WorldWideScience

Sample records for copaifera langsdorffii desf

  1. Spatial heterogeneity and its influence on Copaifera langsdorffii Desf. (Caesalpiniaceae

    Directory of Open Access Journals (Sweden)

    Júlio Carlos França Resende

    2003-06-01

    Full Text Available Population dynamics and structure of young individuals of the tree Copaifera langsdorffii Desf. (Caesalpiniaceae were studied in the gallery forest of the Panga Ecological Station, Uberlândia, MG, Brazil. Three distinct habitats were recognized in this forest, Dike, Middle and Edge zone. Four annual surveys of plant height, diameter at plant base and density were made between 1993 and 1996. The species showed an aggregated distribution in all three habitats. Population structure in all four surveys presented the typical reversed "J" form, characteristic of populations in local regeneration. For the whole population, mortality rates during the four years were constant and low (average of 4.8 % per year, while recruitment declined during the same period (average of 2.9 % per year. The C. langsdorffii seedling and sapling intraspecific density had a negative effect on growth, possibly due to the action of herbivores and pathogens.A estrutura e a dinâmica dos indivíduos jovens da espécie Copaifera langsdorffii Desf. (Caesapiniaceae foi estudada na mata de galeria da Estação Ecológica do Panga (Uberlândia, MG - Brasil. A mata de galeria neste estudo foi descrita como apresentando 3 ambientes: Dique, Meio e Borda. O trabalho de campo consistiu de quatro levantamentos, realizados anualmente entre 1993 e 1996. A população foi caracterizada como agrupada nos três ambientes. A estrutura de tamanho da população se apresentou como uma curva em "J" invertido, indicando regeneração local. As taxas de mortalidade foram constantes e baixas durante os quatro anos (4,8 % por ano, já as de recrutamento sofreram um declínio durante o mesmo período (2,9 % por ano. A densidade intraespecífica das plântulas e indivíduos jovens de C. langsdorffii tem um efeito negativo nas taxas de crescimento, possivelmente devido a ação de herbívoros e patógenos.

  2. Hypericum perforatum-induced hepatotoxicity with possible association with copaiba (Copaifera langsdorffii Desf):case report.

    Science.gov (United States)

    Agollo, Marjorie Costa; Miszputen, Sender Jankiel; Diament, Jayme

    2014-09-01

    We report a case of liver damage in an elderly patient after the use of herbal products of Hypericum perforatum and copaiba (Copaifera langsdorffii Desf). Hepatotoxicity related to Hypericum perforatum is anecdotally known, but for copaiba, widely used as anti-inflammatory, there is just experimental data in the national literature. This report aimed to draw attention to the possible toxic effects of this association as well as to the clinical recovery of the patient after discontinuing their use. There is a tendency to suspect of the action of drugs to justify a non-viral acute liver injury, because of the large number of drugs responsible for hepatotoxicity. There are experiments and clinical reports in the literature describing some herbal products, including Hypericum perforatum, as the causative agents of this aggression, and are considered innocuous and used with no restrictions. We must remember that adverse reactions also occur with these substances; hence, they should be investigated when collecting the patient´s history, for leading to severe liver failure.

  3. Leaf anatomy of Copaifera langsdorffii Desf. (Leguminosae: ecological interpretations based on different soil conditions in the Cerrado

    Directory of Open Access Journals (Sweden)

    João Carlos Ferreira de Melo Júnior

    2012-11-01

    Full Text Available Copaifera langsdorffii Desf. (Caesalpinioideae, Leguminosae is a tree known as copaíba that is widely distributed in Brazil. The present paper discusses, from an ecological perspective, leaf structural changes in populations of copaíba found growing in three different substrates in the Cerrado: alluvial neosoil on riverbanks, sandstone and red latosol in savanna. Qualitative and quantitative leaf traits were observed from permanent histological preparations. Statistically significant differences were observed in all of the ecological parameters analyzed, such as specific leaf area, tissue thickness and stomatal density. A higher proportion of scleromorphic features was found in plants growing on the sandstone and alluvial neosoil, although the latosol was also low in exchangeable bases. The structural changes observed were the result of the combination of soil factors, water, microclimate and plant/herbivore interaction related to each substrate; it was clear that soil nutrients had more influence on these changes than water availability.

  4. Loss of desiccation tolerance in Copaifera langsdorffii Desf. seeds during germination.

    Science.gov (United States)

    Pereira, W V S; Faria, J M R; Tonetti, O A O; Silva, E A A

    2014-05-01

    This study evaluated the loss of desiccation tolerance in C. langsdorffii seeds during the germination process. Seeds were imbibed for 24, 48, 72, 96, 120 and 144 hours and dried to the initial moisture content, kept in this state for 3 days after which they were submitted to pre-humidification and rehydration. Ultraestructural evaluations were done aiming to observe the cell damage caused by the dry process. Desiccation tolerance was evaluated in terms of the percentage of normal seedlings. Seeds not submitted to the drying process presented 61% of normal seedlings, and after 24 hours of imbibition, followed by drying, the seeds presented the same percentage of survival. However, after 48 hours of imbibition, seeds started to lose the desiccation tolerance. There was twenty six percent of normal seedlings formed from seeds imbibed for 96 hours and later dried and rehydrated. Only 5% of seeds imbibed for 144 hours, dried and rehydrated formed normal seedlings. At 144 hours of imbibition followed the dry process, there was damage into the cell structure, indicating that the seeds were unable to keep the cell structure during the drying process. Copaifera langsdorffii seeds loses the desiccation tolerance at the start of Phase 2 of imbibition.

  5. Estrutura populacional de regenerantes de Copaíba (Copaifera langsdorffii Desf. em mata ciliar do Distrito Federal Copaiba (Copaifera langsdorfii Desf. seedlings and sampling population structure of gallery forest at Federal District

    Directory of Open Access Journals (Sweden)

    Angela Maria Conte Leite

    1992-07-01

    Full Text Available A estrutura populacional de plântulas da Copaiba, (Copaifera langsdoffii Desf. foi estudada em mata ciliar do Distrito Federal, no intuito de fornecer subsídios para a conservação in situ da espécie. O método do transecto, tomando em consideração a localização dos parentais (adultos da mesma espécie, foi adotado. Os regenerantes foram plotados e marcados. Considerou-se também a predação e o ataque por patógenos nas plântulas, o que ocorreu da forma intensa e independentemente da proximidade de adultos parentais. A densidade das plântulas nas áreas estudadas foi correlacionada com o aparecimento de clareiras (fator luz. Estimou-se que os regenerantes estudados apresentam idade superior a dois anos, com base no bi ou tri anualidade das árvores no local, sugerindo um crescimento lento para a espécie, viabilizando portanto a conservação in situ desta na forma tanto de adulto quanto de plântula.The population structure of seedlings and saplings of Copaifera langsdorffii Desf. was studied in a gallery forest in the Distrito Federal, Brazil, as an aid for definition of in situ conservation strategies for the species. Transects were made, with all adults being plotted. Seedlings were also mapped and observed for predation or desease, with high degrees of both being present, with no correlation with adults proximity. Seedling density was correlated with open areas (gaps. It was estimated that all regenerants observed were over two years old, based on two to tree years periodicity in flowering and fruiting patterns for this trees species in the study area. This suggests very low grwth rates, suggesting that in situ conversation of both adults and seedlings is a viable alternative for this species.

  6. Effect of the Copaifera langsdorffii Desf. Leaf Extract on the Ethylene Glycol-Induced Nephrolithiasis in Rats

    Directory of Open Access Journals (Sweden)

    Rejane Barbosa de Oliveira

    2013-01-01

    Full Text Available The potential of the Copaifera langsdorffii leaves extract to prevent stone formation was analyzed by means of an ethylene glycol (EG animal model of nephrolithiasis and an in vitro crystallization assay. Different doses of the C. langsdorffii leaves extract were administered to rats treated with EG. Urine biochemical parameters were quantified. CaOx deposits count and analysis of osteopontin expression were conducted on kidneys fixed in formalin. The in vitro assay was performed by turbidimetry. Phytochemical analyses of the extract were accomplished by HPLC-UV-DAD, and several compounds were isolated. C. langsdorffii leaf extract was able to avoid stone formation. The number of deposits was 50.30±31.29 at the higher extract dose, compared to the value of 179.5±45.96 achieved with the EG control. Significantly lower oxalate levels and OPN expression and increased citrate levels were observed after extract administration. In the in vitro assay, the extract diluted the formed crystals. Phytochemical analyses showed that the extract is rich in phenolic compounds that are capable of preventing stone formation. Thus, on the basis of our results, we suggest that the C. langsdorffii leaf extract has potential application in the prevention of kidney stone formation.

  7. Obtenção de nova fonte de peroxidase de folha de Copaifera langsdorffii Desf. com alta atividade Obtention of a new source of peroxidase from Copaifera langsdorffii leaf, Desf. with high activity

    Directory of Open Access Journals (Sweden)

    Hermelinda Penha Freire Maciel

    2006-12-01

    Full Text Available Objetivou-se neste trabalho extrair peroxidase de folha de Copaifera langsdorffii (COP, medir sua atividade, compará-la com a peroxidase de raiz forte (Horseradish peroxidase - HRP e determinar o pH ótimo, a melhor solução extratora e o efeito de aditivos sobre a atividade da COP. Os resultados mostraram que a COP atingiu 81,6% da atividade de HRP e a faixa de pH ótimo foi de 5,5 a 6,0. A melhor solução extratora da enzima foi o tampão fosfato de sódio 50 mM, pH 6,0 e o melhor aditivo foi o PVPP. Concluindo, a COP apresenta atividade mais alta que outras peroxidases de diferentes fontes citadas na literatura.The purpose of this work was to extract peroxidase from Copaifera langsdorffii leaves (COP, measure its activity, compare it to that of Horseradish peroxidase and determine the optimum pH, the best extraction solution and the effect of additives on the COP activity. The results showed that COP has 81.6% of the activity of HRP and an optimum pH range between 5.5-6.0. The best extraction solution was a sodium phosphate buffer 50 mM, pH 6.0 and the best additive was PVPP. In conclusion, COP presents higher activity than peroxidases from different sources reported in the literature.

  8. Reacquisition of New Meristematic Sites Determines the Development of a New Organ, the Cecidomyiidae Gall on Copaifera langsdorffii Desf. (Fabaceae

    Directory of Open Access Journals (Sweden)

    Renê G. S. Carneiro

    2017-09-01

    Full Text Available The development of gall shapes has been attributed to the feeding behavior of the galling insects and how the host tissues react to galling stimuli, which ultimately culminate in a variable set of structural responses. A superhost of galling herbivores, Copaifera langsdorffii, hosts a bizarre “horn-shaped” leaflet gall morphotype induced by an unidentified species of Diptera: Cecidomyiidae. By studying the development of this gall morphotype under the anatomical and physiological perspectives, we demonstrate the symptoms of the Cecidomyiidae manipulation over plant tissues, toward the cell redifferentiation and tissue neoformation. The most prominent feature of this gall is the shifting in shape from growth and development phase toward maturation, which imply in metabolites accumulation detected by histochemical tests in meristem-like group of cells within gall structure. We hypothesize that the development of complex galls, such as the horn-shaped demands the reacquisition of cell meristematic competence. Also, as mature galls are green, their photosynthetic activity should be sufficient for their oxygenation, thus compensating the low gas diffusion through the compacted gall parenchyma. We currently conclude that the galling Cecidomyiidae triggers the establishment of new sites of meristematic tissues, which are ultimately responsible for shifting from the young conical to the mature horn-shaped gall morphotype. Accordingly, the conservative photosynthesis activity in gall site maintains tissue homeostasis by avoiding hypoxia and hipercarbia in the highly compacted gall tissues.

  9. Extração e caracterização parcial de peroxidase de folhas de Copaifera langsdorffii Desf. Extraction and partial characterization of peroxidase from Copaifera langsdorffii Desf. leaves

    Directory of Open Access Journals (Sweden)

    Hermelinda Penha Freire Maciel

    2007-06-01

    Full Text Available Em recentes publicações têm sido descritos vários processos para obtenção de peroxidases. O propósito deste trabalho foi extrair peroxidase de folhas de Copaifera langsdorffii e caracterizar parcialmente a enzima usando planejamento experimental e teste univariado, para confirmação dos resultados obtidos por planejamento experimental. A atividade da peroxidase foi medida usando sistema guaiacol: peróxido de hidrogênio. A peroxidase isolada apresentou 81,6% da atividade da horseradish peroxidase e é de fácil obtenção, a partir de folhas de uma árvore abundante em todo o país. A peroxidase semi-purificada (COP foi obtida pela precipitação do extrato bruto com acetona 65% (v.v-1, produzindo o pó cetônico. A COP apresentou atividade ótima na faixa de pH 5,0 a 7,0 e temperatura de 5 a 45 °C, com atividade máxima em pH 6,0 e 35 °C. A enzima mostrou-se estável em temperaturas inferiores a 50 °C e pH entre 4,5 e 9,0, por até 24 horas. A peroxidase foi inativada após 4 horas a 80 °C e após 3 minutos a 96 °C. Esta enzima demonstra possibilidade para ser usada como reagente para diagnósticos, construção de biossensores e outros métodos analíticos em vários campos da ciência.In the literature, several processes have been described to obtain peroxidases. The purpose of this work was to obtain peroxidase from Copaifera langsdorffii leaves and characterize it partially using a factorial design of experiments and univaried tests, to confirm the results obtained by the factorial design of experiments. Peroxidase activity was measured using the guaiacol: hydrogen peroxide system. The isolated peroxidase presented 81.6% of horseradish peroxidase activity and was easy to obtain from leaves of an abundant tree distributed all over the country. Semi-purified peroxidase (COP was precipitated with acetone 65% (v.v-1 of the crude extract, obtaining the acetone powder. The COP optimum reaction pH values were between 5.0-7.0 and the

  10. Anatomia foliar de Copaifera langsdorffii Desf. (Leguminosae: interpretações ecológicas em diferentes condições edáficas de Cerrado

    Directory of Open Access Journals (Sweden)

    João Carlos Ferreira de Melo Júnior

    2012-09-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n4p29   Copaifera langsdorffii Desf. (Caesalpinioideae, Leguminosae é uma espécie arbórea de ampla distribuição no Brasil, conhecida como copaíba. O presente trabalho objetiva discutir, numa perspectiva ecológica, alterações estruturais foliares em populações de copaíba em três substratos distintos no Cerrado: neossolo flúvico em margem de rio, afloramento arenítico e latossolo vermelho em campo cerrado. Atributos foliares qualitativos e quantitativos foram observados por meio de preparações histológicas permanentes. Diferenças estatisticamente significativas foram verificadas em todos os parâmetros ecológicos analisados, como área específica foliar, espessura de tecidos e densidade estomática. A presença mais acentuada de características escleromórficas foi constatada nas plantas de arenito e neossolo flúvico, embora o latossolo também seja pobre em bases trocáveis. As alterações estruturais encontradas sejam o resultado da combinação de fatores edáficos, hídricos, microclimáticos e da interação planta/herbívoros existente em cada substrato, porém percebe-se claramente que houve prevalência dos fatores nutricionais do solo em detrimento da disponibilidade de água.

  11. GC-MS profiling of the phytochemical constituents of the oleoresin from Copaifera langsdorffii Desf. and a preliminary in vivo evaluation of its antipsoriatic effect.

    Science.gov (United States)

    Gelmini, Fabrizio; Beretta, Giangiacomo; Anselmi, Cecilia; Centini, Marisanna; Magni, Paolo; Ruscica, Massimiliano; Cavalchini, Alberto; Maffei Facino, Roberto

    2013-01-20

    Copaiba is the oleoresin (OR) obtained from Copaifera (Fabaceae), a neotropical tree which grows in Amazon regions. The balsam, constituted by an essential oil and a resinous fraction is used as folkloristic remedy in the treatment of several inflammatory diseases and for its antioxidant and antibacterial properties. Aim of this work was (a) to carry out a characterization by GC-MS of the volatile and nonvolatile constituents of Copaifera langsdorffii Desf. oleoresin (OR); (b) to investigate the mechanism of its anti-inflammatory activity; (c) to evaluate its antipsoriatic effect after oral intake/topical application. The volatile fraction (yield: 22.51%, w/w) shows: α-bergamotene (48.38%), α-himachalene (11.17%), β-selinene (5.00%) and β-caryophyllene (5.47%). The OR residue (77.49%, w/w), after derivatization, showed as main constituents the following compounds: copalic, abietic, daniellic, lambertinic, labd-7-en-15-oic, pimaric, isopimaric acids and kaur16-en18-oic acid. Preincubation of LPS-stimulated human THP-1 monocytes with increasing concentrations of the OR purified fraction (OR-PF), containing diterpene acids, diterpenes and sesquiterpenes, reduced the release of pro-inflammatory cytokines (IL-1β, IL-6, TNFα) in a dose-range of 0.1-10 μM. In addition, in cell culture system of human THP-1 monocytes, 1 μM OR-PF counteracts LPS-driven NF-κB nuclear translocation. In a preliminary clinical trial three patients affected by chronic psoriasis, treated with oral intake or topical application of the OR, exhibited a significant improvement of the typical signs of this disease, i.e. erythema, skin thickness, and scaliness. In conclusion, the results of this work, beside an extensive analytical characterization of the OR chemical composition, provide strong evidences that its anti-inflammatory activity is related to the inhibition of the NF-κB nuclear translocation, and consequently of proinflammatory cytokines secretion.

  12. Skin Wound Healing Potential and Mechanisms of the Hydroalcoholic Extract of Leaves and Oleoresin of Copaifera langsdorffii Desf. Kuntze in Rats

    Directory of Open Access Journals (Sweden)

    Lucas Fernando Sérgio Gushiken

    2017-01-01

    Full Text Available The wound healing is a complex process which, sometimes, can be a problem in public health because of the possibility of physical disability or even death. Due to the lack of a gold standard drug in skin wound treatment and aiming at the discovery of new treatments in skin repair and the mechanisms involved in the process, we used oleoresin (OR from Copaifera langsdorffii and hydroalcoholic extract of the leaves (EH to treat rat skin wounds. For that, male Wistar rats were divided into groups (n=8: Lanette, Collagenase, 10% EH, or 10% OR and, after anesthesia, one wound of 2 cm was made in the back of animals. The wounds were treated once a day for 3, 7, or 14 days and the wound areas were measured. The rats were euthanized and skin samples destined to biochemical, molecular, and immunohistochemical analysis. The results showed a macroscopic retraction of the wounds of 10% EH and 10% OR creams and both treatments showed anti-inflammatory activity. Molecular and immunohistochemical results demonstrated the activity of Copaifera langsdorffii creams in angiogenesis, reepithelialization, wound retraction, and remodeling mechanisms.

  13. Dynamic maceration of Copaifera langsdorffii leaves: a technological study using fractional factorial design

    Directory of Open Access Journals (Sweden)

    Ana R. M. Costa-Machado

    2012-01-01

    Full Text Available The Copaifera langsdorffii Desf., Fabaceae, is a Brazilian native tree, known as copaiba, which oil is commonly used in folk medicine as muscle relaxant, wound healing, antiseptic and anti-inflammatory to respiratory and urinary tracts. Despite of the wide use of the oil of Copaifera species, scientific works related to the study of its leaves are rarely found. In fact, processes for flavonoid extraction from C. langsdorffii leaves have not been studied yet leaving a wide field to be investigated. In this work, the 2(5-2 fractional factorial design was selected in order to study how the factors of a dynamic maceration process influence the responses of total flavonoids, total phenols, quercetrin and afzelin contents, and antioxidant activity in extracts from C. langsdorffii leaves. The results demonstrated that the significant factors studied were the drug load in extractor, the ethanol/water ratio and the stirring speed whereas the temperature and the extraction time were not significant. In conclusion, this study allowed visualizing which factors were considered the most important in copaiba leaves dynamic maceration and their effect in extract antioxidant activity. Furthermore, this technological study gives directions to optimize future extraction experiments from C. langsdorffii.

  14. Dynamic maceration of Copaifera langsdorffii leaves: a technological study using fractional factorial design

    Directory of Open Access Journals (Sweden)

    Ana R. M. Costa-Machado

    2013-02-01

    Full Text Available The Copaifera langsdorffii Desf., Fabaceae, is a Brazilian native tree, known as copaiba, which oil is commonly used in folk medicine as muscle relaxant, wound healing, antiseptic and anti-inflammatory to respiratory and urinary tracts. Despite of the wide use of the oil of Copaifera species, scientific works related to the study of its leaves are rarely found. In fact, processes for flavonoid extraction from C. langsdorffii leaves have not been studied yet leaving a wide field to be investigated. In this work, the 2(5-2 fractional factorial design was selected in order to study how the factors of a dynamic maceration process influence the responses of total flavonoids, total phenols, quercetrin and afzelin contents, and antioxidant activity in extracts from C. langsdorffii leaves. The results demonstrated that the significant factors studied were the drug load in extractor, the ethanol/water ratio and the stirring speed whereas the temperature and the extraction time were not significant. In conclusion, this study allowed visualizing which factors were considered the most important in copaiba leaves dynamic maceration and their effect in extract antioxidant activity. Furthermore, this technological study gives directions to optimize future extraction experiments from C. langsdorffii.

  15. Copaifera langsdorffii: evaluation of potential gastroprotective of extract and isolated compounds obtained from leaves

    Directory of Open Access Journals (Sweden)

    Marivane Lemos

    2015-06-01

    Full Text Available AbstractGastric ulcer is a prevalent gastrointestinal disease, and the drugs currently used in the treatment produce several adverse effects. In this context, the search for new therapeutic antiulcer agents is essential, and medicinal plants have great potential. Here, we investigated the gastroprotective properties of Copaifera langsdorffii Desf., Fabaceae, hydroalcoholic extract obtained from leaves and its isolated compounds. The phytochemistry studies and the compounds isolations were performed using chromatographic and spectroscopic methodologies. The hydroalcoholic extract was evaluated using ethanol/HCl, non-steroidal anti-inflammatory drug, stress-induced-ulcer and chronic ulcer-model. The effects on gastric content volume, pH, total acidity and mucus stomach production were evaluated in the pylorus ligated-model. The C. langsdorffii extract obtained from leaves (50, 250 or 500 mg/kg reduced the injured area compared to control group in all experiments. The extract showed a significant decrease in the total gastric juice acidity and an increase in mucus production (500 mg/kg when compared to vehicle. Among isolated compounds (30 mg/kg α-humulene, β-caryophyllene and caryophyllene oxide showed greater gastroprotective activity in the ethanol/HCl induced ulcer model. The data herein obtained shown that C. langsdorffii leaves extract and isolated compounds from it, presented gastroprotective properties in different animal models of gastric ulcer. These effects may be associated with the ability of the extract to decrease gastric secretion and increase the mucus production.

  16. Extraction, purification and biochemical characterization of a peroxidase from Copaifera langsdorffii leaves

    Directory of Open Access Journals (Sweden)

    Hermelinda Penha Freire Maciel

    2007-10-01

    Full Text Available The aim of this work is to obtain, purify and characterize biochemically a peroxidase from Copaifera langsdorffii leaves (COP. COP was obtained by acetone precipitation followed by ion-exchange chromatography. Purification yielded 3.5% of peroxidase with the purification factor of 46.86. The COP optimum pH is 6.0 and the temperature is 35 ºC. COP was stable in the pH range of 4.5 to 9.3 and at temperatures below 50.0 ºC. The apparent Michaelis-Menten constants (Km for guaiacol and H2O2 were 0.04 mM and 0.39 mM respectively. Enzyme turnover was 0.075 s-1 for guaiacol and 0.28 s-1 for hydrogen peroxide. Copaifera langsdorffii leaves showed to be a rich source of active peroxidase (COP during the whole year. COP could replace HRP, the most used peroxidase, in analytical determinations and treatment of industrial effluents at low cost.

