on the study of electronics and electronic devices. Composed of 14 chapters, the book starts with discussions on dc circuits, including resistance, voltmeter, ammeter, galvanometer, internal resistance, and positive and negative currents. This topic is followed by discussions on ac circuits, particularly addressing voltage and current, average power, resistive load, complex plane, and parallel circuits. Discussions also focus on filters and tuned circuits, diodes, and power supplies. Particularly given attention are the processes, diagrams, and analyses

  5. Introduction to reversible computing

    CERN Document Server

    Perumalla, Kalyan S

    2013-01-01

    Few books comprehensively cover the software and programming aspects of reversible computing. Filling this gap, Introduction to Reversible Computing offers an expanded view of the field that includes the traditional energy-motivated hardware viewpoint as well as the emerging application-motivated software approach. Collecting scattered knowledge into one coherent account, the book provides a compendium of both classical and recently developed results on reversible computing. It explores up-and-coming theories, techniques, and tools for the application of rever

  6. Introduction to contact mechanics

    CERN Document Server

    Fischer-Cripps, Anthony C

    2000-01-01

    Contact mechanics deals with the elastic or plastic contact between two solid objects, and is thus intimately connected with such topics as fracture, hardness, and elasticity.This text, intended for advanced undergraduates, begins with an introduction to the mechanical properties of materials, general fracture mechanics, and fractures in brittle solids.This is followed by a detailed discussion of stresses and the nature of elastic and elastic-plastic contact.

  7. Introduction to Feynman Integrals

    CERN Document Server

    Weinzierl, Stefan

    2010-01-01

    In these lectures I will give an introduction to Feynman integrals. In the first part of the course I review the basics of the perturbative expansion in quantum field theories. In the second part of the course I will discuss more advanced topics: Mathematical aspects of loop integrals related to periods, shuffle algebras and multiple polylogarithms are covered as well as practical algorithms for evaluating Feynman integrals.

  8. An Introduction to Webs

    OpenAIRE

    White, C. D.

    2015-01-01

    Webs are sets of Feynman diagrams that contribute to the exponents of scattering amplitudes, in the kinematic limit in which emitted radiation is soft. As such, they have a number of phenomenological and formal applications, and offer tantalising glimpses into the all-order structure of perturbative quantum field theory. This article is based on a series of lectures given to graduate students, and aims to provide a pedagogical introduction to webs. Topics covered include exponentiation in (no...

  9. Combinatorics an introduction

    CERN Document Server

    Faticoni, Theodore G

    2014-01-01

    Bridges combinatorics and probability and uniquely includes detailed formulas and proofs to promote mathematical thinking Combinatorics: An Introduction introduces readers to counting combinatorics, offers examples that feature unique approaches and ideas, and presents case-by-case methods for solving problems. Detailing how combinatorial problems arise in many areas of pure mathematics, most notably in algebra, probability theory, topology, and geometry, this book provides discussion on logic and paradoxes; sets and set notations; power sets and their cardinality; Venn diagrams; the multip

  10. Introduction to nanotheranostics

    CERN Document Server

    Tamil Selvan, Subramanian

    2016-01-01

    This book offers readers an introduction to the current status of nanoparticles and other nanomaterials that have potential applications in theranostics. Above all, it highlights the diagnostic and therapeutic applications of metallic (e.g. Au, Ag), semiconducting quantum dots (e.g. CdSe, CdTe), magnetic (e.g. Fe3O4, FePt, Co), and multifunctional (combination of two or three) nanoparticles. .

  11. Comparative government : an introduction

    OpenAIRE

    1990-01-01

    A comprehensive and systematic introduction to the institutions and patterns of behavior of political systems worldwide. The book is concept rather than country based, looking in the depth at the key elements necessary to an understanding of political institutions and political change. It also looks at the part played by bureaucracies, the military and the courts in political life and the extent to which people participate directory in politics. Part I. General frameworks and concepts. -- ...

  12. Introduction to microfabrication

    CERN Document Server

    Franssila, Sami

    2005-01-01

    Microfabrication is the key technology behind integrated circuits, microsensors, photonic crystals, ink jet printers, solar cells and flat panel displays. Microsystems can be complex, but the basic microstructures and processes of microfabrication are fairly simple. Introduction to Microfabrication shows how the common microfabrication concepts can be applied over and over again to create devices with a wide variety of structures and functions.Featuring:* A comprehensive presentation of basic fabrication processes* An emphasis on materials and microstructures, rather than devic

  13. Introduction to Sonar, Revision.

    Science.gov (United States)

    1976-01-01

    sodium potassium tartrate), Figure 63.-Scanning magnetostrictive transducer. ammonium dihydrogen phosphate (ADP), and 89 INTRODUCTION TO SONAR... dihydrogen phosphate 4. barium titanate 3-53. In which unit is the incoming echo signal strength increased before 3-46. The maintenance of the close con...restrictions, A controlled area does not contain classified controls, and protective measures required vary information. It serves as a buffer zone to

  14. Differential topology an introduction

    CERN Document Server

    Gauld, David B

    2006-01-01

    Offering classroom-proven results, Differential Topology presents an introduction to point set topology via a naive version of nearness space. Its treatment encompasses a general study of surgery, laying a solid foundation for further study and greatly simplifying the classification of surfaces.This self-contained treatment features 88 helpful illustrations. Its subjects include topological spaces and properties, some advanced calculus, differentiable manifolds, orientability, submanifolds and an embedding theorem, and tangent spaces. Additional topics comprise vector fields and integral curv

  15. Introduction to abstract algebra

    CERN Document Server

    Nicholson, W Keith

    2012-01-01

    Praise for the Third Edition ". . . an expository masterpiece of the highest didactic value that has gained additional attractivity through the various improvements . . ."-Zentralblatt MATH The Fourth Edition of Introduction to Abstract Algebra continues to provide an accessible approach to the basic structures of abstract algebra: groups, rings, and fields. The book's unique presentation helps readers advance to abstract theory by presenting concrete examples of induction, number theory, integers modulo n, and permutations before the abstract structures are defined. Readers can immediately be

  16. Introduction to biomechatronics

    CERN Document Server

    Brooker, Graham

    2012-01-01

    Introduction to Biomechatronics provides fundamental knowledge of mechanical and electronic (mechatronic) components and systems and their interaction with human biology to assist or replace limbs, senses, and even organs damaged by trauma, birth defects, or disease. The first half of the book provides the engineering background to understand all the components of a biomechatronic system: the human subject, stimulus or actuation, transducers and sensors, signal conditioning elements, recording and display, and feedback elements.

  17. Introduction to Pump Rotordynamics

    Science.gov (United States)

    2006-11-01

    RTO-EN-AVT-143 9 - 1 Introduction to Pump Rotordynamics Luis San Andrés Mast-Childs Tribology Professor Turbomachinery Laboratory Texas A... rotordynamics of turbomachinery, excessive vibration and instability. The acceptable performance of a turbomachine depends on the adequate design and operation...on rotordynamics . The basic equations for the modeling of linear rotor-bearing systems are given along with an example for the rotordynamics of a

  18. Earth System Monitoring, Introduction

    Science.gov (United States)

    Orcutt, John

    This section provides sensing and data collection methodologies, as well as an understanding of Earth's climate parameters and natural and man-made phenomena, to support a scientific assessment of the Earth system as a whole, and its response to natural and human-induced changes. The coverage ranges from climate change factors and extreme weather and fires to oil spill tracking and volcanic eruptions. This serves as a basis to enable improved prediction and response to climate change, weather, and natural hazards as well as dissemination of the data and conclusions. The data collection systems include satellite remote sensing, aerial surveys, and land- and ocean-based monitoring stations. Our objective in this treatise is to provide a significant portion of the scientific and engineering basis of Earth system monitoring and to provide this in 17 detailed articles or chapters written at a level for use by university students through practicing professionals. The reader is also directed to the closely related sections on Ecological Systems, Introduction and also Climate Change Modeling Methodology, Introduction as well as Climate Change Remediation, Introduction to. For ease of use by students, each article begins with a glossary of terms, while at an average length of 25 print pages each, sufficient detail is presented for use by professionals in government, universities, and industries. The chapters are individually summarized below.

  19. Ceux-ci ne sont pas : [luuletused] / Kalju Kruusa

    Index Scriptorium Estoniae

    Kruusa, Kalju, pseud., 1973-

    2003-01-01

    Sisu: Ceux-ci ne sont pas ; Köögivahet ; "Taara..." ; "Pakane pistab pisikesi ..." ; "Meri on kaet mattklaasiga ; Pydemise päivil ; "Toas muusika mängib ..." ; "Jäin juustu imetlema ; "Mu elu on mustikas ..." ; Hingepidetus ; ŁNo me gusta la cocina

  20. Ceux-ci ne sont pas : [luuletused] / Kalju Kruusa

    Index Scriptorium Estoniae

    Kruusa, Kalju, pseud., 1973-

    2003-01-01

    Sisu: Ceux-ci ne sont pas ; Köögivahet ; "Taara..." ; "Pakane pistab pisikesi ..." ; "Meri on kaet mattklaasiga ; Pydemise päivil ; "Toas muusika mängib ..." ; "Jäin juustu imetlema ; "Mu elu on mustikas ..." ; Hingepidetus ; ŁNo me gusta la cocina

  1. Por uma ciência do riso e da sabedoria

    Directory of Open Access Journals (Sweden)

    Paula Corrêa Henning

    2010-06-01

    Full Text Available

    O artigo busca problematizar a história das ciências, especialmente o ethos da Modernidade e Pós-modernidade. Para isso, utiliza autores que se anteciparam à Pós-modernidade como Friedrich Nietzsche e Michel Foucault. Na esteira dessa discussão busca uma problematização acerca da Ciência nos rastros da Modernidade e algumas fissuras e fragilidades produzidas na ciência num cenário contemporâneo. Apresenta ainda alguns discursos midiáticos acerca de propagandas televisivas que trazem o discurso científico como legítimo e inabalável. Traz para o campo de discussão uma ciência alegre, como aprendemos com Nietzsche ou prosaica por vezes, anunciando o riso e a sabedoria na produção do conhecimento científico.

     

  2. Surviving High-temperature Components in CI Chondrites

    Science.gov (United States)

    Zolensky, M.; Frank, D.

    2014-01-01

    The CI1 chondrites, while having the most solar-like compo-sition of any astromaterial available for laboratory analysis, have also been considerably altered by asteroidal processes including aqueous alteration. It is of fundamental importance to determine their pre-alteration mineralogy, so that the state of matter in the early Solar System can be better determined. In the course of a re-examination of the compositional range of olivine and low-Ca pyroxene in CI chondrites Orgueil, Ivuna and Alais [1] we found the first reported complete CAI, as already reported [2], with at-tached rock consisting mainly of olivine and low-Ca pyroxene. The range of residual olivine major element compositions we have determined in the CIs (Fig. 1) may now be directly com-pared with those of other astromaterials, including Wild 2 grains. The abundance of olivine and low-Ca pyroxene in CIs is higher than is generally appreciated, and in fact much higher than for some CMs [1]. We also noted numerous rounded objects varying in shape from spheres to oblate spheroids, and ranging up to 100µm in size (Fig. 2), which have been previously noted [3] but have not been well documented or appreciated. We characterized the mineralogy by transmission electron microscopy and found that they consist mainly of rather fine-grained, flaky single phase to intergrown serpentine and saponite. These two materials in fact dominate the bulk of the host CI1 chondrites. With the exception of sparse spinels, the rounded phyllosilicate objects are remarka-bly free of other minerals, suggesting that the precursor from which the phyllosilicates were derived was a homogeneous mate-rial. We suggest that these round phyllosilicates aggregates in CI1 chondrites were cryptocrystalline to glassy microchondrules. If so then CI chondrites cannot be considered chondrule-free. Small though they are, the abundance of these putative microchondrules is the same as that of chondrules in the Tagish Lake meteorite.

  3. Sociologia da ciência: realismo, idealismo e construtivismo

    Directory of Open Access Journals (Sweden)

    Vicente de Paula Gomes

    2013-12-01

    Full Text Available A virada neopragmática, crítica avassaladora da função fundante dos saberes autodefendida pela filosofia, radical ao ponto de incluir a própria vertente analítica de onde se originou, é, inexoravelmente, a fronteira atual do conhecimento filosófico, o golpe do movimento neopragmático à filosofia e à razão; contudo, deve ser avaliado como positivo. Ele possibilitou o retorno à consciência das matrizes conceituais genuínas desse saber ao apontar as propostas de superação do impasse: naturalismo estrito (QUINE, 1969, naturalismo fraco (HABERMAS, 2004, idealismo objetivo (HÖSLE, 1987, contextualismo (RORTY, 1994. Contribuíram, inquestionavelmente, para esse desfecho, os estudos históricos e sociológicos da ciência pós-kuhnianos, inspirados em sua filosofia da ciência. Inserindo-se tangencialmente nesse debate, o objeto de reflexão deste estudo é contrapor o ponto de vista da sociologia da ciência ao realismo e ao idealismo. Nosso intuito é demonstrar que o construtivismo que caracteriza seu modelo de inquirição não nega, como ingênua ou maliciosamente entendem seus críticos, a função determinante da natureza na construção da ciência. A força do nosso argumento emergirá da análise realizada pelos expoentes do strong programme em sociologia da ciência, Barry Barnes, David Bloor e John Henry (1996, no livro “Scientific Knowledge: a sociological analysis”, de um estudo de caso controverso da história da física: os experimentos que o físico norte-americano Robert Millikan realizou para estabelecer a carga do elétron.

  4. Pattern recognition and classification an introduction

    CERN Document Server

    Dougherty, Geoff

    2012-01-01

    The use of pattern recognition and classification is fundamental to many of the automated electronic systems in use today. However, despite the existence of a number of notable books in the field, the subject remains very challenging, especially for the beginner. Pattern Recognition and Classification presents a comprehensive introduction to the core concepts involved in automated pattern recognition. It is designed to be accessible to newcomers from varied backgrounds, but it will also be useful to researchers and professionals in image and signal processing and analysis, and in computer visi

  5. An introduction to mechanical engineering, pt.2

    CERN Document Server

    Clifford, Michael

    2010-01-01

    An Introduction to Mechanical Engineering: Part 2 is an essential text for all second-year undergraduate students as well as those studying foundation degrees and HNDs. The text provides thorough coverage of the following core engineering topics:Fluid dynamicsThermodynamicsSolid mechanicsControl theory and techniquesMechanical power, loads and transmissionsStructural vibrationAs well as mechanical engineers, the text will be highly relevant to automotive, aeronautical/aerospace and general engineering students.The material in this book has full student and lecturer support on an accompanying w

  6. An introduction to mechanical engineering, pt.1

    CERN Document Server

    Clifford, Michael; Shipway, Philip

    2012-01-01

    An Introduction to Mechanical Engineering is an essential text for all first-year undergraduate students as well as those studying for foundation degrees and HNDs. The text gives a thorough grounding in the following core engineering topics: thermodynamics, fluid mechanics, solid mechanics, dynamics, electricals and electronics, and materials science. As well as mechanical engineers, the text will be highly relevant to civil, automotive, aeronautical/aerospace and general engineering students.The text is written by an experienced team of first-year lecturers at the internationally renowned Uni

  7. Data Analysis and Data Mining An Introduction

    CERN Document Server

    Azzalini, Adelchi

    2012-01-01

    An introduction to statistical data mining, Data Analysis and Data Mining is both textbook and professional resource. Assuming only a basic knowledge of statistical reasoning, it presents core concepts in data mining and exploratory statistical models to students and professional statisticians-both those working in communications and those working in a technological or scientific capacity-who have a limited knowledge of data mining.This book presents key statistical concepts by way of case studies, giving readers the benefit of learning from real problems and real data. Aided by a diverse rang

  8. On the introduction of secondary fingerprint classification

    CSIR Research Space (South Africa)

    Msiza, IS

    2011-07-01

    Full Text Available of the fingerprint is extremely acute, hence ?x is extremely small. Figure 5 depicts all three A secondary fingerprint classes. 108 State of the Art in Biometrics On the Introduction of Secondary Fingerprint Classification 5 (a) A-1 secondary class (b) A-2... secondary class (c) A-3 secondary class Fig. 5. Fingerprint patterns that determine the A secondary classes. A-1 class: 0 cores & 0 deltas; A-2 class: equation 1; and A-3 class: equation 2 2.3 Left Loop (LL) primary class and its secondary classes...

  9. A ciência no espaço educacional da criança: do fazer ciência à ciência do fazer

    Directory of Open Access Journals (Sweden)

    Carolina Rodrigues de Souza

    2016-05-01

    Full Text Available This article aims to reflect on the possible articulations of the development of science in the education of children and their respective childhoods. While in Kindergarten and Elementary School students are, above all, children, and as such, subjects endowed with intelligence, emotions, and feelings. They are able to make observations, retain information, propose arguments, participate in discussions, and make choices that allow them to exercise free expression of theirs thoughts in many different languages. However, to ensure the effective participation of the child as a subject of today, not an intented being, it is necessary to reconsider the actions and relationships in the school environment. In this sense, this study highlights contributions on how the educational process of science can/should be thought in the process of children education. Also, we hope to provide access to scientific culture without detracting the childhoods. We highlight the possibility of using some powerful elements of science in the school environment to sharpen curiosity and improve new worldviews. Often different from the adult perspective, science in children education should emphasize issues such as the specificity of child logic, which encompasses creativity, imagination, fantasy, and desire. This article, in its theoretical nature, discusses notions such as childhood, children, and science in order to consider a type of early childhood education in which an educational routine with elements of scientific culture would enable the occurrence of childhood practice. Este artigo objetiva refletir sobre as possíveis articulações do desenvolvimento das ciências na educação das crianças e suas respectivas infâncias e parte da compreensão de que na Educação Infantil e nos primeiros anos do Ensino Fundamental, os estudantes antes de alunos são crianças, e como tais, são sujeitos completos, dotados de inteligência, emoções e sentimentos; capazes de

  10. Introduction to Artificial Neural Networks

    DEFF Research Database (Denmark)

    Larsen, Jan

    1999-01-01

    The note addresses introduction to signal analysis and classification based on artificial feed-forward neural networks.......The note addresses introduction to signal analysis and classification based on artificial feed-forward neural networks....

  11. On the relation of electrophysiological compound action potential (ECAP) measurements and perceptive skills in cochlear implant (CI) listeners

    OpenAIRE

    Linke, Theresa

    2017-01-01

    Background Cochlear Implants (CIs) provide near normal speech intelligibility in quiet environments to individuals suffering from sensorineural hearing loss. Perception of speech in situations with competing background noise and especially music appraisal however are still insufficient. Hence, improving speech perception in ambient noise and music intelligibility is a core challenge in CI research. Quantitatively assessing music intelligibility is a demanding task due to its inherently sub...

  12. A Simple Interactive Introduction to Teaching Genetic Engineering

    Science.gov (United States)

    Child, Paula

    2013-01-01

    In the UK, at key stage 4, students aged 14-15 studying GCSE Core Science or Unit 1 of the GCSE Biology course are required to be able to describe the process of genetic engineering to produce bacteria that can produce insulin. The simple interactive introduction described in this article allows students to consider the problem, devise a model and…

  13. An introduction to hacking and crimeware a pocket guide

    CERN Document Server

    Loewengart, Victoria

    2012-01-01

    An Introduction to Hacking & Crimeware is a comprehensive guide to the most recent and the more serious threats. Knowing about these threats will help you understand how to ensure that your computer systems are protected and that your business is safe, enabling you to focus on your core activities.

  14. Hollow Core, Whispering Gallery Resonator Sensors

    CERN Document Server

    Ward, Jonathan M; Chormaic, Síle Nic

    2014-01-01

    A review of hollow core whispering gallery resonators (WGRs)is given. After a short introduction to the topic of whispering gallery resonators we provide a description of whispering gallery modes in hollow or liquid core WGRs. Next, whispering gallery mode (WGM) sensing mechanisms are outlined and some fabrication methods for microbubbles, microcapillaries and other tubular WGM devices are discussed. We then focus on the most common applications of hollow core WGRs, namely refractive index and temperature sensing, gas sensing, force sensing, biosensing, and lasing. The review highlights some of the key papers in this field and gives the reader a general overview of the current state-of-the-art.

  15. Introduction to cardinal arithmetic

    CERN Document Server

    Holz, M; Weitz, E

    1999-01-01

    This book is an introduction into modern cardinal arithmetic in the frame of the axioms of Zermelo-Fraenkel set theory together with the axiom of choice (ZFC). A first part describes the classical theory developed by Bernstein, Cantor, Hausdorff, König and Tarski between 1870 and 1930. Next, the development in the 1970s led by Galvin, Hajnal and Silver is characterized. The third part presents the fundamental investigations in pcf theory which have been worked out by Shelah to answer the questions left open in the 1970s.Reviews:'The authors aim their text at beginners in set theory. They start

  16. Introduction to biosensors

    Science.gov (United States)

    Bhalla, Nikhil; Jolly, Pawan; Formisano, Nello

    2016-01-01

    Biosensors are nowadays ubiquitous in biomedical diagnosis as well as a wide range of other areas such as point-of-care monitoring of treatment and disease progression, environmental monitoring, food control, drug discovery, forensics and biomedical research. A wide range of techniques can be used for the development of biosensors. Their coupling with high-affinity biomolecules allows the sensitive and selective detection of a range of analytes. We give a general introduction to biosensors and biosensing technologies, including a brief historical overview, introducing key developments in the field and illustrating the breadth of biomolecular sensing strategies and the expansion of nanotechnological approaches that are now available. PMID:27365030

  17. Introduction to Waste Engineering

    DEFF Research Database (Denmark)

    Christensen, Thomas Højlund

    2011-01-01

    Solid waste management as introduced in Chapter 1.1 builds in many ways on engineering. Waste engineering here means the skills and ability to understand quantitatively how a waste management system works in such a detail that waste management can be planned, facilities can be designed and sited......) regional plans for waste management, including (3) the selection of main management technologies and siting of facilities, (4) the design of individual technological units and, for example, (5) the operation of recycling schemes within a municipality. This chapter gives an introduction to waste engineering...

  18. Introduction to laser technology

    CERN Document Server

    Hitz, C Breck; Hecht, Jeff; Hitz, C Breck; John Wiley & Sons

    2001-01-01

    Electrical Engineering Introduction to Laser Technology , Third Edition. Would you like to know how a laser works, and how it can be modified for your own specific tasks? This intuitive third edition-previously published as Understanding Laser Technology , First and Second Editions-introduces engineers, scientists, technicians, and novices alike to the world of modern lasers, without delving into the mathematical details of quantum electronics. It is the only introductory text on the market today that explains the underlying physics and engineering applicable to all lasers. A unique combinatio.

  19. Introduction to laser technology

    CERN Document Server

    Hitz, C Breck; Hecht, Jeff

    2012-01-01

    The only introductory text on the market today that explains the underlying physics and engineering applicable to all lasersAlthough lasers are becoming increasingly important in our high-tech environment, many of the technicians and engineers who install, operate, and maintain them have had little, if any, formal training in the field of electro-optics. This can result in less efficient usage of these important tools. Introduction to Laser Technology, Fourth Edition provides readers with a good understanding of what a laser is and what it can and cannot do. The book explains what types of las.

  20. An introduction to cosmology

    CERN Document Server

    Narlikar, Jayant Vishnu

    2002-01-01

    The third edition of this successful textbook is fully updated and includes important recent developments in cosmology. It begins with an introduction to cosmology and general relativity, and goes on to cover the mathematical models of standard cosmology. The physical aspects of cosmology, including primordial nucleosynthesis, the astroparticle physics of inflation, and the current ideas on structure formation are discussed. Alternative models of cosmology are reviewed, including the model of Quasi-Steady State Cosmology, which has recently been proposed as an alternative to Big Bang Cosmology.

  1. Introduction to mathematical logic

    CERN Document Server

    Mendelson, Elliott

    2015-01-01

    The new edition of this classic textbook, Introduction to Mathematical Logic, Sixth Edition explores the principal topics of mathematical logic. It covers propositional logic, first-order logic, first-order number theory, axiomatic set theory, and the theory of computability. The text also discusses the major results of Gödel, Church, Kleene, Rosser, and Turing.The sixth edition incorporates recent work on Gödel's second incompleteness theorem as well as restoring an appendix on consistency proofs for first-order arithmetic. This appendix last appeared in the first edition. It is offered in th

  2. Introduction to combinatorial designs

    CERN Document Server

    Wallis, WD

    2007-01-01

    Combinatorial theory is one of the fastest growing areas of modern mathematics. Focusing on a major part of this subject, Introduction to Combinatorial Designs, Second Edition provides a solid foundation in the classical areas of design theory as well as in more contemporary designs based on applications in a variety of fields. After an overview of basic concepts, the text introduces balanced designs and finite geometries. The author then delves into balanced incomplete block designs, covering difference methods, residual and derived designs, and resolvability. Following a chapter on the e

  3. Theoretical astrophysics an introduction

    CERN Document Server

    Bartelmann, Matthias

    2013-01-01

    A concise yet comprehensive introduction to the central theoretical concepts of modern astrophysics, presenting hydrodynamics, radiation, and stellar dynamics all in one textbook. Adopting a modular structure, the author illustrates a small number of fundamental physical methods and principles, which are sufficient to describe and understand a wide range of seemingly very diverse astrophysical phenomena and processes. For example, the formulae that define the macroscopic behavior of stellar systems are all derived in the same way from the microscopic distribution function. This function it

  4. Introduction to complex analysis

    CERN Document Server

    Priestley, H A

    2003-01-01

    Complex analysis is a classic and central area of mathematics, which is studied and exploited in a range of important fields, from number theory to engineering. Introduction to Complex Analysis was first published in 1985, and for this much awaited second edition the text has been considerably expanded, while retaining the style of the original. More detailed presentation is given of elementary topics, to reflect the knowledge base of current students. Exercise sets have beensubstantially revised and enlarged, with carefully graded exercises at the end of each chapter.This is the latest additi

  5. An introduction to webs

    Science.gov (United States)

    White, C. D.