  17. Insecticide effects of Ruta graveolens, Copaifera langsdorffii and Chenopodium ambrosioides against pests and natural enemies in commercial tomato plantation = Ação inseticida de Ruta graveolens, Copaifera langsdorffii e Chenopodium ambrosioides sobre pragas de tomate

    Directory of Open Access Journals (Sweden)

    Flávia Silva Barbosa

    2011-01-01

    Full Text Available The aim of this study was to evaluate the insecticide effect of watery leaf extracts of Ruta graveolens (Rutaceae, alcoholic leaf extracts of Copaifera langsdorffii (Caesalpinaceae and Chenopodium ambrosioides (Chenopodiaceae in the concentration of 5% under field conditions. The experiment design was randomized blocks with six replications. The parcels treated with plant extracts showed reduction in the population of pests when compared with the controlparcels. The extract elaborated with C. langsdorffii presented greater insecticidal effect under Bemisia tabaci (Hemiptera: Aleyrodidae and sum of pests. It was verified that after 24 hours ofspraying, the parcels treated with the extract of C. ambrosioides presented minor numbers of adults of Tuta absoluta (Lepidoptera: Gelechiidae, followed by the parcels treated with extract of R.graveolens. There were smaller numbers of parasitoid eggs of epidopterans Trichogramma sp. (Hymenoptera: Trichogrammatidae and sum of natural enemies (predators + parasitoids in the parcels that had received spraying with extracts from the plants of C. langsdorffii and C. ambrosioides, followed by R. graveolens, compared to the control. There were a smaller number of parasitoids from the family Eulophidae (Hymenoptera attacking caterpillars of T. absoluta in plants treated with R. graveolens, followed by C. langsdorffii and C. ambrosioides than in the control.O objetivo deste trabalho foi avaliar o efeito inseticida dos extratos aquosos de folhas de Ruta graveolens (Rutaceae e alcoólicos de folhas de Copaifera langsdorffii (Caesalpinaceae e de folhas de Chenopodium ambrosioides (Chenopodiaceae a 5%. O experimento foi em blocos casualizados com seis repetições. As parcelas tratadas tiveram redução na população de pragas, quando comparadas às parcelas sem nenhum tratamento. O extrato elaborado com C. langsdorffii apresentou maior efeito inseticida em Bemisia tabaci (Hemiptera: Aleyrodidae e soma das pragas

  18. Clinical Pulpotomy Trial of Copaifera Langsdorffii Oil Resin Versus Formocresol and White Mineral Trioxide Aggregate in Primary Teeth.

    Science.gov (United States)

    Musale, Prasad K; Soni, Abhishek S

    2016-01-01

    This study's purpose was to assess clinical and radiographic outcomes of Copaifera langsdorffii oil resin (CLOR) as a pulpotomy medicament compared with one-minute full-strength formocresol (FC) and white mineral trioxide aggregate (WMTA). Determined by a power analysis, 152 primary molars of 64 four- to eight-year-olds with at least two asymptomatic molars requiring vital pulpotomies were recruited, randomly assigned to receive CLOR, WMTA, or FC, and restored with prefabricated metal crowns. At the 12-month follow-up, recordings of 59 children with 142 treated teeth were taken for clinical and radiographic symptoms. Clinical evaluation was performed by a blinded calibrated evaluator, whereas four evaluators scored each radiograph for pathologies based upon a modified scale previously proposed. The data were statistically analyzed. At 12 months, 100 percent clinical success was observed with all groups. CLOR had the highest frequency of pathologic radiolucencies at 12 months. The radiographic success at 12 months was 76 percent, 90.91 percent, and 88.23 percent for the CLOR, FC, and WMTA groups, respectively (P=0.10). Copaifera langsdorffii oil resin can be suggested as a pulpotomy agent for primary teeth up to one year. However, further clinical studies with long-term follow-ups are needed to test its efficacy as a pulpotomy medicament.

  19. Antimicrobial activity of copaíba (Copaifera langsdorffii oleoresin on bacteria of clinical significance in cutaneous wounds

    Directory of Open Access Journals (Sweden)

    D.S. Masson

    2013-01-01

    Full Text Available The present study was designed to evaluate the in vitro antimicrobial activity of Copaifera langsdorffii oleoresin, which has been used in folk medicine as an anti-inflammatory, antibacterial, healing among others. The oleoresin was tested against Gram-positive (Staphylococcus aureus, Streptococcus pyogenes, Enterococcus faecalis and Gram-negative (Pseudomonas aeruginosa and Escherichia coli bacteria related to infections in cutaneous wounds. Antimicrobial activity was determined by the minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC assays. Copaiba oleoresin showed antimicrobial activity only against the Gram-positive bacteria with MIC of 200 μg/mL, 400 μg/mL and 1100 μg/mL for S. aureus, S. pyogenes and E. faecalis, respectively. MBC values were the same as MIC for S. aureus and S. pyogenes and for E. faecalis it was 1200 μg/mL. Considering that infection significantly impairs the wound healing process, we believe that the use of copaiba oleoresin as a component of a topical formulation could be a valuable adjunct in the treatment of infected wounds, mainly in the case of wounds infected by Gram-positive microorganisms.

  20. Edge effects enhance selfing and seed harvesting efforts in the insect-pollinated Neotropical tree Copaifera langsdorffii (Fabaceae).

    Science.gov (United States)

    Tarazi, R; Sebbenn, A M; Kageyama, P Y; Vencovsky, R

    2013-06-01

    Edge effects may affect the mating system of tropical tree species and reduce the genetic diversity and variance effective size of collected seeds at the boundaries of forest fragments because of a reduction in the density of reproductive trees, neighbour size and changes in the behaviour of pollinators. Here, edge effects on the genetic diversity, mating system and pollen pool of the insect-pollinated Neotropical tree Copaifera langsdorffii were investigated using eight microsatellite loci. Open-pollinated seeds were collected from 17 seed trees within continuous savannah woodland (SW) and were compared with seeds from 11 seed trees at the edge of the savannah remnant. Seeds collected from the SW had significantly higher heterozygosity levels (Ho=0.780; He=0.831) than seeds from the edge (Ho=0.702; He=0.800). The multilocus outcrossing rate was significantly higher in the SW (tm=0.859) than in the edge (tm=0.759). Pollen pool differentiation was significant, however, it did not differ between the SW (=0.105) and the edge (=0.135). The variance effective size within the progenies was significantly higher in the SW (Ne=2.65) than at the edge (Ne=2.30). The number of seed trees to retain the reference variance effective size of 500 was 189 at the SW and 217 at the edge. Therefore, it is preferable that seed harvesting for conservation and environmental restoration strategies be conducted in the SW, where genetic diversity and variance effective size within progenies are higher.

  1. Effects of the Dietary Supplementation of Sucupira (Pterodon Emarginatus Vog. and Copaiba (Copaifera Langsdorffii Resinoils on Chicken Breast and Thigh Meat Quality and Oxidative Stability

    Directory of Open Access Journals (Sweden)

    CB de Lima

    2015-12-01

    Full Text Available ABSTRACT An experiment was conducted to evaluate the addition of the oil resins ofsucupira (Pterodon emarginatus Vog. and copaiba (Copaifera langsdorffii to broiler diets on chicken meat composition, quality, and lipid peroxidation. 350 one-d-old broiler chicks were submitted to seven treatments, consisting of the diets supplemented with copaiba (COP or sucupira (SUC resin oils at three different concentrations (500, 900, and 1300 ppm plus a negative control diet (CONT. At 37 days of age, 10 birds per treatment were selected according to the average weight of the experimental unit and slaughtered to collect breast and thigh meat, which was stored at 4°C for 24 hours to evaluate pH, color (L*, a*, b*, cooking weight loss (CWL, and shear force (SF. Raw meat was vacuum packed and stored frozen until lipid peroxidation analysis. Meat samples were pooled to prepare pre-cooked meatballs (30 ± 0.5g, stored under refrigeration (eight days, and analyzed every two days for TBARS concentration. Results were analyzed using the PROC GLM and MIXED procedures (SAS statistical software. Plant oils increased (p<0.05 breast meat humidity (HU and crude protein (CP levels and reduced (p<0.05 total lipid (TLC and ash (AS levels when compared with the CONT treatment. Plant oils increased (p<0.05 thigh meat HU when compared with the CONT. High COP dietary levels reduced (p<0.05 breast meat CWL, and increased (p<0.05 thigh meat L* values when compared to CONT, except for SUC500 and SUC900. The dietary inclusion of plant oil resins showed a pro-oxidant effect (p<0.01 on breast meat when compared with the CONT. Low SUC dietary supplementation levels significantly reduced (p<0.01 the concentration of secondary oxidation products in thigh meat.

  2. Influência do óleo de Copaifera langsdorffii no reparo de ferida cirúrgica em presença de corpo estranho Influence of Copaifera langsdorffii oil on the repair of a surgical wound in the presence of foreign body

    Directory of Open Access Journals (Sweden)

    Rafael C. Vieira

    2008-08-01

    Full Text Available A Copaifera langsdorffii é uma leguminosa nativa do Brasil, da qual pode ser extraído um óleo, popularmente conhecido como óleo de copaíba. Este óleo é amplamente utilizado para tratamento de feridas cutâneas por ser reconhecido como antiinflamatório e cicatrizante. Apesar disso, poucas comprovações científicas do verdadeiro efeito terapêutico desta planta medicinal foram produzidas. O objetivo desse trabalho foi avaliar o efeito do tratamento tópico com C. langsdorffii no processo de reparo quando um corpo estranho é o indutor da inflamação. Para isso, 60 camundongos da linhagem BALB/c foram submetidos à incisão cirúrgica linear de 1cm no dorso para realizar o implante de uma lamínula de vidro com 12mm de diâmetro no tecido subcutâneo. Quatro tratamentos para a ferida foram estabelecidos: controle (C tratado com solução salina estéril, controle veículo (CV tratado com óleo mineral estéril, tratamento 1 (T1 tratado com diluição (v:v de óleo mineral estéril e óleo de C. langsdorffii, tratamento 2 (T2 tratado com óleo de C. langsdorffii puro. As avaliações foram realizadas em períodos de tempo pré-determinados (1, 3, 5, 7 e 14 dias. Era possível perceber características da fase proliferativa como a reepitelização, a presença de fibroblastos e a neovascularização, porém os grupos tratados com o óleo (T1 e T2 não apresentavam reepitelização aos três dias. Esses grupos aos 5 e 7 dias apresentavam no exame macroscópico maior intensidade de edema, hiperemia e permanência de crostas. Na microscopia, a reepitelização ainda não estava completa e a crosta era serocelular. Nos grupos C e CV, apesar de discreta, era predominante a presença de mononucleares, enquanto nos grupos T1 e T2 o infiltrado inflamatório era misto e com maior intensidade que nos outros grupos. Quatorze dias depois da incisão cirúrgica, os aspectos macroscópicos dos grupos C e CV eram semelhantes e os grupos T1 e T2, apesar

  3. Óleo de copaíba (Copaifera langsdorfii Desf. em padrões reprodutivos de camundongos e no desenvolvimento embriofetal Copaiba oil (Copaifera langsdorfii Desf. on mouse reproductive patterns and embryonic or fetal development

    Directory of Open Access Journals (Sweden)

    A.C.S. Lourenço

    2009-01-01

    Full Text Available A utilização de plantas medicinais sempre foi bem difundida, porém hoje se faz necessária uma abordagem científica para comprovar sua eficácia. Este estudo foi realizado para avaliar a possível toxicidade materna e teratogenicidade do óleo de copaíba, um óleo resina exudado do tronco de Copaifera langsdorfii, muito utilizado na medicina natural. Três doses de óleo de copaíba, administradas por gavage durante 5 dias do período gestacional de fêmeas de camundongos, foram testadas 0,3 mL Kg-1, 0,6 mL Kg-1 e 0,9 mL Kg-1 (p.c.. Em relação ao ganho de peso materno, peso dos órgãos, número de fetos vivos e implantes e viabilidade fetal, não houve diferença estatística entre os grupos. Os dados demonstram que este fitoterápico não apresenta toxicidade materna. Com relação às médias de peso e comprimento fetal dos grupos tratados, houve diferença estatística quando comparados ao controle, mas os fetos ainda se encontravam dentro do peso adequado à idade de prenhez. A prole das fêmeas tratadas não apresentou malformações ou alterações externas, viscerais e esqueléticas. Os resultados deste estudo indicam que o óleo de copaíba, nas doses administradas e período estudado, não apresentou toxicidade materna ou causou teratogenicidade na prole das fêmeas tratadas. Portanto, podemos considerar seu uso seguro durante o período gestacional.The use of medicinal plants has always been widely spread, but today a scientific approach is needed to prove their efficiency. The present study was performed to evaluate the possible maternal toxicity and teratogenicity of copaiba oil, a resin oil exudate from the trunk of Copaifera sp., extensively used in natural medicine. Three copaiba oil levels, administered through gavage for 5 days during the gestational period of female mice, were tested: 0.3 mL Kg-1, 0.6 mL Kg-1 and 0.9 mL Kg-1 (b.w.. As regards maternal weight gain, organ weight, live fetus number, implants and fetal

  4. Investigation on the wound healing activity of oleo-resin from Copaifera langsdorffi in rats.

    Science.gov (United States)

    Paiva, L A F; de Alencar Cunha, K M; Santos, F A; Gramosa, N V; Silveira, E R; Rao, V S N

    2002-12-01

    The wound healing activity of oleo-resin from Copaifera langsdorffii Desf. (Leguminaceae) bark was evaluated in rats on experimental wounds. The oleo-resin was tested by monitoring wound contraction in excised wounds and by measuring tensile strength in healing incision wounds. The topical application of oleo-resin at a concentration of 4% accelerated wound contraction in open wounds. The mean values of wound contraction in oleo-resin treated rats on day 9 was 84.05% +/- 2.37% as against 51.29% +/- 9.54% seen in controls and the difference was statistically significant (p contraction were observed on days 12, 15, 18 and 21. Also, the tensile strength in healing incised wounds was found to be significantly higher in the group of animals treated with 4% oleo-resin on day 5 but not on days 7 and 12 (controls: 35.95 +/- 7.44 g/cm; oleo-resin: 71.48 +/- 5.77 g/cm; p resin on wound healing and justify its traditional use for the treatment of wounds.

  5. Antifungal saponins from Swartzia langsdorffii; Saponinas antifungicas de Swartzia langsdorffii

    Energy Technology Data Exchange (ETDEWEB)

    Marqui, Sara Regina de; Lemos, Renata Brionizio; Santos, Luciana Avila; Castro-Gamboa, Ian; Cavalheiro, Alberto Jose; Bolzani, Vanderlan da Silva; Silva, Dulce Helena Siqueira [Universidade Estadual Paulista (UNESP), Araraquara, SP (Brazil). Inst. de Quimica]. E-mail: dhsilva@iq.unesp.br; Scorzoni, Liliana; Fusco-Almeida, Ana Maria; Mendes-Giannini, Maria Jose Soares [Universidade Estadual Paulista (UNESP), Araraquara, SP (Brazil). Faculdade de Ciencias Farmaceuticas; Young, Maria Claudia Marx; Torres, Luce Maria Brandao [Inst. de Botanica, SP (Brazil). Secao de Fisiologia e Bioquimica de Plantas

    2008-07-01

    Chromatographic fractionation of the EtOH extract from the leaves of Swartzia langsdorffii afforded the pentacyclic triterpenes oleanolic acid and lupeol, and two saponins: oleanolic acid 3-sophoroside and the new ester 3-O-{beta}-D-(6'-methyl)-glucopyranosyl-28-O-{beta}-D-glucopyranosyl-oleanate. Their structures were elucidated from spectral data, including 2D NMR and HRESIMS experiments. Antifungal activity of all isolated compounds was evaluated, using phytopathogens Cladosporium cladosporioides and C. sphaerospermum, and human pathogens Candida albicans, C. krusei, C. parapsilosis and Cryptococcus neoformans. (author)

  6. Antimicrobial profile screening of two oils of Copaifera genus

    Directory of Open Access Journals (Sweden)

    F.A. Pieri

    2012-02-01

    Full Text Available O objetivo deste estudo foi identificar a atividade inibitória de óleos de copaíba sobre o crescimento dos micro-organismos: Shigella flexneri, Klebsiella pneumoniae, Escherichia coli, Proteus mirabilis, Pseudomonas aeruginosa, Citrobacter freundi, Staphylococcus aureus, Actinobacillus pleuropneumoniae e Haemophilus parasuis. Foi realizado um teste de difusão em ágar com duas soluções a 10% de óleos de copaíba obtidos de duas diferentes espécies de copaíba (Copaifera officinalis e C. langsdorffii e um controle negativo com tween 80 e água. Os isolados clínicos de H. parasuis e A. pleuropneumoniae foram incubados em microaerofilia. Os resultados mostraram três espécies Gram-negativas inibidas por ambas as soluções de óleo de copaíba: E. coli, P. aeruginosa e S. flexneri. Na inibição de P. aeruginosa o óleo de C. officinalis foi superior ao de C. langsdorffii (P<0,05. Todas as cepas de S. aureus tiveram seu crescimento inibido pelas soluções no ensaio, sem diferença estatística entre os halos. Estes resultados sugerem que o óleo de copaíba pode ser uma fonte potencial de compostos inibitórios para ser utilizada como antimicrobianos no tratamento de infecções humanas e animais e conservação de alimentos.

  7. Saponins from Swartzia langsdorffii: biological activities

    Directory of Open Access Journals (Sweden)

    Magalhães Aderbal Farias

    2003-01-01

    Full Text Available The presence of saponins and the molluscicidal activity of the roots, leaves, seeds and fruits of Swartzia langsdorffii Raddi (Leguminosae against Biomphalaria glabrata adults and eggs were investigated. The roots, seeds and fruits were macerated in 95% ethanol. These extracts exerted a significant molluscicidal activity against B. glabrata, up to a dilution of 100 mg/l. Four mixtures (A2, B2, C and D of triterpenoid oleanane type saponins were chromatographically isolated from the seed and fruit extracts. Two known saponins (1 and 2 were identified as beta-D-glucopyranosyl-[alpha-L-rhamnopyranosyl-(1->3- beta-D-glucuronopyranosyl-(1->3]-3beta-hydroxyolean-12-ene-28 -oate, and beta-D-glucopyranosyl-(1->3-beta-D-glucuronopyranosyl-(1 ->3]-3beta-hydroxyolean-12-ene-28-oate, respectively. These two saponins were present in all the mixtures, together with other triterpenoid oleane type saponins, which were shown to be less polar, by reversed-phase HPLC. The saponin identifications were based on spectral evidence, including ¹H-¹H two-dimensional correlation spectroscopy, nuclear Overhauser and exchange spectroscopy, heteronuclear multiple quantum coherence, and heteronuclear multiple-bond connectivity experiments. The toxicity of S. langsdorffii saponins to non-target organisms was prescreened by the brine shrimp lethality test.

  8. Saponinas antifúngicas de Swartzia langsdorffii Antifungal saponins from Swartzia langsdorffii

    Directory of Open Access Journals (Sweden)

    Sara Regina de Marqui

    2008-01-01

    Full Text Available Chromatographic fractionation of the EtOH extract from the leaves of Swartzia langsdorffii afforded the pentacyclic triterpenes oleanolic acid and lupeol, and two saponins: oleanolic acid 3-sophoroside and the new ester 3-O-b-D-(6'-methyl-glucopyranosyl-28-O-b-D-glucopyranosyl-oleanate. Their structures were elucidated from spectral data, including 2D NMR and HRESIMS experiments. Antifungal activity of all isolated compounds was evaluated, using phytopathogens Cladosporium cladosporioides and C. sphaerospermum, and human pathogens Candida albicans, C. krusei, C. parapsilosis and Cryptococcus neoformans.

  9. Constituintes das sementes de Copaifera officinalis L. Constituents from Copaifera officinalis L. seeds

    Directory of Open Access Journals (Sweden)

    Valdir F. Veiga Junior

    2007-01-01

    Full Text Available O gênero Copaifera L. é um dos mais importantes economicamente na Região Amazônica devido, principalmente, à produção dos óleos de copaíba, oléo-resinas com diversas propriedades farmacológicas confirmadas. Apesar disso, os estudos fitoquímicos com as sementes das árvores do gênero Copaifera L.são raros. Copaifera officinalis foi a primeira espécie do gênero Copaifera a ser descrita. Este trabalho descreve a composição dos extratos obtidos em hexano e em acetato de etila das sementes de C. officinalis. No extrato obtido em hexano, a análise por cromatografia em fase gasosa utilizando padrões e através de espectrometria de massas permitiu a identificação de: esqualeno, tetradecano, hexadecano, campesterol, estigmasterol e beta-sitosterol; os ácidos graxos hexadecanóico, 9-octadecenóico e octadecanóico (majoritários; e decanóico, eicosanóico, docosanóico e tetracosanóico (minoritários. Cumarina foi isolada do extrato em acetato de etila e identificada por técnicas de RMN.Copaifera L. is one of the most economically important plant genera in the Amazon Region, since it exudes a resin-oil named copaiba oil possessing several confirmed pharmacological properties. In spite of that, phytochemical studies of the seeds from this genus are rare. Copaifera officinalis L. was the first species in the genus Copaifera to be described. This paper describes the chemical composition of the hexane and ethyl acetate extracts of the seeds from this species. In the hexane extract, gas chromatography and mass spectrometry analyses enabled us to identify squalene, tetradecane, hexadecane, campesterol, stigmasterol and beta-sitosterol; hexadecanoic, 9-octadecenoic and octadecanoic acids (major substances; as well as decanoic, eicosanoic, docosanoic and tetracosanoic (minor substances acids. Coumarin was detected in the ethyl acetate extract, isolated and identified by NMR.

  10. Phenolic substances in Ailanthus glandulosa Desf

    Directory of Open Access Journals (Sweden)

    Pekala Karolina

    2014-06-01

    Full Text Available The aim of this work was the isolation and identification of phenolic acids from fruit and leaves of Ailanthus glandulosa Desf. The methods used in the isolation and identification of the compounds were: isolation of phenolic acids modified by Ibrahim and Towers, acidic and alkaline hydrolysis by Schmidtlein and Herrmann and identification of phenolic acids in the isolated fraction of two-dimensional thin layer chromatography (TLC on cellulose plates. In the course of the study, the presence of phenolic acids in leaves and fruit of Ailanthus glandulosa Desf was confirmed. Overall, proportions of 15 phenolic acids were found and identified in the analyzed material. These are: gallic acid, ellagic acid, caffeic acid, gentisic acid, protocatechuic acid, p-hydroxybenzoic acid, m-hydroxybenzoic acid, ferulic acid, p-coumaric acid, syryngic acid, vanillic acid, salicylic acid, 2-hydroxy-4- methoxybenzoic acid, 2,5-dimethoxycinnamic, p-hydroxyphenylacetic acid, and 3 other compounds named A, B, C, whose identification was not possible due to the lack of suitable reference patterns. Studies have shown that leaves and fruit of the plant Ailanthus glandulosa Desf. contain a large number of phenolic acids which possess many important pharmacological activities.

  11. Brazilian Amazon Traditional Medicine and the Treatment of Difficult to Heal Leishmaniasis Wounds with Copaifera

    Science.gov (United States)

    de Albuquerque, Kelly Cristina Oliveira; da Veiga, Andreza do Socorro Silva; Silva, João Victor da Silva e; Brigido, Heliton Patrick Cordovil; Ferreira, Erica Patrícia dos Reis; Costa, Erica Vanessa Souza; Marinho, Andrey Moacir do Rosário; Percário, Sandro

    2017-01-01

    The present study describes the use of the traditional species Copaifera for treating wounds, such as ulcers scarring and antileishmanial wounds. It also relates phytochemical studies, evaluation of the leishmanicidal activity, and toxicity. The species of Copaifera with a higher incidence in the Amazon region are Copaifera officinalis, Copaifera reticulata, Copaifera multijuga Hayne. The copaiba oil is used in the Amazon's traditional medicine, especially as anti-inflammatory ingredient, in ulcers healing, and in scarring and for leishmaniasis. Chemical studies have shown that these oils contain diterpenes and sesquiterpenes. The copaiba oil and terpenes isolated have antiparasitic activity, more promising in the amastigote form of L. amazonensis. This activity is probably related to changes in the cell membrane and mitochondria. The oil showed low cytotoxicity and genotoxicity. Furthermore, it may interfere with immune response to infection and also has a healing effect. In summary, the copaiba oil is promising as leishmanicidal agent.