    2016-04-01

    Webs are sets of Feynman diagrams that contribute to the exponents of scattering amplitudes, in the kinematic limit in which emitted radiation is soft. As such, they have a number of phenomenological and formal applications, and offer tantalizing glimpses into the all-order structure of perturbative quantum field theory. This article is based on a series of lectures given to graduate students, and aims to provide a pedagogical introduction to webs. Topics covered include exponentiation in (non-)abelian gauge theories, the web mixing matrix formalism for non-abelian gauge theories, and recent progress on the calculation of web diagrams. Problems are included throughout the text, to aid understanding.

  6. Fourier analysis an introduction

    CERN Document Server

    Stein, Elias M

    2003-01-01

    This first volume, a three-part introduction to the subject, is intended for students with a beginning knowledge of mathematical analysis who are motivated to discover the ideas that shape Fourier analysis. It begins with the simple conviction that Fourier arrived at in the early nineteenth century when studying problems in the physical sciences--that an arbitrary function can be written as an infinite sum of the most basic trigonometric functions.The first part implements this idea in terms of notions of convergence and summability of Fourier series, while highlighting applications such as th

  7. Introduction to Heat Pipes

    Science.gov (United States)

    Ku, Jentung

    2015-01-01

    This is the presentation file for the short course Introduction to Heat Pipes, to be conducted at the 2015 Thermal Fluids and Analysis Workshop, August 3-7, 2015, Silver Spring, Maryland. NCTS 21070-15. Course Description: This course will present operating principles of the heat pipe with emphases on the underlying physical processes and requirements of pressure and energy balance. Performance characterizations and design considerations of the heat pipe will be highlighted. Guidelines for thermal engineers in the selection of heat pipes as part of the spacecraft thermal control system, testing methodology, and analytical modeling will also be discussed.

  8. Introduction to information retrieval

    CERN Document Server

    Manning, Christopher D; Schütze, Hinrich

    2008-01-01

    Class-tested and coherent, this textbook teaches classical and web information retrieval, including web search and the related areas of text classification and text clustering from basic concepts. It gives an up-to-date treatment of all aspects of the design and implementation of systems for gathering, indexing, and searching documents; methods for evaluating systems; and an introduction to the use of machine learning methods on text collections. All the important ideas are explained using examples and figures, making it perfect for introductory courses in information retrieval for advanced un

  9. Game Theory An Introduction

    CERN Document Server

    Barron, E N

    2008-01-01

    A fundamental introduction to modern game theory from a mathematical viewpoint. Game theory arises in almost every fact of human and inhuman interaction since oftentimes during these communications objectives are opposed or cooperation is viewed as an option. From economics and finance to biology and computer science, researchers and practitioners are often put in complex decision-making scenarios, whether they are interacting with each other or working with evolving technology and artificial intelligence. Acknowledging the role of mathematics in making logical and advantageous decisions, Game

  10. An Introduction to Webs

    CERN Document Server

    White, C D

    2015-01-01

    Webs are sets of Feynman diagrams that contribute to the exponents of scattering amplitudes, in the kinematic limit in which emitted radiation is soft. As such, they have a number of phenomenological and formal applications, and offer tantalising glimpses into the all-order structure of perturbative quantum field theory. This article is based on a series of lectures given to graduate students, and aims to provide a pedagogical introduction to webs. Topics covered include exponentiation in (non-)abelian gauge theories, the web mixing matrix formalism for non-abelian gauge theories, and recent progress on the calculation of web diagrams. Problems are included throughout the text, to aid understanding.

  11. Introduction to Econophysics

    Science.gov (United States)

    Mantegna, Rosario N.; Stanley, H. Eugene

    2007-08-01

    Preface; 1. Introduction; 2. Efficient market hypothesis; 3. Random walk; 4. Lévy stochastic processes and limit theorems; 5. Scales in financial data; 6. Stationarity and time correlation; 7. Time correlation in financial time series; 8. Stochastic models of price dynamics; 9. Scaling and its breakdown; 10. ARCH and GARCH processes; 11. Financial markets and turbulence; 12. Correlation and anti-correlation between stocks; 13. Taxonomy of a stock portfolio; 14. Options in idealized markets; 15. Options in real markets; Appendix A: notation guide; Appendix B: martingales; References; Index.

  12. Introduction to cluster dynamics

    CERN Document Server

    Reinhard, Paul-Gerhard

    2008-01-01

    Clusters as mesoscopic particles represent an intermediate state of matter between single atoms and solid material. The tendency to miniaturise technical objects requires knowledge about systems which contain a ""small"" number of atoms or molecules only. This is all the more true for dynamical aspects, particularly in relation to the qick development of laser technology and femtosecond spectroscopy. Here, for the first time is a highly qualitative introduction to cluster physics. With its emphasis on cluster dynamics, this will be vital to everyone involved in this interdisciplinary subje

  13. Introduction to applied thermodynamics

    CERN Document Server

    Helsdon, R M; Walker, G E

    1965-01-01

    Introduction to Applied Thermodynamics is an introductory text on applied thermodynamics and covers topics ranging from energy and temperature to reversibility and entropy, the first and second laws of thermodynamics, and the properties of ideal gases. Standard air cycles and the thermodynamic properties of pure substances are also discussed, together with gas compressors, combustion, and psychrometry. This volume is comprised of 16 chapters and begins with an overview of the concept of energy as well as the macroscopic and molecular approaches to thermodynamics. The following chapters focus o

  14. Introduction to real analysis

    CERN Document Server

    Schramm, Michael J

    2008-01-01

    This text forms a bridge between courses in calculus and real analysis. It focuses on the construction of mathematical proofs as well as their final content. Suitable for upper-level undergraduates and graduate students of real analysis, it also provides a vital reference book for advanced courses in mathematics.The four-part treatment begins with an introduction to basic logical structures and techniques of proof, including discussions of the cardinality concept and the algebraic and order structures of the real and rational number systems. Part Two presents in-depth examinations of the compl

  15. Guest Editor's Introduction

    DEFF Research Database (Denmark)

    Seeberg, Peter

    2015-01-01

    This introductory article’s point of departure is the transformation processes that have taken place in theMiddle East since 2011. It presents perspectives in the academic discussions following the surprising events in a post-‘Arab Spring’ scenario. The Introduction emphasizes that it is the ambi...... that it is the ambition of this collection of articles to discuss and make sense of the significant differences in the developments,where newgeopolitical dynamics reshape theMENA-region’s post-‘Arab Spring’ reality....

  16. Introduction to Numerical Methods

    Energy Technology Data Exchange (ETDEWEB)

    Schoonover, Joseph A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-06-14

    These are slides for a lecture for the Parallel Computing Summer Research Internship at the National Security Education Center. This gives an introduction to numerical methods. Repetitive algorithms are used to obtain approximate solutions to mathematical problems, using sorting, searching, root finding, optimization, interpolation, extrapolation, least squares regresion, Eigenvalue problems, ordinary differential equations, and partial differential equations. Many equations are shown. Discretizations allow us to approximate solutions to mathematical models of physical systems using a repetitive algorithm and introduce errors that can lead to numerical instabilities if we are not careful.

  17. Introduction to superconductivity

    CERN Document Server

    Rose-Innes, AC

    1978-01-01

    Introduction to Superconductivity differs from the first edition chiefly in Chapter 11, which has been almost completely rewritten to give a more physically-based picture of the effects arising from the long-range coherence of the electron-waves in superconductors and the operation of quantum interference devices. In this revised second edition, some further modifications have been made to the text and an extra chapter dealing with """"high-temperature"""" superconductors has been added. A vast amount of research has been carried out on these since their discovery in 1986 but the results, both

  18. Introduction to Coordination Chemistry

    CERN Document Server

    Lawrance, Geoffrey Alan

    2010-01-01

    Introduction to Coordination Chemistry examines and explains how metals and molecules that bind as ligands interact, and the consequences of this assembly process. This book describes the chemical and physical properties and behavior of the complex assemblies that form, and applications that may arise as a result of these properties. Coordination complexes are an important but often hidden part of our world?even part of us?and what they do is probed in this book. This book distills the essence of this topic for undergraduate students and for research scientists.

  19. Introduction to Interventional MRI

    Institute of Scientific and Technical Information of China (English)

    Jarmo Ruohonen; William G.Bradley; Jr.MD

    2002-01-01

    An increasing number of interventional procedures are done under imaging guidance. These include biopsies, drainages and injections. Likewise, imaging guidance and monitoring have enabled the use of sophisticated techniques for minimally invasive therapy of tumors. Since MRI provides the best tissue contrast and lesion sensitivity,the use of MR-guided procedures (MRGP) is quickly gaining momentum. Special hardware and software solutions have been developed that allow more efficient interventional use of the MR scanner.This introduction summarizes the basic concepts of interventional MRI and outlines some of the applications of today and tomorrow.

  20. Introduction to modern cryptography

    CERN Document Server

    Katz, Jonathan

    2014-01-01

    Praise for the First Edition:""This book is a comprehensive, rigorous introduction to what the authors name 'modern' cryptography. … a novel approach to how cryptography is taught, replacing the older, construction-based approach. … The concepts are clearly stated, both in an intuitive fashion and formally. … I would heartily recommend this book to anyone who is interested in cryptography. … The exercises are challenging and interesting, and can benefit readers of all academic levels.""-IACR Book Reviews, January 2010""Over the past 30 years, cryptography has been transformed from a mysterious

  1. Introduction to continuum mechanics

    CERN Document Server

    Lai, W Michael; Rubin, David

    1996-01-01

    Introduction to Continuum Mechanics is a recently updated and revised text which is perfect for either introductory courses in an undergraduate engineering curriculum or for a beginning graduate course.Continuum Mechanics studies the response of materials to different loading conditions. The concept of tensors is introduced through the idea of linear transformation in a self-contained chapter, and the interrelation of direct notation, indicial notation, and matrix operations is clearly presented. A wide range of idealized materials are considered through simple static and dynamic problems, a

  2. Cartesian tensors an introduction

    CERN Document Server

    Temple, G

    2004-01-01

    This undergraduate text provides an introduction to the theory of Cartesian tensors, defining tensors as multilinear functions of direction, and simplifying many theorems in a manner that lends unity to the subject. The author notes the importance of the analysis of the structure of tensors in terms of spectral sets of projection operators as part of the very substance of quantum theory. He therefore provides an elementary discussion of the subject, in addition to a view of isotropic tensors and spinor analysis within the confines of Euclidean space. The text concludes with an examination of t

  3. Introduction to EMC

    CERN Document Server

    Scott, John

    1997-01-01

    This is the clear guide for non-specialists to electromagnetic compatability (EMC), the effects of electromagnetic radiation and the European EMC Directive which is now in force. This book helps by explaining the basic principles of EMC, how it may be controlled in practice through filtering, shielding, appropriate printed circuit board design, and other means. Electrostatic discharge (ESD) and surge protection are discussed. The growing concern about the effects of electromagnetic waves and fields on health are examined in detail.This introduction provides beginners, technical and

  4. Theoretical Optics An Introduction

    CERN Document Server

    Römer, Hartmann

    2004-01-01

    Starting from basic electrodynamics, this volume provides a solid, yet concise introduction to theoretical optics, containing topics such as nonlinear optics, light-matter interaction, and modern topics in quantum optics, including entanglement, cryptography, and quantum computation. The author, with many years of experience in teaching and research, goes way beyond the scope of traditional lectures, enabling readers to keep up with the current state of knowledge. Both content and presentation make it essential reading for graduate and phD students as well as a valuable reference for researche

  5. Introduction to functional equations

    CERN Document Server

    Sahoo, Prasanna K

    2011-01-01

    Introduction to Functional Equations grew out of a set of class notes from an introductory graduate level course at the University of Louisville. This introductory text communicates an elementary exposition of valued functional equations where the unknown functions take on real or complex values. In order to make the presentation as manageable as possible for students from a variety of disciplines, the book chooses not to focus on functional equations where the unknown functions take on values on algebraic structures such as groups, rings, or fields. However, each chapter includes sections hig

  6. Statistics a biomedical introduction

    CERN Document Server

    Brown, Byron Wm

    2009-01-01

    CHAPTER 1: Introduction 1 CHAPTER 2: Elementary Rules of Probability 13 CHAPTER 3: Populations, Samples, and the Distribution of the Sample Mean 37 1. Populations and Distributions 38 2. Sampling from Finite Populations 64 3. The Distribution of the Sample Mean 72 CHAPTER 4: Analysis of Matched Pairs Using Sample Means 85 1. A Confidence Interval for the Treatment Effect 86 2. A Hypothesis Test for the Treatment Effect 96 3. Determining the Sample Size 102 CHAPTER 5: Analysis of the Two-Sample Location Problem Using Sample Means 109 1. A Confidence Interval for the Diffe

  7. History as Modernity. Introduction

    Directory of Open Access Journals (Sweden)

    Pierangelo Schiera

    2016-12-01

    Full Text Available The introduction starts from the exhaustion of modernity, drawing the fundamental lines of its development inside Western historical experience. The end of the political nexus between theology and politics, the evanescence of nation-state sovereignty, the check of great historical interpretations reveal the necessity of new categories and new organizational models, able to make us answer to the violence that the ongoing processes are liberating. Schiera underlines in particular the relevance of the administrative apparatus because of its capacity to link the global government with global organization, human rights and the commons.

  8. Introduction to dynamic programming

    CERN Document Server

    Cooper, Leon; Rodin, E Y

    1981-01-01

    Introduction to Dynamic Programming provides information pertinent to the fundamental aspects of dynamic programming. This book considers problems that can be quantitatively formulated and deals with mathematical models of situations or phenomena that exists in the real world.Organized into 10 chapters, this book begins with an overview of the fundamental components of any mathematical optimization model. This text then presents the details of the application of dynamic programming to variational problems. Other chapters consider the application of dynamic programming to inventory theory, Mark

  9. An introduction to optimization

    CERN Document Server

    Chong, Edwin K P

    2013-01-01

    Praise for the Third Edition "". . . guides and leads the reader through the learning path . . . [e]xamples are stated very clearly and the results are presented with attention to detail.""  -MAA Reviews  Fully updated to reflect new developments in the field, the Fourth Edition of Introduction to Optimization fills the need for accessible treatment of optimization theory and methods with an emphasis on engineering design. Basic definitions and notations are provided in addition to the related fundamental background for linear algebra, geometry, and calculus.  This new

  10. Computational topology an introduction

    CERN Document Server

    Edelsbrunner, Herbert

    2010-01-01

    Combining concepts from topology and algorithms, this book delivers what its title promises: an introduction to the field of computational topology. Starting with motivating problems in both mathematics and computer science and building up from classic topics in geometric and algebraic topology, the third part of the text advances to persistent homology. This point of view is critically important in turning a mostly theoretical field of mathematics into one that is relevant to a multitude of disciplines in the sciences and engineering. The main approach is the discovery of topology through alg

  11. Introduction to finite geometries

    CERN Document Server

    Kárteszi, F

    1976-01-01

    North-Holland Texts in Advanced Mathematics: Introduction to Finite Geometries focuses on the advancements in finite geometries, including mapping and combinatorics. The manuscript first offers information on the basic concepts on finite geometries and Galois geometries. Discussions focus on linear mapping of a given quadrangle onto another given quadrangle; point configurations of order 2 on a Galois plane of even order; canonical equation of curves of the second order on the Galois planes of even order; and set of collineations mapping a Galois plane onto itself. The text then ponders on geo

  12. Introduction to tribology

    CERN Document Server

    Bhushan, Bharat

    2013-01-01

    A fully updated version of the popular Introduction to Tribology, the second edition of this leading tribology text introduces the major developments in the understanding and interpretation of friction, wear and lubrication.  Considerations of friction and wear have been fully revised to include recent analysis and data work, and friction mechanisms have been reappraised in light of current developments.   In this edition, the breakthroughs in tribology at the nano- and micro- level as well as recent developments in nanotechnology and magnetic storage technologies are introduce

  13. Introduction to information science

    CERN Document Server

    Bawden, David

    2012-01-01

    This landmark textbook takes a whole subject approach to Information Science as a discipline. Introduced by leading international scholars and offering a global perspective on the discipline, this is designed to be the standard text for students worldwide. The authors' expert narrative guides you through each of the essential building blocks of information science offering a concise introduction and expertly chosen further reading and resources.Critical topics covered include:foundations: concepts, theories and historical perspectivesorganising and retrieving Information information behaviour,

  14. Neurolaw: A brief introduction.

    Directory of Open Access Journals (Sweden)

    Arian Petoft

    2015-03-01

    Full Text Available Neurolaw, as an interdisciplinary field which links the brain to law, facilitates the pathway to better understanding of human behavior in order to regulate it accurately through incorporating neuroscience achievements in legal studies. Since 1990's, this emerging field, by study on human nervous system as a new dimension of legal phenomena, leads to a more precise explanation for human behavior to revise legal rules and decision-makings. This paper strives to bring about significantly a brief introduction to neurolaw so as to take effective steps toward exploring and expanding the scope of law and more thorough understanding of legal issues in the field at hand.

  15. Quantum chemistry an introduction

    CERN Document Server

    Kauzmann, Walter

    2013-01-01

    Quantum Chemistry: An Introduction provides information pertinent to the fundamental aspects of quantum mechanics. This book presents the theory of partial differentiation equations by using the classical theory of vibrations as a means of developing physical insight into this essential branch of mathematics.Organized into five parts encompassing 16 chapters, this book begins with an overview of how quantum mechanical deductions are made. This text then describes the achievements and limitations of the application of quantum mechanics to chemical problems. Other chapters provide a brief survey

  16. Introduction to data technologies

    CERN Document Server

    Murrell, Paul

    2009-01-01

    Providing key information on how to work with research data, Introduction to Data Technologies presents ideas and techniques for performing critical, behind-the-scenes tasks that take up so much time and effort yet typically receive little attention in formal education. With a focus on computational tools, the book shows readers how to improve their awareness of what tasks can be achieved and describes the correct approach to perform these tasks. Practical examples demonstrate the most important pointsThe author first discusses how to write computer code using HTML as a concrete example. He th

  17. How Common Is the Common Core?

    Science.gov (United States)

    Thomas, Amande; Edson, Alden J.

    2014-01-01

    Since the introduction of the Common Core State Standards for Mathematics (CCSSM) in 2010, stakeholders in adopting states have engaged in a variety of activities to understand CCSSM standards and transition from previous state standards. These efforts include research, professional development, assessment and modification of curriculum resources,…

  18. A CAI in the Ivuna CI1 Chondrite

    Science.gov (United States)

    Frank, David R.; Zolensky, M.; Martinez, J.; Mikouchi, T.; Ohsumi, K.; Hagiya, K.; Satake, W.; Le, L.; Ross, D.; Peslier, A.

    2011-01-01

    We have recently discovered the first well-preserved calcium aluminum-rich inclusion (CAI) in a CI1 chondrite (Ivuna). Previously, all CI1 chondrites were thought to be devoid of preserved CAI and chondrules due to the near total aqueous alteration to which their parent body (bodies) have been subjected. The CAI is roughly spherical, but with a slight teardrop geometry and a maximum diameter of 170 microns (fig. 1). It lacks any Wark-Lovering Rim. Incipient aqueous alteration, and probably shock, have rendered large portions of the CAI poorly crystalline. It is extremely fine-grained, with only a few grains exceeding 10 microns. We have performed electron microprobe analyses (EPMA), FEG-SEM imaging and element mapping, as well as electron back-scattered diffraction (EBSD) and synchrotron X-ray diffraction (SXRD) in order to determine the fundamental characteristics of this apparently unique object.

  19. Zdrowie i medycyna - wyzwania przyszłości

    OpenAIRE

    Pasowicz, Mieczysław

    2013-01-01

    Praca recenzowana / peer-reviewed paper Monografia „Zdrowie i medycyna – wyzwania przyszłości” składa się z czterech części. Podstawowym przesłaniem książki jest omówienie demograficznych i ekonomicznych wyzwań przyszłości, ich przewidywanego wpływu na zdrowie i systemy ochrony zdrowia oraz rozwój medycyny. Monografia stanowi kompleksowy przegląd zjawisk wpływających na kształt przyszłej ochrony zdrowia wraz z omówieniem różnorodnych mechanizmów, które można wykorzystać do z...

  20. Characteristics of CI children with complicated middle ear infections

    DEFF Research Database (Denmark)

    Hoberg, Søren; Danstrup, Christian; Laursen, Bjarke

    2017-01-01

    OBJECTIVE: To describe cases of complicated middle ear infections in children with cochlear implants (CI), i.e., episodes of acute otitis media (AOM) and acute mastoiditis (AM), resulting in hospitalization. METHODS: A total of 206 children under 16 years (300 implantations) were implanted between...... months, respectively. Children younger than 2 years were at highest risk of AOM and/or AM. All had antibiotics prescribed before admittance, and two- thirds of infected ears had already ventilation tubes inserted. Bacteria could not be detected in more than half of cases. The most frequently isolated...... of ventilation tubes is still much debated and more research in this field is needed. CONCLUSION: AOM and/or AM were seen in Danish children with CI as often as in other western countries. Treatment of complicated middle ear infections was sufficient with IV cephalosporin and ventilation tube insertion. Special...

  1. Notas sobre o autotelismo discursivo em ciências humanas

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Lopes

    1994-12-01

    Full Text Available O Ateliê de Semiótica Discursiva, coordenado por Denis Bertrand, propôs focalizar, no ano letivo 1991-1992, a " Estética do Discurso Erudito", no quadro da temática "Estética da Ética" do Seminário de Semântica Geral, de A.J . Greimas, na Escola de Altos Estudos em Ciências Sociais de Paris (E. H. E. S. S.. Bertrand distribuiu cópias de trechos de textos célebres em ciências humanas (Lévi-Strauss, Deleuze e Guattari, Greimas, Barthes, Foucault e outros, sobre os quais os participantes deveriam realizar análises que tomassem como modelo, por exemplo, aquelas praticadas por Greimas e Landowski em lntroduction à L 'Analyse du Discours en Sciences Sociales ( 1979.

  2. História da ciência

    OpenAIRE

    2007-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Programa de Pós-Graduação em Educação Científica e Tecnológica. No presente trabalho apresento os resultados obtidos na investigação da História da Ciência veiculada nas duas coleções de livros didáticos de ciência do ensino fundamental de 5ª a 8ª série, mais usadas nas escolas que compõem a 16ª Gerência de Educação do Estado de Santa Catarina. Para realização da investigação utilizei uma ficha composta por sete tópicos, subd...

  3. Combustion and Performance Characteristics of CI Engine Running with Biodiesel

    OpenAIRE

    Tesfa, Belachew; Mishra, Rakesh; Gu, Fengshou; Ball, Andrew

    2013-01-01

    Biodiesel is one of the alternative fuels which is renewable and environmentally friendly and can be used in diesel engines with little or no modifications. In the present study, experimental investigations were carried out on the effects of biodiesel types, biodiesel fraction and physical properties on the combustion and performance characteristics of a compression ignition (CI) engine. The experimental work was conducted on a four-cylinder, four -stroke, direct injection (DI) and turbocharg...

  4. Excited states of Ne isoelectronic ions: SAC-CI study

    Energy Technology Data Exchange (ETDEWEB)

    Das, A.K.; Ehara, M.; Nakatsuji, H. [Kyoto Univ. (Japan). Faculty of Engineering

    2001-02-01

    Excited states of the s, p, and d symmetries up to principal quantum number n = 4 are studied for the first eight members of Ne isoelectronic sequence (Ne to Cl{sup 7+}) by the SAC-CI (symmetry-adapted-cluster configuration-interaction) method. The valence STO basis sets of Clementi et al. and the optimized excited STO are used by the STO-6G expansion method. The calculated transition energies agree well with the experimental values wherever available. (orig.)