  12. Terpenoid biosynthesis in Euphorbia lathyris and Copaifera spp

    Energy Technology Data Exchange (ETDEWEB)

    Skrukrud, C.L.

    1987-07-01

    Biosynthesis of triterpenoids by isolated latex of Euphorbia lathyris was investigated. The rate of in vitro incorporation of mevalonic acid into triterpenoids was thirty times greater than acetate incorporation indicating that the rate-limiting step in the pathway occurs prior to mevalonate. Both HMG-CoA reductase (EC 1.1.1.34) and HMG-CoA lyase (EC 4.1.3.4) activities were detected in isolated latex. HMG-CoA reductase was localized to a membrane-bound fraction of a 5000g pellet of latex. The rate of conversion of HMG-CoA to mevalonate by this enzyme is comparable to the overall rate of acetate incorporation into the triterpenoids suggesting that this enzyme is rate-determining in the biosynthesis of triterpenoids in E. lathyris latex. HMG-CoA reductase of E. lathyris vegetative tissue was localized to the membrane-bound portion of a particulate fraction (18,000g), and was solubilized by treatment with 2% polyoxyethylene ether W-1. Differences in the optimal pH for activity of HMG-CoA reductase from the latex and vegetative tissue suggest that isozymes of the enzyme may be present in the two tissue types. Studies of the incorporation of various precursors into leaf discs and cuttings taken from Copaifera spp. show differences in the rate of incorporation into Copaifera sesquiterpenes suggesting that the site of sesquiterpene biosynthesis may differ in its accessibility to the different substrates and/or reflecting the metabolic controls on carbon allocation to the terpenes. Mevalonate incorporation by Copaifera langsdorfii cuttings into sesquiterpenes was a hundred-fold greater than either acetate or glucose incorporation, however, its incorporation into squalene and triterpenoids was also a hundred-fold greater than the incorporation into sesquiterpenes. 119 refs., 58 figs., 16 tabs.

  13. Antimicrobial profile screening of two oils of Copaifera genus

    OpenAIRE

    F.A. Pieri; V.O. Silva; SOUZA, C. de F.; Costa,J.C.M.; L.F. Santos; Moreira,M.A.S.

    2012-01-01

    O objetivo deste estudo foi identificar a atividade inibitória de óleos de copaíba sobre o crescimento dos micro-organismos: Shigella flexneri, Klebsiella pneumoniae, Escherichia coli, Proteus mirabilis, Pseudomonas aeruginosa, Citrobacter freundi, Staphylococcus aureus, Actinobacillus pleuropneumoniae e Haemophilus parasuis. Foi realizado um teste de difusão em ágar com duas soluções a 10% de óleos de copaíba obtidos de duas diferentes espécies de copaíba (Copaifera officinalis e C. langsdor...

  14. Antimicrobial activity of Copaifera langsdorffii oil and evaluation of its most bioactive fraction against bacteria of dog’s dental plaque

    Directory of Open Access Journals (Sweden)

    FA Pieri

    2014-04-01

    Full Text Available The aim of this study was to evaluate the inhibitory effect of copaiba oil and its resinous and volatile fractions against 20 bacterial isolates from dental plaque of dogs. The antimicrobial activities of the oil and its fractions were evaluated by the agar diffusion test with solutions at 10% concentration. The results showed antimicrobial activity for the copaiba oil solution on 16 isolates. The volatile fraction was considered statistically similar (P>0.05 to copaiba oil intact on the size of inhibition zones inhibiting 17 isolates. The resinous fraction inhibited only eight isolates, with smaller haloes when compared with those of the volatile fraction and intact oil (P<0.05. It is concluded from these results that copaiba oil is a potential phytotherapic to be used in dental plaque antimicrobial therapy of dogs and suggests that its activity is due to sesquiterpenes of the volatile fraction.

  15. Constituents from Moghat, the Roots of Glossostemon bruguieri (Desf.

    Directory of Open Access Journals (Sweden)

    Meselhy R. Meselhy

    2003-07-01

    Full Text Available The new biflavone moghatin (3″′-hydroxycupressuflavone was isolated from Moghat, the dried peeled roots of Glossostemon bruguieri (Desf., together with five known compounds: 4′-methoxyisoscutellargin, sesamin, chrysophanol, emodin and methoxyemodin (physcion. The structures of these compounds were assigned on the basis of spectroscopic data. Occurrence of these compounds in Moghat is reported here for the first time.

  16. Terpenes from Copaifera demonstrated in vitro antiparasitic and synergic activity.

    Science.gov (United States)

    Izumi, Erika; Ueda-Nakamura, Tânia; Veiga, Valdir F; Pinto, Angelo C; Nakamura, Celso Vataru

    2012-04-12

    To discover new possible therapies for Chagas' disease, we evaluated against all Trypanosoma cruzi life stages the in vitro trypanocidal and synergistic activity of terpenes isolated from Copaifera oleoresins collected in the Amazon and investigated their possible mechanism of action. Seven acid diterpenes and one sesquiterpene were tested. Terpenes promoted changes in oxidative metabolism followed by autophagic processes in the parasite cell leading to selective death. Furthermore, they were more effective against replicative forms, in particular amastigotes. A synergistic effect occurred. Cytotoxicity to erythrocytes and nucleated cells was moderate. This is the first study showing synergic activity between two terpenes against T. cruzi. Combinations of natural compounds can show high activity and may lead to new alternative treatments in the future.

  17. Biological Activities and Cytotoxicity of Diterpenes from Copaifera spp. Oleoresins

    Directory of Open Access Journals (Sweden)

    Fabiano de S. Vargas

    2015-04-01

    Full Text Available Copaifera spp. are Amazonian species widely studied and whose oleoresins are used by local people for various medicinal purposes. However, a detailed study of the activity of the main phytochemical components of these oleoresins remains to be done. Here, we studied the cytotoxicity and in vitro anti-inflammatory effects of six diterpene acids: copalic, 3-hydroxy-copalic, 3-acetoxy-copalic, hardwickiic, kolavic-15-metyl ester, and kaurenoic, isolated from the oleoresins of Copaifera spp. The diterpenes did not show cytotoxicity in normal cell lines, nor did they show significant changes in viability of tumoral line cells. The 3-hydroxy-copalic was able to inhibit the enzyme tyrosinase (64% ± 1.5% at 250 µM. The kolavic-15-metyl ester at 200 µM showed high inhibitory effect on lipoxygenase (89.5% ± 1.2%. Among the diterpenes tested, only kaurenoic and copalic acids showed significant hemolytic activities with 61.7% and 38.4% at 100 µM, respectively. In addition, it was observed that only the copalic acid (98.5% ± 1.3% and hardwickiic acid (92.7% ± 4.9% at 100 mM inhibited nitric oxide production in macrophages activated by lipopolysaccharide. In this assay, the diterpenes did not inhibit tumor necrosis factor-α production. The acids inhibited the production of IL-6, 3-acetoxy-copalic (23.8% ± 8.2%, kaurenoic (11.2% ± 5.7%, kolavic-15-methyl ester (17.3% ± 4.2%, and copalic (4.2% ± 1.8%, respectively, at 25 µM. The kaurenoic, 3-acetoxy-copalic and copalic acids increased IL-10 production. This study may provide a basis for future studies on the therapeutic role of diterpenic acids in treating acute injuries such as inflammation or skin disorders.

  18. Biological activities and cytotoxicity of diterpenes from Copaifera spp. Oleoresins.

    Science.gov (United States)

    de S Vargas, Fabiano; D O de Almeida, Patrícia; Aranha, Elenn Suzany P; de A Boleti, Ana Paula; Newton, Peter; de Vasconcellos, Marne C; Junior, Valdir F Veiga; Lima, Emerson S

    2015-04-09

    Copaifera spp. are Amazonian species widely studied and whose oleoresins are used by local people for various medicinal purposes. However, a detailed study of the activity of the main phytochemical components of these oleoresins remains to be done. Here, we studied the cytotoxicity and in vitro anti-inflammatory effects of six diterpene acids: copalic, 3-hydroxy-copalic, 3-acetoxy-copalic, hardwickiic, kolavic-15-metyl ester, and kaurenoic, isolated from the oleoresins of Copaifera spp. The diterpenes did not show cytotoxicity in normal cell lines, nor did they show significant changes in viability of tumoral line cells. The 3-hydroxy-copalic was able to inhibit the enzyme tyrosinase (64% ± 1.5%) at 250 µM. The kolavic-15-metyl ester at 200 µM showed high inhibitory effect on lipoxygenase (89.5% ± 1.2%). Among the diterpenes tested, only kaurenoic and copalic acids showed significant hemolytic activities with 61.7% and 38.4% at 100 µM, respectively. In addition, it was observed that only the copalic acid (98.5% ± 1.3%) and hardwickiic acid (92.7% ± 4.9%) at 100 mM inhibited nitric oxide production in macrophages activated by lipopolysaccharide. In this assay, the diterpenes did not inhibit tumor necrosis factor-α production. The acids inhibited the production of IL-6, 3-acetoxy-copalic (23.8% ± 8.2%), kaurenoic (11.2% ± 5.7%), kolavic-15-methyl ester (17.3% ± 4.2%), and copalic (4.2% ± 1.8%), respectively, at 25 µM. The kaurenoic, 3-acetoxy-copalic and copalic acids increased IL-10 production. This study may provide a basis for future studies on the therapeutic role of diterpenic acids in treating acute injuries such as inflammation or skin disorders.

  19. In vitro antimicrobial activity of solution blow spun poly(lactic acid)/ polyvinylpyrrolidone nanofibers loaded with Copaiba (Copaifera sp.) oil

    Science.gov (United States)

    In this study poly(lactic acid)(PLA) and polyvinylpyrrolidone (PVP) micro and nanofibers mats loaded with copaiba (Copaifera sp.) oil were produced by solution blow spinning (SBS). The copaiba (Copaifera sp.) oil was characterized by gas chromatography (GC). Neat PLA and four PLA/ PVP blends contain...

  20. Antileishmanial Activity of the Hydroalcoholic Extract of Miconia langsdorffii, Isolated Compounds, and Semi-Synthetic Derivatives

    Directory of Open Access Journals (Sweden)

    Wilson R. Cunha

    2011-02-01

    Full Text Available The in vitro activity of the crude hydroalcoholic extract of the aerial parts of Miconia langsdorffii Cogn. was evaluated against the promastigote forms of L. amazonensis, the causative agent of cutaneous leishmaniasis in humans. The bioassay-guided fractionation of this extract led to identification of the triterpenes ursolic acid and oleanolic acid as the major compounds in the fraction that displayed the highest activity. Several ursolic acid semi-synthetic derivatives were prepared, to find out whether more active compounds could be obtained. Among these ursolic acid-derived substances, the C-28 methyl ester derivative exhibited the best antileishmanial activity.

  1. Application of the essential oil from copaiba (Copaifera langsdori Desf.) for acne vulgaris: a double-blind, placebo-controlled clinical trial.

    Science.gov (United States)

    da Silva, Ary Gomes; Puziol, Paula de Freitas; Leitao, Roane Nunes; Gomes, Tatiana Rafaela; Scherer, Rodrigo; Martins, Monica Lacerda Lopes; Cavalcanti, Aurea Scardua Saade; Cavalcanti, Luiz Carlos

    2012-03-01

    Copaiba oil-resin is widely used in traditional medicine due to its anti-inflammatory, healing, and antiseptic activities. This research aims to extract and evaluate the qualitative and quantitative composition of copaiba essential oil from the oil-resin, and test its effects, after incorporation in a gel applied in volunteers with acne, in a double-blind placebo controlled clinical trial. The essential oil was extracted by steam distillation, and purified by freezing to remove the residual remnant water. The density of the essential oil was gravimetrically determined by weighing 1 mL of liquid at 20 degree C. The identification of the essential oil components was carried out through high-resolution gas chromatography analysis, coupled with mass spectrometry. The essential oil has a density of 0.9175 mg/mL and was composed of 48 substances, 14 of which were the major components representing 95.80% of total essential oil composition. Cis-thujopsene was the main component (46.96% of total essential oil composition). The surface affected with acne decreased when treated with placebo (F = 13.931, p = 0.001, r = 0.518; r2 = 0.268), but the linear model could explain only 26.8% of total variance in original data matrix. There was a highly significant decrease in the surface affected with acne in the areas treated with the 1.0% copaiba essential oil preparation (F = 86.494, p = 0.000, r = 0.834; r2 = 0.695).

  2. "Essential oils of Heracleum Persicum Desf.ex Fischer leaves "

    Directory of Open Access Journals (Sweden)

    Mojab F

    2002-07-01

    Full Text Available The leaves of Heracleum persicum Desf ex Fischer (Syn. H glabrascens Boiss. & Hohen, H. prbescens Rech. (Fam Apiaceae were collected in July - Auguest 1993 from kandavan area in north of Tehran. The oil was extracted by hydrodistillation (0.13% from leaves and was analyzed by GC, GC/CS and 1H-NMR. The major component was trans - anethole (82.8% Other components were β - pinene, p-cymene and terpinolene (monoterpenes , α- caryophylene, α- bergamotene, α- farnesene, zingiberene, spathulenol (sesqiterpenes. Cis - anethole, stragole, 2,5-dimethyl styrene (aromatic compounds, and β- springene ( an aliphatic and hydrocarbonic diterpene . It is concluded that this oil is a source of trans - anethole .

  3. In vitro antiplasmodial activity of crude extracts of Tetrapleura tetraptera and Copaifera religiosa

    Directory of Open Access Journals (Sweden)

    Lekana-Douki Jean

    2011-11-01

    Full Text Available Abstract Background Malaria remains a major public health problem, especially in tropical and subtropical regions because of the emergence and widespread of antimalarial drug resistance. Traditional medicine represents one potential source of new treatments. Here, we investigated the in vitro antiplasmodial activity of bark extracts from two Fabaceae species (Tetrapleura tertaptera and Copaifera religiosa traditionally used to treat malaria symptoms in Haut-Ogooué province, Gabon. Findings The antiplasmodial activity of dichloromethane and methanolic extracts was tested on P. falciparum strains FCB (chloroquine-resistant and 3D7 (chloroquine-sensitive and on fresh clinical isolates, using the DELI method. Host cell toxicity was analyzed on MRC-5 human diploid embryonic lung cells using the MTT test. The dichloromethane extracts of the two plants had interesting activity (IC50 between 8.5 ± 4.7 and 13.4 ± 3.6 μg/ml. The methanolic extract of Tetrapleura tetraptera was less active (IC50 around 30 μg/ml and the methanolic extract of Copaifera religiosa was inactive. The selectivity index (toxicity/antiplasmodial activity of the dichloromethane extract of Tetrapleura tetraptera was high (around 7, while the dichloromethane extract of Copaifera religiosa had the lowest selectivity (0.6. The mean IC50 values for field isolates were less than 1.5 μg/ml for dichloromethane extracts of both plants, while methanolic extracts of Tetrapleura tetraptera showed interesting activity (IC50 = 13.1 μg/ml. The methanolic extract of Copaifera religiosa was also inactive on field isolates. Conclusions Dichloromethane extracts of Tetrapleura tetraptera and Copaifera religiosa, two plants used to treat malaria in Gabon, had interesting antiplasmodial activity in vitro. These data provide a scientific rationale for the traditional use of these plants against malaria symptoms. Bioactivity-guided phytochemical analyses are underway to identify the active compounds.

  4. In vitro efficacy of Coriandrum sativum, Lippia sidoides and Copaifera reticulata against Leishmania chagasi

    OpenAIRE

    Rondon, Fernanda Cristina Macedo; Bevilaqua,Claudia Maria Leal; Accioly,Marina Parissi; Morais,Selene Maia de; Andrade-Júnior,Heitor Franco de; Carvalho, Camila Aparecida de; Lima,Josemar Coelho; Magalhães,Hilton César Rodrigues

    2012-01-01

    The increased incidence of visceral leishmaniasis (VL) in Brazil is due to a lack of effective disease control measures. In addition to that, no effective treatment exists for canine VL in response to synthetic drugs. Thus, the objective of this study was to evaluate the effect of the essential oils of Coriandrum sativum and Lippia sidoides, and oleoresin from Copaifera reticulata, on Leishmania chagasi promastigotes and amastigotes. We also examined the toxicity of these treatments on the mu...

  5. Preliminary phytochemical screening and antioxidant activities of solvent extracts from Daucus crinitus Desf., from Algeria

    OpenAIRE

    Bendiabdellah, Amel; DIB, Mohammed El Amine; Meliani, Nawel; Djabou, Nassim; Allali, Hocine; Tabti, Boufeldja

    2012-01-01

    The presence of natural antioxidant in plants is well known. Plant phenolics constitute one of the major groups of components that act as primary antioxidant free radical terminators. This paper reports the antioxidative activity of methanolic and water extract of Daucus crinitus Desf. Phytochemical screening of the crude extracts of stems/leaves revealed the presence of different kind of chemical groups such as tannin, flavonoids, phenolic acids and coumarins. The amounts of tota...

  6. Flood-promoted vessel formation in Prioria copaifera trees in the Darien Gap, Colombia.

    Science.gov (United States)

    López, Janeth; Del Valle, Jorge I; Giraldo, Jorge A

    2014-10-01

    Trees growing in floodplains develop mechanisms by which to overcome anoxic conditions. Prioria copaifera Griseb. grows on the floodplains of the Atrato River, Colombia, and monodominant communities of this species remain flooded for at least 6 months a year. The aims of this study were as follows: (i) to compare variations in tree-ring structure with varying river water levels; and (ii) to reconstruct variations in water levels from the chronology of variations in the porosity of the tree rings. Discs were taken from 12 trees, and the number of vessels along 3-mm-wide radial transects was counted. Standard dendrochronological techniques were used to determine the mean number of vessels over 130 years, between 1877 and 2006; the signal-to-noise ratio was 13.3 and the expressed population signal 0.93. Furthermore, this series of vessel numbers was calibrated against variations in the water levels between 1977 and 2000; positive correlations were found with the mean for both the annual river water level and the level from June to August. The transfer function between the principal components of the mean annual water level and those of chronology allowed us to reconstruct the river levels over 130 years. Our conclusions are as follows: (i) the number of vessels per ring is an appropriate proxy for determining variations in water levels; and (ii) P. copaifera grows thicker and produces more vessels when water levels rise. The probable ecophysiological causes of this interesting behaviour are discussed.

  7. Ionomic profiling of Nicotiana langsdorffii wild-type and mutant genotypes exposed to abiotic stresses.

    Science.gov (United States)

    Ardini, Francisco; Soggia, Francesco; Abelmoschi, Maria Luisa; Magi, Emanuele; Grotti, Marco

    2013-01-01

    To provide a new insight into the response of plants to abiotic stresses, the ionomic profiles of Nicotiana langsdorffii specimens have been determined before and after exposure to toxic metals (chromium) or drought conditions. The plants were genetically transformed with the rat glucocorticoid receptor (GR) or the gene for Agrobacterium rhizogenes rolC, because these modifications are known to produce an imbalance in phytohormone equilibria and a significant change in the defence response of the plant. Elemental profiles were obtained by developing and applying analytical procedures based on inductively coupled plasma atomic emission and mass spectrometry (ICP-AES/MS). In particular, the removal of isobaric interferences affecting the determination of Cr and V by ICP-MS was accomplished by use of a dynamic reaction cell, after optimization of the relevant conditions. The combined use of ICP atomic emission and mass spectrometry enabled the determination of 29 major and trace elements (Ba, Bi, Ca, Cd, Co, Cr, Cu, Eu, Fe, Ga, K, Li, Mg, Mn, Mo, Na, P, Pb, Pt, Rb, S, Sb, Sn, Sr, Te, V, W, Y, and Zn) in different parts of the plants (roots, stems, and leaves), with high accuracy and precision. Multivariate data processing and study of element distribution patterns provided new information about the ionomic response of the target organism to chemical treatment or water stress. Genetic modification mainly affected the distribution of Bi, Cr, Mo, Na, and S, indicating that these elements were involved in biochemical processes controlled by the GR or rolC genes. Chemical stress strongly affected accumulation of several elements (Ba, Ca, Fe, Ga, K, Li, Mn, Mo, Na, P, Pb, Rb, S, Sn, Te, V, and Zn) in different ways; for Ca, Fe, K, Mn, Na, and P the effect was quite similar to that observed in other studies after treatment with other transition elements, for example Cu and Cd. The effect of water deficit was less evident, mainly consisting in a decrease of Ba, Cr, Na, and Sr

  8. Nonannual tree rings in a climate-sensitive Prioria copaifera chronology in the Atrato River, Colombia.

    Science.gov (United States)

    Herrera-Ramirez, David; Andreu-Hayles, Laia; Del Valle, Jorge I; Santos, Guaciara M; Gonzalez, Paula L M

    2017-08-01

    In temperate climates, tree growth dormancy usually ensures the annual nature of tree rings, but in tropical environments, determination of annual periodicity can be more complex. The purposes of the work are as follows: (1) to generate a reliable tree-ring width chronology for Prioria copaifera Griseb. (Leguminoceae), a tropical tree species dwelling in the Atrato River floodplains, Colombia; (2) to assess the climate signal recorded by the tree-ring records; and (3) to validate the annual periodicity of the tree rings using independent methods. We used standard dendrochronological procedures to generate the P. copaifera tree-ring chronology. We used Pearson correlations to evaluate the relationship of the chronology with the meteorological records, climate regional indices, and gridded precipitation/sea surface temperature products. We also evaluated 24 high-precision (14)C measurements spread over a range of preselected tree rings, with assigned calendar years by dendrochronological techniques, before and after the bomb spike in order to validate the annual nature of the tree rings. The tree-ring width chronology was statistically reliable, and it correlated significantly with local records of annual and October-December (OND) streamflow and precipitation across the upper river watershed (positive), and OND temperature (negative). It was also significantly related to the Oceanic Niño Index, Pacific Decadal Oscillation, and the Southern Oscillation Index, as well as sea surface temperatures over the Caribbean and the Pacific region. However, (14)C high-precision measurements over the tree rings demonstrated offsets of up to 40 years that indicate that P. copaifera can produce more than one ring in certain years. Results derived from the strongest climate-growth relationship during the most recent years of the record suggest that the climatic signal reported may be due to the presence of annual rings in some of those trees in recent years. Our study alerts

  9. Zizyphus lotus L. (Desf. modulates antioxidant activity and human T-cell proliferation

    Directory of Open Access Journals (Sweden)

    Belarbi Meriem

    2010-09-01

    Full Text Available Abstract Background Zizyphus lotus L. (Desf. also known as Jujube, is a deciduous shrub which belongs to Rhamnaceae family. This plant is used in Algerian traditional medicine for its anti-diabetic, sedative, analgesic, anti-inflammatory and hypoglycaemic activities. In the present study, we determined the concentrations of different vitamins (vitamin A, C and E and fatty acids in root, stem, leaves, fruit pulp and seed of Zizyphus lotus L. (Desf. and assessed the effects of their aqueous extracts on antioxidant status and human T-cell proliferation. Methods Aqueous filtrates from different parts, i.e, root, leaf, stem, fruit pulp and seed, of Zizyphus lotus L. (Desf. were prepared. Vitamin C levels were determined by precipitating with 10% trichloroacetic acid and vitamin A and E were assessed by HPLC. Lipid composition of these extracts was determined by gas-liquid chromatography. Anti-oxidant capacity was evaluated by using anti-radical resistance kit [Kit Radicaux Libres (KRL@; Kirial International SA, Couternon, France]. T-cell blastogenesis was assessed by the incorporation of 3H-thymidine. IL-2 gene expression was evaluated by RT-qPCR. Results Our results show that fruit pulp contained higher vitamin A and C contents than other parts of the plant. Furthermore, the fruit pulp was the richest source of linoleic acid (18:2n-6, a precursor of n-6 fatty acids. Fruit seeds possessed higher vitamin C levels than leaves, roots and stem. The leaves were the richest source of vitamin E and linolenic acid (18:3n-3, a precursor of n-3 fatty acids. The antioxidant capacity of the different extracts, measured by KRL@ test, was as follows: pulp Zizyphus lotus L. (Desf. exerted immunosuppressive effects. Conclusion Seed extracts exerted the most potent immunosuppressive effects on T cell proliferation and IL-2 mRNA expression. The results of the present study are discussed in the light of their use to modulate the immune-mediated diseases.