  5. A busca da transdisciplinaridade nas ciências humanas

    Directory of Open Access Journals (Sweden)

    Aloísio Krohling

    2007-08-01

    Full Text Available Este artigo busca elaborar uma retrospectiva histórica das raízes epistemológicas do pensamento moderno, passando pelo Iluminismo e todas as correntes teóricas, seguidoras da mesma fonte metodológica e epistemológica do SABER INSTRUMENTAL, o que se refletiu nas várias áreas do saber do campo das Ciências Humanas, com o objetivo de mostrar a importância da busca da transdisciplinaridade e da interdisciplinaridade nas Ciências Humanas, com o resgate do paradigma do Múltiplo. A busca da transdisciplinaridade será o fio da meada no sentido de voltar ao MÚLTIPLO heraclitiano e resgatar o “Pantha Rei” das mudanças e contradições da História e da cultura ocidentais. Questiona o atomismo e a fragmentação disciplinar da maioria dos cursos de graduação na área de Ciências Humanas, mormente na Educação, e de modo exacerbado no curso de Direito, com as suas dezenas de disciplinas atomizadas e fragmentadas e sem um fio condutor. É proposta a busca da transdisciplinaridade para o resgate da Metodologia Dialética e da Filosofia da Educação e Filosofia do Direito como as duas grandes alavancas para uma visão e prática holísticas nos Cursos de Educação e Direito bem como na área das Ciências Humanas.

  6. Skinner: sobre ciência e comportamento humano

    Directory of Open Access Journals (Sweden)

    Angelo Augusto Silva Sampaio

    Full Text Available Atualmente, não se pode pensar no estudo do comportamento humano sem considerar a abordagem científica a este objeto: o campo da Psicologia científica. Esse campo é disputado por diversos enfoques teóricos que divergem quanto ao modo como definem ciência e comportamento humano. A abordagem de B. F. Skinner foi bastante proeminente no século XX, mas ainda continua a ser mal-entendida. Partindo do desenvolvimento histórico de sua obra, o presente texto visa a iluminar alguns aspectos relacionados às noções de ciência e comportamento humano desse autor e ressaltar as transformações por que passaram. Analisam-se três tópicos da obra de Skinner: seu período inicial (de 1930 a cerca de 1938, a obra "Ciência e Comportamento Humano" de 1953, e as influências da Biologia. São enfatizados aspectos relevantes da sua teorização sobre o tema: busca por relações funcionais, ênfase nos dados empíricos, operacionismo, externalismo, multideterminação do comportamento, experimentalismo, previsão e controle, ética.

  7. O Alienista: loucura, poder e ciência

    Directory of Open Access Journals (Sweden)

    ROBERTO GOMES

    1993-12-01

    Full Text Available Este artigo analisa o conto de Machado de Assis, O Alienista. Ficção centrada nos delírios de Simão Bacamarte, médico-psiquiatra, nela estão referidas as pretensões e impasses das concepções científicas do século XIX, em particular do Positivismo, que tem vínculos profundos com o nascimento das Ciências Humanas. De um lado, a sede de explicação rigorosa de seu objeto, no caso, a Loucura, e, de outro, o direito que se arroga de dizer a verdade a respeito da Loucura e do Louco e de agir sobre ele com plenos e legítimos direitos. A obra de Machado denuncia o vínculo entre ciência e poder bem como a usurpação, pelo homem de ciência, do direito que cada um tem de dizer a sua própria verdade. O que conduz à ironia final: parece haver mais loucura na pretensão de estabelecer com nitidez a linha divisória entre Razão e Loucura do que em perder-se entre seus supostos limites.

  8. GUEST EDITORS' INTRODUCTION: Guest Editors' introduction

    Science.gov (United States)

    Guerraoui, Rachid; Vinoski, Steve

    1997-09-01

    The organization of a distributed system can have a tremendous impact on its capabilities, its performance, and its ability to evolve to meet changing requirements. For example, the client - server organization model has proven to be adequate for organizing a distributed system as a number of distributed servers that offer various functions to client processes across the network. However, it lacks peer-to-peer capabilities, and experience with the model has been predominantly in the context of local networks. To achieve peer-to-peer cooperation in a more global context, systems issues of scale, heterogeneity, configuration management, accounting and sharing are crucial, and the complexity of migrating from locally distributed to more global systems demands new tools and techniques. An emphasis on interfaces and modules leads to the modelling of a complex distributed system as a collection of interacting objects that communicate with each other only using requests sent to well defined interfaces. Although object granularity typically varies at different levels of a system architecture, the same object abstraction can be applied to various levels of a computing architecture. Since 1989, the Object Management Group (OMG), an international software consortium, has been defining an architecture for distributed object systems called the Object Management Architecture (OMA). At the core of the OMA is a `software bus' called an Object Request Broker (ORB), which is specified by the OMG Common Object Request Broker Architecture (CORBA) specification. The OMA distributed object model fits the structure of heterogeneous distributed applications, and is applied in all layers of the OMA. For example, each of the OMG Object Services, such as the OMG Naming Service, is structured as a set of distributed objects that communicate using the ORB. Similarly, higher-level OMA components such as Common Facilities and Domain Interfaces are also organized as distributed objects that can

  9. Achieving micelle control through core crystallinity.

    Science.gov (United States)

    Glavas, Lidija; Olsén, Peter; Odelius, Karin; Albertsson, Ann-Christine

    2013-11-11

    We have designed a pathway for controlling the critical micelle concentration and micelle size of polyester-based systems. This was achieved by creating an array of different copolymers with semicrystalline or amorphous hydrophobic blocks. The hydrophobic block was constructed through ring-opening polymerization of ε-caprolactone, L-lactide, and ε-decalactone, either as homopolymers or random copolymers, using PEG as both the initiator and the hydrophilic block. Micelles formed with amorphous cores exhibited considerably higher critical micelle concentrations than those with semicrystalline cores. Micelles with amorphous cores also became larger in size with an increased molecular weight of the hydrophobic bock, in contrast to micelles with semicrystalline cores, which displayed the opposite behavior. Hence, core crystallinity was found to be a potent tool for tailoring micelle properties and thereby facilitating the optimization of drug delivery systems. The introduction of PEG-PεDL also proved to be a valuable asset in the tuning of micelle properties.

  10. Causas e leis nas ciências do homem

    Directory of Open Access Journals (Sweden)

    Sara Albieri

    2011-12-01

    Full Text Available A proposta humeana acerca do método e da investigação na ciência do homem tornou-o um precursor do conhecido modelo covering-law de explicação científica, tal como defendido por Hempel, Nagel e outros filósofos contemporâneos da ciência. A interpretação da teoria da ciência de Hume como precursora desse modelo costuma ser majoritária entre os comentadores de sua filosofia. Apenas Donald Livingston travou uma discussão singular contra essa quase unanimidade, propondo-se a defender a existência de dois modelos de explicação na epistemologia de Hume, um adequado às ciências naturais, outro às morais. O autor apóia-se em certas passagens em que Hume parece reconhecer que, em ciências morais, predominariam as explicações recorrendo a causas morais, as quais consistiriam nas razões do agente ou conjunto de agentes envolvidos no evento a ser explicado. Defendemos que a diversidade das explicações causais naturais e morais em Hume pode ser discutida, não a partir de uma distinção radical de natureza, como aquela que Livingston quer estabelecer, mas a partir de uma distinção de grau: os graus de certeza que distinguem entre provas e probabilidades, entre explicações pela via dedutiva a partir de leis ou por generalizações estatísticas. Isto é, mais de acordo com a assimetria que Nagel reconhece entre ciências do particular e generalizadoras, quanto ao objetivo de estabelecer leis, no segundo caso, ou de apenas aplicá-las, no primeiro. Uma distinção compatível com aquela que Hume já adotara, atribuindo graus diferentes de generalidade de modo análogo a ciências naturais ou morais.Hume's proposal of a science of man is often taken as a precursor of the now well-known covering-law model of scientific explanation, sustained by Hempel, Nagel and other contemporary philosophers of science. Among Hume's commentators D. Livingston is an exception, defending the existence of two models of explanation in Hume

  11. A psicanálise freudiana e a dualidade entre ciências naturais e ciências humanas

    Directory of Open Access Journals (Sweden)

    Richard Theisen Simanke

    2009-06-01

    Full Text Available Este artigo discute a tomada de posição freudiana em favor de uma epistemologia naturalista. Ele procura circunscrever a especificidade do naturalismo psicológico que Freud reivindica e, a seguir, avaliar em que medida a epistemologia freudiana pode fornecer um modelo para o questionamento da dualidade que opõe as ciências naturais às ciências humanas.This paper discusses Freud's standing in favor of a naturalist epistemology. It seeks to circumscribe the specificity of the psychological naturalism claimed by him and, next, to evaluate the extent of Freudian epistemology as a model for challenging the duality which opposes natural and human sciences.

  12. DNA damage in isolated rat hepatocytes exposed to C.I. pigment orange 5 and C.I. pigment yellow 12 by the alkaline comet assay

    DEFF Research Database (Denmark)

    Møller, P; Wallin, Håkan; Grunnet, N

    1998-01-01

    The induction of DNA damage by commonly used printing ink pigments, C.I. pigment orange 5 (C.I. 12075) and C.I. pigment yellow 12 (C.I. 21090), was investigated in freshly isolated rat hepatocytes with the comet assay. C.I. pigment yellow 12 is a 3,3'-dichlorobenzidine-based diarylide pigment, an......]quinoxaline. Our data indicate that both C.I. pigment orange 5 and C.I. pigment yellow 12 are genotoxic in hepatocytes with metabolizing capacities. However, further investigation of the metabolism and disposition are required for the evaluation of the safety of these pigments....

  13. Introduction to computer ethics

    Directory of Open Access Journals (Sweden)

    Ćorić Dragana M.

    2015-01-01

    Full Text Available Ethics is becoming one of the most often used but also misinter­preted words. It is often taken as an additional, corrective parameter to the policies and strategies that has to be adopted in the area of political works, environment, business, and medicine. Computer ethics thus makes the latest ethical discipline in the scientific sky. But its roots, as it was the case with environmental ethics, ranging decades; only the speech and the use of the same, as well as discussions on the postulates of computer ethics, are the results of rapid IT development in the last decade or two. In this paper, according to the title, will be shown introduction to computer ethics-its basis, the most important representatives, as well as the most important succession.

  14. Introduction to lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, R.

    1998-12-31

    The goal of the lectures on lattice QCD (LQCD) is to provide an overview of both the technical issues and the progress made so far in obtaining phenomenologically useful numbers. The lectures consist of three parts. The author`s charter is to provide an introduction to LQCD and outline the scope of LQCD calculations. In the second set of lectures, Guido Martinelli will discuss the progress they have made so far in obtaining results, and their impact on Standard Model phenomenology. Finally, Martin Luescher will discuss the topical subjects of chiral symmetry, improved formulation of lattice QCD, and the impact these improvements will have on the quality of results expected from the next generation of simulations.

  15. Introduction to general relativity

    CERN Document Server

    Parthasarthy, R

    2016-01-01

    INTRODUCTION TO GENERAL RELATIVITY begins with a description of the geometry of curved space, explaining geodesics, parallel transport, covariant differentiation, geodesic deviation and spacetime symmetry by killing vectors. It then introduces Einstein's theory of gravitation followed by Schwarzschild solution with its relevance to Positive Mass theorem. The three tests for Einstein's gravity are explained. Other exact solutions such as Vaidya, Kerr and Reisner - Nordstrom metric are included. In the Chapter on cosmological solutions, a detailed description of Godel metric is provided. It then introduces five dimensional spacetime of Kaluza showing the unification of gravity with electromagnetism. This is extended to include non-Abelian gauge theory by invoking compact extra dimensions. Explicit expressions in this case for Christoffel connections and ricci tensor are derived and the higher dimensional gravity action is shown to compactification are given.

  16. Introduction to Waste Management

    DEFF Research Database (Denmark)

    Christensen, Thomas Højlund

    2011-01-01

    Solid waste management is as old as human civilization, although only considered an engineering discipline for about one century. The change from the previous focus on public cleansing of the cities to modern waste management was primarily driven by industrialization, which introduced new materials...... and chemicals, dramatically changing the types and composition of waste, and by urbanization making waste management in urban areas a complicated and costly logistic operation. This book focuses on waste that commonly appears in the municipal waste management system. This chapter gives an introduction to modern...... waste management, including issues as waste definition, problems associated with waste, waste management criteria and approaches to waste management. Later chapters introduce aspects of engineering (Chapter 1.2), economics (Chapter 1.3) and regulation (Chapter 1.4)....

  17. Solar energy an introduction

    CERN Document Server

    Mackay, Michael E

    2015-01-01

    Solar Energy presents an introduction to all aspects of solar energy, from photovoltaic devices to active and passive solar thermal energy conversion, giving both a detailed and broad perspective of the field. It is aimed at the beginner involved in solar energy or a related field, or for someone wanting to gain a broader perspective of solar energy technologies. A chapter considering solar radiation, basic principles applied to solar energy, semiconductor physics, and light absorption brings the reader on equal footing with the technology of either solar generated electrical current or useful heat. Details of how a solar cell works and then production of current from a photovoltaic device is discussed. Characterization of a solar cell is examined, allowing one the ability to interpret the current-voltage relation, followed by discussion of parameter extraction from this relation. This information can be used to understand what limits the performance of a given solar cell with the potential to optimize its pe...

  18. Introduction to Complex Plasmas

    CERN Document Server

    Bonitz, Michael; Ludwig, Patrick

    2010-01-01

    Complex plasmas differ from traditional plasmas in many ways: these are low-temperature high pressure systems containing nanometer to micrometer size particles which may be highly charged and strongly interacting. The particles may be chemically reacting or be in contact with solid surfaces, and the electrons may show quantum behaviour. These interesting properties have led to many applications of complex plasmas in technology, medicine and science. Yet complex plasmas are extremely complicated, both experimentally and theoretically, and require a variety of new approaches which go beyond standard plasma physics courses. This book fills this gap presenting an introduction to theory, experiment and computer simulation in this field. Based on tutorial lectures at a very successful recent Summer Institute, the presentation is ideally suited for graduate students, plasma physicists and experienced undergraduates.

  19. Morbillivirus Infections: An Introduction

    Directory of Open Access Journals (Sweden)

    Rory D. de Vries

    2015-02-01

    Full Text Available Research on morbillivirus infections has led to exciting developments in recent years. Global measles vaccination coverage has increased, resulting in a significant reduction in measles mortality. In 2011 rinderpest virus was declared globally eradicated – only the second virus to be eradicated by targeted vaccination. Identification of new cellular receptors and implementation of recombinant viruses expressing fluorescent proteins in a range of model systems have provided fundamental new insights into the pathogenesis of morbilliviruses, and their interactions with the host immune system. Nevertheless, both new and well-studied morbilliviruses are associated with significant disease in wildlife and domestic animals. This illustrates the need for robust surveillance and a strategic focus on barriers that restrict cross-species transmission. Recent and ongoing measles outbreaks also demonstrate that maintenance of high vaccination coverage for these highly infectious agents is critical. This introduction briefly summarizes the most important current research topics in this field.

  20. Introduction to Tidal Streams

    Science.gov (United States)

    Newberg, Heidi Jo

    Dwarf galaxies that come too close to larger galaxies suffer tidal disruption; the differential gravitational force between one side of the galaxy and the other serves to rip the stars from the dwarf galaxy so that they instead orbit the larger galaxy. This process produces "tidal streams" of stars, which can be found in the stellar halo of the Milky Way, as well as in halos of other galaxies. This chapter provides a general introduction to tidal streams, including the mechanism through which the streams are created, the history of how they were discovered, and the observational techniques by which they can be detected. In addition, their use in unraveling galaxy formation histories and the distribution of dark matter in galaxies is discussed, as is the interaction between these dwarf galaxy satellites and the disk of the larger galaxy.

  1. Introduction to variance estimation

    CERN Document Server

    Wolter, Kirk M

    2007-01-01

    We live in the information age. Statistical surveys are used every day to determine or evaluate public policy and to make important business decisions. Correct methods for computing the precision of the survey data and for making inferences to the target population are absolutely essential to sound decision making. Now in its second edition, Introduction to Variance Estimation has for more than twenty years provided the definitive account of the theory and methods for correct precision calculations and inference, including examples of modern, complex surveys in which the methods have been used successfully. The book provides instruction on the methods that are vital to data-driven decision making in business, government, and academe. It will appeal to survey statisticians and other scientists engaged in the planning and conduct of survey research, and to those analyzing survey data and charged with extracting compelling information from such data. It will appeal to graduate students and university faculty who...

  2. Introduction to thermoelectricity

    CERN Document Server

    Goldsmid, H Julian

    2010-01-01

    Introduction to Thermoelectricity is the latest work by Professor Julian Goldsmid drawing on his 55 years experience in the field. The theory of the thermoelectric and related phenomena is presented in sufficient detail to enable researchers to understand their observations and develop improved thermoelectric materials. The methods for the selection of materials and their improvement are discussed. Thermoelectric materials for use in refrigeration and electrical generation are reviewed. Experimental techniques for the measurement of properties and for the production of thermoelements are described. Special emphasis is placed on nanotechnology which promises to yield great improvements in the efficiency of thermoelectric devices. Chapters are also devoted to transverse thermoelectric effects and thermionic energy conversion, both techniques offering the promise of important applications in the future.

  3. Superconductivity an introduction

    CERN Document Server

    Kleiner, Reinhold

    2016-01-01

    The third edition of this proven text has been developed further in both scope and scale to reflect the potential for superconductivity in power engineering to increase efficiency in electricity transmission or engines. The landmark reference remains a comprehensive introduction to the field, covering every aspect from fundamentals to applications, and presenting the latest developments in organic superconductors, superconducting interfaces, quantum coherence, and applications in medicine and industry. Due to its precise language and numerous explanatory illustrations, it is suitable as an introductory textbook, with the level rising smoothly from chapter to chapter, such that readers can build on their newly acquired knowledge. The authors cover basic properties of superconductors and discuss stability and different material groups with reference to the latest and most promising applications, devoting the last third of the book to applications in power engineering, medicine, and low temperature physics. An e...

  4. Introduction to information retrieval

    CERN Document Server

    Manning, Christopher D; Schütze, Hinrich

    2008-01-01

    Class-tested and coherent, this textbook teaches classical and web information retrieval, including web search and the related areas of text classification and text clustering from basic concepts. It gives an up-to-date treatment of all aspects of the design and implementation of systems for gathering, indexing, and searching documents; methods for evaluating systems; and an introduction to the use of machine learning methods on text collections. All the important ideas are explained using examples and figures, making it perfect for introductory courses in information retrieval for advanced undergraduates and graduate students in computer science. Based on feedback from extensive classroom experience, the book has been carefully structured in order to make teaching more natural and effective. Slides and additional exercises (with solutions for lecturers) are also available through the book's supporting website to help course instructors prepare their lectures.

  5. Background and introduction

    DEFF Research Database (Denmark)

    2012-01-01

    by their particular theories and conceptual analyses, data, tools, and best practices, with a focus on respectively costs and benefits of facilities and services, alignment of corporate and public real estate to organizational objectives and organisational performance, and relationship management in market...... background information to understand the following chapters in this book. Research limitations: The chapter is mainly based on the experience and knowledge of the editors. It does not include original research but provides an introductory overview of the book. Originality/value: This chapter takes a look...... behind the scenes of the making of this book and connects contributions from three different fields - FM, CREM, and B2B marketing - to shed more light on the concept of added value of FM. It serves as an introduction to the research presented in the other chapters in this book....

  6. Introduction to tropical geometry

    CERN Document Server

    Maclagan, Diane

    2015-01-01

    Tropical geometry is a combinatorial shadow of algebraic geometry, offering new polyhedral tools to compute invariants of algebraic varieties. It is based on tropical algebra, where the sum of two numbers is their minimum and the product is their sum. This turns polynomials into piecewise-linear functions, and their zero sets into polyhedral complexes. These tropical varieties retain a surprising amount of information about their classical counterparts. Tropical geometry is a young subject that has undergone a rapid development since the beginning of the 21st century. While establishing itself as an area in its own right, deep connections have been made to many branches of pure and applied mathematics. This book offers a self-contained introduction to tropical geometry, suitable as a course text for beginning graduate students. Proofs are provided for the main results, such as the Fundamental Theorem and the Structure Theorem. Numerous examples and explicit computations illustrate the main concepts. Each of t...

  7. Dark Matter: Introduction

    CERN Document Server

    Rees, Martin J

    2003-01-01

    This short review was prepared as an introduction to the Royal Society's 'Dark Matter' conference. It addresses the embarrassing fact that 95% of the universe is unaccounted for. Favoured dark matter candidates are axions or weakly-interacting particles that have survived from the very early universe, but more exotic options cannot be excluded. Experimental searches are being made for the 'dark' particles but we have indirect clues to their nature too. Comparisons of data (from, eg, gravitational lensing) with numerical simulations of galaxy formation can constrain (eg) the particle velocities and collision cross sections. The mean cosmic density of dark matter (plus baryons) is now pinned down to be only about 30% of the critical density However, other recent evidence -- microwave background anisotropies, complemented by data on distant supernovae -- reveals that our universe actually is 'flat', and that its dominant ingredient (about 70% of the total mass-energy) is something quite unexpected -- 'dark energ...

  8. Introduction: Bateson the Precursor

    DEFF Research Database (Denmark)

    Hoffmeyer, Jesper

    2008-01-01

    of those few. And while his thinking has influenced scholars from a wide range of fields dealing in one way or another with aspects of communication and epistemology, mainstream biology unfortunately has shown little interest in such matters, clinging instead to a simplified description of the natural...... for the inability of science to help us cope with the complex, unruly and messy problems confronting modern societies at many levels. He urged science to search for patterns that will emerge only in a broad-spectrum analysis of communication in all its forms This is the challenge to modern science and philosophy...... taken up by the authors of this book. The introduction briefly presents each of these approches....

  9. Superconductivity an introduction

    CERN Document Server

    Mangin, Philippe

    2017-01-01

    This book proposes a thorough introduction for a varied audience. The reader will master London theory and the Pippard equations, and go on to understand type I and type II superconductors (their thermodynamics, magnetic properties, vortex dynamics, current transport…), Cooper pairs and the results of BCS theory. By studying coherence and flux quantization he or she will be lead to the Josephson effect which, with the SQUID, is a good example of the applications. The reader can make up for any gaps in his knowledge with the use of the appendices, follow the logic behind each model, and assimilate completely the underlying concepts. Approximately 250 illustrations help in developing a thorough understanding. This volume is aimed towards masters and doctoral students, as well as advanced undergraduates, teachers and researchers at all levels coming from a broad range of subjects (chemistry, physics, mechanical and electrical engineering, materials science…). Engineers working in industry will have a useful ...

  10. Introduction to uncertainty quantification

    CERN Document Server

    Sullivan, T J

    2015-01-01

    Uncertainty quantification is a topic of increasing practical importance at the intersection of applied mathematics, statistics, computation, and numerous application areas in science and engineering. This text provides a framework in which the main objectives of the field of uncertainty quantification are defined, and an overview of the range of mathematical methods by which they can be achieved. Complete with exercises throughout, the book will equip readers with both theoretical understanding and practical experience of the key mathematical and algorithmic tools underlying the treatment of uncertainty in modern applied mathematics. Students and readers alike are encouraged to apply the mathematical methods discussed in this book to their own favourite problems to understand their strengths and weaknesses, also making the text suitable as a self-study. This text is designed as an introduction to uncertainty quantification for senior undergraduate and graduate students with a mathematical or statistical back...

  11. Introduction to dynamics

    CERN Document Server

    Pfeiffer, Friedrich

    2015-01-01

    This concise textbook for students preferably of a postgraduate level, but also for engineers in practice, contains the basic kinematical and kinetic structures of dynamics together with carefully selected applications. The book is a condensed introduction to the fundamental laws of kinematics and kinetics, on the most important principles of mechanics and presents the equations of motion in the form of Lagrange and Newton-Euler. Selected problems of linear and nonlinear dynamics are treated, as well as problems of vibration formation. The presented selection of topics gives a useful basis for stepping into more advanced problems of dynamics. The contents of this book represent the result of a regularly revised course, which has been and still is given for masters students at the Technische Universität München. .

  12. Sociophysics an introduction

    CERN Document Server

    Sen, Parongama

    2014-01-01

    This book discusses the study and analysis of the physical aspects of social systems and models, inspired by the analogy with familiar models of physical systems and possible applications of statistical physics tools. Unlike the traditional analysis of the physics of macroscopic many-body or condensed matter systems, which is now an established and mature subject, the upsurge in the physical analysis and modelling of social systems, which are clearly many-body dynamical systems, is a recent phenomenon. Though the major developments in sociophysics have taken place only recently, the earliest attempts of proposing "Social Physics" as a discipline are more than one and a half centuries old. Various developments in the mainstream physics of condensed matter systems have inspired and induced the recent growth of sociophysical analysis and models. In spite of the tremendous efforts of many scientists in recent years, the subject is still in its infancy and major challenges are yet to be taken up. An introduction t...

  13. Introduction to cosmology

    CERN Document Server

    Ryden, Barbara

    2017-01-01

    This second edition of Introduction to Cosmology is an exciting update of an award-winning textbook. It is aimed primarily at advanced undergraduate students in physics and astronomy, but is also useful as a supplementary text at higher levels. It explains modern cosmological concepts, such as dark energy, in the context of the Big Bang theory. Its clear, lucid writing style, with a wealth of useful everyday analogies, makes it exceptionally engaging. Emphasis is placed on the links between theoretical concepts of cosmology and the observable properties of the universe, building deeper physical insights in the reader. The second edition includes recent observational results, fuller descriptions of special and general relativity, expanded discussions of dark energy, and a new chapter on baryonic matter that makes up stars and galaxies. It is an ideal textbook for the era of precision cosmology in the accelerating universe.