  10. First report on susceptibility of wild Aedes aegypti (Diptera: Culicidae) using Carapa guianensis (Meliaceae) and Copaifera sp. (Leguminosae).

    Science.gov (United States)

    Prophiro, Josiane S; da Silva, Mario Antonio Navarro; Kanis, Luiz A; da Rocha, Louyse Caroline B P; Duque-Luna, Jonny E; da Silva, Onilda S

    2012-02-01

    Oils of Carapa guianensis and Copaifera spp. are well known in the Amazonian region as natural insect repellent, and studies have reported their efficiency as larvicide against some laboratory mosquito species. However, in wild populations of mosquitoes, these oils have not yet been evaluated. Thus, the objective of this study was to investigate their efficiency as larvicide in wild populations of Aedes aegypti with a history of exposure to organophosphate. The susceptibility of larvae was determined under three different temperatures, 15°C, 20°C, and 30°C. For each test, 1,000 larvae were used (late third instar and early fourth instar-four replicates of 25 larvae per concentration). Statistical tests were used to identify significant differences. The results demonstrated that as the laboratory A. aegypti, the wild populations of A. aegypti were also susceptible to C. guianensis and Copaifera sp. oils. The lethal concentrations for Copaifera sp. ranged from LC(50) 47 to LC(90) 91 (milligrams per liter), and for C. guianensis, they were LC(50) 136 to LC(90) 551 (milligrams per liter). In relation to different temperature, the effectiveness of the oils on larvae mortality was directly related to the increase of temperature, and better results were observed for temperature at 25°C. The results presented here indicate the potential larvicidal activity of C. guianensis and species of Copaifera, in populations of A. aegypti from the wild. Therefore, the results presented here are very important since such populations are primarily responsible for transmitting the dengue virus in the environment.

  11. Simultaneous determination of shikimic acid, salicylic acid and jasmonic acid in wild and transgenic Nicotiana langsdorffii plants exposed to abiotic stresses.

    Science.gov (United States)

    Scalabrin, Elisa; Radaelli, Marta; Capodaglio, Gabriele

    2016-06-01

    The presence and relative concentration of phytohormones may be regarded as a good indicator of an organism's physiological state. The integration of the rolC gene from Agrobacterium rhizogenes and of the rat glucocorticoid receptor (gr) in Nicotiana langsdorffii Weinmann plants has shown to determine various physiological and metabolic effects. The analysis of wild and transgenic N. langsdorffii plants, exposed to different abiotic stresses (high temperature, water deficit, and high chromium concentrations) was conducted, in order to investigate the metabolic effects of the inserted genes in response to the applied stresses. The development of a new analytical procedure was necessary, in order to assure the simultaneous determination of analytes and to obtain an adequately low limit of quantification. For the first time, a sensitive HPLC-HRMS quantitative method for the simultaneous determination of salicylic acid, jasmonic acid and shikimic acid was developed and validated. The method was applied to 80 plant samples, permitting the evaluation of plant stress responses and highlighting some metabolic mechanisms. Salicylic, jasmonic and shikimic acids proved to be suitable for the comprehension of plant stress responses. Chemical and heat stresses showed to induce the highest changes in plant hormonal status, differently affecting plant response. The potential of each genetic modification toward the applied stresses was marked and particularly the resistance of the gr modified plants was evidenced. This work provides new information in the study of N. langsdorffii and transgenic organisms, which could be useful for the further application of these transgenes.

  12. Estudio del crecimiento de Prioria copaifera (Caesalpinaceae mediante técnicas dendrocronológicas

    Directory of Open Access Journals (Sweden)

    Jorge Andrés Giraldo Jiménez

    2011-12-01

    Full Text Available El cativo (Prioria copaifera G. forma bosques dominados por la especie llamados cativales. Durante más de 70 años el cativo ha sido la base principal de la industria maderera en el Darién colombiano, siendo, por su alta productividad y dominancia uno de los bosques tropicales más fáciles de ordenar sosteniblemente. El propósito de esta investigación es modelar el crecimiento del diámetro y el volumen del cativo en función de la edad así como las tasas instantáneas, medias y relativas, empleando anillos de crecimiento. La anualidad de los anillos se demostró usando el efecto de las bombas nucleares y mediante cofechado. Con base en los anillos de crecimiento radiales se modelo el crecimiento del diámetro y del volumen. Esta especie alcanza 40cm de diámetro en 90 años y presenta crecimiento medio de 0.31cm/año. El lapso vital de la especie es de aproximadamente 614 años. El incremento corriente anual máximo del volumen a los 90 años es 0.033m3/año, e iguala al incremento medio a los 145 años con 0.018m3/año. La tasa media de crecimiento absoluta es 0.021m3/año. Los resultados aquí obtenidos sirven como base técnica para el manejo sostenible de los cativales.A growth study of Prioria copaifera (Caesalpinaceae using dendrochronological techniques. The Cativo (Prioria copaifera forms very homogeneous forests called cativales in the flooded plains of some rivers from Costa Rica to Colombia. For over 70 years Cativo has been the main base of the timber industry in the Colombian Darien area. Because of high productivity and high-dominance of Cativo trees, they represent one of the most prone tropical forests for sustainable forest management. The objective of this research is to model diameter and timber volume growth and growth rates (absolute, mean and relative of Cativo as a function of age, using tree ring data derived from dendrochronologycal techniques. We evaluated the annual nature of the tree rings by radiocarbon

  13. Partial chemical composition and antimicrobial activity of Daucus crinitus Desf. extracts

    Energy Technology Data Exchange (ETDEWEB)

    Dib, M. A.; Bendahou, M.; Bendiabdellah, A.; Djabou, N.; Allali, H.; Tabti, B.; Paolini, J.; Costa, J.

    2010-07-01

    The chemical composition of fatty acids and the unsaponifiable fraction of the roots, leaves and stems from Daucus crinitus Desf. were, determined using gas chromatography (GC) and gas chromatography-Mass Spectrometry (GC-MS). The fatty acid fractions of different organs (leaves, stems and roots) were characterized by lauric acid (17.9, 17.5 and 18.1 % respectively) and other long chain fatty acids (until C22). Qualitative and quantitative differences were reported between the unsaponifiable fractions of different organs from D. crinitus. The unsaponifiable fractions of the leaves, roots and stem showed high amounts of aliphatic components (83.4%, 87.2% and 91.4%, respectively). The monoterpen, diterpen and sesquiterpen components were only present in small percentages. The antimicrobial properties of the D. critinus extracts were tested on four different microorganisms. These extracts were found to be active against Bacillus cereus, Staphylococcus aureus, Escherichia coli and Candida albicans. (Author) 35 refs.

  14. In vivo evaluation of the mutagenic potential and phytochemical characterization of oleoresin from Copaifera duckei Dwyer

    Directory of Open Access Journals (Sweden)

    Edson Luis Maistro

    2005-12-01

    Full Text Available We characterized the chemical constituents of Copaifera duckei oleoresin and used dermal application to Wistar rats to evaluated its possible mutagenic and cytotoxic activities on peripheral blood reticulocytes and bone marrow cells. Chemical characterization of the oleoresin revealed the presence of sesquiterpene hydrocarbons, an unidentified neutral diterpene and diterpene acids. To evaluate mutagenicity evaluation the rats were treated with 10, 25 and 50% of the LD50 dose of the oleoresin for three consecutive days and peripheral blood collected after 0, 24, 48 and 72 h for micronucleus analysis. The rats were humanly sacrificed 24 hours after the last treatment and chromosome preparations made using standard techniques. At the three concentrations and the three time intervals tested we found that there were no statistically significant differences in either the mean number of micronucleated reticulocytes (MNRETs or the number of chromosomal aberrations as to the negative control. However, at 25 and 50% of the LD50 dose of the oleoresin there was a significant decrease in the mitotic index (MI as compared to the negative control. Under our experimental conditions, C. duckei V11 oleoresin produced no mutagenic effects on bone marrow cells or in peripheral reticulocytes as assessed by chromosome aberrations and the micronucleus test respectively, but showed cytotoxic activity at high doses.

  15. EVALUATION OF CELL CYCLE OF Aspergillus nidulans EXPOSED TO THE EXTRACT OF Copaifera officinalis L PLANT

    Directory of Open Access Journals (Sweden)

    Simone Jurema Ruggeri Chiuchetta, Uériton Dias de Oliveira e Josy Fraccaro de Marins

    2006-12-01

    Full Text Available The oil extracted from the Copaifera officinalis L plant has been used in popular medicine to the treatment of several diseases, like cancer. In eukaryotic cells, the process of cellular proliferation follows a standard cycle, named cellular cycle. The transformation of a normal cell in a malignant one requires several steps, in which genes that control normal cellular division or cellular death are modified. Aspergillus nidulans fungus is an excellent system for the study of the cellular differentiation. Its asexual cycle results in the formation of conidia, which are disposed like chains, constituting a structure named conidiophore. This structure consists in an aerial hifae, multinucleate vesicle and uninucleate cells. Current research evaluated the capacity of the C. officinalis L plant extract in promoting alterations in the cellular cycle of A. nidulans diploid strains, by observing macroscopic and microscopic alterations in cellular growth of this fungus. Results shown that no macroscopic alterations were observed in cellular growth of strains exposed to the extract, however, microscopic alterations of conidiophore have been observed in the different extract concentrations analyzed. In this way, the study of the action of C. officinalis L plant extract becomes important considering the fact that this substance is capable to promote alterations in cellular cycle of eukaryotic cells.

  16. In vitro efficacy of Coriandrum sativum, Lippia sidoides and Copaifera reticulata against Leishmania chagasi.

    Science.gov (United States)

    Rondon, Fernanda Cristina Macedo; Bevilaqua, Claudia Maria Leal; Accioly, Marina Parissi; de Morais, Selene Maia; de Andrade-Júnior, Heitor Franco; de Carvalho, Camila Aparecida; Lima, Josemar Coelho; Magalhães, Hilton César Rodrigues

    2012-01-01

    The increased incidence of visceral leishmaniasis (VL) in Brazil is due to a lack of effective disease control measures. In addition to that, no effective treatment exists for canine VL in response to synthetic drugs. Thus, the objective of this study was to evaluate the effect of the essential oils of Coriandrum sativum and Lippia sidoides, and oleoresin from Copaifera reticulata, on Leishmania chagasi promastigotes and amastigotes. We also examined the toxicity of these treatments on the murine monocyte cell line RAW 264.7. To determine the IC50 a MTT test (3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) was performed on promastigotes, and an in situ ELISA assay was conducted on amastigotes. Here, we demonstrate that oleoresin from C. reticulata was effective against both promastigotes (IC50 of 7.88 µg.mL-1) and amastigotes (IC50 of 0.52 µg.mL-1), and neither of the two treatments differed significantly (p > 0.05) from pentamidine (IC50 of 2.149 µg.mL-1) and amphotericin B (IC50 of 9.754 µg.mL-1). Of the three plant oils tested, only oleoresin showed no toxicity toward monocyte, with 78.45% viability after treatment. Inhibition of promastigote and amastigote growth and the lack of cytotoxicity by C. reticulata demonstrate that oleoresin may be a viable option for analyzing the in vivo therapeutic effects of leishmanicidal plants.

  17. Effects of submergence in water on seed germination and vigor of the Copaifera lucens (Fabaceae) seedlings

    Institute of Scientific and Technical Information of China (English)

    Daniela Baldez Vidal; Isis Leite Andrade; Marcelo Schramm Mielke

    2014-01-01

    We analyzed the tolerance of Copaifera lucens seeds to sub-mersion in water to assess the use of this species for direct seeding in riparian forest restoration programs. Seeds were submerged in water for 2, 4, 8, 16 and 32 days or not submerged (control = 0 days of submer-gence). For the control and at the end of each period of submersion, germination and seedling vigor tests were carried out. For germination tests, seeds were sown in plastic pots containing sand and kept in labora-tory conditions. The percentage of seed germination, the germination rate and the average germination time were analyzed. For seedlings, total biomass, leaf area, leaf mass per area and leaf area ratio were analyzed. Submersion time drastically affected the dissolved oxygen content and seed germination. Between 4 and 8 days of submersion there was a de-crease from 83.8% to 15.6% in the germination percentage. No seed germination occurred after 16 days of submersion. Although there was a significant decrease in the percentage of seed germination between 4 and 8 days of submersion, seedling vigor was not affected. Seeds of this species were partially tolerant to submersion in water, suggesting that C. lucens is a promising species for direct seeding in riparian forest restora-tion projects.

  18. Factors affecting variation in the vase life response of waxflower cultivars (Myrtaceae: Chamelaucium Desf. and Verticordia spp. Desf. tested under various vase solutions

    Directory of Open Access Journals (Sweden)

    Dung Cao D.

    2016-06-01

    Full Text Available The effects of genotype and vase solutions on the vase lives of waxflower cultivars were studied. The vase life of 16 cultivars derived from different genetic backgrounds showed a variation. The vase life of Chamelaucium uncinatum cultivars held in deionised water was generally the shortest, with four cultivars averaging 9.5 and 8.9 days for flowers and leaves while the vase lives of C. uncinatum × megalopetalum hybrids were on average 16.0 and 25.0 days for flowers and leaves, respectively. The hybrid ‘Southern Stars’ with C. uncinatum × Verticordia plumosa as parents had the longest flower vase life of 24.9 days, although another Verticordia × Chamelaucium had a 9.5-day flower vase life and other hybrids of the cultivars of C. uncinatum and Verticordia grandis Desf. (‘WX73’, C. sp. Gingin Marchantii (‘WX97’ and C. floriferum (‘Lady Stephanie’ as a parent had intermediate to short vase lives of 11.4 to 15.5 days. The cultivars responded most to 8-hydroxyquniline sulphate (HQS + sucrose or HQS + sucrose + silver thiosulphate (STS, being 1.5- to 1.6-folds higher than in deionized water. The cultivars showed a varied response to a vase solution of sucrose + HQS + STS, with which C. uncinatum vase life increased 1.9-fold compared to 1.7-fold for C. megalopetalum. Waxflowers were found to be susceptible to water stress, causing flowers to close and shortening vase life. On average for the 80 cultivar-vase solution combinations tested, flower vase life ended when the stems reached 75.5 ± 5% fresh weigh. Longer vase life cultivars had a greater ability of maintaining a water balance at or above 75% for longer.

  19. Estudio del crecimiento de Prioria copaifera (Caesalpinaceae mediante técnicas dendrocronológicas

    Directory of Open Access Journals (Sweden)

    Jorge Andrés Giraldo Jiménez

    2011-12-01

    Full Text Available El cativo (Prioria copaifera G. forma bosques dominados por la especie llamados cativales. Durante más de 70 años el cativo ha sido la base principal de la industria maderera en el Darién colombiano, siendo, por su alta productividad y dominancia uno de los bosques tropicales más fáciles de ordenar sosteniblemente. El propósito de esta investigación es modelar el crecimiento del diámetro y el volumen del cativo en función de la edad así como las tasas instantáneas, medias y relativas, empleando anillos de crecimiento. La anualidad de los anillos se demostró usando el efecto de las bombas nucleares y mediante cofechado. Con base en los anillos de crecimiento radiales se modelo el crecimiento del diámetro y del volumen. Esta especie alcanza 40cm de diámetro en 90 años y presenta crecimiento medio de 0.31cm/año. El lapso vital de la especie es de aproximadamente 614 años. El incremento corriente anual máximo del volumen a los 90 años es 0.033m3/año, e iguala al incremento medio a los 145 años con 0.018m3/año. La tasa media de crecimiento absoluta es 0.021m3/año. Los resultados aquí obtenidos sirven como base técnica para el manejo sostenible de los cativales.

  20. Partial chemical composition and antimicrobial activity of Daucus crinitus Desf. extracts

    Directory of Open Access Journals (Sweden)

    Paolini, J.

    2010-09-01

    Full Text Available The chemical composition of fatty acids and the unsaponifiable fraction of the roots, leaves and stems from Daucus crinitus Desf. were, determined using gas chromatography (GC and gas chromatography-Mass Spectrometry (GC-MS. The fatty acid fractions of different organs (leaves, stems and roots were characterized by lauric acid (17.9, 17.5 and 18.1 % respectively and other long chain fatty acids (until C22. Qualitative and quantitative differences were reported between the unsaponifiable fractions of different organs from D. crinitus. The unsaponifiable fractions of the leaves, roots and stem showed high amounts of aliphatic components (83.4%, 87.2% and 91.4%, respectively. The monoterpen, diterpen and sesquiterpen components were only present in small percentages. The antimicrobial properties of the D. critinus extracts were tested on four different microorganisms. These extracts were found to be active against Bacillus cereus, Staphylococcus aureus, Escherichia coli and Candida albicans.La composición química de los ácidos grasos y la fracción insaponificable de raíces, hojas, y tallos de Daucus crinitus Desf. fueron establecidas utilizando cromatografía de gases (GC y cromatografía de gases-espectrometría de masas (GC-MS. La fracción de ácidos grasos de los diferentes órganos (hojas, tallos y raíces se caracterizó por el ácido láurico (17.9, 17.5 y 18.1% respectivamente y otros ácidos grasos de cadena larga (hasta C22. Diferencias cualitativas y cuantitativas se registraron entre las fracciones insaponificable de los diferentes órganos de D. crinitus. De hecho, las fracciones insaponificable de la raíz, de la hoja y del tallo mostraron cantidades altas de componentes alifáticos (83.4%, 87.2% y 91.4%, respectivamente. Los componentes monoterpénicos, diterpénicos y sesquiterpénicos solo estuvieron presentes en un pequeño porcentaje. Las propiedades antimicrobianas de los extractos de D. critinus fueron ensayadas en cuatro

  1. Multivariate optimization of a headspace solid-phase microextraction method followed by gas chromatography with mass spectrometry for the determination of terpenes in Nicotiana langsdorffii.

    Science.gov (United States)

    Ardini, Francisco; Carro, Marina Di; Abelmoschi, Maria Luisa; Grotti, Marco; Magi, Emanuele

    2014-07-01

    A simple and sensitive procedure based on headspace solid-phase microextraction and gas chromatography with mass spectrometry was developed for the determination of five terpenes (α-pinene, limonene, linalool, α-terpineol, and geraniol) in the leaves of Nicotiana langsdorffii. The microextraction conditions (extraction temperature, equilibration time, and extraction time) were optimized by means of a Doehlert design. The experimental design showed that, for α-pinene and limonene, a low temperature and a long extraction time were needed for optimal extraction, while linalool, α-terpineol, and geraniol required a high temperature and a long extraction time. The chosen compromise conditions were temperature 60°C, equilibration time 15 min and extraction time 50 min. The main analytical figures of the optimized method were evaluated; LODs ranged from 0.07 ng/g (α-pinene) to 8.0 ng/g (geraniol), while intraday and interday repeatability were in the range 10-17% and 9-13%, respectively. Finally, the procedure was applied to in vitro wild-type and transgenic specimens of N. langsdorffii subjected to abiotic stresses (chemical and heat stress). With the exception of geraniol (75-374 ng/g), low concentration levels of terpenes were measured (ng/g level or lower); some interesting variations in terpene concentration induced by abiotic stress were observed.

  2. Some Ecological Properties of Pistacia atlantica Desf.in Khojir National Park of Iran

    Institute of Scientific and Technical Information of China (English)

    Kambiz Taheri Abkenar; Ali Salehi; Jalal Bagheri; Hooman Ravanbakhsh

    2013-01-01

    Khojir national park is one of the oldest protected areas in Iran that is greatly considerable in terms of biodiversity and ecological values.Pistachio (Pistacia atlantica Desf.) communities,which create some woodland in this park,are unique because they grow tolerantly in a dry land,in the vicinity of Tehran capital.This research is about some ecological properties of Pistachio woodlands.The dominant community of the area is Pistacia-Amygdalus lycioides.The density of Pistacia is 86 per hectare.The density of Pistachio trees was greater in the higher elevation than in the lower one.In addition,the collar diameter and the height of trees in the higher class were less.The average density of Pistacia in plots in northern slopes was significantly more than southern slopes (at 5% level),but the average collar diameter of them were more on the southern aspect.The distribution,diameter and height of pistachio trees were not significantly related to the percentage of slope.Among the soil variables,the saturated water percentage (SP),N (total nitrogen) and texture of soil were effective factors which played significant role in ordination of plots containing pistachio.Considering the important role of P.atlantica forest stands in soil and water conservation in Iran,we should attach more importance to their protection and conservation,as well as activities such as road and dam construction,and garden establishment in such unique ecosystems.

  3. Antioxidant activity and phenolic profile of different organs of Pistacia atlantica Desf. subsp. atlantica from Algeria.

    Science.gov (United States)

    Toul, Fethi; Belyagoubi-Benhammou, Nabila; Zitouni, Amel; Atik-Bekkara, Fawzia

    2017-03-01

    The present study evaluated the antioxidant activity of 21 extracts prepared from seven parts of Pistacia atlantica Desf. subsp. atlantica. (Fruits, leaves, buds, stems, roots, internal and external trunk barks) collected from Tlemcen, Algeria. Total phenolic, flavonoid and flavonol contents were determined and the antioxidant properties were measured using different assays: 2,2-diphenyl-1-picrylhydrazyl radical (DPPH), ferric antioxidant reducing power and β-carotene bleaching assay. BHA (butylated hydroxyanisole) was used for comparison purposes. The results showed that the extracts of leaves and buds had the highest phenolic contents with 255.789 ± 4.733 and 233.946 ± 6.205 mg GAE/g DM, respectively. For the antioxidant activity, values of EC50 concentrations ranged from 0.059 to 5.712 mg/mL for DPPH, 0.015 to 3.141 mg/mL for reducing power and 0.068 to 5.021 mg/mL for β-carotene method, for all studied extracts. Analysing the phenolic composition, 10 components were identified in different parts of the plant.

  4. Chemical Variability and Biological Activities of Essential Oils of Micromeria inodora (Desf.) Benth. from Algeria.

    Science.gov (United States)

    Benomari, Fatima Zahra; Djabou, Nassim; Medbouhi, Ali; Khadir, Abdelmounaim; Bendahou, Mourad; Selles, Chaouki; Desjobert, Jean-Marie; Costa, Jean; Muselli, Alain

    2016-11-01

    The chemical composition of the essential oils isolated from the aerial parts of Micromeria inodora (Desf.) Benth. collected in 24 Algerian localities was investigated from the first time using GC-FID, GC/MS and (13) C-NMR. Altogether, 83 components which accounted for 94.7% of the total oil composition were identified. The main compounds were trans-sesquisabinene hydrate (1; 20.9%), α-terpinyl acetate (2; 19.8%), globulol (3; 4.9%), caryophyllene oxide (4; 4.3%), β-bisabolol (5; 2.9%) and trans-7-epi-sesquisabinene hydrate (6; 2.6%). Comparison with the literature highlighted the originality of the Algerian M. inodora oil and indicated that 1 might be used as taxonomical marker. The study of the chemical variability allowed the discrimination of two main clusters confirming that there is a relation between the essential-oil compositions and the soil nature of the harvest locations. Biological activity of M. inodora essential oil was assessed against fourteen species of microorganisms involved in nosocomial infections using paper disc diffusion and dilution agar assays. The in vitro study demonstrated a good activity against Gram-positive strains such as Staphylococcus aureus, Bacillus cereus, Bacillus subtilis, and Enterococcus faecalis, and moderate activity against Candida albicans. These results might be useful for the future commercial valorization of M. inodora essential oil as a promising source of natural products with potential against various nosocomial community and toxinic infections.