  14. Introduction to thermoelectricity

    CERN Document Server

    Goldsmid, H Julian

    2016-01-01

    This book is a comprehensive introduction to all aspects of thermoelectric energy conversion. It covers both theory and practice. The book is timely as it refers to the many improvements that have come about in the last few years through the use of nanostructures. The concept of semiconductor thermoelements led to major advances during the second half of the twentieth century, making Peltier refrigeration a widely used technique. The latest materials herald thermoelectric generation as the preferred technique for exploiting low-grade heat. The book shows how progress has been made by increasing the thermal resistivity of the lattice until it is almost as large as it is for glass. It points the way towards the attainment of similar improvements in the electronic parameters. It does not neglect practical considerations, such as the desirability of making thermocouples from inexpensive and environmentally acceptable materials. The second edition was extended to also include recent advances in thermoelectric ener...

  15. Introduction to singularities

    CERN Document Server

    Ishii, Shihoko

    2014-01-01

    This book is an introduction to singularities for graduate students and researchers. It is said that algebraic geometry originated in the seventeenth century with the famous work Discours de la méthode pour bien conduire sa raison, et chercher la vérité dans les sciences by Descartes. In that book he introduced coordinates to the study of geometry. After its publication, research on algebraic varieties developed steadily. Many beautiful results emerged in mathematicians’ works. Most of them were about non-singular varieties. Singularities were considered “bad” objects that interfered with knowledge of the structure of an algebraic variety. In the past three decades, however, it has become clear that singularities are necessary for us to have a good description of the framework of varieties. For example, it is impossible to formulate minimal model theory for higher-dimensional cases without singularities. Another example is that the moduli spaces of varieties have natural compactification, the boundar...

  16. Introduction to Waste Engineering

    DEFF Research Database (Denmark)

    Christensen, Thomas Højlund

    2011-01-01

    and systems can be operated in a way that is environmentally sound, technical feasible, economically efficient and socially acceptable. This applies to all scales of relevance: (1) national surveys of energy use and material flows determining the frame for politically setting goals in waste management, (2......Solid waste management as introduced in Chapter 1.1 builds in many ways on engineering. Waste engineering here means the skills and ability to understand quantitatively how a waste management system works in such a detail that waste management can be planned, facilities can be designed and sited......) regional plans for waste management, including (3) the selection of main management technologies and siting of facilities, (4) the design of individual technological units and, for example, (5) the operation of recycling schemes within a municipality. This chapter gives an introduction to waste engineering...

  17. Semiconductor physics an introduction

    CERN Document Server

    Seeger, Karlheinz

    1999-01-01

    Semiconductor Physics - An Introduction - is suitable for the senior undergraduate or new graduate student majoring in electrical engineering or physics. It will also be useful to solid-state scientists and device engineers involved in semiconductor design and technology. The text provides a lucid account of charge transport, energy transport and optical processes, and a detailed description of many devices. It includes sections on superlattices and quantum well structures, the effects of deep-level impurities on transport, the quantum Hall effect and the calculation of the influence of a magnetic field on the carrier distribution function. This 6th edition has been revised and corrected, and new sections have been added to different chapters.

  18. Hyperplane arrangements an introduction

    CERN Document Server

    Dimca, Alexandru

    2017-01-01

    This textbook provides an accessible introduction to the rich and beautiful area of hyperplane arrangement theory, where discrete mathematics, in the form of combinatorics and arithmetic, meets continuous mathematics, in the form of the topology and Hodge theory of complex algebraic varieties. The topics discussed in this book range from elementary combinatorics and discrete geometry to more advanced material on mixed Hodge structures, logarithmic connections and Milnor fibrations. The author covers a lot of ground in a relatively short amount of space, with a focus on defining concepts carefully and giving proofs of theorems in detail where needed. Including a number of surprising results and tantalizing open problems, this timely book also serves to acquaint the reader with the rapidly expanding literature on the subject. Hyperplane Arrangements will be particularly useful to graduate students and researchers who are interested in algebraic geometry or algebraic topology. The book contains numerous exercise...

  19. Introduction to morphogenetic computing

    CERN Document Server

    Resconi, Germano; Xu, Guanglin

    2017-01-01

    This book offers a concise introduction to morphogenetic computing, showing that its use makes global and local relations, defects in crystal non-Euclidean geometry databases with source and sink, genetic algorithms, and neural networks more stable and efficient. It also presents applications to database, language, nanotechnology with defects, biological genetic structure, electrical circuit, and big data structure. In Turing machines, input and output states form a system – when the system is in one state, the input is transformed into output. This computation is always deterministic and without any possible contradiction or defects. In natural computation there are defects and contradictions that have to be solved to give a coherent and effective computation. The new computation generates the morphology of the system that assumes different forms in time. Genetic process is the prototype of the morphogenetic computing. At the Boolean logic truth value, we substitute a set of truth (active sets) values with...

  20. Photonics an introduction

    CERN Document Server

    Reider, Georg A

    2016-01-01

    This book provides a comprehensive introduction into photonics, from the electrodynamic and quantum mechanic fundamentals to the level of photonic components and building blocks such as lasers, amplifiers, modulators, waveguides, and detectors. The book will serve both as textbook and as a reference work for the advanced student or scientist. Theoretical results are derived from basic principles with convenient, yet state-of-the-art mathematical tools, providing not only deeper understanding but also familiarization with formalisms used in the relevant technical literature and research articles. Among the subject matters treated are polarization optics, pulse and beam propagation, waveguides, light–matter interaction, stationary and transient behavior of lasers, semiconductor optics and lasers (including low-dimensional systems such as quantum wells), detector technology, photometry, and colorimetry. Nonlinear optics are elaborated comprehensively. The book is intended for both students of physics and elect...

  1. Introduction to Mineralogy

    Science.gov (United States)

    Knittle, Elise

    A course in mineralogy is a rite of passage for most undergraduate Earth sciences majors. As fluency with minerals is so basic for deciphering a range of geologic processes, many Earth scientists can recall long hours in the lab memorizing mineral samples, their chemical formulae and crystal systems, and perhaps staring through a petrographic microscope wondering, what exactly is 2V? In this venerable field with so many classic textbooks, one might ask why another mineralogy text is warranted.Introduction to Mineralogy is organized in a traditional way, with Part I covering the topics of symmetry, crystallography, crystal chemistry and structure, and crystal growth. Part II covers physical properties of minerals and methods for studying mineral structures and chemistry (including optical mineralogy and x-ray diffraction), and Part III presents the systematic mineralogy of all of the mineral groups.

  2. Introduction to transonic aerodynamics

    CERN Document Server

    Vos, Roelof

    2015-01-01

    Written to teach students the nature of transonic flow and its mathematical foundation, this book offers a much-needed introduction to transonic aerodynamics. The authors present a quantitative and qualitative assessment of subsonic, supersonic, and transonic flow around bodies in two and three dimensions. The book reviews the governing equations and explores their applications and limitations as employed in modeling and computational fluid dynamics.  Some concepts, such as shock and expansion theory, are examined from a numerical perspective. Others, including shock-boundary-layer interaction, are discussed from a qualitative point of view. The book includes 60 examples and more than 200 practice problems. The authors also offer analytical methods such as Method of Characteristics (MOC) that allow readers to practice with the subject matter.  The result is a wealth of insight into transonic flow phenomena and their impact on aircraft design, including compressibility effects, shock and expansion waves, sho...

  3. Introduction to mathematical physics

    CERN Document Server

    Vaughn, Michael T

    2007-01-01

    A comprehensive survey of all the mathematical methods that should be available to graduate students in physics. In addition to the usual topics of analysis, such as infinite series, functions of a complex variable and some differential equations as well as linear vector spaces, this book includes a more extensive discussion of group theory than can be found in other current textbooks. The main feature of this textbook is its extensive treatment of geometrical methods as applied to physics. With its introduction of differentiable manifolds and a discussion of vectors and forms on such manifolds as part of a first-year graduate course in mathematical methods, the text allows students to grasp at an early stage the contemporary literature on dynamical systems, solitons and related topological solutions to field equations, gauge theories, gravitational theory, and even string theory

  4. Guerra (in)justa, ciência (im)pura

    OpenAIRE

    Cascais, António Fernando

    2003-01-01

    Se há conjunção fatal, é entre guerra e ciência, em nome dos imperativos da defesa nacional. É hoje um dado adquirido que a Segunda Guerra Mundial foi tão extraordinariamente produtiva no campo científico, quanto inumana, da biomedicina criminosa nazi à física atômica norte-americana. Muitas das aplicações técnicas com que actualmente convivemos de forma pacífica, na maior candura e na maior inocência, tiveram origem em investigação fundamental e aplicada desenvolvida no dec...

  5. Editorial - Por uma nova ciência (nova?)

    OpenAIRE

    Roncalli, Angelo Giuseppe

    2015-01-01

    Os fractais fazem parte da identidade visual da revista que ora debuta no campo da divulgação científica, a “Ciência Plural”. Para além de mais um rótulo dentre tantos outros (ou mesmo um aparente pleonasmo) o adjetivo se coloca como aquilo que é composto, diversificado, múltiplo. Não se propõe como novo paradigma (nem poderia), mais que isso, admite a perspectiva crítica de qualquer um deles.3Pluralidade no seu sentido dialético, de realidades contraditórias. Enfim, trata-se de entender que ...

  6. Combustion Stratification for Naphtha from CI Combustion to PPC

    KAUST Repository

    Vallinayagam, R.

    2017-03-28

    This study demonstrates the combustion stratification from conventional compression ignition (CI) combustion to partially premixed combustion (PPC). Experiments are performed in an optical CI engine at a speed of 1200 rpm for diesel and naphtha (RON = 46). The motored pressure at TDC is maintained at 35 bar and fuelMEP is kept constant at 5.1 bar to account for the difference in fuel properties between naphtha and diesel. Single injection strategy is employed and the fuel is injected at a pressure of 800 bar. Photron FASTCAM SA4 that captures in-cylinder combustion at the rate of 10000 frames per second is employed. The captured high speed video is processed to study the combustion homogeneity based on an algorithm reported in previous studies. Starting from late fuel injection timings, combustion stratification is investigated by advancing the fuel injection timings. For late start of injection (SOI), a direct link between SOI and combustion phasing is noticed. At early SOI, combustion phasing depends on both intake air temperature and SOI. In order to match the combustion phasing (CA50) of diesel, the intake air temperature is increased to 90°C for naphtha. The combustion stratification from CI to PPC is also investigated for various level of dilution by displacing oxygen with nitrogen in the intake. The start of combustion (SOC) was delayed with the increase in dilution and to compensate for this, the intake air temperature is increased. The mixture homogeneity is enhanced for higher dilution due to longer ignition delay. The results show that high speed image is initially blue and then turned yellow, indicating soot formation and oxidation. The luminosity of combustion images decreases with early SOI and increased dilution. The images are processed to generate the level of stratification based on the image intensity. The level of stratification is same for diesel and naphtha at various SOI. When O concentration in the intake is decreased to 17.7% and 14

  7. Dual-core antiresonant hollow core fibers.

    Science.gov (United States)

    Liu, Xuesong; Fan, Zhongwei; Shi, Zhaohui; Ma, Yunfeng; Yu, Jin; Zhang, Jing

    2016-07-25

    In this work, dual-core antiresonant hollow core fibers (AR-HCFs) are numerically demonstrated, based on our knowledge, for the first time. Two fiber structures are proposed. One is a composite of two single-core nested nodeless AR-HCFs, exhibiting low confinement loss and a circular mode profile in each core. The other has a relatively simple structure, with a whole elliptical outer jacket, presenting a uniform and wide transmission band. The modal couplings of the dual-core AR-HCFs rely on a unique mechanism that transfers power through the air. The core separation and the gap between the two cores influence the modal coupling strength. With proper designs, both of the dual-core fibers can have low phase birefringence and short modal coupling lengths of several centimeters.

  8. Diversidade sexual e ensino de ciências: buscando sentidos

    Directory of Open Access Journals (Sweden)

    Leandro Jorge Coelho

    2015-12-01

    Full Text Available ResumoO objetivo desse estudo foi analisar os sentidos atribuídos por professores de Ciências e alunos à diversidade sexual. Foram utilizados: questionário, entrevista, produção de textos, análise documental e a técnica de grupo focal para a coleta de dados. De modo geral, os alunos possuem sentidos que reconhecem Lésbicas, Gays, Bissexuais e Transgêneros (LGBT como "estranhos", mesmo assim, acreditam que têm o dever de respeitar as escolhas de cada um. As travestis foram declaradamente apresentadas com repúdio por eles, sendo a homossexualidade e bissexualidade aparentemente mais aceitas. Os professores parecem manter aulas que não abordam estas questões, mesmo o Ensino de Ciências, sendo um momento privilegiado para problematizações sobre diversidade sexual e gênero. É necessário investir em discussões sobre esses temas na formação inicial e continuada de professores, buscando a construção de novos sentidos e práticas que se preocupem com o desvelamento de significados preconceituosos sobre gênero e diversidade sexual.

  9. The radiation shielding potential of CI and CM chondrites

    Science.gov (United States)

    Pohl, Leos; Britt, Daniel T.

    2017-03-01

    Galactic Cosmic Rays (GCRs) and Solar Energetic Particles (SEPs) pose a serious limit on the duration of deep space human missions. A shield composed of a bulk mass of material in which the incident particles deposit their energy is the simplest way to attenuate the radiation. The cost of bringing the sufficient mass from the Earth's surface is prohibitive. The shielding properties of asteroidal material, which is readily available in space, are investigated. Solution of Bethe's equation is implemented for incident protons and the application in composite materials and the significance of various correction terms are discussed; the density correction is implemented. The solution is benchmarked and shows good agreement with the results in literature which implement more correction terms within the energy ranges considered. The shielding properties of CI and CM asteroidal taxonomy groups and major asteroidal minerals are presented in terms of stopping force. The results show that CI and CM chondrites have better stopping properties than Aluminium. Beneficiation is discussed and is shown to have a significant effect on the stopping power.

  10. Spacecraft COst REduction Team (SCORE): TQM/CI on a massive scale

    Science.gov (United States)

    Bullard, Jerry D.

    The business of building satellites and space systems has matured. Few missions require, or can afford, excellent performance at any price. The new paradigm is doing more with less, providing quality systems at lower cost--in other words, doing our job 'Faster-Better-Cheaper.' The TRW Spacecraft COst REduction (SCORE) initiative was launched in 1990 by Daniel S. Goldin, then general manager of TRW's Space & Technology Group. The SCORE mission is to apply continuous improvement (CI) techniques to effect major reductions in the cost (our primary goal) and span time (as a corollary) required for the production of spacecraft. SCORE is a multi-year initiative that is having a profound effect on both the procedural and the cultural aspects of how we do business. The objectives of this initiative are being realized. The focus of this paper is not on the results of SCORE per se, but rather on the things we have leaned about how to do continuous improvement on a massive scale, with multilevel (hierarchical) CI teams. The following sections summarize the chronology of the SCORE initiative, from team formation to development of the year-end report for 1991. Lessons learned, the core of this presentation, are discussed--with particular focus on the unique aspects of SCORE. The SCORE initiative is continuing and, as a part of our evolving culture, will never end. It has resulted in profound insights into the way we do work and (the topic at hand) how to do CI for large and complex multidisciplinary development activities.

  11. Postponement in New Product Introduction

    Institute of Scientific and Technical Information of China (English)

    Biao; Yang; Neil; Burns

    2002-01-01

    Agility has now been a main research topic in the l it erature. There is much written on agility mainly focusing on manufacturing p rocess and strategic processes. However, we argue that new product introduction should call for agility as well due to uncertainty about technological advances and customers' demand. A technological superiority alone may not guarantee succe ss for new product introduction. We focus on the role of postponement for two ma in processes in new product introduction: new product ...

  12. Core of Cloud Computing

    Directory of Open Access Journals (Sweden)

    Prof. C.P.Chandgude

    2017-04-01

    Full Text Available Advancement in computing facilities marks back from 1960’s with introduction of mainframes. Each of the computing has one or the other issues, so keeping this in mind cloud computing was introduced. Cloud computing has its roots in older technologies such as hardware virtualization, distributed computing, internet technologies, and autonomic computing. Cloud computing can be described with two models, one is service model and second is deployment model. While providing several services, cloud management’s primary role is resource provisioning. While there are several such benefits of cloud computing, there are challenges in adopting public clouds because of dependency on infrastructure that is shared by many enterprises. In this paper, we present core knowledge of cloud computing, highlighting its key concepts, deployment models, service models, benefits as well as security issues related to cloud data. The aim of this paper is to provide a better understanding of the cloud computing and to identify important research directions in this field

  13. Introduction to Indoor Air Quality

    Science.gov (United States)

    ... United States Environmental Protection Agency Search Search Indoor Air Quality (IAQ) Contact Us Share Introduction to Indoor Air Quality Health Effects Primary Causes Identifying Problems Improving IAQ ...

  14. Estudos de Comunidade e ciências sociais no Brasil

    Directory of Open Access Journals (Sweden)

    Nemuel da Silva Oliveira

    2011-12-01

    Full Text Available O objetivo deste artigo é fazer um balanço da literatura sobre os Estudos de Comunidade (EC no Brasil, destacando o contexto intelectual em que foram produzidos e os debates que suscitaram, especialmente entre as décadas de 1940 e 1960. Método de pesquisa em comunidades, oriundo da Antropologia, em investigações sobre o processo de mudança social, os EC estiveram em voga nos Estados Unidos entre os anos 1920 e 1950, tendo papel fundamental na institucionalização das Ciências Sociais no Brasil. Destacamos três aspectos na produção desses estudos no país, iniciando com uma abordagem conceitual: definições, origem e sua relação com temáticas marcantes nos anos 1950. Em seguida, privilegiamos os aspectos relacionados ao papel dos EC na história das Ciências Sociais no Brasil, com destaque para o processo de institucionalização das Ciências Sociais. Por fim, revisitamos os debates que tais estudos geraram entre os cientistas sociais quanto ao padrão de trabalho sociológico a ser desenvolvido naquele momento.The purpose of this article is to examine the literature about Community Studies(CS in Brazil, highlighting their intellectual context of production and the debates evoked by them, especially between the 1940's and 1960's. As a research method arising from Anthropology on communities in social change process, CS was used in United States between 1920's and 1950's, and played a fundamental role in the institutionalization of Social Sciences in Brazil. Three aspects are highlighted on CS production: first, in a conceptual approach, we discuss their definitions, origins and relation to main topics in the 1950's. The second aspect is related to the role of CS in the history of Social Sciences, especially their institutionalization process. By the end, we revisit the debates between social scientists about the sociological work standard to be developed at that time.

  15. Women and AIDS: introduction.

    Science.gov (United States)

    Krieger, N; Margo, G

    1991-01-01

    Around the world, more and more women--principally poor women of color--are being diagnosed with and are dying of AIDS, the acquired immune deficiency syndrome. Yet, effective and appropriate prevention programs for women are sorely missing from the global program to control AIDS. To help us understand why this gap exists, and what we must do to close it, the three articles in this issue focus on women and AIDS. Examining the situation in such countries as Zimbabwe and South Africa, as well as in other economically underdeveloped and developed regions, the authors argue that women with the least control over their bodies and their lives are at greatest risk of acquiring AIDS. For example, the high rate of infection among women in Africa cannot be understood apart from the legacy of colonialism (including land expropriation and the forced introduction of a migrant labor system) and the insidious combination of traditional and European patriarchal values. Only by recognizing the socioeconomic and cultural determinants of both disease and sexual behavior, and only by incorporating these insights into our AIDS prevention programs, will we be able to curb the spread of this lethal disease.

  16. Arctic freshwater synthesis: Introduction

    Science.gov (United States)

    Prowse, T.; Bring, A.; Mârd, J.; Carmack, E.

    2015-11-01

    In response to a joint request from the World Climate Research Program's Climate and Cryosphere Project, the International Arctic Science Committee, and the Arctic Council's Arctic Monitoring and Assessment Program, an updated scientific assessment has been conducted of the Arctic Freshwater System (AFS), entitled the Arctic Freshwater Synthesis (AFSΣ). The major reason for joint request was an increasing concern that changes to the AFS have produced, and could produce even greater, changes to biogeophysical and socioeconomic systems of special importance to northern residents and also produce extra-Arctic climatic effects that will have global consequences. Hence, the key objective of the AFSΣ was to produce an updated, comprehensive, and integrated review of the structure and function of the entire AFS. The AFSΣ was organized around six key thematic areas: atmosphere, oceans, terrestrial hydrology, terrestrial ecology, resources and modeling, and the review of each coauthored by an international group of scientists and published as separate manuscripts in this special issue of Journal of Geophysical Research-Biogeosciences. This AFSΣ—Introduction reviews the motivations for, and foci of, previous studies of the AFS, discusses criteria used to define the domain of the AFS, and details key characteristics of the definition adopted for the AFSΣ.

  17. Supraconductivité introduction

    CERN Document Server

    Mangin, Philippe

    2013-01-01

    La supraconductivité fait rêver, surtout depuis la découverte de son existence à des températures relativement accessibles. Ses applications sont déjà notables (Imagerie par Résonance Magnétique, futur ITER, NEUROSPIN, SQUID...) et des projets plus futuristes se développent (transport de courant, train en lévitation, moteurs). Le présent ouvrage propose une introduction solide, pour un public assez large. Le lecteur pourra s'initier à la théorie de London et aux équations de Pippard, puis étudier les supraconducteurs de type I et de type II (thermodynamique, magnétisme, dynamique de vortex, transport de courant...), les paires de Cooper et les résultats de la théorie BCS. L'étude de la cohérence et de la quantification du flux conduit à l'effet Josephson qui, avec le SQUID. est un bon exemple d'application. Le lecteur pourra combler certaines de ses lacunes grâce aux compléments, suivre le cheminement d'un modèle et s'approprier les concepts. Environ 250 illustrations en facilitent la...

  18. Introduction: Childhood and Disability.

    Science.gov (United States)

    Salter, Erica K

    2017-06-21

    From growth attenuation therapy for severely developmentally disabled children to the post-natal management of infants with trisomy 13 and 18, pediatric treatment decisions regularly involve assessments of the probability and severity of a child's disability. Because these decisions are almost always made by surrogate decision-makers (parents and caregivers) and because these decision-makers must often make decisions based on both prognostic guesses and potentially biased quality of life judgments, they are among the most ethically complex in pediatric care. As the introduction to HEC Forum's special thematic issue on Childhood and Disability, this article orients the reader to the history of bioethics' relationship to both pediatric ethics and disability studies and introduces the issue's five manuscripts. As clinicians, disability scholars, philosophers and clinical ethicists writing on various aspects of pediatric disability, the articles' authors all invite readers to dig beneath an overly-simplified version of what disability might mean to children and families and instead embrace a posture of genuine humility, recognizing both the limits and harms of traditional medical and bioethical responses (or indifferences) to the disabled child.

  19. Chemical thermodynamics. An introduction

    Energy Technology Data Exchange (ETDEWEB)

    Keszei, Ernoe [Budapest Univ. (Hungary). Dept. of Physical Chemistry

    2012-07-01

    Eminently suitable as a required textbook comprising complete material for or an undergraduate chemistry major course in chemical thermodynamics. Clearly explains details of formal derivations that students can easily follow and so master applied mathematical operations. Offers problems and solutions at the end of each chapter for self-test and self- or group study. This course-derived undergraduate textbook provides a concise explanation of the key concepts and calculations of chemical thermodynamics. Instead of the usual 'classical' introduction, this text adopts a straightforward postulatory approach that introduces thermodynamic potentials such as entropy and energy more directly and transparently. Structured around several features to assist students' understanding, Chemical Thermodynamics: - Develops applications and methods for the ready treatment of equilibria on a sound quantitative basis. - Requires minimal background in calculus to understand the text and presents formal derivations to the student in a detailed but understandable way. - Offers end-of-chapter problems (and answers) for self-testing and review and reinforcement, of use for self- or group study. This book is suitable as essential reading for courses in a bachelor and master chemistry program and is also valuable as a reference or textbook for students of physics, biochemistry and materials science.

  20. Chief Editors’ Introduction

    Directory of Open Access Journals (Sweden)

    Kerry Carrington

    2015-12-01

    Full Text Available It has been a great year for the journal:  our most successful ever. This edition marks three years of publication of the International Journal for Crime, Justice and Social Democracy. In 2015 the journal was selected for inclusion into Scopus and Web of Science data bases. This is a terrific success story and testimony to the high quality of the articles, the editorship, the reviewing and the international readership of the journal. We are grateful as ever to our distinguished International Editorial Board and all our reviewers who are anonymous to readers and authors due to the norms of blind peer reviewing. We also thank the out-going foundational co-editor-in-chief Reece Walters for his efforts in making this journal the success it is. The journal has now surpassed 150,000 abstract views and 100,000 full PDF downloads. This journal is one of only a few in the world of criminology to support fully on-line free-to-download articles, and to promote creative commons copyright: that is, authors’ rights to reproduce their own material. We support the democratisation of knowledge and are delighted to be leaders in high quality international journal publishing.Download the PDF file here for the Chief Editors’ introduction to this issue and be motivated by the eclectic and impressive range of topics offered by our contributors to read further.