  5. Italian alder (Alnus cordata/Loisel./Desf. - new species for Allochtonous dendroflora of Serbia

    Directory of Open Access Journals (Sweden)

    Bobinac Martin

    2015-01-01

    Full Text Available The foreign tree species, Alnus cordata/Loisel./Desf. (Italian alder, (Betulaceae/Loisel./Duby, not previously recorded in the dendroflora of Serbia, is described in this paper. Italian alder trees in an experimental plot in the area of Erdevik, aged 11 years, show good vitality and fast growth, and bear fruits since their 10th year. Tree heights are in range from 10.4 to 16.2 m, and diameters at the breast height range from14.6 to 34.9 cm. The morphological properties of leaves, fruiting organs (“cones” and male catkins are in concordance with the values in literature sources, although they show great variability. Since the time of plantation establishment, the absolute minimum air temperature in the nearby meteorological station of Sremska Mitrovica was -26.50C, so it can be assumed that the species is frost hardy. On the basis of the researched properties of Italian alder, it can be concluded that this species can be cultivated in Serbia as an ornamental in urban areas and as a fast growing species in forest plantations for biomass production. [Projekat Ministarstva nauke Republike Srbije, br. 31041: Šumski zasadi u funkciji povećanja pošumljenosti Srbije

  6. Assessment of heritability and genetic advance for agronomic traits in durum wheat (Triticum durum Desf.

    Directory of Open Access Journals (Sweden)

    HASSAN NIKKHAHKOUCHAKSARAEI

    2017-09-01

    Full Text Available In order to evaluate the amount of heritability for desirable agronomic characteristics and the genetic progress associated with grain yield of durum wheat (Triticum durum Desf., a split plot experiment was carried out with four replications during three cropping seasons (2009-2012. Three sowing dates (as environmental factor and six durum wheat varieties (as genotypic factor were considered as main and sub factors respectively. Analysis of variance showed interaction effects between genotypes and environments in days to ripening, plant height, spike length, number of grains per spike, number of spikes per unit area, grain mass and grain yield. The grain yield showed the highest positive correlation with number of grains per spike also grain mass (91 % and 85 %, respectively. A relatively high heritability of these traits (82.1 % and 82.2 %, respectively suggests that their genetic improvement is possible. The maximum genetic gain (19.6 % was observed for grain mass, indicating this trait should be a very important indicator for durum wheat breeders, although the climatic effects should not be ignored.

  7. Efecto cicatrizante del aceite de Copaifera officinalis (copaiba, en pacientes con úlcera péptica

    Directory of Open Access Journals (Sweden)

    Jorge Arroyo-Acevedo

    2011-04-01

    Full Text Available Objetivos: Determinar la eficacia cicatrizante del aceite de copaiba obtenido de la corteza de Copaifera officinalis, comparado con omeprazol 20 mg, en pacientes con diagnóstico definitivo de úlcera péptica. Diseño: Estudio experimental, clínico comparativo, de fase II, aleatorio, doble ciego, grupo paralelo. Institución: Instituto de Investigaciones Clínicas, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Participantes: Pacientes con diagnóstico definitivo de úlcera péptica. Intervenciones: El diagnóstico fue tanto por exploración física como complementaria, siendo la endoscopia la técnica de elección, con evaluación pre y postratamiento con aceite de copaiba, formulada en cápsulas de 80 mg y 120 mg. El ensayo clínico incluyó 60 pacientes que voluntariamente ingresaron al programa de estudio, previa firma del consentimiento informado aprobado por el Comité institucional de Ética en Investigación. Los pacientes fueron distribuidos aleatoriamente en tres grupos, de 20 casos cada uno, según orden de llegada; los dos primeros grupos recibieron cápsulas de aceite de copaiba, en dosis de 80 y 120 mg, respectivamente; y un tercer grupo recibió omeprazol 20 mg. Los tratamientos fueron administrados en ayunas, una vez por la mañana, 30 minutos antes de la ingesta del primer alimento. Los datos fueron evaluados mediante técnicas multivariadas, considerando estadísticamente significativo p<0,05. Se tuvo en cuenta el consentimiento informado aprobado por el Comité de Bioética en Investigación del Centro Asistencial. Principales medidas de resultados: Porcentaje de cicatrización. Resultados: Se logró 65% y 75% de cicatrización de la úlcera péptica con aceite de copaiba, respectivamente, contra 100% en el grupo de omeprazol, sin efectos adversos significativos; dos presentaron náuseas y tres epigastralgia. Conclusiones: Los pacientes con úlcera péptica y con tratamiento de las c

  8. Óleo de copaíba (Copaifera sp.: histórico, extração, aplicações industriais e propriedades medicinais Copaiba oil (Copaifera sp.: history, extraction, industrial applications and medicinal properties

    Directory of Open Access Journals (Sweden)

    F.A. Pieri

    2009-01-01

    Full Text Available Este trabalho teve como objetivo realizar uma revisão de literatura sobre o gênero Copaifera sp. Foi realizado levantamento bibliográfico do período de 1792 a 2008 utilizando bibliotecas da Universidade de São Paulo, Universidade Federal de Viçosa, Universidade Federal de Alfenas e Universidade José do Rosário Vellano, pesquisas às bases de dados SCOPUS e PubMed, além de ferramentas de busca na web. Utilizou-se para a busca palavras chave como "Copaiba", "Copaifera", "Copaíba oil" "Óleo de Copaíba". Como resultado desta pesquisa obteve-se a seleção de 63 referências incluindo livros, artigos, cadernos técnicos, resumos de congressos, teses, dissertações e patentes. Estes dados apontaram o óleo de copaíba como um exsudato produzido pelas copaibeiras como defesa contra seus predadores, que vem sendo utilizado pela medicina tradicional popular e silvícola há mais de 500 anos. Ele é extraído destas árvores através de perfurações realizadas em seus troncos. Além das inúmeras aplicações do óleo em cosméticos e outras indústrias, ainda há uma série de indicações para seu uso na medicina. Existem hoje descritas algumas dezenas de propriedades medicinais diferentes, que vem sendo em alguns casos comprovadas cientificamente, como atividade antimicrobiana, antiinflamatória, anti-neoplásica entre outras. Estudos recentes têm demonstrado também grande potencial de uso do óleo de copaíba na odontologia, na composição de cimentos endodônticos e na prevenção e combate da doença periodontal. As informações contidas neste trabalho demonstram uma grande variabilidade de aplicações do óleo de copaíba. Entretanto uma quantidade limitada de pesquisas sobre suas propriedades medicinais tem sido realizada, apresentando assim a necessidade de novas pesquisas sobre estas.The aim of this study was to conduct a literature review concerning the genus Copaifera sp. The survey involved the period from 1792 to 2008 and

  9. Cytotoxic Activity and Composition of Petroleum Ether Extract from Magydaris tomentosa (Desf. W. D. J. Koch (Apiaceae

    Directory of Open Access Journals (Sweden)

    Giuseppina Autore

    2015-01-01

    Full Text Available The petroleum ether extract of Magydaris tomentosa flowers (Desf. W. D. J. Koch has been analyzed by GC-MS. It is mainly constituted by furanocoumarins such as xanthotoxin, xanthotoxol, isopimpinellin, and bergaptene. Other coumarins such as 7-methoxy-8-(2-formyl-2-methylpropyl coumarin and osthole also occurred. The antiproliferative activity of Magydaris tomentosa flower extract has been evaluated in vitro on murine monocye/macrophages (J774A.1, human melanoma (A375 and human breast cancer (MCF-7 tumor cell lines, showing a major activity against the latter.

  10. Caracterização florística, fitossociológica e regeneração natural do sub-bosque da reserva genética florestal Tamanduá, D.F.

    Directory of Open Access Journals (Sweden)

    José Silva Alves da

    2004-01-01

    Full Text Available This work was carried out in the Tamanduá Forest Genetic Reserve, in Brasília, Brazil, comprised mainly by gallery forest. It aimed to assess the floristic composition, natural regeneration and the spatial distribution of the main woody species in the undergrowth. The species were Cariniana estrellensis (Raddi O. Kuntze, Apuleia leiocarpa (Vogel J. F.Macbr., Copaifera langsdorffii Desf., Anadenanthera macrocarpa (Benth. Brenan, Virola sebifera Aubl., Hymenaea courbaril var. stilbocarpa (Hayne Lee & Lang., Aspidosperma discolor A. St. Hil., Astronium fraxinifolium Schott and Schefflera morototoni B. Maguire, Stey. & Frodin, all considered priorities for in situ conservation. Five transects were used, each 10 meters wide, laid perpendicular to the main watercourse in the studied area. A total of 21,482 regenerants per hectare were found in 69 species, 53 genera and 39 families. The families which had the largest numbers of species as seedlings were, in descending order, Leguminosae (Fabaceae, Rubiaceae, Sapindaceae and Meliaceae. Surveying of young individuals, the dominant families with higher importance value (IV were as follows: Meliaceae (32.78 %, Rubiaceae (13.92 %, Burseraceae (13.76 %, Rutaceae (8.54 % and Hippocrateaceae (6.36 %, accounting for 75.36 % of total IV and 78.56 % of cover. All target species studied were represented among regenerants, especially Cariniana estrelllensis. However, only Copaifera langsdorffii and Virola sebifera were found among young individuals. A mixture quotient of 1:3 was calculated and indicates a forest rich in species, when compared to other similar forest formations. The spatial distribution of the regenerant species showed different patterns.

  11. Drought-induced changes in photosynthetic apparatus and antioxidant components of wheat (Triticum durum Desf.) varieties.

    Science.gov (United States)

    Huseynova, Irada M; Rustamova, Samira M; Suleymanov, Saftar Y; Aliyeva, Durna R; Mammadov, Alamdar Ch; Aliyev, Jalal A

    2016-12-01

    Water deficit is a key factor influencing the yield and quality of crops. In the present study, the photosynthetic responses by means of chlorophyll fluorescence of chloroplasts, thylakoid membrane proteins, and antioxidant components were analyzed in wheat (Triticum durum Desf.) plants differing in their tolerance to drought. Two durum winter wheat varieties, Barakatli 95 (drought tolerant) and Garagylchyg 2 (drought sensitive) were grown under field well-watered and drought conditions. It was found that contents of the PS I core (CPI) with Mr of 123 kD and apoprotein P700 with Mr of 63 kD were relatively higher in Barakatli 95 variety under drought stress compared with the control plants. Synthesis of α- and β-subunits of CF1 ATP-synthase complex with Mr of 55 and 53.5 kD also slightly increased in the tolerant Barakatli 95 and decreased in the drought sensitive variety Garagylchyg 2. A decrease in the intensity of 30 kD band and a significant increase were found in the content of the 25-16 kD region in Garagylchyg 2 variety. The synthesis of 60 kD and content of low molecular mass polypeptides (21.5 and 12 kD) were increased in the tolerant genotype Barakatli 95. The intensity of peaks at 687, 695, and 742 nm considerably increases in the fluorescence spectra (77 K) of chloroplasts isolated from the sensitive variety Garagylchyg 2, and there is a stimulation of the ratio of fluorescence band intensity F687/F740. At the same time, higher level of glycine betaine was found in the drought tolerant variety compared with the control one throughout the different periods of growth.

  12. High-throughput SNP discovery and genotyping in durum wheat (Triticum durum Desf.).

    Science.gov (United States)

    Trebbi, Daniele; Maccaferri, Marco; de Heer, Peter; Sørensen, Anker; Giuliani, Silvia; Salvi, Silvio; Sanguineti, Maria Corinna; Massi, Andrea; van der Vossen, Edwin Andries Gerard; Tuberosa, Roberto

    2011-08-01

    We describe the application of complexity reduction of polymorphic sequences (CRoPS(®)) technology for the discovery of SNP markers in tetraploid durum wheat (Triticum durum Desf.). A next-generation sequencing experiment was carried out on reduced representation libraries obtained from four durum cultivars. SNP validation and minor allele frequency (MAF) estimate were carried out on a panel of 12 cultivars, and the feasibility of genotyping these SNPs in segregating populations was tested using the Illumina Golden Gate (GG) technology. A total of 2,659 SNPs were identified on 1,206 consensus sequences. Among the 768 SNPs that were chosen irrespective of their genomic repetitiveness level and assayed on the Illumina BeadExpress genotyping system, 275 (35.8%) SNPs matched the expected genotypes observed in the SNP discovery phase. MAF data indicated that the overall SNP informativeness was high: a total of 196 (71.3%) SNPs had MAF >0.2, of which 76 (27.6%) showed MAF >0.4. Of these SNPs, 157 were mapped in one of two mapping populations (Meridiano × Claudio and Colosseo × Lloyd) and integrated into a common genetic map. Despite the relatively low genotyping efficiency of the GG assay, the validated CRoPS-derived SNPs showed valuable features for genomics and breeding applications such as a uniform distribution across the wheat genome, a prevailing single-locus codominant nature and a high polymorphism. Here, we report a new set of 275 highly robust genome-wide Triticum SNPs that are readily available for breeding purposes.

  13. Quantification of vitamin D3 and its hydroxylated metabolites in waxy leaf nightshade (Solanum glaucophyllum Desf.), tomato (Solanum lycopersicum L.) and bell pepper (Capsicum annuum L.)

    DEFF Research Database (Denmark)

    Jäpelt, Rie Bak; Silvestro, Daniele; Smedsgaard, Jørn

    2013-01-01

    Changes in vitamin D3 and its metabolites were investigated following UVB- and heat-treatment in the leaves of Solanum glaucophyllum Desf., Solanum lycopersicum L. and Capsicum annuum L. The analytical method used was a sensitive and selective liquid chromatography electrospray ionisation tandem...

  14. Atividade alelopática de extratos brutos de três espécies de Copaifera (Leguminosae-Caesalpinioideae Allelophatic activity of crude extracts from three species of Copaifera (Leguminosae - Caesalpinioidedae

    Directory of Open Access Journals (Sweden)

    A.P.S Souza Filho

    2010-12-01

    Full Text Available Nos últimos anos, atenção especial foi dada aos compostos químicos envolvidos na interação entre plantas, especialmente quando se sabe das possibilidades do seu uso em estratégia de manejo de plantas daninhas. A Amazônia, pela sua megabiodiversidade e abundância de espécies vegetais, pode oferecer excelente oportunidade para a descoberta de inovadoras moléculas químicas com potencial de uso na atividade agrícola. Dessa forma, neste trabalho analisou-se, comparativamente, a atividade potencialmente alelopática de três espécies de Copaifera, caracterizando-se as variações na intensidade dos efeitos alelopáticos em função da espécie doadora, da fração da planta e da polaridade dos constituintes químicos. Extratos hexânico e etanólico, preparados a 1,0% a partir de folhas, galhos e cascas de Copaifera duckei, C. martii e C. reticulata, foram testados sobre a germinação de sementes e o desenvolvimento da raiz das plantas daninhas malícia (Mimosa pudica e mata-pasto (Senna obtusifolia. Observaram-se variações nas intensidades dos efeitos em função das variáveis estudadas. O extrato etanólico de folhas e o de galhos de C. martii e C. reticulata apresentaram alto potencial para inibir a germinação de sementes, sobretudo da espécie malícia. A espécie C. duckei evidenciou baixo potencial alelopático inibitório na germinação das duas espécies receptoras. Cascas, folhas e galhos de C. duckei apresentaram potencial inibitório mais expressivo sobre o desenvolvimento da raiz, com destaque para as folhas. Compostos químicos apolares e polares estão envolvidos na atividade alelopática da espécie C. duckei, com ênfase maior para os compostos apolares. Diferentemente, para C. martii e C. reticulata, compostos polares estão envolvidos, preferencialmente, na atividade inibitória evidenciada por essas espécies, notadamente aqueles localizados nas folhas e cascas. Comparativamente, a tendência observada foi de

  15. Characterization of volatile compounds of Daucus crinitus Desf. Headspace Solid Phase Microextraction as alternative technique to Hydrodistillation

    Directory of Open Access Journals (Sweden)

    Tabti Boufeldja

    2010-09-01

    Full Text Available Abstract Background Traditionally, the essential oil of aromatic herbs is obtained using hydrodistillation (HD. Because the emitted volatile fraction plays a fundamental role in a plant's life, various novel techniques have been developed for its extraction from plants. Among these, headspace solid phase microextraction (HS-SPME can be used to obtain a rapid fingerprint of a plant's headspace. Daucus crinitus Desf. is a wild plant that grows along the west coast of Algeria. Only a single study has dealt with the chemical composition of the aerial part oils of Algerian D. crinitus, in which isochavicol isobutyrate (39.0%, octyl acetate (12.3%, and β-caryophyllene (5.4% were identified. Using GC-RI and GC-MS analysis, the essential oils and the volatiles extracted from separated organs of D. crinitus Desf. were studied using HS-SPME. Results GC-RI and GC-MS analysis identified 72 and 79 components in oils extracted using HD and in the volatile fractions extracted using SPME, respectively. Two types of essential oils were produced by the plant: the root oils had aliphatic compounds as the main component (87.0%-90.1%, and the aerial part oils had phenylpropanoids as the main component (43.1%-88.6%. HS-SPME analysis showed a more precise distribution of compounds in the organs studied: oxygenated aliphatic compounds were well represented in the roots (44.3%-84.0%, hydrocarbon aliphatic compounds were in the leaves and stems (22.2%-87.9%, and phenylpropanoids were in the flowers and umbels (47.9%-64.2%. Moreover, HS-SPME allowed the occurrence of isochavicol (29.6 - 34.7% as main component in D. crinitus leaves, but it was not detected in the oils, probably because of its solubility in water. Conclusions This study demonstrates that HD and HS-SPME modes could be complimentary extraction techniques in order to obtain the complete characterization of plant volatiles.

  16. Allelopathic evaluation of ethanol extracts of Copaifera sabulicola on the initial development of Lactuca sativa, Lycopersicum esculentum, and Zea mays

    Directory of Open Access Journals (Sweden)

    Manoel Viana Linhares Neto

    2014-09-01

    Full Text Available This paper aimed to evaluate the allelopathic potential of ethanol extracts from stem and leaves of Copaifera sabulicola on seed germination and seedling growth of Lactuca sativa and Lycopersicum esculentum, as well as to evaluate the allelopathic effect of these extracts on seedling germination and growth of Zea mays, through bioassays under laboratory conditions. The extracts were tested at the concentrations 0, 250, 500, and 1,000 mg.L-1. We evaluated the germination percentage, germination average speed, germination speed index, and seedling average length. All parameters underwent variance analysis, and the mean values were compared by means of Scott-nott test p 0.05. We found out that, in L. sativa, the extract from stem promoted signicant stimuli on germination percentage and root growth, while the extract from leaves only stimulated root growth. In L. esculentum, the extract from stem promoted signicant stimulus on hypocotyl and root growth, in turn, the extract from leaves stimulated only root growth. In Z. mays, both extracts signicantly inhibited germination. Therefore, we found out the allelopathic potential of ethanol extracts of C. sabulicola on L. sativa and L. esculentum, as well as inhibitory allelopathic effect on Z. mays.

  17. Allelopathic evaluation of ethanol extracts of Copaifera sabulicola on the initial development of Lactuca sativa, Lycopersicum esculentum, and Zea mays

    Directory of Open Access Journals (Sweden)

    Manoel Viana Linhares Neto

    2014-05-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2014v27n3p23 This paper aimed to evaluate the allelopathic potential of ethanol extracts from stem and leaves of Copaifera sabulicola on seed germination and seedling growth of Lactuca sativa and Lycopersicum esculentum, as well as to evaluate the allelopathic effect of these extracts on seedling germination and growth of Zea mays, through bioassays under laboratory conditions. The extracts were tested at the concentrations 0, 250, 500, and 1,000 mg.L-1. We evaluated the germination percentage, germination average speed, germination speed index, and seedling average length. All parameters underwent variance analysis, and the mean values were compared by means of Scott-Knott test (p ≤ 0.05. We found out that, in L. sativa, the extract from stem promoted significant stimuli on germination percentage and root growth, while the extract from leaves only stimulated root growth. In L. esculentum, the extract from stem promoted significant stimulus on hypocotyl and root growth, in turn, the extract from leaves stimulated only root growth. In Z. mays, both extracts significantly inhibited germination. Therefore, we found out the allelopathic potential of ethanol extracts of C. sabulicola on L. sativa and L. esculentum, as well as inhibitory allelopathic effect on Z. mays.

  18. Composition chimique et activité antimicrobienne des huiles essentielles de Thymus algeriensis Boiss. & Reut. et Thymus ciliatus (Desf. Benth. du Maroc

    Directory of Open Access Journals (Sweden)

    Chaouch, A.

    2010-01-01

    Full Text Available Chemical composition and antimicrobial activity of the Thymus algeriensis Boiss. & Reut. and Thymus ciliatus (Desf. Benth. essential oils of Morocco. The aim of this work is to study the chemical composition and antibacterial and antifungal activity of essential oils of Thymus algeriensis Boiss. & Reut. and Thymus ciliatus (Desf. Benth. of Morocco against seven microorganisms. The essential oils of T. ciliatus are characterized by the presence of thymol (44.2%, β-E-ocimene (25.8% and α-terpinene (12.3% as principal chemical components. The essential oils of T. algeriensis are formed mainly by camphor (27.7% and α-pinene (20.5%. The oil of T. ciliatus showed a strong antibacterial and antifungal activity against all tested bacteria and fungi. This bioactivity is due mainly to the richness of this essential oil in thymol known for its effectiveness against the microbial agents.

  19. Characterization of volatile compounds of Daucus crinitus Desf. Headspace Solid Phase Microextraction as alternative technique to Hydrodistillation

    OpenAIRE

    Tabti Boufeldja; Allali Houcine; Desjobert Jean-Marie; Djabou Nassim; El Amine Dib Mohammed; Muselli Alain; Costa Jean

    2010-01-01

    Background : Traditionally, the essential oil of aromatic herbs is obtained using hydrodistillation (HD). Because the emitted volatile fraction plays a fundamental role in a plant's life, various novel techniques have been developed for its extraction from plants. Among these, headspace solid phase microextraction (HS-SPME) can be used to obtain a rapid fingerprint of a plant's headspace. Daucus crinitus Desf. is a wild plant that grows along the west coast of Algeria. Only a single study ...

  20. Accumulation of human EGF in nectar of transformed plants of Nicotiana langsdorffii x N. sanderae and transfer to honey by bees.

    Science.gov (United States)

    Helsper, J P F G; Ruyter-Spira, C P; Kwakman, P H S; Bleeker, W K; Keizer, L C P; Bade, J B; Te Velde, A A; Zaat, S A J; Verbeek, M; Creemers-Molenaar, J

    2011-09-01

    Honey has been used successfully in wound healing for thousands of years. The peptide hormone human epidermal growth factor (hEGF) is also known to have a beneficial effect in various wound healing processes via mechanisms that differ from those for honey. In this study, we show that hEGF can be incorporated into honey via nectar. Plants of Nicotiana langsdorffii x N. sanderae were transformed with the gene for hEGF, equipped with a nectary-targeted promoter and a signal sequence for secretion to nectar. These plants accumulated hEGF in the nectar. The maximum hEGF concentration recorded with ELISA in these plants is 2.5 ng·ml⁻¹. There is a significant linear relationship (Pplants did not allow production of honey from their nectar, we used feeding solutions, spiked with synthetic hEGF, to study transfer of this peptide into honey through bee activity. Transfer of hEGF from a feeding solution to honey by bees occurred with retention of the hEGF concentration and the capacity to induce hEGF-receptor phosphorylation. These observations indicate that plants can function as a production platform for honey containing biologically active peptides, which may enhance wound healing and other biological processes.