  1. Animal MRI Core

    Data.gov (United States)

    Federal Laboratory Consortium — The Animal Magnetic Resonance Imaging (MRI) Core develops and optimizes MRI methods for cardiovascular imaging of mice and rats. The Core provides imaging expertise,...

  2. Introduction to the general relativity; Introduction a la relativite generale

    Energy Technology Data Exchange (ETDEWEB)

    Radix, J.C.

    1994-12-31

    This work deals with the introduction of the general relativity including the introduction of the tensorial calculation, the Euclidean space in curvilinear coordinates, the Riemann space, the recalls and complements of the restricted relativity and the elements of the general relativity. (O.L.) 83 figs., 3 tabs.

  3. iLCDirac and CI: Automated testing for distributed computing

    CERN Document Server

    Ebbing, Jan Hendrik

    2016-01-01

    Detector optimization studies for future high-energy physics experiments require the simulation and reconstruction of many physics processes and detector geometries. As an efficient way of accessing the necessary computational and storage resources, DIRAC has been developed and extended by iLCDirac, which is specialized for the applications used in the context of linear collider detector studies. We give a short introduction of grid computing and the concept of “High-throughput computing” behind DIRAC before explaining the unique features of DIRAC and iLCDirac. With this preparation we explain how we leveraged continuous integration to ensure smooth day-to-day operations, and that changes to the underlying code base do not cause an interruption of the service.

  4. Ciénega de Chapala, Jalisco, México

    Directory of Open Access Journals (Sweden)

    J. L. Martínez

    2005-01-01

    Full Text Available En la Ciénega de Chapala se llevaron a cabo una serie de experimentos de laboratorio y campo para determinar la interacción biológica entre la alimentación de la chinche apestosa y la severidad de tizón de la panoja del sorgo, causado por el hongo Fusarium moniliforme. La chinche Oebalus mexicanus es el insecto que predomina sobre las panojas de sorgo en esa región. F. moniliforme fue aislado del interior del insecto. Las pruebas de transmisión del patógeno resultaron positivas. Pruebas de regresión realizadas para los datos de 1996 y 1997 indican que del 70% al 85% del daño por tizón de la panoja se explica por la abundancia de la chinche apestosa.

  5. Autonomia ou dependência da ciência

    OpenAIRE

    Morin, Edgar; Centre National de la Recherche Scientifique

    2008-01-01

    Em consequência do “caso Sokal”1 , a questão de saber em que condições se pode falar de autonomia ou de dependência da ciência retomou toda a sua virulência e, cabe afirmar, toda a sua pertinência. Muitos viram na mistificação de Sokal um teste de falsificação científica: falsificar o enunciado de um discurso para testar os critérios de reconhecimento da sua validade. Mas parece mais divertido de ver nisso, antes de tudo, um jogo de cena entre dois poderes bastante distintos: os “científicos”...

  6. Ciência da Computação

    Directory of Open Access Journals (Sweden)

    André Felipe Henriques Librantz

    2006-01-01

    Full Text Available Este trabalho apresenta um sistema de navegação autônoma de robôs construídos com kits Lego Mindstorms, para cálculo de trajetórias. Esse sistema pode ser utilizado como instrumento pedagógico multidisciplinar no curso de Ciência da Computação, uma vez que, para o seu desenvolvimento são necessários conhecimentos de algoritmos, linguagem de programação, lógica computacional, estrutura de dados, inteligência artificial (IA, redes de computadores, computação gráfica e robótica.

  7. Fazer ciência: o lugar do conceito

    Directory of Open Access Journals (Sweden)

    Wilton Garcia

    2007-06-01

    Full Text Available Este texto visa abrir uma discussão acerca da pesquisa contemporânea, investindo o enfoque no discurso científico para uma abordagem dinâmica de estratégias discursivas. Tento realizar uma reflexão crítica sobre a produção do saber em alguns procedimentos conceituais. Neste caso, remeto o olhar a uma consideração teórico-metodológica que pretende contribuir à atualização do discurso da ciência, hoje, e permita propor maior flexibilidade e deslocamento diante das diferentes produções de conhecimento. Este trabalho, portanto, não pretende expor, diretamente, idéias sobre ciência, mas sobre o discurso dito científico. Nesta investigação crítica, apresento sucintamente a noção de pós-(desconstrução. Utilizo os estudos contemporâneos como eixo teórico-metodológico para este desenvolvimento argumentativo. Os estudos contemporâneos pesquisam as atualizações de conceitos, que se organizam mediante a produção de atualidades e vasculham uma (redimensão teórica e política, associada ao sistema flexível da linguagem. Essas atualizações esboçam a área dos estudos contemporâneos em sua intensidade descritiva, quando aciona um olhar investigativo sobre as inovações no discurso científico, hoje.

  8. Introduction: Victorian Theatricalities

    Directory of Open Access Journals (Sweden)

    Michael Dobson

    2009-04-01

    Full Text Available After a barrage of manipulative fan-letters from Sir Merton and Annie Russell-Cotes, Sir Henry Irving, titan of the Victorian stage and the first actor to be knighted, eventually came to stay, briefly, at East Cliff Hall in Bournemouth. A peculiar but attractive compound of Scots baronial castle, Italian villa, French château and Bournemouth seaside bungalow, complete with lavish Art Nouveau interiors and a fountain in the entrance lobby, the house was always designed in and of itself as a dramatic location and was also intended as a magnet for theatrical celebrities. Sir Merton and Annie amply stuffed it with nineteenth-century British paintings, miscellaneous sculptures, and souvenirs of their extensive overseas holidays. Today the Russell-Cotes Art Gallery and Museum remains the late Victorian treasure house par excellence, and I can imagine few more vivid short-cuts into the culture and mindset of the late nineteenth-century haute bourgeoisie than an afternoon spent marvelling at the tons of accumulated trophies and bibelots cluttering its rooms or the acres of tastefully-exposed nipples adorning its walls. What the Russell-Cotes Museum also makes clear, even at its gloomiest, is the key place of drama in the Victorian imagination. After Irving's death in 1905, the Russell-Cotes bought many of Irving's personal effects at auction. Adding these to their existing collection of Irving memorabilia and other theatrical paintings and souvenirs, they converted the bedroom in which Irving had stayed into a permanent shrine to his memory. The Henry Irving Room would make an ideal introduction to most of the contents of this volume.

  9. A Biblioteconomia e a Ciência da Informação na taxionomia das ciências de Charles Sanders Peirce

    Directory of Open Access Journals (Sweden)

    Carlos Cândido de Almeida

    2005-07-01

    Full Text Available Mostra a taxionomia das ciências desenvolvida por Charles Sanders Peirce (1839-1914 que divide as ciências em três ramos: ciências teóricas, ciências da revisão e ciências aplicadas. Detalha principalmente as ciências teóricas: a Matemática, a Filosofia e a Idioscopia. Discute também o conceito de Biblioteconomia e de Ciência da Informação e que segundo as definições e características, encontradas na literatura consultada, estão na condição de ciências aplicadas, direcionadas a problemas práticos da sociedade, ou seja, o problema de controle e disseminação da informação.

  10. Advanced Introduction to Private Law

    NARCIS (Netherlands)

    Smits, Jan

    2017-01-01

    In this Advanced Introduction, the reader is taken on an intellectual journey through the different facets and dimensions of private law, from the family home to Kuta Beach and from Thomas Piketty to Nina Hagen. This concise book provides an accessible and fresh introduction to private law, presenti

  11. Trophic analysis of the fish community in the Ciénega Churince, Cuatro Ciénegas, Coahuila

    Directory of Open Access Journals (Sweden)

    Ariana Hernández

    2017-09-01

    Full Text Available Fish diets were analyzed to evaluate the dynamic trophs of the fish community in the Churince wetland system of the Cuatro Ciénegas, where the fauna consists of nine species: endemic, native and introduced. In nine sampling events (between February 2011 and May 2014 556 specimens of all nine species were collected. Stomach contents were analyzed and the Relative Importance Index (IRI was calculated. The feed coefficient (Q of the diets and the accumulated trophic diversity (Hk, as well as the amplitude of the trophic niche were evaluated. Feeding strategies in the fish community were found to be eurifagic. The main foods in general were insects, crustaceans, gastropods, plants and teleosts. According to the average linkage method, four functional trophic groups were defined, with no higher consumption species; nevertheless all were regulators, mainly invertebrates. Therefore, the chain reaction in food control was higher from top to bottom, meaning a downwards dietary control.

  12. Trophic analysis of the fish community in the Ciénega Churince, Cuatro Ciénegas, Coahuila.

    Science.gov (United States)

    Hernández, Ariana; Espinosa-Pérez, Hector S; Souza, Valeria

    2017-01-01

    Fish diets were analyzed to evaluate the dynamic trophs of the fish community in the Churince wetland system of the Cuatro Ciénegas, where the fauna consists of nine species: endemic, native and introduced. In nine sampling events (between February 2011 and May 2014) 556 specimens of all nine species were collected. Stomach contents were analyzed and the Relative Importance Index (IRI) was calculated. The feed coefficient (Q) of the diets and the accumulated trophic diversity (Hk), as well as the amplitude of the trophic niche were evaluated. Feeding strategies in the fish community were found to be eurifagic. The main foods in general were insects, crustaceans, gastropods, plants and teleosts. According to the average linkage method, four functional trophic groups were defined, with no higher consumption species; nevertheless all were regulators, mainly invertebrates. Therefore, the chain reaction in food control was higher from top to bottom, meaning a downwards dietary control.

  13. Ciência e linguagem: Fleck e o estilo de pensamento como rede de significados na ciência

    OpenAIRE

    Fernanda Schiavo Nogueira

    2012-01-01

    Na investigação conduzida, pretendemos somar esforços a outras iniciativas ainda incipientes voltadas para a (re)descoberta das contribuições pioneiras dadas pela teoria da ciência de Ludwik Fleck, pensador polonês precursor, condenado a mais de três décadas de ostracismo. Para tanto, concentraremos as atenções sobre questão de fundamental importância no processo de elaboração das ideias originais de Fleck: a contraposição do pensador polonês ao Círculo de Viena, no geral, e a Carnap, no part...

  14. Ciência e consciência, conhecimento e liberdade

    Directory of Open Access Journals (Sweden)

    Luiz Roberto Alves

    2012-08-01

    Full Text Available No tempo de novas tramas tecnológicas e riscos globais, o pensamento científico elaborado na experiência brasileira celebra um texto memorável de pouco mais de 40 anos: Ciência e libertação, do físico nuclear J. Leite Lopes. O presente ensaio perscruta esse pensamento, que se comunica com a crítica científica horrorizada com os escombros do pós-guerra e se projeta numa visão de ruptura epistemológica em vista da realidade social. Tal movimento de política científica se converte em proposta de gestão do conhecimento. A atitude metodológica deste ensaio busca textos que testemunham o entre e o pós-guerra do século XX e em contribuições das ciências da natureza e da cultura dirigidos à construção da sociedade democrática. A obra de Leite Lopes reside aí, como um feixe de linguagens a serviço da mudança social e do efetivo desenvolvimento do Brasil e da América Latina.At the time of new technological schemes and global risks, scientific thinking developed in the Brazilian experience celebrates a memorable text of little more than 40 years: Science and Liberation, written by the nuclear physicist J. Leite Lopes. This paper investigates this thought, which communicates with the critical scientific horrified by the rubble of postwar and design a vision of epistemological rupture in view of social reality. This movement becomes a proposal for a management of knowledge. The methodological approach of this essay seeks texts that bear witness to and from post-war twentieth century, and contributions from the natural sciences and culture aimed at building a democratic society. The work of Leite Lopes lies there like a bunch of languages in the service of social change and the effective development of Brazil and Latin America.

  15. INTRODUCTION: GRADUATE STUDENT SCHOLARSHIP

    Directory of Open Access Journals (Sweden)

    Laverne Jacobs

    2016-03-01

    Full Text Available The Windsor Yearbook of Access to Justice is proud to publish issue 32 (1. This issue features a special section highlighting the scholarship of graduate students. While it is always a pleasure to read promising work by newer scholars in the fields of law and social justice, we are certain that this collection of articles represents some of the finest and thought-provoking scholarship stemming from current graduate students in law. The articles stem from a graduate student essay contest that WYAJ held in 2013 and for which we received many submissions. The collection of selected papers offers a view of legal and interdisciplinary research examining issues that are topically diverse but which are all of deep, long-term importance to the world of access to justice. A reader of the special section on Graduate Student Scholarship will find explorations of access to justice from the perspectives of equality rights, discretion, adjudication and methods of legal service delivery, to name a few. A prize was offered to two papers judged to be of exceptional quality. I am very pleased to announce that the winners of those two prizes are Andrew Pilliar, for his article “Exploring a Law Firm Business Model to Improve Access to Justice” and Blair A. Major, for his contribution, “Religion and Law in R v NS: Finding Space to Re-think the Balancing Analysis”. The Editorial Board thanks all those who submitted papers to the contest and to this final special issue of the Windsor Yearbook of Access to Justice. Another notable feature of this issue is the introduction of a section called Research Notes. The Yearbook will periodically publish peer-reviewed research notes that present the findings of empirical (quantitative, qualitative or mixed method research studies. This section aims to contribute to the growing and important body of empirical scholarship within the realm of access to justice socio-legal research. We hope that you enjoy

  16. Evolução darwiniana & ciências sociais

    Directory of Open Access Journals (Sweden)

    José Eli da Veiga

    2008-01-01

    Full Text Available Este artigo sintetiza os principais resultados do ciclo temático com o mesmo título que foi coordenado pelo autor em 2007 como uma das atividades públicas do Instituto de Estudos Avançados da Universidade de São Paulo. Também é uma introdução às outras três contribuições que fazem parte deste dossiê: os artigos dos professores Ricardo Waizbort, da Fiocruz, e do professor Mario Possas, da UFRJ, e a entrevista especial concedida pelo professor Geoffrey Hodgson (University of Hertfordshire, UK.This article is a synthesis of the main results obtained in a thematic cycle with the same title which was coordinated by the author during 2007 as one of the public activities of the University of Sao Paulo's Institute of Advanced Studies. It is also an introduction to the three o other contributions to this dossier: the articles from professors Ricardo Waizbort (Fiocruz and Mario Possas (UFRJ, and the especial interview with professor Geoffrey Hodgson (University of Hertfordshire, UK.

  17. Variações sobre arte e ciência

    Directory of Open Access Journals (Sweden)

    Octavio Ianni

    2004-06-01

    Full Text Available O texto propõe aproximações entre ciência e arte por meio de contrastes e semelhanças reconhecíveis nessas modalidades discursivas de conhecimento, como linguagens e narrativas singulares, dotadas de características próprias, mas que freqüentemente se valem de procedimentos e recursos alheios. Busca salientar tanto os usos de recursos ficcionais pelos textos científicos, como o contrário, as valências cognitivas e mesmo a reconstrução complexa de experiências sociais pelos textos literários, articulados por uma ambição estética.The text establishes connections between science and art through the contrasts and similarities traceables in those discourses of knowledge, while languages and peculiar narratives endowed with its own traits, but that quite often appeal to alien proce-dures and resources. It seeks to point out the uses of fiction resources in scientific texts, as the opposite, the cognitives assets and even the complex reconstruction of social experiences found out literary texts, moved by an aesthetic ambition.

  18. Cientometria: a métrica da ciência

    Directory of Open Access Journals (Sweden)

    José Aparecido da Silva

    2001-01-01

    Full Text Available Cientometria é definida como o estudo da mensuração e quantificação do progresso científico, estando a pesquisa baseada em indicadores bibliométricos. A cientometria tem um grande potencial de aplicação, havendo interesse de Governos e instituições de pesquisas em utilizar este conhecimento com o objetivo de implementar diferentes formas de apoio ao desenvolvimento científico e tecnológico. Nos últimos tempos, também, ela tem sido usada para ajudar nações a tomarem decisões sobre quais áreas do saber necessitam de fundos especiais; além disso, a análise das citações ou dos fatores de impacto de periódicos e artigos vem se tornando uma fonte importante de informação para historiadores, sociólogos e outros pesquisadores interessados na evolução da ciência. Este artigo focaliza como diferentes indicadores de citação tornam possível verificar tanto a evolução das descobertas quanto o impacto do trabalho publicado. Esta análise quantitativa complementa as opiniões e os julgamentos realizados por especialistas (avaliação pelos pares, fornecendo instrumentos úteis e objetivos para avaliar os resultados da atividade científica.

  19. de La Ciénega, costa sur de Jalisco

    Directory of Open Access Journals (Sweden)

    Peter R. W. Gerritsen

    2008-01-01

    Full Text Available Hoy día la producción agroindustrial de alimentos es una actividad que está causando gran impacto tanto en los recursos naturales como en las culturas y los tejidos sociales; mientras que el modo campesino, opuesto al agroindustrial, propone una agricultura justa con base en las prácticas y experiencias campesinas generando así alternativas sustentables de producción.En este artículo se analizan cuatro estudios de caso de agricultores en el ejido de La Ciénega en la costa sur de Jalisco, los cuales se ubican en estos dos sistemas de producción. Los resultados exponen las técnicas de producción y estrategias campesinas que se desarrollan, así como la relación de los sistemas de producción ante las políticas agropecuarias. Terminamos resaltando la importancia de las prácticas y experiencias endógenas para el fortalecimiento de un desarrollo rural sustentable

  20. Introduction to mathematical physics methods and concepts

    CERN Document Server

    Wong, Chun Wa

    2013-01-01

    Mathematical physics provides physical theories with their logical basis and the tools for drawing conclusions from hypotheses. Introduction to Mathematical Physics explains to the reader why and how mathematics is needed in the description of physical events in space. For undergraduates in physics, it is a classroom-tested textbook on vector analysis, linear operators, Fourier series and integrals, differential equations, special functions and functions of a complex variable. Strongly correlated with core undergraduate courses on classical and quantum mechanics and electromagnetism, it helps the student master these necessary mathematical skills. It contains advanced topics of interest to graduate students on relativistic square-root spaces and nonlinear systems. It contains many tables of mathematical formulas and references to useful materials on the Internet. It includes short tutorials on basic mathematical topics to help readers refresh their mathematical knowledge. An appendix on Mathematica encourages...

  1. Core Muscle Activity, Exercise Preference, and Perceived Exertion during Core Exercise with Elastic Resistance versus Machine

    Directory of Open Access Journals (Sweden)

    Jonas Vinstrup

    2015-01-01

    Full Text Available Objectives. To investigate core muscle activity, exercise preferences, and perceived exertion during two selected core exercises performed with elastic resistance versus a conventional training machine. Methods. 17 untrained men aged 26–67 years participated in surface electromyography (EMG measurements of five core muscles during torso-twists performed from left to right with elastic resistance and in the machine, respectively. The order of the exercises was randomized and each exercise consisted of 3 repetitions performed at a 10 RM load. EMG amplitude was normalized (nEMG to maximum voluntary isometric contraction (MVC. Results. A higher right erector spinae activity in the elastic exercise compared with the machine exercise (50% [95% CI 36–64] versus 32% [95% CI 18–46] nEMG was found. By contrast, the machine exercise, compared with the elastic exercise, showed higher left external oblique activity (77% [95% CI 64–90] versus 54% [95% CI 40–67] nEMG. For the rectus abdominis, right external oblique, and left erector spinae muscles there were no significant differences. Furthermore, 76% preferred the torso-twist with elastic resistance over the machine exercise. Perceived exertion (Borg CR10 was not significantly different between machine (5.8 [95% CI 4.88–6.72] and elastic exercise (5.7 [95% CI 4.81–6.59]. Conclusion. Torso-twists using elastic resistance showed higher activity of the erector spinae, whereas torso-twist in the machine resulted in higher activity of the external oblique. For the remaining core muscles the two training modalities induced similar muscular activation. In spite of similar perceived exertion the majority of the participants preferred the exercise using elastic resistance.

  2. Por uma nova abordagem da interface ciência/sociedade: a tarefa da filosofia da ciência no contexto dos science studies

    OpenAIRE

    André Luís De Oliveira Mendonça

    2008-01-01

    Com esta tese, eu examino a relação entre ciência e sociedade a partir das novas discussões no interior da filosofia da ciência, suscitadas, em grande parte, pelos trabalhos empíricos produzidos pelos science studies. Trata-se de uma abordagem temática, na qual eu discorro sobre as principais teses dos profissionais mais renomados e autorizados de escrita inglesa nas áreas de história da ciência, sociologia da ciência e filosofia da ciência, tais como Thomas Kuhn, Paul Feyerabend, David Bloor...

  3. Introduction to Microemulsions

    Directory of Open Access Journals (Sweden)

    Gotić, M.

    2013-11-01

    Full Text Available Hoar and Schulman were the first (in 1943 to describe the transparent water-in-oil dispersion. They noted that a certain combination of water, oil, surfactant and alcohol cosurfactant would produce a clear homogeneous "solution", which Schulman in 1959 termed microemulsion. Schulman’s model of the inverse submicroscopic micelle is shown in Fig. 1. The IUPAC definitiondescribes microemulsion as a dispersion made of water, oil, and surfactant(s, which is an isotropic and thermodynamically stable system with dispersed domain diameter varying approximately from 1 to 100 nm, usually 10 to 50 nm. Water-in-oil microemulsions are important for the synthesis of various inorganic materials. In contrast to inverse micelle, water-in-oil micro-emulsion aggregates have mobile or free water in the core of the aggregate (Fig. 2. Reactions take place in a small volume of water inside a microdroplet, which results in improved properties of the products in terms of purity and particle size distribution. Microdroplet size can be controlled by suitable choice and mixing ratio of surfactant and cosurfactant (Fig. 3 and by the chemical composition of the oil and water phases. Microemulsions may have complex phase behaviour, commonly displayed in a phase diagram (Fig. 5 and Fig. 12. Surfactants are amphiphile molecules with hydrophilic head and lypophilic tail, thus bringing them affinity both to water and oil. Their main characteristics are adsorption at the interface and self-organization into supramolecular structures. By forming the interface layer, surfactants decrease surface tension and stabilize the microemulsion. According to the character of the hydrophilic head, surfactants are divided into anionic, cationic, nonionic, and amphoteric. Chemical structures of typical representatives are given in Fig. 6. Microemulsion aggregates may have various shapes, e.g. spherical, ellipsoidal, cylindrical, worm-like or bilayer (Fig. 7. Bicontinuous phase also occurs in

  4. An introduction to gas discharges

    CERN Document Server

    Howatson, A M

    2013-01-01

    An Introduction to Gas Discharges: Second Edition aims to provide a compact introduction to the subject of gas discharges, which continues to make both scientific and industrial progress. In this second edition, the author has made minor corrections, rewritten and expanded some sections, used SI units and modernized notions, in hopes of making the book more up to date. Included in the book is a short history of the subject, an introduction that enumerates the types of gas discharges, the fundamental processes, and then moves on to the more specific areas such as the breakdown, the self-sustai

  5. Nuclear physics a very short introduction

    CERN Document Server

    Close, Frank

    2015-01-01

    Nuclear physics began long before the identification of fundamental particles, with J. J. Thomson's discovery of the electron at the end of the 19th century, which implied the existence of a positive charge in the atom to make it neutral. In this Very Short Introduction Frank Close gives an account of how this area of physics has progressed, including the recognition of how heavy nuclei are built up in the cores of stars and in supernovae, the identification of quarks and gluons, and the development of quantum chromodynamics (QCD). Exploring key concepts such as the stability of different configurations of protons and neutrons in nuclei, Frank Close shows how nuclear physics brings the physics of the stars to Earth and provides us with important applications, particularly in medicine. ABOUT THE SERIES: The Very Short Introductions series from Oxford University Press contains hundreds of titles in almost every subject area. These pocket-sized books are the perfect way to get ahead in a new subject quickly. Our...

  6. Outburst-related period changes of recurrent nova CI aquilae

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, R. E.; Honeycutt, R. K., E-mail: honey@astro.indiana.edu, E-mail: rewilson@ufl.edu [Astronomy Department, Indiana University, Swain Hall West, Bloomington, IN 47405 (United States)

    2014-11-01

    Pre-outburst and post-outburst light curves and post-outburst eclipse timings are analyzed to measure any period (P) change related to nova CI Aql's outburst of early 2000 and a mean post-outburst dP/dt, which then lead to estimates of the accreting component's rate of mass (M) change and its overall outburst-related change of mass over roughly a decade of observations. We apply a recently developed procedure for unified analysis of three timing-related data types (light curves, radial velocities, and eclipse timings), although with only light curves and timings in this case. Fits to the data are reasonably good without need for a disk in the light-curve model, although the disk certainly exists and has an important role in our post-outburst mass flow computations. Initial experiments showed that, although there seems to be an accretion hot spot, it has essentially no effect on derived outburst-related ΔP or on post-outburst dP/dt. Use of atomic time (HJED) in place of HJD also has essentially nil effect on ΔP and dP/dt. We find ΔP consistently negative in various types of solutions, although at best only marginally significant statistically in any one experiment. Pre-outburst HJD {sub 0} and P results are given, as are post-outburst HJD {sub 0}, P, and dP/dt, with light curves and eclipse times as joint input, and also with only eclipse time input. Post-outburst dP/dt is negative at about 2.4σ. Explicit formulae for mass transfer rates and epoch-to-epoch mass change are developed and applied. A known offset in the magnitude zero point for 1991-1994 is corrected.