  1. Copaiba oil-resin (Copaifera reticulata Ducke) modulates the inflammation in a model of injury to rats' tongues.

    Science.gov (United States)

    Teixeira, Francisco Bruno; de Brito Silva, Raíra; Lameira, Osmar Alves; Webber, Liana Preto; D'Almeida Couto, Roberta Souza; Martins, Manoela Domingues; Lima, Rafael Rodrigues

    2017-06-14

    The regeneration of integrity and tissue homeostasis after injury is a fundamental property and involves complex biological processes fully dynamic and interconnected. Although there are medications prescribed to accelerate the process of wound healing by reducing the exaggerated inflammatory response, comes the need to search for different compounds of Amazonian biodiversity that can contribute to the acceleration of the healing process. Among these products, the copaiba oil-resin is one of the most prominent feature in this scenario, as they have been reported its medicinal properties. Aiming to evaluate the anti-inflammatory and healing effect of copaiba oil-resin (Copaifera reticulata Ducke) in transfixing injury of rats' tongues first proceeded up the copaiba oil-resin oral toxicity test in 5 male mice to stipulate the therapeutic dose which was established at 200 mg/kg/day. Then it was induced transfixing injury in a total of 15 Wistar rats. The animals were randomly divided into three groups based on the treatment: control group, dexamethasone group and copaiba oil-resin group. After 7 days of treatment, histological slides stained with hematoxylin and eosin was prepared. Immunohistochemistry for CD68 (macrophage marker) was performed and analyzed by the cell counter Image J. The acute toxicity test showed that the oil-resin copal has low toxicity. Furthermore, copaiba oil-resin therapy modulates the inflammatory response by decreasing the chronic inflammatory infiltrate, edema and specifically the number of macrophages. The results indicate the potential of the Amazon region and showed up relevant because therapy with this extract modulates the inflammatory process.

  2. In vitro antimicrobial activity of solution blow spun poly(lactic acid)/polyvinylpyrrolidone nanofibers loaded with Copaiba (Copaifera sp.) oil

    Energy Technology Data Exchange (ETDEWEB)

    Bonan, Roberta F. [Departamento de Engenharia de Materiais (DEMAT), Universidade Federal da Paraíba (UFPB), Cidade Universitária, 58.051-900 João Pessoa, PB (Brazil); Centro de Ciências da Saúde (CCS), Universidade Federal da Paraíba (UFPB), Cidade Universitária, 58.051-900 João Pessoa, PB (Brazil); Bonan, Paulo R.F.; Batista, André U.D.; Sampaio, Fábio C.; Albuquerque, Allan J.R. [Centro de Ciências da Saúde (CCS), Universidade Federal da Paraíba (UFPB), Cidade Universitária, 58.051-900 João Pessoa, PB (Brazil); Moraes, Maria C.B. [Embrapa Recursos Genéticos e Biotecnologia, Parque Estação Ecológica, W/5 Norte (Final) Cenargen (Laboratório de Semioquímicos) ASA NORTE, 70770900 Brasília, DF (Brazil); Mattoso, Luiz H.C. [Laboratório Nacional de Nanotecnologia para o Agronegócio (LNNA), Embrapa Instrumentação Agropecuária (CNPDIA), Rua XV de Novembro, 1452, Centro, 13.560, 970 São Carlos, SP (Brazil); Glenn, Gregory M. [United States Department of Agriculture (USDA), Western Regional Research Center (WRRC), Bioproduct Chemistry and Engineering - BCE, Albany, CA 94710 (United States); and others

    2015-03-01

    In this study poly(lactic acid) (PLA) and polyvinylpyrrolidone (PVP) micro- and nanofiber mats loaded with Copaiba (Copaifera sp.) oil were produced by solution blow spinning (SBS). The Copaiba (Copaifera sp.) oil was characterized by gas chromatography (GC). Neat PLA and four PLA/PVP blends containing 20% (wt.%) oil were spun and characterized by scanning electron microscopy (SEM) and by studying the surface contact angle, in vitro release rate, and antimicrobial activity. All compositions evaluated were able to produce continuous and smooth fibers by SBS. The addition of PVP increased fiber diameter, and decreased the surface contact angle. GC analysis demonstrated that the main component of the Copaiba oil was β-caryophyllene, a known antimicrobial agent. In vitro release tests of Copaiba oil volatiles demonstrated a higher release rate in fibers containing PVP. Fiber mats made from blends containing higher amounts of PVP had greater antimicrobial action against Staphylococcus aureus. The results confirm the potential of the fiber mats for use in controlled drug release and could lead to promising applications in the biomedical field. - Highlights: • An efficient method for production of antimicrobial nanofiber mats using solution blow spinning was reported. • Nanofiber mats containing Copaiba oil were efficient against Staphylococcus aureus. • Nanofiber composition changed morphological properties and antimicrobial action.

  3. Comparison of Several Models for Calculating Ozone Stomatal Fluxes on a Mediterranean Wheat Cultivar (Triticum durum Desf. cv. Camacho

    Directory of Open Access Journals (Sweden)

    Daniel de la Torre Llorente

    2007-01-01

    Full Text Available Ozone stomatal fluxes were modeled for a 3-year period following different approaches for a commercial variety of durum wheat (Triticum durum Desf. cv. Camacho at the phenological stage of anthesis. All models performed in the same range, although not all of them afforded equally significant results. Nevertheless, all of them suggest that stomatal conductance would account for the main percentage of ozone deposition fluxes. A new modeling approach was tested, based on a 3-D architectural model of the wheat canopy, and fairly accurate results were obtained. Plant species-specific measurements, as well as measurements of stomatal conductance and environmental parameters, were required. The method proposed for calculating ozone stomatal fluxes (FO3_3-D from experimental gs data and modeling them as a function of certain environmental parameters in conjunction with the use of the YPLANT model seems to be adequate, providing realistic estimates of the canopy FO3_3-D, integrating and not neglecting the contribution of the lower leaves with respect to the flag leaf, although a further development of this model is needed.

  4. Atividade antimicrobiana do óleo de copaíba (Copaifera langsdorffii) e seus constituintes, e avaliação do bioproduto obtido na inibição de bactérias da placa dental de cães

    OpenAIRE

    Pieri, Fábio Alessandro

    2012-01-01

    A doença periodontal acomete cerca de 85% dos cães com mais de quatro anos de idade e é causada pelo acúmulo de placa bacteriana na superfície dos dentes e pela reação do organismo a esta. O óleo de copaíba apresentou, anteriormente, resultados positivos na inibição da placa dental em cães, entretanto faltam estudos que identifiquem esta atividade sobre as bactérias oriundas de cães in vitro e que estabeleçam as substâncias ativas do óleo. O objetivo deste trabalho foi verificar a atividade...

  5. Efecto citoprotector y antisecretor del aceite de Copaifera officinalis en lesiones gástricas inducidas en ratas

    Directory of Open Access Journals (Sweden)

    Jorge Arroyo

    2009-06-01

    Full Text Available Objetivos: Demostrar el efecto gastroprotector del aceite de Copaifera officinalis usando indometacina y ligadura de píloro en ratas. Diseño: Estudio preclínico. Lugar: Facultades de Medicina, de Farmacia y Bioquímica. Universidad Nacional Mayor de San Marcos, Lima, Perú. Material biológico: Ratas y aceite de copaiba. Intervenciones: Se colectó el aceite de copaiba en Ucayali, Pucallpa. La citoproteccción fue evaluada con indometacina, considerando un grupo control normal, indometacina, grupos de aceite de copaiba y omeprazol. Las lesiones de la mucosa gástrica fueron calificadas como las compatibles con necrosis local (tejido no viable, hiperemia, enrojecimiento presente y hemorragia, empleando la escala de puntaje observacional; y la úlcera, según la escala de Macallister modificado. El ensayo de antisecreción fue realizado por el modelo de ligadura del píloro, en el que 24 ratas albinas fueron divididas al azar en 3 grupos; un control, otro de aceite de copaiba 40mg/kg y un tercero de omeprazol 10 mg/kg. Después de 4 horas de ligazón, fueron sacrificados, extrayéndose los estómagos; con mucho cuidado se midió el volumen y se determinó el pH de la secreción gástrica, por potenciometría. Se realizó evaluación histopatológica según Devi. Principales medidas de resultados: Lesiones ulcerosas. Resultados: Los resultados indicaron 100% de efecto citoprotector con el aceite de copaiba y de 97,8% para el omeprazol (p<0,0001, ratificado con los hallazgos histopatológicos; la disminución del volumen de secreción fue 79,4% para omeprazol y 42,8% para el aceite de copaiba (p<0,001, con incremento del pH. Conclusiones: En condiciones experimentales, el aceite de copaiba fue efectivo como agente gastroprotector en ratas con inducción de úlcera gástrica.

  6. Etude des effets du déficit hydrique sur le processus de germination chez le blé dur (Triticum durum Desf.)

    OpenAIRE

    ZEMOUR, Kamel

    2014-01-01

    Le déficit hydrique constitue le principal stress abiotique limitant considérablement la productivité du blé dur (Triticum durum Desf.) en Algérie. La phase de germination constitue l’une des étapes les plus sensibles aux effets engendrés par ce stress. Le travail présenté traite les impacts du déficit hydrique exprimés par l’abaissement du potentiel hydrique du milieu sur la réalisation des principales phases de la germination. Quatre niveaux de potentiel osmotique provoqués par des solution...

  7. Interspecific variation in vitamin E levels and the extent of lipid peroxidation in pioneer and non-pioneer species used in tropical forest restoration.

    Science.gov (United States)

    Contin, Daniele R; Munné-Bosch, Sergi

    2016-09-01

    Reforestation projects have gained interest over recent years due to the loss of biodiversity in tropical regions as a result of large deforestation by anthropogenic actions. However, better knowledge on the tolerance of plant species to environmental stresses is needed for reforestation success. Here, we evaluated the photoprotective and antioxidant capacity, in terms of vitamin E accumulation, of five pioneer (Platypodium elegans Vogel, Schinus terebinthifolius Raddi, Lafoensia pacari A. St.-Hil, Cecropia pachystachya Trécul. and Aegiphila sellowiana Cham.) and five non-pioneer (Myracrodruon urundeuva Allemão, Cedrela fissilis Vell., Genipa americana L., Copaifera langsdorffii Desf. and Hymenaea courbaril L.) species, in relation to the extent of lipid peroxidation in leaves. Furthermore, we examined differences between sun and shade leaves on vitamin E accumulation and the extent of lipid peroxidation. Pioneer plants showed on average 33% higher malondialdehyde levels, an indicator of lipid peroxidation, than non-pioneer species, but no significant differences in vitamin E contents. In contrast, a marked interspecific variation was observed in the levels of α-tocopherol and its precursor, γ-tocopherol. Natural variation revealed interesting relationships between vitamin E levels and the extent of lipid peroxidation in leaves. The pioneer species, P. elegans, did not accumulate α-tocopherol and displayed the highest levels of malondialdehyde. Sun and shade leaves accumulated vitamin E levels to a similar extent, except for the pioneer L. pacari and the non-pioneer C. langsdorffii, the former accumulating more α-tocopherol in sun leaves and the latter in shade leaves. We conclude that interspecific variation is higher than both leaf type and successional-group variation in terms of vitamin E accumulation and the extent of lipid peroxidation, and that vitamin E levels, particularly those of α-tocopherol, negatively correlate with the extent of lipid

  8. Hepatoprotective effect of flavonol glycosides rich fraction from Egyptian Vicia calcarata Desf. against CCl4-induced liver damage in rats.

    Science.gov (United States)

    Singab, Abdel Nasser B; Youssef, Diaa T A; Noaman, Eman; Kotb, Saeed

    2005-07-01

    The hepatoprotective activity of flavonol glycosides rich fraction (F-2), prepared from 70% alcohol extract of the aerial parts of V. calcarata Desf., was evaluated in a rat model with a liver injury induced by daily oral administration of CCl4 (100 mg/kg, b.w) for four weeks. Treatment of the animals with F-2 using a dose of (25 mg/kg, b.w) during the induction of hepatic damage by CCl4 significantly reduced the indices of liver injuries. The hepatoprotective effects of F-2 significantly reduced the elevated levels of the following serum enzymes: alanine aminotransferase (ALT), aspartate aminotransferase (AST), alkaline phosphatase (ALP) and lactate dehydrogenase (LDH). The antioxidant activity of F-2 markedly ameliorated the antioxidant parameters including glutathione (GSH) content, glutathione peroxidase (GSH-Px), superoxide dismutase (SOD), plasma catalase (CAT) and packed erythrocytes glucose-6-phosphate dehydrogenase (G6PDH) to be comparable with normal control levels. In addition, it normalized liver malondialdehyde (MDA) levels and creatinine concentration. Chromatographic purification of F-2 resulted in the isolation of two flavonol glycosides that rarely occur in the plant kingdom, identified as quercetin-3, 5-di-O-beta-D-diglucoside (5) and kaempferol-3, 5-di-O-beta-D-diglucoside (4) in addition to the three known compounds identified as quercetin-3-O-alpha-L-rhamnosyl- (1-->6)-beta-D-glucoside [rutin, 3], quercetin-3-O-beta-D-glucoside [isoquercitrin, 2] and kaempferol-3-O-beta-D-glucoside [astragalin, 1]. These compounds were identified based on interpretation of their physical, chemical, and spectral data. Moreover, the spectrophotometric estimation of the flavonoids content revealed that the aerial parts of the plant contain an appreciable amount of flavonoids (0.89%) calculated as rutin. The data obtained from this study revealed that the flavonol glycosides of F-2 protect the rat liver from hepatic damage induced by CCl4 through inhibition of

  9. Effects of Different Growing Media and Polyethylene Pot Size on Some Morphological Seedling Characteristics of Caper (Capparis ovata Desf.

    Directory of Open Access Journals (Sweden)

    Zafer Ölmez

    2011-04-01

    Full Text Available Caper (Capparis ovata Desf. can be used to prevent destruction of the forests by providing an economical source to inhabitant and in order to combate against the soil erosion. The growing healthy and the best quality seedlings is an important issue in plantation and erosion control studies. Seedling morphology is an important indicator to obtain high quality seedlings. The mixtures of different materials such as road slope soil + sand (1:1, forest soil + creek sand + manure (3:1:1, forest soil and road slope soil, and polyethylene pots of different dimensions such as 12-22 cm, 15-23 cm, 19-30 cm were used as seedling growing media and pot in this study. The study was carried out to determine the effects of different seedling growing media and polyethylene pots on some morphological seedling characteristics such as shoot length (SL, root collar diameter (RCD, fresh shoot weight (FSW, dry shoot weight (DSW, fresh root weight (FRW and dry root weigh (DRW. The experimental design was a randomized complete block with three replications (30 polyethylene pots for each replication for every treatment under open field conditions. According to statistical analyses (α=0.05, the best SL (167.3 mm and RCD (2.01 mm were obtained from the growing media of forest soil + creek sand + manure (3:1:1 with polyethylene pots had 19-30 cm dimension. The best FRW (3.45 g, FSW (1.28 g, DRW (1.36 g and DSW (0.43 g were determined from forest soil + creek sand + manure (3:1:1 growing media with the pots had 15-23 cm dimension.

  10. Antistaphylococcal activity of DX-619, a new des-F(6)-quinolone, compared to those of other agents.

    Science.gov (United States)

    Bogdanovich, Tatiana; Esel, Duygu; Kelly, Linda M; Bozdogan, Bülent; Credito, Kim; Lin, Gengrong; Smith, Kathy; Ednie, Lois M; Hoellman, Dianne B; Appelbaum, Peter C

    2005-08-01

    The in vitro activity of DX-619, a new des-F(6)-quinolone, was tested against staphylococci and compared to those of other antimicrobials. DX-619 had the lowest MIC ranges/MIC(50)s/MIC(90)s (microg/ml) against 131 Staphylococcus aureus strains (32), and ciprofloxacin (>32/>32). Raised quinolone MICs were associated with mutations in GyrA (S84L) and single or double mutations in GrlA (S80F or Y; E84K, G, or V) in all S. aureus strains tested. A recent vancomycin-resistant S. aureus (VRSA) strain (Hershey) was resistant to available quinolones and was inhibited by DX-619 at 0.25 microg/ml and sitafloxacin at 1.0 microg/ml. Vancomycin (except VRSA), linezolid, ranbezolid, tigecycline, and quinupristin-dalfopristin were active against all strains, and teicoplanin was active against S. aureus but less active against coagulase-negative staphylococci. DX-619 produced resistant mutants with MICs of 1 to >32 microg/ml after 32 microg/ml for ciprofloxacin, sitafloxacin, moxifloxacin, and gatifloxacin. DX-619 and sitafloxacin were also more active than other tested drugs against selected mutants and had the lowest mutation frequencies in single-step resistance selection. DX-619 and sitafloxacin were bactericidal against six quinolone-resistant (including the VRSA) and seven quinolone-susceptible strains tested, whereas gatifloxacin, moxifloxacin, levofloxacin, and ciprofloxacin were bactericidal against 11, 10, 7, and 5 strains at 4x MIC after 24 h, respectively. DX-619 was also bactericidal against one other VRSA strain, five vancomycin-intermediate S. aureus strains, and four vancomycin-intermediate coagulase-negative staphylococci. Linezolid, ranbezolid, and tigecycline were bacteriostatic and quinupristin-dalfopristin, teicoplanin, and vancomycin were bactericidal against two, eight, and nine strains, and daptomycin and oritavancin were rapidly bactericidal against all strains, including the VRSA. DX-619 has potent in vitro activity against staphylococci, including

  11. Chemical Composition and Biological Activity of Extracts from Salvia bicolor Desf. Growing in Egypt

    Directory of Open Access Journals (Sweden)

    Taghreed A. Ibrahim

    2012-09-01

    Full Text Available A petroleum ether extract (PEE and a methanolic extract (ME of aerial parts of Salvia bicolor Desf were prepared, and their chemical compositions and antioxidant, anti-inflammatory, analgesic and antimicrobial activities were evaluated. GC/MS analysis of the PEE revealed the presence of 20 compounds in the unsaponifiable matter, among which β-sitosterol and β-amyrin (constituting 24.75% and 15.62%, respectively were the main constituents, and 21 fatty acids, with linolenic acid and erucic acid being the main fatty acid constituents (21.65% and 16.65%, respectively. HPLC/MS analysis of the methanol extract for individual phenolics revealed the presence of 14 phenolic acids; protocatchuic acid was predominant (75.22 mg/g dry sample, followed by p-coumaric, gallic and synergic acids (70.27, 68.26 and 54.38 mg/g dry weight, respectively. HPLC/MS analysis of flavonoid contents revealed the presence of five flavonoid compounds, among which luteolin 7-O-glucoside and apigenin were the major constituents (120.25 mg/100g dry sample and 88.48 mg/100g dry sample, respectively. The antioxidant activities of both extracts were evaluated using the 2,2-diphenyl-1-picrylhydrazyl (DPPH assay, and the total antioxidant capacity was determined in terms of GAE (gallic acid equivalents. Anti-inflammatory and analgesic activities were evaluated using the rat paw edema and hot plate testing methods, respectively. The antimicrobial activities of both the PEE and ME were examined by means of the disk-diffusion method. The Salvia bicolor PEE and ME exhibited significant antioxidant, anti-inflammatory, and analgesic properties, in addition to antimicrobial effects against the selected microorganisms.

  12. In vitro efficacy of Coriandrum sativum, Lippia sidoides and Copaifera reticulata against Leishmania chagasi Eficácia in vitro de Coriandrum sativum, Lippia sidoides e Copaifera reticulata sobre Leishmania chagasi

    Directory of Open Access Journals (Sweden)

    Fernanda Cristina Macedo Rondon

    2012-09-01

    Full Text Available The increased incidence of visceral leishmaniasis (VL in Brazil is due to a lack of effective disease control measures. In addition to that, no effective treatment exists for canine VL in response to synthetic drugs. Thus, the objective of this study was to evaluate the effect of the essential oils of Coriandrum sativum and Lippia sidoides, and oleoresin from Copaifera reticulata, on Leishmania chagasi promastigotes and amastigotes. We also examined the toxicity of these treatments on the murine monocyte cell line RAW 264.7. To determine the IC50 a MTT test (3-(4,5-Dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide was performed on promastigotes, and an in situ ELISA assay was conducted on amastigotes. Here, we demonstrate that oleoresin from C. reticulata was effective against both promastigotes (IC50 of 7.88 µg.mL-1 and amastigotes (IC50 of 0.52 µg.mL-1, and neither of the two treatments differed significantly (p > 0.05 from pentamidine (IC50 of 2.149 µg.mL-1 and amphotericin B (IC50 of 9.754 µg.mL-1. Of the three plant oils tested, only oleoresin showed no toxicity toward monocyte, with 78.45% viability after treatment. Inhibition of promastigote and amastigote growth and the lack of cytotoxicity by C. reticulata demonstrate that oleoresin may be a viable option for analyzing the in vivo therapeutic effects of leishmanicidal plantsO aumento na incidência da Leishmaníase Visceral (LV no Brasil deve-se à ineficácia das medidas de controle da doença. Além disso, não há tratamento efetivo para LV canina com drogas sintéticas. Assim, o objetivo deste trabalho foi avaliar o efeito dos óleos essenciais de Coriandrum sativum e de Lippia sidoides e do óleo-resina de Copaiferareticulata sobre promastigotas e amastigotas de Leishmania chagasi e analisar o grau de toxicidade sobre células monocíticas murinas RAW 264.7. Para determinar a CI50 sobre promastigotas foi usado teste MTT (brometo de 3-[4,5-dimetil-tiazol-2-il]-2

  13. Potencial de produção de óleo-resina de copaíba (Copaifera spp de populações naturais do sudoeste da Amazônia Oil resin production potential of Copaifera spp natural populations in the Southwestern Brazilian Amazon

    Directory of Open Access Journals (Sweden)

    Onofra Cleuza Rigamonte-Azevedo

    2006-08-01

    Full Text Available O potencial de produção de óleo-resina extraído de Copaífera spp foi avaliado em duas populações naturais do sudoeste da Amazônia brasileira (municípios de Tarauacá e Xapuri, nos anos de 2000 e 2001. Foram selecionadas 388 árvores adultas de copaíbas das duas populações, sendo identificados em cada árvore o diâmetro à altura do peito (DAP, a produção de óleo-resina, a posição da árvore no relevo local (baixio ou terra firme e a tipologia florestal local (floresta aberta ou densa, além do nome regional da copaíba, com base em características morfológicas da casca: Copaifera reticulata: copaíba-branca, vermelha, amarela e preta e Copaifera paupera: mari-mari. Os resultados indicam que a copaíba mari-mari possui maior proporção de indivíduos produtivos (80%, enquanto os demais morfotipos apresentaram apenas de 22 a 40% de seus indivíduos produtivos. Com relação a todas as árvores amostradas, a produção de óleo-resina variou de 0 a 18 L árvore-1, com a copaíba mari-mari tendo a maior produção média (1,33 L árvore-1, porém sem diferir significativamente dos demais morfotipos. Após excluir da análise as árvores não produtivas, a copaíba-preta apresentou significativamente a maior produção média de óleo-resina (2,92 L árvore-1. A tipologia florestal, posição da árvore no relevo e o DAP não se mostraram relacionados a produção de óleo-resina.The potential for production of oil resin extracted from Copaifera spp natural populations was studied in two natural populations (municipalities of Tarauacá and Xapuri in the Southwestern Brazilian Amazon, in 2000 and 2001. Three hundred and eighty-eight adult trees were selected within these two populations. DBH, oil production, topographic position, regional common names (based on bark appearance; White, Red, Yellow, Black for Copaifera reticulata, and Mari-Mari for C. paupera and forest typology were recorded for each individual. Copaiba Mari

  14. Larvicidal activity of oil-resin fractions from the Brazilian medicinal plant Copaifera reticulata Ducke (Leguminosae-Caesalpinoideae against Aedes aegypti (Diptera, Culicidae Atividade larvicida das frações do óleo-resina da planta medicinal brasileira Copaifera reticulata Ducke (Leguminosae-Caesalpinoideae sobre o Aedes aegypti (Diptera, Culicidae

    Directory of Open Access Journals (Sweden)

    Heloísa Helena Garcia da Silva

    2007-06-01

    Full Text Available Oil-resin fractions from Copaifera reticulata Ducke (Leguminosae-Caesalpinoideae were evaluated for larvicidal activity on third larval instars of Aedes aegypti, in searching for alternative control methods for this mosquito. The bioactive fractions were chemically monitored by thin-layer chromatography, ¹H and 13C nuclear magnetic resonance and mass spectrometry. Bioassays were performed using five repetitions, at a temperature of 28 ± 1°C, relative humidity of 80 ± 5% and light and dark cycles of 12h. Mortality was indicated by darkening of the cephalic capsule after 24h of exposure of the larvae to the solutions. The most active fractions were CRM1-4 (sesquiterpenes and CRM5-7 (labdane diterpenes, which showed LC50 values of 0.2 and 0.8ppm, respectively.A atividade larvicida das frações do óleo-resina de Copaifera reticulata Ducke (Leguminosae-Caesalpinoideae foi avaliada em larvas de 3º estádio de Aedes aegypti, na busca de alternativas para o controle desse mosquito. As frações bioativas foram monitoradas quimicamente através de cromatografia de camada delgada, analisada por ressonância magnética nuclear de hidrogênio (¹H e 13C e espectrometria de massas. Os bioensaios foram realizados à temperatura de 28±1°C, 80±5% de umidade relativa e fotofase de 12h, com cinco repetições. A mortalidade foi determinada através do escurecimento da cápsula cefálica, após 24h de exposição das larvas às soluções. As frações mais ativas foram CRM1-4 (sesquiterpenos e CRM5-7 (diterpeno labdano, que mostraram os valores de CL50 de 0,2 e 0,8ppm, respectivamente.

  15. Quantification of vitamin D3 and its hydroxylated metabolites in waxy leaf nightshade (Solanum glaucophyllum Desf.), tomato (Solanum lycopersicum L.) and bell pepper (Capsicum annuum L.).

    Science.gov (United States)

    Jäpelt, Rie Bak; Silvestro, Daniele; Smedsgaard, Jørn; Jensen, Poul Erik; Jakobsen, Jette

    2013-06-01

    Changes in vitamin D(3) and its metabolites were investigated following UVB- and heat-treatment in the leaves of Solanum glaucophyllum Desf., Solanum lycopersicum L. and Capsicum annuum L. The analytical method used was a sensitive and selective liquid chromatography electrospray ionisation tandem mass spectrometry (LC-ESI-MS/MS) method including Diels-Alder derivatisation. Vitamin D(3) and 25-hydroxy vitamin D(3) were found in the leaves of all plants after UVB-treatment. S. glaucophyllum had the highest content, 200 ng vitamin D(3)/g dry weight and 31 ng 25-hydroxy vitamin D(3)/g dry weight, and was the only plant that also contained 1,25 dihydroxy vitamin D(3) in both free (32 ng/g dry weight) and glycosylated form (17 ng/g dry weight).

  16. Avaliação do efeito do óleo-resina de copaíba (Copaifera sp. na proliferação celular in vitro

    Directory of Open Access Journals (Sweden)

    Edson de Oliveira Nogueira

    2012-08-01

    Full Text Available Copaiba oleoresin is extracted from the trunk of Copaifera sp genus trees and used for treating wounds in several regions of Brazil. Its antimicrobial and anti-inflammatory effects have been proved, however there are no reports of activity on cell growth. Proliferation of MDBK (Madin Darby Bovine Kidney cells was evaluated under the influence of different concentrations of Copaiba oleoresin. Control groups consisted of cells in medium without addition of oleoresin (M group and cells in the medium with application of the solvent Tween 80 at dilution 10-3 (TM group. Decimal dilutions of 10-1 to 10-3 were shown to be toxic and, therefore, the proliferation studies were conducted from dilution 10-4 to 10-7. Cell growth was faster in all groups that received the Copaiba oleoresin dilutions in the first 24 hours, specially the 10-5 dilution group, which proliferation rate was 5,47 higher than that of M group. It was concluded that Copaiba oleoresin stimulates cell multiplication, which may be one mechanism of its positive effect on wound healing, in association with those previously known.

  17. Mass propagation and genetic improvement of forest trees for biomass production by tissue culture. [Sapium sebiferum, Leucaena leucocephala, and Copaifera multijuga

    Energy Technology Data Exchange (ETDEWEB)

    Venketeswaran, S.; Gandhi, V.

    1982-01-01

    Wood derived from forest trees can serve as a major alternative source of energy and fuel because of the current energy shortage and increase in price of oil and natural gas. Normally, trees take several years to grow and produce seeds. But, in recent years, test tube trees have been produced in large numbers (as many as 3000 plants per year) from one seedling using tissue culture by treating a few cells of a tree with specific chemical substances. Tissue culture is a promising technique for mass production of large numbers of superior trees, derived through genetic improvement, and may prove widely applicable to trees which show promise as energy sources. Three selected tree genera, viz. Sapium sebiferum (Chinese Tallow), Leucaena leucocephala (giant ipil-ipil, a tropical legume) and Copaifera multijuga (Copaiba tree from Brazil) have been studied because of their potential usefulness for biomass production. Regeneration of vegetatively produced plantlets has been achieved from embyros and callus cells grown in specific culture medium for two of the above genera. High yields of protoplasts have been obtained isolated from cells of different plant parts and grown as calli. Conditions which will enable callus derived from protoplasts to undergo in vitro regeneration, plantlet formation and eventually growth into plants are being investigated. 16 figures.

  18. Curva Preliminar de Crecimiento del Cativo (prioria copaifera en Bosque Virgen Empleando el Método de los Tiempos de Paso

    Directory of Open Access Journals (Sweden)

    Del Valle Arango Jorge Ignacio

    1979-12-01

    Full Text Available La información relativa al crecimiento de las especies nativas es muy escasa y, más aún, si se trata de especies del bosque climax. Entre estas últimas quizás no existe en el país ninguna información que dé una idea, así sea aproximada de la curva de crecimiento de una especie de importancia forestal. Esto es lamentable puesto que tales curvas son el fundamento para la correcta determinación de turnos con una base racional, siendo por lo tanto fundamentales para la ordenación. Posiblemente la causa de tal deficiencia radica en desconocimiento de técnicas que suministran en corto plazo de la información necesaria para su elaboración. El informe que a continuación se presenta tratará de ejemplarizar la construcción de una curva de crecimiento para la importante especie nativa Prioria copaifera empleando la técnica de cálculo de tiempos de paso.

  19. Avaliação da toxicidade aguda e potencial neurotóxico do óleo-resina de copaíba (Copaifera reticulata Ducke, Fabaceae Assessment of the neurotoxic potential and acute toxicity of copaiba

    Directory of Open Access Journals (Sweden)

    Camile Giaretta Sachetti

    2009-12-01

    Full Text Available O óleo-resina de copaíba obtido do gênero Copaifera L., Fabaceae, é largamente utilizado na medicina popular como antiinflamatório, antimicrobiano e antitumoral. Porém, informações sobre seu potencial tóxico são escassos na literatura. O objetivo deste estudo foi estabelecer a toxicidade oral aguda e os possíveis efeitos neurotóxicos relacionados à ingestão do óleo-resina de Copaifera reticulata Ducke, Fabaceae, em ratas Wistar. O estudo foi conduzido com quinze ratas nulíparas distribuídas nos grupos de doses 300 e 2000 mg/kg pc de óleo-resina administrado por gavagem. Os resultados obtidos mostraram que nestas doses não houve sinais clínicos de toxicidade ou neurotoxicidade, alteração no consumo de ração ou alteração no peso corpóreo. A dose letal aguda foi estimada como maior que 2000 mg/kg pc e classificada como categoria 5, segundo o Guia OECD 423. Estes resultados indicam que existe uma relativa margem de segurança para o uso do óleo-resina de copaíba como agente terapêutico, embora estudos toxicológicos adicionais sejam ainda necessários, principalmente com a administração repetida de baixas doses.Copaiba oil-resin obtained from Copaifera L. genus, Fabaceae, is largely used in popular medicine as antinflammatory, antimicrobial and antitumoral. Information concerning the potential toxicity of this oil is limited in the literature. The goal of this study was to investigate the acute toxicity and the possible neurotoxic effects related to the ingestion of Copaifera reticulata Ducke, Fabaceae, oil-resin using female Wistar rats. Fifteen nulliparous rats were used and distributed in the experimental groups orally exposed to doses of 300 e 2000 mg/kg bw of oil-resin (gavage. No overt clinical signs of toxicity or neurotoxicity, alteration of food consumption or body weight were observed in the animals at the tested doses. The lethal oral toxicity was estimated to be higher than 2000 mg/kg bw, classified as

  20. Qualitative analysis of Copaifera oleoresin using comprehensive two-dimensional gas chromatography and gas chromatography with classical and cold electron ionisation mass spectrometry.

    Science.gov (United States)

    Wong, Yong Foo; Uekane, Thais M; Rezende, Claudia M; Bizzo, Humberto R; Marriott, Philip J

    2016-12-16

    Improved separation of both sesquiterpenes and diterpenic acids in Copaifera multijuga Hayne oleoresin, is demonstrated by using comprehensive two-dimensional gas chromatography (GC×GC) coupled to accurate mass time-of-flight mass spectrometry (accTOFMS). GC×GC separation employs polar phases (including ionic liquid phases) as the first dimension ((1)D) column, combined with a lower polarity (2)D phase. Elution temperatures (Te) of diterpenic acids (in methyl ester form, DAME) increased as the (1)D McReynolds' polarity value of the column phase decreased. Since Te of sesquiterpene hydrocarbons decreased with increased polarity, the very polar SLB-IL111 (1)D phase leads to excessive peak broadening in the (2)D apolar phase due to increased second dimension retention ((2)tR). The combination of SLB-IL59 with a nonpolar column phase was selected, providing reasonable separation and low Te for sesquiterpenes and DAME, compared to other tested column sets, without excessive (2)tR. Identities of DAME were aided by both soft (30eV) electron ionisation (EI) accurate mass TOFMS analysis and supersonic molecular beam ionisation (cold EI) TOFMS, both which providing less fragmentation and increased relative abundance of molecular ions. The inter-relation between EI energies, emission current, signal-to-noise and mass error for the accurate mass measurement of DAME are reported. These approaches can be used as a basis for conducting of GC×GC with soft EI accurate mass measurement of terpenes, particularly for unknown phytochemicals.

  1. Study of environmental contamination in growth tree rings of Copaifera Langsdorfii by SR-TXRF: evaluation of Cr, Ni, Cu, Zn and Pb

    Energy Technology Data Exchange (ETDEWEB)

    Faria, Bruna Fernanda; Moreira, Silvana, E-mail: bffaria@yahoo.com.b [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Faculdade de Engenharia Civil, Arquitetura e Urbanismo. Dept. de Saneamento e Ambiente; Vives, Ana Elisa S. de, E-mail: aesvives@unimep.b [Universidade Metodista de Piracicaba (UNIMEP), Santa Barbara D' Oeste, SP (Brazil). Faculdade de Engenharia, Arquitetura e Urbanismo

    2009-07-01

    Some arboreal species present annual cycles of growth and sleeping, registered in the log by different anatomical structures - the growth rings. With the objective of verifying the industrial activity in the city of Bauru, SP samples were submitted to a quantitative analysis in order to verify the bio-accumulation of metals. For that Synchrotron Radiation Total Reflection X-Ray Fluorescence was used. Samples of Copaifera Langsdorfii (Copaiba) were collected close to Municipal Forest of Bauru, SP located at 200m of distance of a disabled company of energy accumulators (batteries) known by receiving several penalties of CETESB due disagreement with the environmental legislation. Through the quantification of the elements Cr, Ni, Cu, Zn and Pb in the annual growth rings were possible to verify the influence of the battery industry in the local pollution. The temporal variation of Pb showed that after the interdiction of the battery industry the concentrations are close to the reference value, but in the periods previous to the industry interdiction the Pb concentrations were above the reference value. For Cr, 46% of the samples presented superior concentration to the reference value. Zinc presented larger concentration in the period from 1996 to 1998, reaching 1383 mug g{sup -1}. For Cu the concentrations were higher than the reference value in almost all periods analyzed, that is, from 1969 to 2004. On the other hand Ni presented great oscillation in its concentration, and the highest values were observed in the period from 1969 to 1971 and from 1999 to 2001, reaching 87 mug g{sup -1}. (author)

  2. Physical and chemical properties of soils under some wild Pistachio (Pistacia atlantica Desf) canopies in a semi-arid ecosystem, southwestern Iran.

    Science.gov (United States)

    Owliaie, Hamidreza

    2010-05-01

    Pistacia atlantica Desf. is one of the most important wild species in Zagros forests which is of high economical and environmental value. Sustainability of these forests primarily depends on soil quality and water availability. Study the relationships between trees and soil is one of the basic factors in management and planning of forests. Hence, this study was undertaken with the objective of assessing the effect of tree species on soil physical and chemical properties in a semi-arid region (Kohgilouye Province) in the southwestern part of Iran. The experimental design was a factorial 4×2 (4 depths and 2 distances) in a randomized complete block design with six replications. Soil samples (0-20, 20-40, 40-60 and 60-80 cm depth) were taken from beneath the tree crowns and adjacent open areas. Soil samples were analyzed for physical and chemical properties. The results showed that wild pistachio canopy increased mostly organic carbon, hydraulic conductivity, total N, SP, available K+, P (olsen), EC, EDTA extractable Fe2+ and Mn2+, while bulk density, CCE and DTPA extractable Cu2+ were decreased. Pistachio canopy had no significant effect on soil texture, Zn2+ and pH.

  3. THE DIFFERENCE OF MACHINING PROPERTIES OF TIMO (Timonius sericeus (Desf K. Schum. And KABESAK WOOD (Acacia leucophloea (Roxb. Willd. FROM EAST NUSA TENGGARA

    Directory of Open Access Journals (Sweden)

    Heny Rianawati

    2015-09-01

    Full Text Available Machining properties is one of the parameters to determine the quality of the wood. Tests on machining properties of wood are important to know the easiness level of workmanship as raw materials of furniture industry, construction wood and other wood products. This research was aimed at determining the difference of machining properties between timo wood (Timonius sericeus (Desf K. Schum. and kabesak wood (Acacia leucophloea (Roxb. Willd. from the village of Reknamo, Kupang district, East Nusa Tenggara. Testing procedures were based on ASTM D1666 including: planning, shaping, sanding, drilling and turning. The observation of qualities of the machining were done visually by calculating the percentage of defects that arise on the surface of the samples after the machining process, then the qualities were classified into five quality classes. The results showed that the machining properties of timo wood and kabesak wood were very good and belonging to the quality of class I. The significant difference between the machining properties of both the timbers is in the sanding properties, where the average free defect of sanding timo wood is 85% while kabesak wood is 84.5%. Both timo and kabesak wood are suitable as raw material, for the variety of furniture and molding products.

  4. Cumulative abiotic stresses and their effect on the antioxidant defense system in two species of wheat, Triticum durum Desf and Triticum aestivum L.

    Directory of Open Access Journals (Sweden)

    Ibrahim M.M.

    2013-01-01

    Full Text Available The combined effects of heat and UV-B on the antioxidant system and photosynthetic pigments were investigated in the leaves of T. durum Desf. and Triticum aestivum L. The photosynthetic pigment content, in vitro evaluation of the antioxidant system activities including DPPH radical scavenging activity, and super oxide anion radical scavenging activity were determined. In addition, the antioxidant enzyme activities, such as superoxide dismutase (SOD and guaiacol peroxidase (GPX, were determined. Heat and UV-B irradiation alone caused a significant decrease in the photosynthetic pigment content, radical scavenging activity and super oxide radical scavenging activity in the two studied plants. The antioxidant enzymes SOD and GPX were stimulated in response to UV and/or heat stresses. The elevation of enzyme activities was higher under heat than under UV-B, especially in T. aestivum. According to our findings, it can be concluded that combined heat and UV-B provided cross-tolerance; otherwise, single stress was found to aggravate the responses.

  5. In vitro assessment of the anthelmintic activity of Hedysarum carnosum Desf. at different phenological stages and from six locations in Tunisia.

    Science.gov (United States)

    Aissa, A; Manolaraki, F; Ben Salem, H; Hoste, H; Kraiem, K

    2016-05-01

    Gastrointestinal nematodes are compromising productivity of grazing sheep and goats. Therefore, scientists have been looking for cost-effective alternative options. Forage legumes (Fabacea Family) contain tannins that could improve livestock performance and their health as well. The present study aimed to (i) determine the in vitro anthelmintic (AH) activity of 19 acetonic extracts of Hedysarum carnosum Desf on Haemonchus contortus by a larval exsheathment assay (LEA); (ii) test the anthelmintic activity of condensed tannins using a deactivating reagent, polyvinylpolypyrrolidone (PVPP); (iii) study the effect of location and the phenological stage on the percentage of exsheathment. The LEA was used at different concentrations (150, 300, 600, 1200 µg mL-1 of acetonic extract/mL of purified buffer solution (PBS)). The larval exsheathment is concentration, location, phenological stage dependent. All extracts, caused a delay of the percentage of exsheathment over 50% so the AH activity of H. carnosum was confirmed. After addition of PVPP, the % exsheathment was similar to the 150 µg mL-1 concentration. The biplot showed that Loc1(S), Loc4(B), Loc 5(PF), Loc 6(BM) and Loc 6(PF) were isolated from other plant extract sample. Our in vitro study showed that H. carnosum seems to be a promising alternative to AH drugs.

  6. Morphological leaf variability in natural populations of Pistacia atlantica Desf. subsp. atlantica along climatic gradient: new features to update Pistacia atlantica subsp. atlantica key

    Science.gov (United States)

    El Zerey-Belaskri, Asma; Benhassaini, Hachemi

    2016-04-01

    The effect of bioclimate range on the variation in Pistacia atlantica Desf. subsp. atlantica leaf morphology was studied on 16 sites in Northwest Algeria. The study examined biometrically mature leaves totaling 3520 compound leaves. Fifteen characters (10 quantitative and 5 qualitative) were assessed on each leaf. For each quantitative character, the nested analysis of variance (ANOVA) was used to examine relative magnitude of variation at each level of the nested hierarchy. The correlation between the climatic parameters and the leaf morphology was examined. The statistical analysis applied on the quantitative leaf characters showed highly significant variation at the within-site level and between-site variation. The correlation coefficient ( r) showed also an important correlation between climatic parameters and leaf morphology. The results of this study exhibited several values reported for the first time on the species, such as the length and the width of the leaf (reaching up to 24.5 cm/21.9 cm), the number of leaflets (up to 18 leaflets/leaf), and the petiole length of the terminal leaflet (reaching up to 3.4 cm). The original findings of this study are used to update the P. atlantica subsp. atlantica identification key.

  7. Optimization of headspace solid-phase microextraction for analysis of {beta}-caryophyllene in a nanoemulsion dosage form prepared with copaiba (Copaifera multijuga Hayne) oil

    Energy Technology Data Exchange (ETDEWEB)

    Dias, Daiane de O; Colombo, Mariana; Kelmann, Regina G. [Programa de Pos-Graduacao em Ciencias Farmaceuticas, Faculdade de Farmacia, Universidade Federal do Rio Grande do Sul, Porto Alegre, RS, Av. Ipiranga, 2752, CEP 90610-000 (Brazil); De Souza, Tatiane P. [Programa de Pos-Graduacao em Ciencias Farmaceuticas, Universidade Federal do Amazonas, Manaus, Amazonas (Brazil); Bassani, Valquiria L.; Teixeira, Helder F. [Programa de Pos-Graduacao em Ciencias Farmaceuticas, Faculdade de Farmacia, Universidade Federal do Rio Grande do Sul, Porto Alegre, RS, Av. Ipiranga, 2752, CEP 90610-000 (Brazil); Veiga, Valdir F. [Departamento de Quimica, Instituto de Ciencias Exatas, UFAM, Av. Gal. Rodrigo Octavio, 6.200 - Japiim, 69.079-000, Manaus - AM (Brazil); Limberger, Renata P. [Programa de Pos-Graduacao em Ciencias Farmaceuticas, Faculdade de Farmacia, Universidade Federal do Rio Grande do Sul, Porto Alegre, RS, Av. Ipiranga, 2752, CEP 90610-000 (Brazil); and others

    2012-04-06

    Highlights: Black-Right-Pointing-Pointer A SPME-CG method is proposed for {beta}-caryophyllene assay in nanoemulsions containing copaiba oil. Black-Right-Pointing-Pointer SPME parameters were optimized for efficient {beta}-caryophyllene extraction. Black-Right-Pointing-Pointer The stability-indicating capability and specificity of the method were satisfied. Black-Right-Pointing-Pointer Nanoemulsions partially protected {beta}-caryophyllene under stressing conditions. Black-Right-Pointing-Pointer The proposed method presents linearity, lows LOD and LOQ, good precision, accuracy and robustness. - Abstract: Recent studies have shown the anti-inflammatory activity of Copaiba oils may be addressed to the high content of {beta}-caryophyllene, the most common sesquiterpene detected, especially in the Copaifera multijuga Hayne species. In the present study, nanoemulsions were proposed as a delivery system for copaiba oil in view to treat locally inflamed skin. This article describes the optimization and validation of a stability-indicating SPME-GC method, for {beta}-caryophyllene analysis in the nanoemulsions produced by high pressure homogenization. SPME methods are performed with PDMS (polydimethylsiloxane) fiber (100 {mu}m). Three SPME parameters were evaluated by a three-level-three-factor Box-Behnken factorial design as potentially affecting the technique efficiency. According to the results obtained, the best conditions to extract {beta}-caryophyllene were: (i) sampling temperature of 45 Degree-Sign C, (ii) sampling time of 20 min and (iii) no NaCl addition. Results coming from the forced degradation tests showed a reduction of {beta}-caryophyllene peak area when both caryophyllene methanolic solution and nanoemulsions were exposed to acid hydrolysis, UV-A irradiation, oxidative (H{sub 2}O{sub 2}) and thermolitic (60 Degree-Sign C) conditions. Such reduction occurred in lower extent in the nanoemulsions, suggesting a protective effect of the formulation to {beta

  8. Áreas prioritárias na Amazônia para conservação dos recursos genéticos de espécies florestais nativas: fase preliminar Priority areas for genetic resources conservation of native Forest Species: preliminary phase

    Directory of Open Access Journals (Sweden)

    Angela Maria Conte Leite

    1993-07-01

    Full Text Available O CENARGEN/EMBRAPA está realizando a prospecção das áreas prioritárias para a conservação in situ dos recursos genéticos de espécies com importância sócio-econômica para cada bioma existente no Brasil, buscando a conservação da variabilidade genética das mesmas. Para a prospecção da floresta tropical úmida amazônica, inicialmente foram feitos levantamentos de herbários nacionais bem como de literatura, para tentar definir os padrões de distribuição geográfica de algumas espécies prioritárias da região. A ocorrência das mesmas foi correlacionada com solos, clima, vegetação e com a existência de unidades de conservação na Amazônia, no intuito de se propor as áreas mais adequadas para a implantação de reservas genéticas (conservação in situ e de bancos de germoplasma (conservação ex situ à campo. As espécies relatadas no presente trabalho são Aniba rosaeodora Ducke (pau-rosa, Bertholletia excelsa H.B.K. (castanha-do-Pará, Carapa quianensis Aubl. (andiroba, Cedrela fissilis Veil, e C. odorata L. (cedros, Copaifera langsdorffii Desf. e C. multijuga Hayne (copaibas, Cordia goeldiana Huber (freijó, Jacaranda copaia (Aubl. D. Dom (pará-pará, Simaruba amara Aubl. e Virola sebifera Aubl. e V. surinamensis Warb. (ucuúbas e Voucapoua americana Aubl. e V. pallidor Ducke (acapús. Trabalhos posteriores com as mesmas incluirão a corroboração à campo dos dados obtidos nos herbários e na literatura, bem como estudos a nível de população dentro das áreas selecionadas.CENARGEN/EMBRAPA is investigating priority areas for in situ conservation of genetic resources of socially and economically important species. Herbaria and the literature were consulted to determine the distribution patterns of some tropical rain forest species. Known species distribution were correlated with soils, climate, vegetation types and the existence of conservation units, in order to propose the establishment of genetic reserves for