  7. A Brief Introduction to the Writing Strategy-Process Writing

    Institute of Scientific and Technical Information of China (English)

    YU Peng-tao

    2014-01-01

    Process writing has been commonly recognized by scholars as an effective writing strategy and widely applied in the teaching of writing. The stages of process writing have been elaborated in this paper through the introduction of overseas core ar-ticles in this field from a scientific perspective combined with a cognition angle. Implications have been put forward to teachers at the end of this paper.

  8. Gramsci’s Political Analysis: A Critical Introduction

    OpenAIRE

    Martin, James

    1998-01-01

    Antonio Gramsci's prison writings of the 1930s have made a lasting impression on contemporary political theory. Above all, his concept of `hegemony' has enabled new kinds of research into the relationship between culture and power. In this new introduction to Gramsci's thought, James Martin takes a critical look at the core themes of his famous Prison Notebooks and considers the relevance of Gramsci's analysis today.\\ud \\ud Martin situates Gramsci in the context of Italy's social and politica...

  9. Intracochlear Fluid Pressure Changes Related to the Insertional Speed of a CI Electrode

    Directory of Open Access Journals (Sweden)

    I. Todt

    2014-01-01

    Full Text Available Introduction. To preserve residual hearing the atraumaticity of the cochlea electrode insertion has become a focus of cochlear implant research. In addition to other factors, the speed of insertion is thought to be a contributing factor in the concept of atraumatic implantation. The aim of our study was to observe intracochlear fluid pressure changes due to different insertional speeds of an implant electrode in a cochlear model. Materials and Methods. The experiments were performed using an artificial cochlear model. A linear actuator was mounted on an Advanced Bionics IJ insertional tool. The intracochlear fluid pressure was recorded through a pressure sensor which was placed in the helicotrema area. Defined insertions were randomly performed with speeds of 0.1 mm/sec, 0.25 mm/sec, 0.5 mm/sec, 1 mm/sec, and 2 mm/sec. Results. A direct correlation between speed and pressure was observed. Mean maximum values of intracochlear fluid pressure varied between 0.41 mm Hg and 1.27 mm Hg. Conclusion. We provide the first results of fluid pressure changes due to insertional speeds of CI electrodes in a cochlear model. A relationship between the insertional speed and intracochlear fluid pressure was observed. Further experiments are needed to apply these results to the in vivo situation.

  10. A Science Centre as a Geoturism promoter - the Lagos Ciência Viva examples (Portugal).

    Science.gov (United States)

    Azevedo Rodrigues, Luis; Leote, Catarina

    2017-04-01

    Science outreach and engagement are crucial core objectives of the Lagos Ciência Viva Science Centre (CCVL). By engaging audiences in the real world a link is made between their science centre experience and the environment in which they live. Therefore, it has been an option of the CCVL to offer geological outdoor activities, both in the natural environment and urban context. Dinosaurs are an appealing science subject for both students and tourists. Thus, the CCVL has a long tradition in organizing and guiding field trips to two dinosaur track sites - Salema and Santa beaches (Vila do Bispo, southwest Algarve). These sites, both from the Lower Cretaceous reveal at least two types of tracks - theropod and iguanodontian footprints. Often in combination with the paleontology field trips, the CCVL also offers different geological field trips both for formal (school) and informal (tourism) education. This allows students and tourists to be introduced to dinosaur paleobiology and ichnology and to the structural geology and stratigraphy of the area. Our science outreach is being further developed by contractual agreement with a regional tour operator, in which the CCVL is responsible for the scientific content and guidance of the visits. Aiming at an urban context, the CCVL produced three Urban Geology and Paleontology Guide Books for three Algarve cities (Lagos, Faro and Tavira), which can be acquired in the three Ciência Viva Science Centres shops as well as in the tourist information offices serving this way as a basis for guided urban tours also offered by the CCVL. Based on our experience, we review and contextualise these geoscience activities and their potential for science outreach, communication and tourism. We discuss and propose a classification of different possibilities in geoscience communication and outreach based on three vertices: Science, Heritage and Geotourism. Some particularities of these visits, such as the merge between geosciences and other

  11. k-core covers and the core

    NARCIS (Netherlands)

    Sanchez-Rodriguez, E.; Borm, Peter; Estevez-Fernandez, A.; Fiestras-Janeiro, G.; Mosquera, M.A.

    2015-01-01

    This paper extends the notion of individual minimal rights for a transferable utility game (TU-game) to coalitional minimal rights using minimal balanced families of a specific type, thus defining a corresponding minimal rights game. It is shown that the core of a TU-game coincides with the core of

  12. Academic Rigor: The Core of the Core

    Science.gov (United States)

    Brunner, Judy

    2013-01-01

    Some educators see the Common Core State Standards as reason for stress, most recognize the positive possibilities associated with them and are willing to make the professional commitment to implementing them so that academic rigor for all students will increase. But business leaders, parents, and the authors of the Common Core are not the only…

  13. k-core covers and the core

    NARCIS (Netherlands)

    Sanchez-Rodriguez, E.; Borm, Peter; Estevez-Fernandez, A.; Fiestras-Janeiro, G.; Mosquera, M.A.

    This paper extends the notion of individual minimal rights for a transferable utility game (TU-game) to coalitional minimal rights using minimal balanced families of a specific type, thus defining a corresponding minimal rights game. It is shown that the core of a TU-game coincides with the core of

  14. An Introduction to Quantum Optomechanics

    National Research Council Canada - National Science Library

    Milburn, G J; Woolley, M J

    2011-01-01

    We provide an introduction to the description of mechanical systems in the quantum regime, and provide a review of the various types of micro-scale and nano-scale optomechanical and electromechanical systems...

  15. Introduction to indexing and abstracting

    CERN Document Server

    Cleveland, Ana

    2013-01-01

    Successful information access in the digital information age requires robust systems of indexing and abstracting. This book provides a complete introduction to the subject that covers the many recent changes in the field.

  16. Branon dark matter: an introduction

    CERN Document Server

    Cembranos, J A R; Maroto, A L

    2004-01-01

    This is a brief introduction to branon physics and its role in the dark matter problem. We pay special attention to the phenomenological consequences, both in high-energy particle physics experiments and in astrophysical and cosmological observations.

  17. An Introduction to Learning Design

    NARCIS (Netherlands)

    Koper, Rob

    2005-01-01

    Koper, R. (2005). An Introduction to Learning Design. In: Koper, R. & Tattersall, C., Learning Design: A Handbook on Modelling and Delivering Networked Education and Training (pp. 3-20). Berlin-Heidelberg: Springer Verlag.

  18. Antioxidants and Health: An Introduction

    Science.gov (United States)

    ... R S T U V W X Y Z Antioxidants: In Depth Share: On This Page Introduction Key ... safe care. About Free Radicals, Oxidative Stress, and Antioxidants Free radicals are highly unstable molecules that are ...

  19. An Introduction to Learning Design

    NARCIS (Netherlands)

    Koper, Rob

    2005-01-01

    Koper, R. (2005). An Introduction to Learning Design. In: Koper, R. & Tattersall, C., Learning Design: A Handbook on Modelling and Delivering Networked Education and Training (pp. 3-20). Berlin-Heidelberg: Springer Verlag.

  20. An Introduction to Cognitive Musicology

    DEFF Research Database (Denmark)

    Haumann, Niels Trusbak

    2015-01-01

    This historical-scientific introduction to Cognitive Musicology introduces the 150 years of research and discoveries in the psychology of music that partly presuppose the more recent discipline of Cognitive Musicology. Atomistic, Gestalt, functionalist, testing, behaviorist, cognitive, and neuros......This historical-scientific introduction to Cognitive Musicology introduces the 150 years of research and discoveries in the psychology of music that partly presuppose the more recent discipline of Cognitive Musicology. Atomistic, Gestalt, functionalist, testing, behaviorist, cognitive...

  1. Short Introduction to Quantum Computation

    Science.gov (United States)

    2007-11-02

    Proceedings of the Air Force Office of Scientific Research Computational Mathematics Meeting 1996 Revision 2 Short Introduction to Quantum...useful for nanoscale computing and quantum computing. KEY WORDS: quantum computing, nano-scale computing, Moore’s law 1 Introduction It is likely that...memory) Digital Devices magnetostrictive delay line Intel 1103 integrated circuit IBM 3340 disk drive Smallest DRAM cell reported on at ISSC Current

  2. Introduction to wind turbine aerodynamics

    CERN Document Server

    Schaffarczyk, Alois Peter

    2014-01-01

    Wind-Turbine Aerodynamics is a self-contained textbook which shows how to come from the basics of fluid mechanics to modern wind turbine blade design. It presents a fundamentals of fluid dynamics and inflow conditions, and gives a extensive introduction into theories describing the aerodynamics of wind turbines. After introducing experiments the book applies the knowledge to explore the impact on blade design.The book is an introduction for professionals and students of very varying levels.

  3. An introduction to electrooptic devices

    CERN Document Server

    Kaminow, Ivan P

    1974-01-01

    An Introduction to Electrooptic Devices aims to present an introduction to the electrooptic effect and to summarize work on devices employing the electrooptic effect. The book provides the necessary background in classical crystal optics. The text then discusses topics including crystal symmetry, the tensor description of linear dielectric properties, propagation in anisotropic media, and passive crystal optic devices. The book also describes the phenomenological description of tensor nonlinear dielectric properties of crystals, with emphasis on the electrooptic effect; device design and appli

  4. Ciência em Cuba: uma aposta pela soberania

    Directory of Open Access Journals (Sweden)

    Orfilio Peláez Mendoza

    2011-01-01

    Full Text Available No dia 15 de janeiro de 1960, o então primeiro-ministro do Governo Revolucionário, Fidel Castro Ruz, disse que o futuro de Cuba teria que ser necessariamente um futuro de homens de ciência, um futuro de homens de pensamento. Meio século depois de pronunciada tão profética frase, a ilha caribenha é um país de pesquisadores, especialistas e operários altamente qualificados, que dispõe de uma das indústrias biotecnológicas mais importantes do mundo, com resultados comparáveis aos atingidos pelas nações líderes nessa área do conhecimento, e na qual a atividade científica está a caminho de se converter numa potente força produtiva, geradora de significativo ingresso de divisas e de um bem-estar maior para a sociedade.El 15 de enero de 1960 el entonces primer ministro del Gobierno Revolucionario, Fidel Castro Ruz, dijo que el futuro de Cuba tendría que ser necesariamente un futuro de hombres de ciencia, un futuro de hombres de pensamiento. Medio siglo después de pronunciada tan profética frase, la Isla caribeña es un país de investigadores, especialistas y obreros altamente calificados, que dispone de una de las industrias biotecnológicas más pujantes del mundo, con resultados comparables a los alcanzados por las naciones líderes en esta esfera del conocimiento, y donde la actividad científica va en camino de convertirse en una potente fuerza productiva, generadora de significativos ingresos en divisas y de un mayor bienestar para la sociedad.On January 15, 1960, Fidel Castro Ruz, then prime minister of the Revolutionary Government, said that Cuba's future would necessarily have to be a future of men of science, a future of men of thought. Half a century after this prophetic announcement, the Caribbean island is a country of researchers, specialists and highly skilled workers, boasting one of the world's most important biotechnological industries, with achievements comparable to those of leading nations in this field of

  5. EDITORIAL: Editor's Introduction

    Science.gov (United States)

    Blackburn, D. A.

    1990-01-01

    Since its first issue in 1965 Metrologia has had just three editors, a history of tenure which suggests that those who hold the post find in it sufficient to interest, occupy, challenge and amuse them. I see no reason to doubt that this happy circumstance will continue and look forward to my own period as editor with the intention of retaining, insofar as I am able to interpret them, the best traditions the journal has established so far. As I take up my editorial duties I have become aware that surrounding Metrologia there is a small community of authors, reviewers and readers on whose support the success of the journal entirely depends. It is a community in which the roles change daily with some of its members engaged, even simultaneously, as reader, reviewer and author. I am well aware that the goodwill extended to me as I enter this community is in no small part due the efforts of the outgoing editor, Dr Ralph Hudson, whose easy, engaging and courteous, yet firm, relationship with authors and reviewers emerges clearly from editorial correspondence. I thank him for that he has done and wish him an active and happy retirement. A short foray into the records of Metrologia shows - in the first editorial - that four main kinds of article were originally envisaged: research articles likely to contribute to progress in fundamental scientific measurements, reports of experiments or techniques of particular importance or originality in the area of secondary measurement, articles concerning the decisions of the Comité International des Poids et Mesures, and review articles. No balance was specified but a priority was assigned to articles dealing with fundamental metrology. Of the four categories, the first two represent the core of Metrologia's activity and largely determine its reputation as a publication. For this reason, editorial implementation of the policy set by the CIPM is mainly exercised through the operation of a reviewing system which is intentionally strict

  6. Comodules over semiperfect corings

    CERN Document Server

    Caenepeel, S

    2011-01-01

    We discuss when the Rat functor associated to a coring satisfying the left $\\alpha$-condition is exact. We study the category of comodules over a semiperfect coring. We characterize semiperfect corings over artinian rings and over qF-rings.

  7. Coring Sample Acquisition Tool

    Science.gov (United States)

    Haddad, Nicolas E.; Murray, Saben D.; Walkemeyer, Phillip E.; Badescu, Mircea; Sherrit, Stewart; Bao, Xiaoqi; Kriechbaum, Kristopher L.; Richardson, Megan; Klein, Kerry J.

    2012-01-01

    A sample acquisition tool (SAT) has been developed that can be used autonomously to sample drill and capture rock cores. The tool is designed to accommodate core transfer using a sample tube to the IMSAH (integrated Mars sample acquisition and handling) SHEC (sample handling, encapsulation, and containerization) without ever touching the pristine core sample in the transfer process.

  8. An in vitro comparative evaluation of physical properties of four different types of core materials

    OpenAIRE

    2014-01-01

    Introduction: Compressive and tensile stresses of core materials are important properties because cores usually replace a large bulk of tooth structure and must resist multidirectional masticatory forces for many years. Material and Methods: The present study was undertaken to find out the best core build up material with respect to their physical properties among resin-based composites. Individual compressive, tensile, and flexural strength of fiber-reinforced dual cure resin core build...

  9. Banded transformer cores

    Science.gov (United States)

    Mclyman, C. W. T. (Inventor)

    1974-01-01

    A banded transformer core formed by positioning a pair of mated, similar core halves on a supporting pedestal. The core halves are encircled with a strap, selectively applying tension whereby a compressive force is applied to the core edge for reducing the innate air gap. A dc magnetic field is employed in supporting the core halves during initial phases of the banding operation, while an ac magnetic field subsequently is employed for detecting dimension changes occurring in the air gaps as tension is applied to the strap.

  10. Chaos a very short introduction

    CERN Document Server

    Smith, Leonard

    2007-01-01

    Chaos: A Very Short Introduction shows that we all have an intuitive understanding of chaotic systems. It uses accessible maths and physics (replacing complex equations with simple examples like pendulums, railway lines, and tossing coins) to explain the theory, and points to numerous examples in philosophy and literature (Edgar Allen Poe, Chang-Tzu, and Arthur Conan Doyle) that illuminate the problems. The beauty of fractal patterns and their relation to chaos, as well as the history of chaos, and its uses in the real world and implications for the philosophy of science are all discussed in this Very Short Introduction.

  11. Introduction to biomedical engineering technology

    CERN Document Server

    Street, Laurence J

    2011-01-01

    IntroductionHistory of Medical DevicesThe Role of Biomedical Engineering Technologists in Health CareCharacteristics of Human Anatomy and Physiology That Relate to Medical DevicesSummaryQuestionsDiagnostic Devices: Part OnePhysiological Monitoring SystemsThe HeartSummaryQuestionsDiagnostic Devices: Part TwoCirculatory System and BloodRespiratory SystemNervous SystemSummaryQuestionsDiagnostic Devices: Part ThreeDigestive SystemSensory OrgansReproductionSkin, Bone, Muscle, MiscellaneousChapter SummaryQuestionsDiagnostic ImagingIntroductionX-RaysMagnetic Resonance Imaging ScannersPositron Emissio

  12. Introduction to THz wave photonics

    CERN Document Server

    Zhang, X-C

    2009-01-01

    Introduction to THz Wave Photonics examines the science and technology related to terahertz wave technologies, taking a dual approach between presenting the field 's history while simultaneously providing an overview of existing technology. The latest research in developing THz areas such as electromagnetic waves are presented, along with an introduction to continuous wave THz technology. Authors X.-C. Zhang and Jingzhou Xu place particular emphasis on pulsed THz technology, among many other facets of THz technology including: Complete coverage of THz wave spectroscopy and imagingA discussion

  13. An introduction to fire dynamics

    CERN Document Server

    Drysdale, Dougal

    2011-01-01

    "Drysdale's book is by far the most comprehensive - everyone in the office has a copy...now including me. It holds just about everything you need to know about fire science."(Review of An Introduction to Fire Dynamics, 2nd Edition) After 25 years as a bestseller, Dougal Drysdale's classic introduction has been brought up-to-date and expanded to incorporate the latest research and experimental data.  Homework problems are included, with solutions, and others are available on the accompanying website at www.wiley.com/go/drysdale. Essential reading for all involved in the field from undergraduate

  14. Introduction to applied algebraic systems

    CERN Document Server

    Reilly, Norman R

    2009-01-01

    This upper-level undergraduate textbook provides a modern view of algebra with an eye to new applications that have arisen in recent years. A rigorous introduction to basic number theory, rings, fields, polynomial theory, groups, algebraic geometry and elliptic curves prepares students for exploring their practical applications related to storing, securing, retrieving and communicating information in the electronic world. It will serve as a textbook for an undergraduate course in algebra with a strong emphasis on applications. The book offers a brief introduction to elementary number theory as

  15. An Introduction to TTCN-3

    CERN Document Server

    Willcock, Colin; Tobies, Stephan; Keil, Stefan; Engler, Federico; Schulz, Stephan; Wiles, Anthony

    2011-01-01

    This unique book provides a fully revised and up-to-date treatment of the TTCN-3 language TTCN-3 is an internationally standardised test language with a powerful textual syntax which has established itself as a global, universal testing language. Application of TTCN-3 has been widened beyond telecommunication systems to areas such as the automotive industry, internet protocols, railway signalling, medical systems, and avionics.An Introduction to TTCN-3 gives a solid introduction to the TTCN-3 language and its uses, guiding readers though the TTCN-3 standards, methodologies and tools with examp

  16. Introduction to computers: Reference guide

    Energy Technology Data Exchange (ETDEWEB)

    Ligon, F.V.

    1995-04-01

    The ``Introduction to Computers`` program establishes formal partnerships with local school districts and community-based organizations, introduces computer literacy to precollege students and their parents, and encourages students to pursue Scientific, Mathematical, Engineering, and Technical careers (SET). Hands-on assignments are given in each class, reinforcing the lesson taught. In addition, the program is designed to broaden the knowledge base of teachers in scientific/technical concepts, and Brookhaven National Laboratory continues to act as a liaison, offering educational outreach to diverse community organizations and groups. This manual contains the teacher`s lesson plans and the student documentation to this introduction to computer course.

  17. Solid state physics an introduction

    CERN Document Server

    Hofmann, Philip

    2015-01-01

    A must-have textbook for any undergraduate studying solid state physics. This successful brief course in solid state physics is now in its second edition. The clear and concise introduction not only describes all the basic phenomena and concepts, but also such advanced issues as magnetism and superconductivity. Each section starts with a gentle introduction, covering basic principles, progressing to a more advanced level in order to present a comprehensive overview of the subject. The book is providing qualitative discussions that help undergraduates understand concepts even if they can?t foll

  18. As ciências naturais e as ciências do espírito na era da globalização

    Directory of Open Access Journals (Sweden)

    Jaeschke, Walter

    2006-01-01

    Full Text Available Este artigo, o autor apresenta, primeiramente, reflexões de cunho histórico sobre a relação entre as Ciências Naturais e as Ciências do Espírito, seguidas de observações, de caráter mais sistemático, sobre o conceito das próprias Ciências do Espírito. Com fundamento nessas observações, tece algumas reflexões sobre até que ponto podemos esperar da globalização efeitos sobre as Ciências Naturais e as Ciências do Espírito

  19. CI in the work place: does involving the HRM function make any difference?

    DEFF Research Database (Denmark)

    Hyland, Paul; Becker, Karen; Sload, Terry

    2008-01-01

    People are central to successful Continuous Improvement (CI), and in larger organisations a Human Resource Management (HRM) function is responsible for people related issues. Central to CI is learning and a culture that supports CI. Learning needs to be both individual and organisational, and must...... benefit the organisation's performance. The HRM function is often given the task of championing cultural change and managing aspects of training and learning, and it would appear that involvement of HRM professionals would enhance CI efforts and assist in the timely solution of issues within the CI...... process. This paper aims to determine the influence of involving HRM professionals in CI, and if their involvement has any impact on support and tools used in CI and the contribution of CI to business performance....

  20. A General Introduction to Microcomputers.

    Science.gov (United States)

    Muiznieks, Viktors

    This basic introduction to microcomputers provides the neophyte with the terminology, definitions, and concepts that explain the microcomputer and computing technology in general. Mathematical operations with binary numbers, computer storage, controlling logic, and the concepts of stack and interrupt are explained. (RAO)

  1. Introduction to nanomedicine and nanobioengineering

    CERN Document Server

    Prasad, Paras N

    2012-01-01

    This book is an introduction to the emerging field of nanomedicine and its applications to health care. It describes the many multidisciplinary challenges facing nanomedicine and discusses the required collaboration between chemists, physicists, engineers and clinicians. The book introduces the reader to nanomedicine's vast potential to improve and extend human life through the application of nanomaterials in diagnosis and treatment of disease.

  2. Unit 03 - Introduction to Computers

    OpenAIRE

    Unit 74, CC in GIS; National Center for Geographic Information and Analysis

    1990-01-01

    This unit provides a brief introduction to computer hardware and software. It discusses binary notation, the ASCII coding system and hardware components including the central processing unit (CPU), memory, peripherals and storage media. Software including operating systems, word processors database packages, spreadsheets and statistical packages are briefly described.

  3. Presentación (Introduction

    Directory of Open Access Journals (Sweden)

    Margarita Gómez Gómez

    2015-03-01

    Full Text Available Resumen: Presentación del monográfico "Rey, sello y representación: el poder de la escritura y el documento en el gobierno de las Indias".Abstaract: Introduction of the monograph "King, seal and representation: the power of writing and document in the government of the Spanish Indies."

  4. Introduction to QCD Sum Rules

    Science.gov (United States)

    Dominguez, C. A.

    2013-08-01

    A general, and very basic introduction to QCD sum rules is presented, with emphasis on recent issues to be described at length in other papers in this issue. Collectively, these papers constitute the proceedings of the International Workshop on Determination of the Fundamental Parameters of QCD, Singapore, March 2013.

  5. Polymeric Materials - introduction and degradation

    DEFF Research Database (Denmark)

    Kontogeorgis, Georgios

    1999-01-01

    These notes support the polymer part of the courses 91742 and 91762 (Materials and Corrosion/degradation of materials) taught in IFAKthey contain a short introduction on group contribution methods for estimating properties of polymers, polymer thermodynamics, viscoelasticity models as well...

  6. Introduction: Teaching Black Lives Matter

    Directory of Open Access Journals (Sweden)

    Paula Austin

    2016-11-01

    Full Text Available An introduction to Radical Teacher, Issue 106: Teaching Black Lives Matter. This issue brings together a diverse collection of articles exploring educator’s responses, strategies, and stories on how #BlackLivesMatter has informed their teaching practice, the content of their courses, and their personal relationship to colleagues, family, friends, and self.

  7. Introduction to Weeds and Herbicides.

    Science.gov (United States)

    Hartwig, Nathan L.

    This agriculture extension service publication from Pennsylvania State University is an introduction to weed control and herbicide use. An initial discussion of the characteristics of weeds includes scientific naming, weed competition with crops, weed dispersal and dormancy, and conditions affecting weed seed germination. The main body of the…

  8. The Lisbon Agenda: An Introduction

    Science.gov (United States)

    Lice, Anita; Striedinger, Angelika; Scholz, Christine; Mac Sithigh, Daithi; Fenech, Justin; Miklavic, Klemen; Geven, Koen; Stambolieva, Marija; Haslinger, Susi

    2006-01-01

    This handbook is an introduction to Lisbon Agenda and it is presented as a basis for ESIB's (The National Unions of Students in Europe) concerted work on the European Union's all-embracing strategy that is changing the parameters of the education systems. The reason for the existence of this handbook is the necessity to coordinate the work on all…

  9. Introduction to mathematical fluid dynamics

    CERN Document Server

    Meyer, Richard E

    2010-01-01

    An introduction to the behavior of liquids and gases, this volume provides excellent coverage of kinematics, momentum principle, Newtonian fluid, rotating fluids, compressibility, and more. It is geared toward advanced undergraduate and graduate students of mathematics and general science, and it requires a background in calculus and vector analysis. 1971 edition.

  10. Introduction to Supersymmetric Gauge Theories

    CERN Document Server

    Piguet, O

    1997-01-01

    In these lectures I present a basic introduction to supersymmetry, especially to N=1 supersymmetric gauge theories and their renormalization, in the Wess-Zumino gauge. I also discuss the various ways supersymmetry may be broken in order to account for the lack of exact supersymmetry in the actual world of elementary particles.

  11. Introduction to (participatory) design games

    DEFF Research Database (Denmark)

    Brandt, Eva

    2014-01-01

    This article gives an introduction to (participatory) design games in three rounds. Firstly it argues that designing design games is a particular and very productive genre for formatting participation and design dialogues during ongoing design projects. Secondly it presents some of the main...

  12. Freud's "On Narcissism: An Introduction"

    Science.gov (United States)

    Crockatt, Philip

    2006-01-01

    The author reviews Freud's (1914) seminal paper "On narcissism: an introduction". Freud's paper is briefly set in the historical context of the evolution of psychoanalysis and psychoanalytic theories, and Freud's metapsychology up to the publication of his Narcissism paper is outlined. A detailed and comprehensive description of the content of the…

  13. Polymeric Materials - introduction and degradation

    DEFF Research Database (Denmark)

    Kontogeorgis, Georgios

    1999-01-01

    These notes support the polymer part of the courses 91742 and 91762 (Materials and Corrosion/degradation of materials) taught in IFAKthey contain a short introduction on group contribution methods for estimating properties of polymers, polymer thermodynamics, viscoelasticity models as well...

  14. Presentación (Introduction

    Directory of Open Access Journals (Sweden)

    Gómez Gómez, Margarita

    2014-05-01

    Full Text Available Resumen: Presentación del monográfico "Rey, sello y representación: el poder de la escritura y el documento en el gobierno de las Indias". Abstaract: Introduction of the monograph "King, seal and representation: the power of writing and document in the government of the Spanish Indies."

  15. Freud's "On Narcissism: An Introduction"

    Science.gov (United States)

    Crockatt, Philip

    2006-01-01

    The author reviews Freud's (1914) seminal paper "On narcissism: an introduction". Freud's paper is briefly set in the historical context of the evolution of psychoanalysis and psychoanalytic theories, and Freud's metapsychology up to the publication of his Narcissism paper is outlined. A detailed and comprehensive description of the content of the…

  16. Introduction to Weeds and Herbicides.

    Science.gov (United States)

    Hartwig, Nathan L.

    This agriculture extension service publication from Pennsylvania State University is an introduction to weed control and herbicide use. An initial discussion of the characteristics of weeds includes scientific naming, weed competition with crops, weed dispersal and dormancy, and conditions affecting weed seed germination. The main body of the…

  17. Consumption and happiness: An introduction

    NARCIS (Netherlands)

    R. Veenhoven (Ruut); L. Stanca (Luca)

    2015-01-01

    textabstractWhile abundant evidence is available about the relationship between income and happiness, relatively little is known about the effects of the level and composition of consumption on happiness. The present paper provides an introduction to this special issue devoted to Consumption and Hap

  18. Introduction to the Special Issue

    OpenAIRE

    Benati, Alessandro; Lee, James F.

    2015-01-01

    [Without Abstract]\\ud Introduction to International Review of Applied Linguistics in Language Teaching, Volume 53, Issue 2 (Jun 2015)- Special Issue: Processing instruction: New insights after twenty years of theory, research and application. Guest Editors: Alessandro Benati and James F. Lee.

  19. Introduction to High Explosives Science

    Energy Technology Data Exchange (ETDEWEB)

    Skidmore, Cary Bradford [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Preston, Daniel N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-11-17

    These are a set of slides for educational outreach to children on high explosives science. It gives an introduction to the elements involved in this science: carbon, hydrogen, nitrogen, and oxygen. Combined, these form the molecule HMX. Many pictures are also included to illustrate explosions.

  20. Introduction

    Science.gov (United States)

    Assmann, R. W.; Ferrario, M.

    2016-09-01

    Particle accelerators are a field of continuing and growing success. Today about 30,000 accelerators are operated with various types of particles, including electrons, positrons, protons, neutrinos and various kinds of ions. These particles are used for the investigation of fundamental particles and forces in our universe. In parallel a fast growing field of accelerator-based photon science has developed since the 1970"s. Modern particle beams produce unique photon pulses that are used in ground-breaking studies on fast processes in chemistry and biology, on structures of viruses and bacteria, on the phenomenon of multi-resistivity to medication, on the functioning of photo-synthesis at the electronic level and on other important challenges for human mankind. Last not least, numerous particle accelerators are being used every day for industrial and medical applications, including the irradiation of tumors in human patients.

  1. Introduction

    Science.gov (United States)

    Rebecca J. McLain; Marla R. Emery

    2001-01-01

    Wherever and whenever forests and humans have occupied the same space on Earth, it can be expected that Non-Timber Forest Products (NTFP) have made important contributions to people's livelihoods. NTFP research and policy, however, have generally focused on the Third World. This special issue shifts attention to NTFP use, research, and policy concerns in the...

  2. Introduction

    NARCIS (Netherlands)

    Binsbergen, van W.M.J.

    2003-01-01

    This volume brings together fifteen essays investigating aspects of interculturality. Published between 1969 and 2002, the essays operate at the borderline between anthropology and intercultural philosophy. Ethnographic data are derived from field research carried out in Tunisia, Zambia and Botswana

  3. Introduction

    DEFF Research Database (Denmark)

    Kornberger, Martin; Justesen, Lise; Mouritsen, Jan;

    2015-01-01

    that are grounded in the way people praise and prize things. The book is arranged around five concerns that underpin the debate about making things valuable. These concerns are: calculating/economizing; commensurating/switching; visualizing/hiding; modelling/tracing; and knowing/disciplining....

  4. Introduction

    NARCIS (Netherlands)

    M. de Wilde

    2008-01-01

    This year, on December 10, it will be exactly 60 years since the United Nations General Assembly unanimously adopted the Universal Declaration of Human Rights. The Declaration's aim was togive all ‘members of the human family', regardless of sex, race, nationality, and class, legal protection agains

  5. Introduction

    NARCIS (Netherlands)

    Jansen, M.M.; Jordão, Paula

    2006-01-01

    The events of 1968 and their repercussions in the seventies are generally characterised as an essential part of a decade of social conflict and evoke contradictory memories in national European imaginaries. This is certainly the case in Italy and Portugal, where the clash between creativity and viol

  6. Introduction

    Institute of Scientific and Technical Information of China (English)

    Y. J. Cui

    2010-01-01

    @@ This is the second issue on unsaturated soil mechanics and deep geological nuclear waste disposal, corresponding to the International Symposium UNSAT-WASTE 2009 which was organised by Tongji University, China Three Gorges University, State Key Laboratory of Geomechanics and Geotechnical Engineering, Institute of Rock and Soil Mechanics, Chinese Academy of Sciences, and Ecole des Ponts ParisTech. This Symposium was held under the supports of TC6 (unsaturated soils) of ISSMGE, Commission on Radioactive Waste Disposal of ISRM, Commission on Underground Waste Disposal of CSRME, the National Natural Science Foundation of China and Earth Products China (EPC) Limited. Different experiences gained by various countries such as China, France, Germany, Belgium and Spain were presented and exchanged at the Symposium.

  7. Introduction

    Directory of Open Access Journals (Sweden)

    David-Claude Kemo Keimbou

    2016-01-01

    Full Text Available Depuis le début des années 2010, on « commémore » le cinquantenaire des indépendances des pays d'Afrique noire francophone, de leurs armées, de leurs universités et grandes écoles, mais aussi de leur sport et mouvement sportif.

  8. Introduction

    DEFF Research Database (Denmark)

    Pyka, Andreas; Andersen, Esben Sloth

    2013-01-01

    The general theme of the thirteenth International Joseph A. Schumpeter Society Conference, held during June 21th–24th, 2010 at Aalborg University in Denmark, was the exploration of the interrelated phenomena of innovation, organization, sustainability and crises. By addressing these phenomena...

  9. Introduction

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Review of China' s Logistics Industry in 2011 and Outlook in 2012 The past year of 2011 is the first period of China' s Twelfth Five-Year Plan. Over the past year, under the strong leadership of the State Council, with the theme of scientific development and the main line of the transformation, all walks of the life continue to promote reform and opening up policy and socialist modemization construction,

  10. Introduction

    Science.gov (United States)

    Luhmann, J. G.; Tatrallyay, M.

    Venus and Mars, our neighboring planets, have a long history in the human consciousness. Venus, in particular, was notable because of its brightness compared to other star-like objects in the sky. The first observations of Venus on record may be those enscribed by Babylonians on the famous "Venus tablet" in the British museum, which has been dated to ˜1700 BC. Venus has generally been associated with the female gender, except in ancient India. The name comes from the Roman goddess of love and beauty (analogous to the Babylonian Ishtar and the Greek Aphrodite). Venus was first thought by the Greeks to be two objects—a morning star "Phosphorus" and an evening star "Hesperus". Phythagoras, in 6 BC, is credited with being first to recognize they were the same object. Venus has since figured prominently in the history of physics and astronomy. The Greek Aristarchus first suggested (in ˜310-250 BC) that the planets move around the sun, but the idea lost favor to a theory of Ptolemy, which placed Earth at the center of the solar system. In the 9th-15th centuries, Arab astronomers studied Venus, and in the "new world," the Mayas used it in the organization of their calendar. In 1543, Copernicus finally published his own version of Aristarchus' vision of a heliocentric solar system, but it was probably not until Galileo, in ˜1610, telescopically observed that Venus had phases like the moon, that heliocentric theory was widely accepted (despite delays associated with the prevailing religious dogma). He announced that momentous discovery in a coded message to his contemporary Kepler (a usual practice of the time), which translated to "the mother of the loves imitates the phases of Cynthia".

  11. Introduction

    Directory of Open Access Journals (Sweden)

    Daniele Benati

    2016-11-01

    Full Text Available This Dossier – the first of «Intrecci d’Arte» – collects some of the papers presented at an international conference organized in 2014 by the PhD course in History of Art of the University of Bologna, in collaboration with The PhD courses of the Universities of Florence, Genoa, Naples, Padua, Pisa, Siena and Venice-Verona. In presenting the topics, the curator focuses on the ‘main’ function of the fresco decoration in the Gothic period. The use of embellishing the sacred buildings with great fresco cycles aims to indicate the sacredness of the place and to represent the message of God's Word through images. According to Bruno Toscano, in fact, the main function of fresco cycles is connected to their setting. Carefully studied iconographic programs address to educated people, while the rich colors of the painted walls and the forcefulness of single images have to appeal the devotees, even if they weren’t able to understand the meaning of them. This aspect also explains the controversy born in the Franciscan Order concerning the pomp of the decoration, in contrast with the Vote of Poverty. During the Fourteenth Century, the custom of votive frescoes commissioned by single devotees changes the relationship between audience and images.

  12. Introduction

    DEFF Research Database (Denmark)

    Grosser, Kate; McCarthy, Lauren; Kilgour, Maureen A.

    2016-01-01

    The idea for this book grew out of the work on gender and corporate social responsibility (CSR) undertaken at the International Centre for Corporate Social Responsibility (ICCSR), Nottingham University Business School (UK). Beginning in 2003, this research and teaching agenda expanded quite rapid...

  13. Introduction

    Directory of Open Access Journals (Sweden)

    Lynn A. Higgins

    1985-09-01

    Full Text Available From an issue of the Magazine Litteraire featuring the work of Fernand Braudel to an article by Hayden White on the "Absurdist moment" in criticism, it is clear that the disciplines of history and literary studies are converging. Historians like White and Dominick La Capra in the United States, and Michel de Certeau and the members of the Annales School in France are investigating the rhetorical modes of their craft and exploring implications of the fact that it is historians themselves who "make history." At the same time, literary scholars, emerging from Structuralism and the New Criticism, are seeking with increasing urgency to understand the historical dimensions of fiction. By bridging the gap between story and history and by opening lines of dialogue between two traditionally separate. even hostile, fields of inquiry, the essays in this issue of Studies in Twentieth Century Literature provide support for the recent assertion that to raise the question of the historical within literary studies is "the most vital stance to take at this particular moment in history..."

  14. Introduction

    DEFF Research Database (Denmark)

    Peters, Chris

    2016-01-01

    the Google equivalent of a blank stare, even writing it down or saying it aloud feels a little awkward. This is almost certainly no discursive anomaly but is rather indicative of the subjugation of spatial thinking to temporal analysis within academia (Soja 1989). While space has been “treated as the dead...

  15. Introduction

    DEFF Research Database (Denmark)

    Jakobsen, Michael; Worm, Verner; Li, Xin

    2017-01-01

    The global business context is turbulent and becoming a dynamic complex system where small events can trigger large outcomes that are difficult to predict. This gives urgency to the search for responsive global organizations that are able to adapt the multinational corporate strategy so it provides...... a better fit with the changing demands of the environment. An important key to this challenge is to activate the responsive potential of the many individuals in the multinational corporation and use them to inform strategic decisions and gain updated insights from the field and instill an organizational...... culture with supportive structures that will release the entrepreneurial human potential throughout the global organization. The eight chapters presented in this book provide useful insights to fuel these considerations....

  16. Introduction

    Directory of Open Access Journals (Sweden)

    Jana S. ROŠKER

    2016-02-01

    Full Text Available Spirituality plays a significant role in shaping the cohesion of communities, their values, and their structures across the globe. Various religious practices and ideational systems are particularly complex in Asia. Home to some of the world major spiritual traditions such as Hinduism and Buddhism, Daoism and Confucianism, as well as to a relevant number of practicing Christians, Muslims, and self-identified atheists and agnostics, Asia provides us with an intense and extraordinarily rich tapestry of different religious and spiritual practices...

  17. Introduction

    DEFF Research Database (Denmark)

    Andersen, Gisle; Hardt, Daniel

    2014-01-01

    Recent decades of research in linguistics have seen a shift towards empirical methods and an increased use of data from corpora as a basis for making claims about language (Sampson 2005). This trend has made its mark on research on the Nordic languages also, and the current special issue aims...

  18. Introduction

    DEFF Research Database (Denmark)

    Rubin, Olivier; Bruun, Ole

    2015-01-01

    The article discusses various reports publsihed within the issue which includes social repercussions of diverse natural disasters and disaster management policies across Vietnam, Indonesia, Thailand and Nepal, impact of the 2004 tsunami on Indonesia and the 2008 cyclone Nargis in Myanmar and South...

  19. Introduction

    DEFF Research Database (Denmark)

    2015-01-01

    are amongst the most creative and thought provoking of this diverse field. The selection covers diverse topics such as theories, concepts, methods, and approaches as well as exploring various modes of mobilities and the relationship to everyday life practices. The pieces also cover the ‘politics of mobilities...

  20. Introduction

    Directory of Open Access Journals (Sweden)

    Marc Berdet

    2009-12-01

    Full Text Available « Angesichts dieser Allgegenwart von stories in der heutigen Medienkulturgesellschaft spricht vieles für die These, daß das Erzählen von (kürzeren oder längeren, privaten oder öffentlichen Geschichten in der Tat ein anthropologisches Grundbedürfnis zu sein scheint. » (Nünning, 2002 : 9Dans le Zeit du 05 mars 2009, l’écrivaine Kathrin Röggla constate que nous n’avons pas encore trouvé de forme narrative pour expliquer la crise financière mondiale. Une nouvelle dramaturgie politique a eu beau...

  1. Introduction

    Science.gov (United States)

    Ahonen, Pasi; Alahuhta, Petteri; Daskala, Barbara; Delaitre, Sabine; Hert, Paul De; Lindner, Ralf; Maghiros, Ioannis; Moscibroda, Anna; Schreurs, Wim; Verlinden, Michiel

    The brave new world of ambient intelligence is almost upon us. Ambient intelligence is the phrase coined to describe a world in which "intelligence" is embedded in virtually everything around us. It has been called an Internet of things, where radio frequency identification (RFID) tags are attached to all products. It is a world of smart dust with networked sensors and actuators so small as to be virtually invisible, where the clothes you wear, the paint on your walls, the carpets on your floor, and the paper money in your pocket have a computer communications capability. It is a 4G world where today's mobile phone is transformed into a terminal capable of receiving television, accessing the Internet, downloading music, reading RFIDs, taking pictures, enabling interactive video telephony, and much more. It is a world of convergence, where heterogeneous devices are able to communicate seamlessly across today's disparate networks, a world of machine learning and intelligent software, where computers monitor our activities, routines and behaviours to predict what we will do or want next. In the brave new world of ambient intelligence, we will never have to worry about losing track of our children because they will have a location device implanted under the skin or, if they are squeamish about that, then at least they will have one in their wristwatch.

  2. Introduction

    Directory of Open Access Journals (Sweden)

    Marc Chenetier

    2006-01-01

    Full Text Available This « concept » or « test » issue  of the European Journal of American Studies gathers a series of presentations on the state of and problems posed by American Studies in a variety of European countries. As we endeavored to take advantage of the potential new dimension that might be given American Studies in Europe thanks to the generous hospitality of the « revues.org » website, it seemed fit to give Americanists and all readers interested in American Studies a general sense of the situatio...

  3. Introduction

    Directory of Open Access Journals (Sweden)

    Helge Hvid

    2015-10-01

    Full Text Available In this issue, there are three concepts that stand out as particularly important: Equality, Trust, and Agency. Three articles have equality as normative guideline. In the first article, it is analyzed how inequality is reproduced in recruitment practices, even when laws and formal rules are respected. A second article examines class and gender inequality, related to berth, maternity leave, work orientation, and the return to the labor market. A third article examines the evolution of government policy for gender equality. The concept of trust is analyzed theoretically in one article. Agency is highlighted in two articles. The analyses of the first article is at the micro level. Here, it is investigated how agency in daily work is challenged when municipalities are exposed to major reforms. Analyses in the second article are on the macro level. Here, it is investigated how European trade unions can influence EU policy (...

  4. Introduction

    DEFF Research Database (Denmark)

    Mortensen, Peder Duelund; Feuerhake, Eduardo

    2005-01-01

    Bogen beskriver den særegne arkitektur, som kendetegner den sydchilenske øgruppe Chiloe Archipelago. Huse i træ udviklet i en lang tradition fra fiskerlandsbyernes Palafitos til et stort antal kirker, hvoraf 16 er på Unescos liste. Videreført i moderne arkitektur....

  5. Introduction

    DEFF Research Database (Denmark)

    Kristiansen, Tore; Sandøy, Helge

    2010-01-01

    , and involve both quantitative and qualitative relationships. Indeed, the outcome of language contact is a question of numbers and frequencies in terms of use and users, of sameness vs. differencein terms of linguistic structure, of dominance vs. subordination in terms of socio-historical contexts, etc...

  6. Introduction

    Directory of Open Access Journals (Sweden)

    Claudia Jiménez

    2015-12-01

    Full Text Available The control of external borders is undoubtedly an issue of the greatest contemporary relevance. It presents a range of challenges on various fronts in a setting in which, in an increasingly globalised world, the movement of populations is an unstoppable process. For reception countries, it is crucial to achieve intelligent, effective and organised management of external borders without neglecting human rights. This edition of Revista CIDOB d’Afers Internacionals reflects on the control of foreign borders from a perspective that seeks to give greater visibility to the need for human rights to be respected in the face of approaches whose priority is essentially security. To this end, five of the studies in this edition focus on the European situation, while three analyse alternative experiences and models of action that serve to enrich the debate and provide a wider perspective on the issue.

  7. Introduction

    DEFF Research Database (Denmark)

    Seeberg, Peter

    2015-01-01

    , and to discuss theoretical approaches and paradigms of relevance for the analysis of these new regional dynamics. The MENA region experienced, in connection with and following the Arab uprisings, a hitherto unseen popular mobilization. Despite the recent highly problematic situation in several Middle Eastern...

  8. Introduction

    DEFF Research Database (Denmark)

    2006-01-01

    officials. The case studies show different countries wrestling with the problem, some doing better and some worse. This is a fascinating and important book." Richard R. Nelson, George Blumenthal, Professor Emeritus of International and Public Affairs, Business, and Law, Columbia University, New York, USA....

  9. Introduction

    Directory of Open Access Journals (Sweden)

    Oded Rabinovitch

    2009-07-01

    Full Text Available Le dossier ici présenté au lecteur se veut une occasion d’ouvrir et d’élargir la discussion autour de « Sauver le Grand-Siècle ». Il ne s’agit pas d’une étude de réception ou pire, d’un « méta-compte rendu » qui aurait présomptueusement la prétention de conclure le débat en tranchant entre les divers points de vue. Au contraire, le fait de regrouper une partie des comptes rendus édités dans des publications très diverses permet de faire émerger des questions, des suggestions et des manières d...

  10. Introduction

    African Journals Online (AJOL)

    Onyii Ogbonna

    Risk management strategies utilized by small scale poultry farmers in Oyo. State, Nigeria: .... Taking Scale (DOSPERT) (Weber, 2003) to measure farmers' risk perception to ..... Effects of poverty on risk attitudes of farmers in ... Tools for project.

  11. Introduction

    Directory of Open Access Journals (Sweden)

    Merete Anderssen

    2008-02-01

    Full Text Available The third volume of the 34th edition of Nordlyd contains the proceedings for a workshop on language acquisition that took place at the Twenty Second Scandinavian Conference of Linguistics (SCL 22. The overall theme of the conference was 'brain, mind and language,' and the workshop invited abstracts in first, second and bilingual acquisition related to this theme. SCL 22 was held at the Centre For Linguistics (CFL at the University of Aalborg in Denmark on June 19–22, 2006, under the auspices of the Nordic Association of Linguists (NAL.

  12. Introduction

    OpenAIRE

    Delbey, Evrard

    2016-01-01

    Venance Fortunat continue d’exister pour les lecteurs du xxie siècle qui appartiennent au grand public, selon l’expression usuelle. Nous en voulons pour preuve anecdotique le roman historique Les voiles de Frédégonde écrit par J.-L. Fetjaine. Fortunat y figure, en effet, comme poète latin de la cour mérovingienne d’Austrasie où règne Sigebert époux de Brunehilde, la fille du roi wisigoth d’Espagne. Il apparaît dans l’intrigue au moment où Chilpéric, frère de Sigebert, assiste ébloui à ce mari...

  13. Introduction

    Directory of Open Access Journals (Sweden)

    Helge Hvid

    2013-01-01

    This issue includes six articles where we start off by Abrahamsson and Johansson, who give us a short but comprehensive presentation of how psychosocial work environment has been understood in research and policy over 100 years, with Sweden as the focal point. Short, because they write in the format of an article. Comprehensive, because the authors take a broad understanding of the psychosocial work environment comprising “health/illness,” where factors such as stress and burnout are central, “management and development,” where employee involvement, learning, and innovation are central, and “problematization,” which includes critically oriented research on the nature of work. The article not only provides an overview of the research that has been done in this area in the last 100 years but also relates research to policy and practice. The article thus provides a valuable perspective on today’s research and public debate on the works, with a Nordic perspective (...

  14. Introduction

    NARCIS (Netherlands)

    Vermeulen, P.A.M.; Hutte, E.

    2014-01-01

    For over 50 years Western initiatives to alleviate poverty were driven by a dominant logic that was based on the assumption that poor people were victims that needed to be helped by large-scale development aid projects to break the “vicious circle of poverty”. The late Peter Bauer said (1987: 30): “

  15. Introduction

    Directory of Open Access Journals (Sweden)

    Helge Hvid

    2016-06-01

    Full Text Available In this issue, two of the articles present studies on the creation of working conditions through work place communication—informal communication at the workplace  and at formal meetings, respectively. An article examines how young unemployed people position themselves in relation to the dominant discourse on unemployment. An article examines the impact of collective agreements on the employment of older workers, and finally, an article presents a study on employment in the third sector (...

  16. Introduction

    OpenAIRE

    Alfred Hornung

    2012-01-01

    Forty years after the assassination of Dr. Martin Luther King, Jr., the charismatic leader of the civil rights movement, Barack H. Obama was elected the first African American president of the United States of America in 2008. Although U.S. Attorney General Robert Kennedy had predicted in 1961 that a black person could be president like his brother “in the next thirty or forty years,” nobody really expected this kind of victory to come true.

  17. Introduction

    OpenAIRE

    2006-01-01

    Constructivism has become the overarching scientific paradigm in the social study of science and technology (STS). The notion that scientific facts and technological artefacts result from processes of social construction is the major scientific innovation of the preceding decades in the sociology of science and technology. With constructivism being the established paradigm in this field of research: what comes next? What comes after constructivism in science and technology studies? The contr...

  18. Introduction

    Science.gov (United States)

    Herbst, Eric

    2016-07-01

    The formation of life remains a mystery. In our three-day scientific event, we will hear talks and see posters concerning what astrochemistry and astrobiology can currently tell us about this mystery. The first subject to be explored by our speakers will be astrochemistry, and what has been learned about the formation of complex molecules in star- and planet-forming regions of the interstellar medium. This topic will be sub-divided into three subjects: astronomical observations, laboratory experiments, and simulations of the chemistry leading to large molecules, both in the gas and on the surfaces of interstellar dust particles. Some introductory remarks will be given about these subjects. We will next learn about the roles of comets and exoplanets. We will hear how comets can produce water and complex molecules, and possibly deliver them to nascent planets such as the early earth, and we will learn what current space probes such as Rosetta can tell us about the chemical make-up of comets. Regarding exoplanets, speakers will explore their likely atmospheres, and what complex molecules can be simulated in them. The last part of the event will be divided into various fields of astrobiology, including synthetic approaches to primitive life, paths to observations of life on other worlds, simulations of the origin of life, and the particular role of hydrothermal environments. In summary, we will learn about significant progress in astrochemistry and astrobiology, and yet we will also learn about how much more must be known before we can solve in its entirety the basic problem of how life arose.

  19. Introduction

    Science.gov (United States)

    Bainbridge, William Sims

    This brief introductory chapter sets the stage for a broad discussion of many aspects of virtual worlds, by comparing episodes experienced by two avatar researchers, one in Second Life (SL), and the other in Star Wars Galaxies (SWG). Interviewer Wilber attends a medieval dance on an SL island created by Starfleet, an innovative and hard-working group of 500 Star Trek fans, who have created working virtual technology and soaring architecture to make real their fantasies about the human future. Algorithma Teq visits the Mos Eisley Cantina in SWG, where Luke Skywalker originally met Han Solo, and is scrutinized by two Imperial storm troopers, even as she attempts to remain aloof from the Star Wars mythos and simply practice her engineering skills in making droids. It can be useful to distinguish gamelike virtual worlds from non-game worlds, yet as these examples show, they are not distinct categories, and virtual worlds inevitably mix fantasy and reality in complex ways.

  20. Introduction

    DEFF Research Database (Denmark)

    2016-01-01

    Notions of life and death hold a prominent place in our metaphorical repertoires. As oppositional pairs go, there are few more stark and palpable, and this is probably why it’s not only tempting but also persuasive to present the claim for journalism’s worth in similar terms. If journalism is ind...

  1. Introduction

    Directory of Open Access Journals (Sweden)

    Alexander Streitberger

    2010-12-01

    Full Text Available

    The papers in this special issue arise from a conference held at the University of Louvain (UCL in Louvain-la-Neuve in October 2009 under the title Between documentation and fiction – photography in artists’ books. As for the conference, the aim of this publication is to reconsider the functions of photographic images in books created by artistes since the 1960s.

  2. Introduction

    DEFF Research Database (Denmark)

    Steijn, Arthur; Ion Wille, Jakob

    2013-01-01

    concerts. Three cultural institutions in the Øresund region, Malmö Symphony Orchestra, The Royal Danish Theatre, and Copenhagen Phil, are functioning as laboratories for developing and testing new concepts. Concept development in the project focuses mainly on artistic and technological productions...

  3. Introduction

    OpenAIRE

    2008-01-01

    It is more than 10 years since we have published our first special issue devoted to the Computer Algebra. For us it was a starting point for the development of Computer Algebra in Moldova. Looking back we can say that this was a period during which we have found our own place in this very important part of modern Computer Science. It was, of course, impossible without the help of our colleagues from other countries, without the financial support from INTAS and Swedish Academy of Science. In f...

  4. Introduction

    OpenAIRE

    Eiroa San Francisco, Matilde; Rojo Hernandez, Severiano

    2016-01-01

    El levantamiento militar del 18 de julio de 1936 y la sangrienta guerra civil que generó demostraron hasta qué punto la prensa en España –como en el resto de las sociedades occidentales– desempeñaba desde finales del siglo XIX un papel político y social fundamental, papel que las crisis incrementaron constantemente. Por su impacto sobre las representaciones, su capacidad para orientar las emociones de las masas y su rol en la definición de las normas de conducta legítimas ocupaba una función ...

  5. Introduction

    OpenAIRE

    2015-01-01

    « Eh bien,j'ai noté, messieurs, je crois, et je vais essayer de traiter le problème monétaire dans son ensemble et dans tous ses aspects. Je vous préviens tout de suite que je serai très long, très ennuyeux, mais je n'y peux rien, c'est le sujet. »Georges Pompidou, « Entretiens et discours 1968-1974 », t. 2, Paris, Plon, 1975, p. 39. Je n’ai pas trop de mérites à me sentir européen. Les idées et les arguments ont, certes, contribué à forger mes convictions. Mais mon passé a donné à mon chemin...

  6. Introduction

    African Journals Online (AJOL)

    Choice-Academy

    1987-09-23

    Sep 23, 1987 ... Ethiopian Journal of Environmental Studies and Management Vol.2 No.2. ... analyzed the spatial patterns of healthcare facilities in Akwa Ibom State ... indicator variables were obtained and analyzed to assess the levels of ...

  7. Introduction

    DEFF Research Database (Denmark)

    Jørgensen, Christian Helms; Bohlinger, Sandra; Haake, Ulrika;

    2015-01-01

    Research on adult, professional and vocational education in a global world is timely (Farrell & Fenwick, 2007). Globalisation and economic crises are the trends that most dramatically transform the social, political, economic and ecological spheres of our time and directly affect the everyday life...... of local communities and workplaces. Current challenges set compelling requirements for the working and learning of the members of communities. Over the past decades of adult, professional and vocational education research, researchers have increasingly addressed globalisation and its political, value......-based and ethical underpinnings. Work-related learning and the workplace as an arena of learning and education is, in Fenwick’s (2001) terms, a highly political space, in which the requirements of flexibility, specialisation, privatisation, and globalisation “change the nature and environment of work...

  8. Introduction

    DEFF Research Database (Denmark)

    Petersen, Hanne

    2010-01-01

    Introduktion til Religion in the 21st Century, der indeholder bidrag fra den afsluttende konference i Københavns Universitets satsningsområde 2003-2007 om Religion i det 21. århundrede. Bidrag om 'Political and Intellectual Challenge', 'The Religion and Science Debate', 'Islam and State Politics'...

  9. Introduction

    DEFF Research Database (Denmark)

    Meiner, Carsten; Bury, Emmanuel

    2013-01-01

    Les travaux réunis ici se proposent d'explorer les principaux champs du savoir où la notion de clarté fait sens durant la période des xviie et xviiie siècles: dans la philosophie, dans les discours grammatical, rhétorique et religieux, et enfin, dans le domaine de la poétique classique....

  10. Introduction.

    NARCIS (Netherlands)

    Stobbelaar, D.J.; Mansvelt, van J.D.

    1997-01-01

    This special issue of Agriculture, Ecosystems & Environment contains the work done in the framework of the EU-concerted action programme "The nature and landscape production capacity of organic/sustainable types of agriculture". The aim of this concerted action is to define proposals to extend the E

  11. Introduction

    Directory of Open Access Journals (Sweden)

    Marc-Éric Bobillier Chaumon

    2007-10-01

    Full Text Available L’importance des technologies d’information demeure toujours d’actualité, car elle concerne directement la gestion des activités de travail par les professionnels, les liens avec l’évolution des conditions de travail et les conséquences sur la santé et le bien-être des salariés. De l’informatique des années 1960 aux technologies de l’information et de la communication (TIC, fruits de la convergence numérique : où en est-on de la diffusion des TIC dans les entreprises et dans les administrati...

  12. Introduction

    Directory of Open Access Journals (Sweden)

    Alfred Hornung

    2012-01-01

    Full Text Available Forty years after the assassination of Dr. Martin Luther King, Jr., the charismatic leader of the civil rights movement, Barack H. Obama was elected the first African American president of the United States of America in 2008. Although U.S. Attorney General Robert Kennedy had predicted in 1961 that a black person could be president like his brother “in the next thirty or forty years,” nobody really expected this kind of victory to come true.

  13. Introduction

    NARCIS (Netherlands)

    Strijker, Derk; Voerman, Gerrit; Terluin, Ida; Strijker, Dirk; Voerman, Gerrit; Terluin, Ida

    2015-01-01

    Some agricultural or rural protest groups in the Western world evolved into political parties - often of a populist nature - whereas others did not. This book is the first to explore under which conditions this happens, and to what extent current populist parties have agricultural or rural ties and

  14. Introduction

    Science.gov (United States)

    Rossing, Thomas D.

    String instruments are found in almost all musical cultures. Bowed string instruments form the backbone of symphony orchestras, and they are used widely as solo instruments and in chamber music as well. Guitars are used universally in pop music as well as in classical music. The piano is probably the most versatile of all musical instruments, used widely not only in ensemble with other musical instruments but also as a solo instrument and to accompany solo instruments and the human voice.

  15. Introduction

    OpenAIRE

    Manninen, Lea Parjo, Asta; Jeskanen-Sundström, Heli

    2003-01-01

    \\emph{The papers in this issue}} focus on \\emph{Statistics Describing the Information Society}. Most of the papers originate from presentations given during the IAOS Satellite Meeting on Statistics for the Information Society, Tokyo 2001 in connection with the ISI Session in Seoul 2001. However, the authors have further developed and up-dated their papers. The aim of this special issue of the ISR is very much the same as the goal of the above mentioned IAOS Satellite Meeting...

  16. Introduction

    NARCIS (Netherlands)

    L. Douw

    2015-01-01

    This special issue contains a selection of articles, produced from papers presented at a workshop under the title Border Societies, Chinese descendants in East Asia under Japanese colonialism, 1895-1945, convened in Macao on 25 June 2013. Its purpose is to contribute to the writing of a global histo

  17. Introduction

    Science.gov (United States)

    Weissman, Jon; Wolters, Lex; Abramson, David; Humphrey, Marty

    Grid, Cluster, and Cloud Computing represent important points on the parallel and distributed computing platform landscape. Grids and clusters continue to generate interesting and important research. The inclusion of Cloud computing is new for 2009 and we are happy to report that our track has two high quality papers on Clouds. This year the track was very competitive and 7 out of 27 papers were selected, an acceptance rate that is lower than the conference as a whole. The papers were carefully reviewed by all chairs with 4 reviews per paper and a clear consensus emerged on the top 7 papers. We are pleased that one of our papers (POGGI) was selected as one of the top 4 best papers in the conference. The papers spanned many countries in Europe and Asia and covered a wide-array of topics including programming systems, infrastructure, and applications.

  18. Introduction

    DEFF Research Database (Denmark)

    Egbert, Maria; Deppermann, Arnulf

    2012-01-01

    Hearing loss is a prevalent communication disability, yet to date there is almost no research on naturally occurring interaction which examines how participants handle hearing loss and the use of hearing aids in communication. In contrast, research focussing on the medical and technological dimen......, interdisciplinary research approach geared at understanding and improving social interaction impacted by hearing loss and (non-)use of hearing technologies. Towards this end, we are integrating Conversation Analysis, audiology and User Centered Design....

  19. Introduction

    NARCIS (Netherlands)

    Lardinois, A.P.M.H.; Levie, S.A.; Hoeken, H.; Lüthy, C.H.

    2014-01-01

    The papers collected in this volume study the function and meaning of narrative texts from a variety of perspectives. The word 'text' is used here in the broadest sense of the term: it denotes literary books, but also oral tales, speeches, newspaper articles and comics. One of the purposes of this v

  20. Introduction

    NARCIS (Netherlands)

    Lardinois, A.P.M.H.; Levie, S.A.; Hoeken, H.; Lüthy, C.H.

    2015-01-01

    The papers collected in this volume study the function and meaning of narrative texts from a variety of perspectives. The word 'text' is used here in the broadest sense of the term: it denotes literary books, but also oral tales, speeches, newspaper articles and comics. One of the purposes of this v

  1. Introduction

    Directory of Open Access Journals (Sweden)

    César González Ochoa

    2015-06-01

    Full Text Available La unam y la uba, Universidad de Buenos Aires, han estado ligadas por varias razones desde hace mucho tiempo; su historia, sus problemas, sus logros han sido paralelos; han tenido un continuo intercambio, sobre todo de profesores, aunque tal vez la unam ha sido más favorecida en este aspecto. La necesidad de iniciar esta presentación de Acta Poetica con esas alusiones a las dos universidades obedece a que este número es un esfuerzo conjunto de investigadores de ambas casas de estudio. Antes de hablar de los artículos que se publican, quisiéramos hacer un breve recorrido histórico de la uba para observar la similaridad con el camino que ha seguido nuestra universidad.

  2. Introduction

    Directory of Open Access Journals (Sweden)

    Isabelle Grangaud

    2010-07-01

    Full Text Available Issue d’une réflexion menée en commun par un groupe d’historiens orientalistes, la construction de l’objet de recherche au cœur de ce dossier s’est nourrie à la source de la volonté de dépasser un problème sur lequel butaient les entreprises d’histoire sociale de notre champ d’étude. C’est dans le cadre d’un séminaire autour d’une réévaluation de la recherche sur les villes du Maghreb et du Machrek aux époques médiévale et moderne, que s’est peu à peu élaboré le projet d’une étude des formes ...

  3. Introduction

    DEFF Research Database (Denmark)

    2013-01-01

    African countries, taken separately, or grouped together as a unit, still largely remain resource-based economies. The challenge is to change the resource-based economic structure into a science, technology, engineering and innovation driven knowledge based economic system. Taking this challenge...... head on means African countries have to organise their science, technology, engineering and innovation for a development agenda systematically, more in collaboration than in competition with one another. What appears to remain a deficit is the vast collaborative distance that still exists on matters...

  4. Introduction

    African Journals Online (AJOL)

    sulaiman.adebowale

    2008-09-10

    Sep 10, 2008 ... Council for the Development of Social Science Research in Africa, 2008 ... work of a select number of African graduate students in the US. It locates the different ... It highlights the issue of the role which the fourth generation.

  5. Introduction

    DEFF Research Database (Denmark)

    Leschke, Janine; Jepsen, Maria

    2012-01-01

    and governments' policy responses have also been widening labour market inequalities between different groups within countries, the authors argue, as illustrated by the disproportionate growth of youth employment and their specific focus on gender inequality. Cross-national variations in the content and structure......Introducing the contributions to this special issue of the International Labour Review, this article reviews the broad phases of the economic crisis in the EU since 2008 and highlights the critical role of social policy in mitigating its initial impact on Europeans. However, the crisis...

  6. Introduction

    Science.gov (United States)

    de Graauw, T.

    2010-09-01

    As this editorial is written, we have seven antennas at the Chajnantor plateau, the "High Site". Seven antennas means twenty-one baselines, i.e. more than twice as many as we had only two months ago. As you know, the bonus we have in interferometry is that the the number of baselines increases roughly with the square of the available antennas. The image quality can be further enhanced, because the projection of a celestial source onto the existing baselines changes due to the rotation of the Earth. A large number of baselines is important but not sufficient to fulfill one important promise of ALMA, namely to provide crisp images. Unlike the sharp images from the Hubble Space Telescope, images from ground based optical or radio telescopes are blurred by the Earth's atmosphere. It is the Holy Grail of observing astronomy to overcome such atmospheric effects. Recently, ALMA has made a big step toward this goal by using Water Vapor Radiometers operating at 183 GHz to measure the amount of atmospheric water vapor at any instant in the line of sight of each antenna, and applying a corresponding correction to the astronomical data received. This not only improves the image quality, it is essential for using ALMA at its lowest wavelengths of around 0.3mm and at baselines exceeding several kilometers. Achieving this has a been a collaborative effort involving many parts of the project and there are all to be congratulated. JAO has now moved into our new Santiago Central Office in Vitacura next to the ESO premises, ending a phase of two years were Santiago based staff was distributed in two different buildings. This new ALMA office will also host the ALMA archive. Although ALMA users are normally not expected to come to Chile to observe, there will be office space for visitors, since ALMA has been and will always be a cooperation of people from many countries and many fields of science and engineering. This newsletter contains a list of workshops, schools and conferences dealing with ALMA, reflecting the interest of the astronomical community in our project. I invite everybody to join these events in order to discuss the exciting science made possible with ALMA, and to learn how to use this instrument in an efficient way. After all, the first call for ALMA observing proposals will be released very soon. After having served as ALMA Project Engineer since 2004, Rick Murowinski has decided to go back to Canada. We thank him for his important contributions to our project during very crucial years and wish him all the best for his future career.

  7. Introduction

    OpenAIRE

    Raineau, Clémentine; Bernard, Mathias

    2014-01-01

    Depuis le milieu du XXe siècle, la figure du jeune est au coeur des représentations collectives des sociétés occidentales. Jeune rebelle contestant les normes de la société de consommation ou jeune soucieux de son intégration par l’école et le travail, jeune étudiant des « années 68 » ou « jeune des banlieues » des années 1980, marqué par le chômage et la crise urbaine, adolescent en rupture avec le modèle familial ou jeune adulte qui quitte à grand-peine le cocon parental... toutes ces image...

  8. Introduction

    DEFF Research Database (Denmark)

    2016-01-01

    The anthology offers 11 original contributions about the women in GoT, the transmedial universe of George R.R. Martin's book series A Song of Ice and Fire, the HBO TV series Game of Thrones, computer games and online fan activities. The anthology examines the representation of women, and activity...

  9. Introduction

    OpenAIRE

    Carozza, Jean-Michel; Devillers, Benoît; Marriner, Nick; Morhange, Christophe

    2015-01-01

    Ce numéro 122 (2014) de la revue Méditerranée, dédié au petit âge de glace en Méditerranée, est une contribution aux programmes de recherche suivants (1) laboratoire LABEX OT MED, (2) programme PALEOMEX-MISTRALS, en particulier ENVIMED, projet pluridisciplinaire consacré à l’étude des changements climatiques de l’aire méditerranéenne depuis 10 000 ans, (3) ANR GEOMAR. Cette publication a aussi bénéficié d’un financement complémentaire du programme IUF Mer Noire-Méditerranée (2011-2016) et du ...

  10. Introduction

    Directory of Open Access Journals (Sweden)

    Jean-Louis Fournel

    2005-04-01

    Full Text Available Préambule et hypothèsesL’hypothèse qui prévalait à l’organisation de cette rencontre transdisciplinaire, réunissant des philosophes, des historiens, des spécialistes de géostratégie et d’histoire militaire, mais aussi des acteurs des guerres récentes (militaires ou victimes de la « barbarisation de la guerre », était de remettre en question l’idée d’un lien de dépendance logique ou d’un lien de causalité direct, souvent établi, entre l’« humanisation » et la « barbarisation » de la guerre, l...

  11. Introduction

    NARCIS (Netherlands)

    Tavasszy, L.A.; Jong, G. de

    2013-01-01

    In this introductory chapter we provide a concise overview of the state of the art of mathematical models of the freight transport system, focussing mainly on areas where it deviates from passenger transport models. We introduce a conceptual model of the freight transport system that includes

  12. Introduction

    Directory of Open Access Journals (Sweden)

    Françoise LAINÉ

    2009-12-01

    Full Text Available La persistance de l’itinérance des cours dans la péninsule ibérique nourrit une abondante historiographie qui a récemment glissé de l’étude des itinéraires à celle de l’itinérance. L’exercice itinérant du pouvoir, conjugué à un développement administratif non négligeable consiste en une succession d’étapes urbaines, surtout, sans générer de véritables capitales comme dans les états bourguignons. Les déplacements d’une cour plurielle tournent néanmoins au défi logistique permanent.La persistencia de la itinerancia de las cortes en la península ibérica nutre una abundante historiografía, la cual ha pasado recientemiente del estudio de los itinerarios al estudio de la itinerancia. El exercicio itinerante del poder, aunado a un desarrollo administrativo no desdeñable, consiste en una sucesión de etapas urbanas sobre todo, sin suscitar verdaderas capitales, como en los estados borgoñones. Los traslados de una corte plural se convierten no obstante en un reto logístico permanente.

  13. Introduction

    Science.gov (United States)

    2016-11-01

    A year has passed since Raymond left us, but for many of us it seems like it was yesterday. Indeed, since his departure last July, not a week or even a day has gone by without his former collaborators, students, colleagues having a thought for him. Some initiatives have already been taken in order to celebrate Raymond's memory. The special day for Raymond organized at CERN last December was an opportunity to celebrate this exceptional man. In Annecy, with the implication of CERN and Marseille and thanks to a spontaneous and generous gift of Raymond's wife Marie-Françoise and their children Olivier and Thierry, the opening of a special room containing a huge collection of scientific books of Raymond is almost completed. It is in the same spirit that the present editors decided to dedicate a special issue of Nuclear Physics in memory of Raymond. In the following pages, some important problems Raymond was interested in are presented, discussed and sometimes solved. The diversity of topics in this issue reflects well the extent of Raymond's interests in Physics and Mathematics. Raymond was not only a gifted man for the so-called theoretical sciences, mathematics and physics, but he was also passionate about arts, music, drawing and of course literature, just as he was a leader always ready to bring his help and share his deep knowledge in physics and mathematics with others. Many people were deeply touched by Paul Sorba's tribute during Raymond's funeral. This is why we asked Paul to translate his speech, originally given in French, which seemed to us a perfect Prolegomena for this special volume of Nuclear Physics. The volume "Mathematical Foundations of Quantum Field Theory" is organized as follows:

  14. Introduction

    OpenAIRE

    Dominique Maingueneau

    2012-01-01

    Comme l’indique clairement son titre, ce numéro spécial de la revue Argumentation et Analyse du Discours présente une réflexion non sur un thème bien circonscrit mais sur une double frontière : d’une part celle qui distingue analyse du discours et rhétorique (pour faire vite, j’utilise ce terme pour désigner l’ensemble des travaux sur l’argumentation), d’autre part celle qui distingue analyse critique et analyse non-critique (« critique » étant entendu ici dans le sens qu’il a communément dan...

  15. Introduction

    Directory of Open Access Journals (Sweden)

    Dominique Maingueneau

    2012-10-01

    Full Text Available Comme l’indique clairement son titre, ce numéro spécial de la revue Argumentation et Analyse du Discours présente une réflexion non sur un thème bien circonscrit mais sur une double frontière : d’une part celle qui distingue analyse du discours et rhétorique (pour faire vite, j’utilise ce terme pour désigner l’ensemble des travaux sur l’argumentation, d’autre part celle qui distingue analyse critique et analyse non-critique (« critique » étant entendu ici dans le sens qu’il a communément dan...

  16. Introduction

    Directory of Open Access Journals (Sweden)

    Jörg Nagler

    2009-09-01

    Full Text Available February 12, 2009, marked the 200th anniversary of Abraham Lincoln’s birthday. In anticipation of this event, the annual U.S. Embassy Teacher Academy, hosted by the U.S. Embassy, Berlin, from October 2 to 5, 2008 in Potsdam, explored the implications of his presidency on the United States and the world in terms of nation building, democratic development, race relations and civil rights.

  17. Introduction

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-01-01

    This section of the report describes the history of the tribology program of the Office of Transportation Materials (OTM) in the Office of Transportation Technologies (OTT). The mission of the Office of Transportation Technology is discussed. OTT`s research objectives focus on (1) automobiles and light-duty trucks and vans and (2) heavy duty trucks and buses. Even small gains in efficiency can produce large paybacks for the tax dollar. The mission of the Office of Transportation Materials is also described. Its research objective is to enable the development and engineering of energy-efficient transportation systems that will make possible the transition of the U.S. transportation sector from dependence on petroleum to alternative fuels and electricity. The mission of the Tibology Program is to provide the base technology to enable savings in annual U.S. energy consumption through tribological advances in the transportation sector. Current task areas are in the fields of advanced lubrication, engineered tribological interfaces, advanced tribomaterials and components, and project management.

  18. Introduction

    DEFF Research Database (Denmark)

    Beim, Anne

    2014-01-01

    building practice, the point of departure being an ecological approach to the creation of architecture. Ecology is here defined in its widest sense, which besides ecological systems found in nature includes environmental dimensions, the life cycle of resources, social organisation, and the longevity...... of the contextual qualities of design....

  19. Introduction

    Directory of Open Access Journals (Sweden)

    Deborah Hauptmann

    2014-08-01

    Full Text Available Over the past fifteen years most advanced education programmes within Schools of Architecture have been questioning the parameters and requirements of doctoral research both in terms of content and form. This double issue of Footprint was motivated by the question of where the field stands today. Footprint 10|11 presents nine contributions from both recently defended and developing PhD candidates from a variety of institutions. The diversity of their work, as well as the similarities found in the submissions, offers a partial view into research topics currently addressed in PhD programmes within Schools of Architecture. In addition to the nine papers by PhD researchers, we have included a paper by Andrew Leach that we believe provides an overview of the general state of contemporary architecture research. Leach makes an appeal to refrain from making all research operational. At a time when the application of research and its economic value seem to form the primary criteria for judging value, this appeal should not be taken lightly.

  20. Introduction

    DEFF Research Database (Denmark)

    2012-01-01

    in ways not offered by these other thinkers. Bourdieu helps us rediscover the everyday practices. symbolic structures and arenas of conflict that bring many other actors into perspective. rather than just focusing on nation slates that produce (what we call) international politics. All engagement with his...... work redirects our discipline from being in influenced by overly abstract and simplified reifications of world politics. which is currently the case in both positivist and post-positivist IR schools. Bourdieu allows us to explore how people create international relations in their daily activities...