  9. Toxicity and repellency of essential oils to Zabrotes subfasciatus (Boheman (Coleoptera, Chrysomelidae, Bruchinae in Phaseolus vulgaris L Toxicidade e repelência de óleos essenciais a Zabrotes subfasciatus (Boheman (Coleoptera, Chrysomelidae, Bruchinae em grãos de Phaseolus vulgaris L

    Directory of Open Access Journals (Sweden)

    Solange Maria de França

    2012-09-01

    Full Text Available The effects of tangerine (Phaseolus vulgaris Blanco, lemon (Citrus medica limonum Lush, pear orange (Citrus sinensis L. Osbeck, red copaiba (Copaifera langsdorffii Desf., rosemary (Baccharis dracunculifolia De Candole, Eucalyptus (Eucalyptus globulus Labillardière and E. citriodora Hook, lemongrass (Cymbopogon citratus Stapf. and citronella (Cimbopogon nardus Linnaeus oils at several concentrations on Zabrotes subfasciatus (Boheman were studied. In toxicity tests, grains of Phaseolus vulgaris L. cv. Rajadinho were impregnated with oils and infested with adults of Z. subfasciatus up to 24 hours old. All tested oils were effective in reducing the viable egg-laying and adult emergence of this pest, in function of the concentrations used, highlighting E. citriodora and E. globulus oils which caused 100% effectiveness from 0.5 mL Kg-1 concentration. In repellency tests, two arenas consisting of plastic containers, connected symmetrically to a central box by two plastic tubes were used. In one of the boxes, untreated beans were placed and on the other ones beans treated with each oil concentration were used. In the central box, five couples of Z. subfasciatus were released. Grains of P. vulgaris treated with oils of E. citriodora, C. citratus and C. oleifera reduced the attraction percentage of Z. subfasciatus adults, while the E. globulus increased this percentage. The percentages of reduced viable eggs ranged from 17.9% (C. medica limonum to 93.3% (C. nardus, while the reduction on the number of emerged insects was 23.9% and 95.9%, respectively for these same oils.Estudaram-se os efeitos dos óleos de tangerina 'Cravo' (Phaseolus vulgaris Blanco, limão-siciliano (Citrus medica limonum Lush, laranja 'Pêra' (Citrus sinensis L. Osbeek, copaíba-vermelha (Copaifera langsdorffii Desf., alecrim-do-campo (Baccharis dracunculifolia De Candole, eucalipto (Eucalyptus globulus Labillardière e Eucalyptus citriodora Hook, capim-santo (Cymbopogon citratus

  10. Morphometric of four species in agroforestry systems in the municipality of Porto Velho, Rondônia. = Morfometria de quatro espécies florestais em sistemas agroflorestais no munícipio de Porto Velho, Rondônia

    Directory of Open Access Journals (Sweden)

    Tiago Monteiro Condé

    2013-04-01

    Full Text Available This study aims to describe the morphometry of Andiroba (Carapa guianensis Aubl, Brasil nut tree (Bertholletia excelsa HBK, Copaíba (Copaifera langsdorffii Desf. Mogno (Swietenia macrophylla King. and simulate the vital space for it to grow without competition in agroforestry plantations. Data were collected in 20 agroforestry (SAF’s considered productive age (16.5 years of Project RECA (Economic Reforestation Consortium and Compacted, the municipality of Porto Velho, Rondônia. The deployment of the SAF’s occurred through the removal of vegetation through the process of clearing and burningof native forests. Morphometric data were collected randomly from individuals with DBH > 10 cm of four tree species in onehectare of each farm, for a total sample area of 20 ha (20 properties. The sample was composed by 25 individuals of Andiroba,40 of Brasil nut tree, 23 of Copaíba and 46 of Mogno. Andiroba was very similar to Mogno in relation to Cup Percentage (PC,Coverage Index (AI and Cup Form (FC, both showed potential for higher density plantations with timber purposes. The Brasilnut tree and Copaíba had the highest values of the FC (1.66, 1.79 and Crown Area (92.60, 57.51, respectively, showing frondscrowns, silvicultural interesting features for the extraction of seeds. Was simulated living space for the four species developwithout competition between cups. It was concluded that the four species have potential for planting for extraction of timberand non-timber forest in areas subject to degradation and deforestation in the Amazon.ResumoO presente estudo visa descrever a morfometria das espécies Andiroba (Carapa guianensis Aubl, Castanheira-do-Brasil (Bertholletia excelsa H.B.K., Copaíba (Copaifera langsdorffii Desf. e Mogno (Swietenia macrophylla King. e simular o espaço vital para que as mesmas cresçam sem concorrência em plantios agroflorestais. Os dados foram coletadosem vinte sistemas agroflorestais (SAF’s em idade considerada

  11. Estudo etnobotânico na comunidade de Conceição-Açu (alto da bacia do rio Aricá Açu, MT, Brasil Ethnobotany study in community of Conceição-Açu (on the upper basin of the River Aricá Açu, MT, Brazil

    Directory of Open Access Journals (Sweden)

    Maria Corette Pasa

    2005-06-01

    Full Text Available O presente trabalho tem como objetivo realizar o levantamento etnobotânico de plantas classificadas em diferentes categorias de uso na comunidade de Conceição-Açu, no município de Cuiabá, MT, Brasil e estimar o valor de uso das espécies botânicas em matas de galeria. Entrevistas estruturadas e semi-estruturadas, o uso do questionário foram aplicados em 59 residentes adultos de ambos os sexos. Identificou-se as unidades de paisagem: quintais, roças e matas de galeria e o número total de espécies utilizadas foi de 180. A maioria das plantas foi coletada durante a entrevista e depositadas no Herbário da UFMT. Nos quintais das residências identificou-se 86 espécies, pertencentes a 43 famílias, a maioria cultivada e utilizada como alimento (48,1% e como remédio (44,5%. Nas roças os principais cultivos são: Manihot esculenta L. (100%, Carica papaya L. (76,2%, Musa paradisiaca L. (71,4%, Saccharum officinarum L. (57,1%. Na mata de galeria destacou-se a categoria medicinal (65%, com as espécies: Copaifera langsdorffii Desf. (2,5, Aspidosperma polyneuron Muell. Arg. (2,5, Hymenaea stignocarpa Mart. (2,33, Diptychandra aurantiaca Tul. (2,0, Cariniana rubra Gardner ex. Miers (20 e as famílias botânicas Mimosaceae, Bignoniaceae, Caesalpiniaceae, Fabaceae e Sapindaceae. Os resultados demonstram que a população possui vasto conhecimento das plantas e de suas propriedades de cura.This paper aims at doing the ethnobotany survey of plants classified in different categories of use in the community of Conceição-Açu, in the city of Cuiabá, MT, Brazil and estimate the value of use of the species botanic in the gallery forest. Structured and non-structured interviews and the questionnaire were used in 59 adult dwellers of both sexes. Were identified the landscape units: backyards, husbandry and gallery forest and the total number of used species is the 180. The majority of the plants was collected during the interview and is kept in the

  12. Avaliação dos efeitos antineoplásicos do óleo da Copaifera reticulata Ducke em linhagens de células cancerosas de pulmão

    OpenAIRE

    Tatiana Ranieri

    2015-01-01

    Nos últimos anos as evidências de novos casos de câncer têm alarmado o mundo. O objetivo desse trabalho foi avaliar possíveis propriedades antineoplásicas atribuídas ao óleo de Copaifera reticulata Ducke pela etnofarmacologia. Ocorreu pela análise da citotoxicidade deste em cultivos de células normais e cancerosas de pulmão, murinas E10 e E9 e humanas das linhagens NCI-H460 e NCI-H2023. Os cultivos após serem incubados a 37°C foram expostos a oito diferentes concentrações do óleo diluído ...

  13. Chemical composition and bio-pesticidal values of essential oil isolated from the seed of Heracleum persicum Desf. ex Fischer (Apiaceae

    Directory of Open Access Journals (Sweden)

    Asgar Ebadollahi

    2014-11-01

    Full Text Available The present investigation was aimed to analyse the chemical composition of essential oil isolated from Heracleum persicum Desf. ex Fischer and assess its lethal and sub-lethal effects against Tribolium castaneum (Herbst. Essential oil from hydro-distilled seeds of H. persicum was analyzed by gas chromatography-mass spectrometry (GC-MS, and hexyl butyrate (50.58%, octyl acetate (9.80% and hexyl hexanoate (8.75% were found as principal constituents. Repellent activity, contact and fumigant toxicity and antifeedant effects of this oil were assessed against the adults of T. castaneum. The essential oil strongly repelled T. castaneum adults even at the lowest concentration (0.035 μL cm-2. Complete repellency (100% occurred when the highest concentration (0.212 μL cm-2 was applied for 8 h. T. castaneum was very susceptible to H. persicum oil at both contact and fumigant bioassays. In the fumigant toxicity, essential oil killed the larvae, pupae and adults and significantly decreased larvae emerged from treated eggs. LC10 to LC40 values of fumigation adult’s bioassay as sub-lethal concentrations were used to evaluate the antifeedant effects. H. persicum essential oil has significant antifeedant effects on T. castaneum adults and decrease of feeding happened when oil concentrations increased. The results of the present study indicate that essential oil of H. persicum, with wide bio-effects on T. castaneum, is a source of biologically active agents which may potentially prove to be efficient insecticides.

  14. Efeitos clínicos e microbiológicos do óleo de copaíba (Copaifera officinalis sobre bactérias formadoras de placa dental em cães Clinical and microbiological effects of copaiba oil (Copaifera officinalis on dental plaque forming bacteria in dogs

    Directory of Open Access Journals (Sweden)

    F.A. Pieri

    2010-06-01

    Full Text Available O potencial de uso do óleo de copaíba (Copaifera officinalis na prevenção da doença periodontal, eliminando seu agente etiológico, foi avaliado em 18 cães sem raça definida, distribuídos homogeneamente em três grupos: teste, (contendo óleo de copaíba controle positivo e controle negativo. Os tratamentos ocorreram três vezes ao dia, durante oito dias. Ao nono dia, os animais receberam aplicação tópica de fucsina básica 0,5% para evidenciação do biofilme. Mudanças na halitose e gengivite foram avaliadas diariamente por inspeção visual. Adicionalmente, foram realizados testes laboratoriais de inibição de aderência de Streptococcus mutans e ensaio antimicrobiano de difusão em ágar, sobre bactérias formadoras de placa dental. Os resultados da placa evidenciada apontaram áreas de cobertura microbiana nos dentes de 53,4±8,8%, 28,5±5,4%, e 22,3±5,3% para os grupos negativo, positivo e teste, respectivamente, indicando diferença entre o controle negativo e os demais grupos (PThe copaiba oil (Copaifera officinalis potential was evaluated in preventing periodontal disease and reducing its etiology. For that 18 mongrel dogs were homogeneously distributed in three groups: test (copaiba oil, positive control (chlorexidine and negative control. The treatments were carried out three times a day, during eight days. On the 9th day, the animals were tested with a 0.5% basic solution of fuchsin for the detection of biofilm. Changes in halitosis and gingivitis were daily observed. In addition, the following laboratory tests were done: inhibition of the adherence of Streptococcus mutans, and plaque forming bacteria antimicrobial assays by the agar diffusion method. The results of the fuchsin test showed that dental plaque reached areas of 53.4±8.8%, 28.5±5.4%, and 22.3±5.3% in the negative control, positive control, and test groups, respectively, showing differences between dogs from the negative control group and dogs from the

  15. Avaliação in vitro da atividade antibacteriana de um cimento odontológico à base de óleo-resina de Copaifera multijuga Hayne In vitro assessment of antibacterial activity of a dental cement constituted of a Copaifera multijuga Hayne oil-resin

    Directory of Open Access Journals (Sweden)

    Kátia Regina Felizardo Vasconcelos

    2008-12-01

    Full Text Available Um dos materiais utilizados para a adequação do meio bucal no serviço público é o cimento produzido a partir de óxido de zinco e eugenol. Entretanto, o eugenol é uma substância citotóxica que pode desencadear alguns efeitos adversos. Por essa razão, procura-se substituir o eugenol por uma substância que apresente baixa toxicidade, mantendo ou mesmo melhorando as propriedades do cimento. O óleo-resina de copaíba é um produto natural, utilizado pelas populações amazônicas e reconhecido por suas propriedades medicinais. Baseando-se nas propriedades desse óleo-resina, na ação antimicrobiana comprovada do hidróxido de cálcio e na ação anti-séptica do óxido de zinco, propôs-se formular um cimento odontológico obtido da associação do ZnO, Ca(OH2 e óleo-resina de Copaifera multijuga Hayne e avaliar sua atividade antibacteriana através do teste de diluição em meio líquido frente às cepas padrão de Streptococcus mutans (ATCC 25175 e S. sanguinis (ATCC 15300. Nesse ensaio, utilizaram-se os seguintes grupos experimentais: o cimento contendo ZnO, Ca(OH2 e óleo-resina de copaíba (G1 e cada um dos constituintes isoladamente, ZnO (G2, Ca(OH2 (G3 e óleo-resina de copaíba (G4. Todos os grupos analisados demonstraram atividade antibacteriana, o G4 apresentou os melhores resultados e o G1 mostrou-se um cimento promissor a ser utilizado em odontologia.One of the materials utilized for suitability of the oral means in the public service is the cement produced from zinc oxide and eugenol. However, eugenol is a cytotoxic substance that can trigger some adverse effects. For this reason, it is desired to replace eugenol for another substance that presents low toxicity, keeping or even improving the cement properties. The copaiba oil-resin is a natural product, utilized by the Amazonian population and recognized for its medicinal properties. Based on the properties of this oil-resin, on the proven antimicrobial activity of calcium

  16. Alterações ultraestruturais em larvas de Aedes aegypti submetidas ao diterpeno labdano, isolado de Copaifera reticulata (Leguminosae, e à uma fração rica em taninos de Magonia pubescens (Sapindaceae Ultrastructural alterations in larvae of Aedes aegypti subject to labdane diterpene isolated from Copaifera reticulata (Leguminosae and a fraction enriched with tannins of Magonia pubescens (Sapindaceae

    Directory of Open Access Journals (Sweden)

    Cleyde Ferreira Barreto Valotto

    2011-04-01

    Full Text Available INTRODUÇÃO: Dengue é um importante problema de saúde pública, em vários países, e tem como principal vetor o Aedes aegypti, mosquito mais adaptado às áreas urbanizadas. Apresenta-se, pela primeira vez, as alterações ultraestruturais em larvas de 3º estádio, desse mosquito, causadas pelos larvicidas naturais, um diterpeno labdano, extraído de Copaifera reticulata, e uma fração rica em taninos catéquicos, extraída de Magonia pubescens, evidenciando o mecanismo de ação dessas substâncias. MÉTODOS: Os experimentos foram realizados com larvas de 3º estádio em solução de 0,9ppm, do diterpeno (3-β-acetoxylabdan-8(17-13-dien-15-óico e de 3,7ppm, da fração majoritária de tanino catéquico de massa molecular 864Da. Obtiveram-se as substâncias através de fracionamentos cromatográficos sucessivos, identificadas por ressonância magnética nuclear de hidrogênio e espectrometria de massas. As larvas que atingiram estado letárgico foram coletadas e dissecadas e seus tubos digestórios fixados, desidratados, emblocados e polimerizados. Cortes ultrafinos foram feitos e contrastados com acetato de uranila 3% e citrato de chumbo, posteriormente, levados ao microscópio eletrônico. RESULTADOS: As principais alterações ultraestruturais provocadas pelos diterpeno e tanino sobre larvas de Aedes aegypti foram vacuolização citoplasmática, desorganização e degeneração celular, mudança estrutural dos microvilos e deslocamento das células da lâmina basal. CONCLUSÕES: O diterpeno e a fração rica em taninos catéquicos provocaram a morte das larvas de Aedes aegypti através da destruição celular no intestino médio.INTRODUCTION: Dengue is an important public health problem in many countries and its main vector Aedes aegypti, is the mosquito most adapted to urban areas. For the first time, the mechanism of action of labdane diterpenoid extracted from Copaifera reticulata and the fraction enriched of catechin tannins

  17. Autoecología y distribución potencial de la encina (Quercus ilex subsp. ballota (Desf. Samp. en la zona norte de Monegros

    Directory of Open Access Journals (Sweden)

    R. Rodríguez Ochoa

    2014-01-01

    Full Text Available Para conocer la autoecología y distribución potencial de la encina (Quercus ilex subsp. ballota (Desf. Samp. en la zona norte de Monegros se ha cartografiado la distribución de la encina y sus especies asociadas, analizando 37 parcelas con presencia de esta especie. Se han analizado las relaciones entre variables dasométricas de los encinares y variables ambientales, edáficas y climáticas, mediante análisis de correlaciones, y se ha utilizado el análisis canónico de correspondencias para estudiar las relaciones entre las especies vegetales descritas en los encinares y aquellas variables ambientales. A partir del mapa de suelos de la zona, se han definido como áreas potenciales para la encina las que presentan suelos similares a los de las parcelas con presencia actual de esta especie, y como áreas de exclusión las afectadas por salinidad-sodicidad, las que presentan suelos erosionados desarrollados sobre lutitas, y las formaciones de ribera. Las condiciones climáticas a escala de parcela indican un clima semiárido con precipitaciones de 400 - 500 mm, y déficits hídricos entre 364 y 741 mm. Los suelos asociados se clasifican, principalmente, como Torriorthentslítico-xéricos y Petrocalcids cálcicos. Son suelos bien drenados, no salinos, con una proporción de arena superior al 30 % en la fracción fina, y profundidad en raizable de 8 - 70 cm. Las masas de encina presentan áreas basimétricas de 1.1 - 27.6 m2.ha-1, diámetros medios de 3.9 - 27.7 cm y alturas dominantes de 3.0 - 10.7 m, y aparece regenerado de esta especie en un 81 % de las parcelas. La cartografía muestra que más del 60 %de la zona de estudio podría ser un hábitat apto para la encina.

  18. Caracterização florística, fitossociológica e regeneração natural do sub-bosque da reserva genética florestal Tamanduá, DF.

    Directory of Open Access Journals (Sweden)

    José Alves da Silva

    2010-08-01

    Full Text Available O presente trabalho, desenvolvido na Reserva Genética Florestal Tamanduá, DF, teve como objetivo efetuar o levantamento fitossociológico, composição florística e distribuição espacial dos indivíduos das espécies arbóreas ocorrentes no sub-bosque da Reserva, focalizando Cariniana estrellensis (Raddi O. Kuntze, Apuleia leiocarpa (Vogel J. F.Macbr., Copaifera langsdorffii Desf., Anadenanthera macrocarpa (Benth. Brenan, Virola sebifera Aubl., Hymenaea courbaril var. stilbocarpa (Hayne Lee & Lang., Aspidosperma discolor A. St. Hil., Astronium fraxinifolium Schott e Schefflera morototoni B. Maguire, Stey. & Frodin, consideradas prioritárias para conservação in situ. Foram utilizados cinco transectos com 10 m de largura cada, alocados eqüidistantes e de comprimento variável, demarcados perpendicularmente ao curso da drenagem principal. Foram encontrados 21.482 regenerantes ha-1 em 69 espécies vegetais, 53 gêneros e 39 famílias botânicas. Em número de espécies, as famílias que mais se destacaram entre os regenerantes foram, em ordem decrescente, Leguminosae, Rubiaceae, Sapindaceae e Meliaceae. Entre os jovens, as famílias com maiores valor de importância (VI foram pela ordem Meliaceae (32,78 %, Rubiceae (13,92 %, Burseraceae (13,76 %, Rutaceae (8,54 % e Hippocrateaceae (6,36, totalizando 75,36 % de valor de importância e 78,56 % de valor de cobertura. Todas as espécies objeto deste trabalho ocorreram entre os regenerantes, destacando-se Cariniana estrellensis, porém, apenas Copaifera lagsdorffii e Virola sebifera ocorreram entre os indivíduos jovens. O quociente de mistura de 1:3 indicou tratar-se de uma mata rica em espécies, comparativamente a outros tipos florestais. A distribuição espacial dos regenerantes das espécies em questão mostrou padrões diferenciados.

  19. CARACTERIZAÇÃO FLORÍSTICA, FITOSSOCIOLÓGICA E REGENERAÇÃO NATURAL DO SUB-BOSQUE DA RESERVA GENÉTICA FLORESTAL TAMANDUÁ, DF

    Directory of Open Access Journals (Sweden)

    Salomão João Marcelo de Rezende

    2004-04-01

    Full Text Available O presente trabalho, desenvolvido na Reserva Genética Florestal Tamanduá, DF, teve como objetivo efetuar o levantamento fitossociológico, composição florística e distribuição espacial dos indivíduos das espécies arbóreas ocorrentes no sub-bosque da Reserva, focalizando Cariniana estrellensis (Raddi O. Kuntze, Apuleia leiocarpa (Vogel J. F.Macbr., Copaifera langsdorffii Desf., Anadenanthera macrocarpa (Benth. Brenan, Virola sebifera Aubl., Hymenaea courbaril var. stilbocarpa (Hayne Lee & Lang., Aspidosperma discolor A. St. Hil., Astronium fraxinifolium Schott e Schefflera morototoni B. Maguire, Stey. & Frodin, consideradas prioritárias para conservação in situ. Foram utilizados cinco transectos com 10 m de largura cada, alocados eqüidistantes e de comprimento variável, demarcados perpendicularmente ao curso da drenagem principal. Foram encontrados 21.482 regenerantes ha-1 em 69 espécies vegetais, 53 gêneros e 39 famílias botânicas. Em número de espécies, as famílias que mais se destacaram entre os regenerantes foram, em ordem decrescente, Leguminosae, Rubiaceae, Sapindaceae e Meliaceae. Entre os jovens, as famílias com maiores valor de importância (VI foram pela ordem Meliaceae (32,78 %, Rubiceae (13,92 %, Burseraceae (13,76 %, Rutaceae (8,54 % e Hippocrateaceae (6,36, totalizando 75,36 % de valor de importância e 78,56 % de valor de cobertura. Todas as espécies objeto deste trabalho ocorreram entre os regenerantes, destacando-se Cariniana estrellensis, porém, apenas Copaifera lagsdorffii e Virola sebifera ocorreram entre os indivíduos jovens. O quociente de mistura de 1:3 indicou tratar-se de uma mata rica em espécies, comparativamente a outros tipos florestais. A distribuição espacial dos regenerantes das espécies em questão mostrou padrões diferenciados.

  20. Biotransformações dos terpenos ?-cariofileno e ácido 3?-acetoxi-copálico presentes em oleorresinas de Copaifera sp utilizando fungos filamentosos e bactérias do trato gastrointestinal e avaliação da atividade citotóxica dos derivados obtidos

    OpenAIRE

    Tatiane Cruz de Carvalho

    2016-01-01

    Oleorresinas de espécies de Copaifera sp são amplamente utilizadas na medicina popular brasileira e estudos químicos e biológicos demonstram que diterpenos e sesquiterpenos estão entre os principais compostos bioativos das oleorresinas. Um importante fator para a avaliação da segurança e eficácia de fármacos é o conhecimento sobre o seu metabolismo, o qual pode ser adquirido por meio de estudos de biotransformação utilizando fungos filamentosos e bactérias do trato gastrointestinal. Os fungos...

  1. Avaliação da segurança clínica de um fitoterápico contendo Mikania glomerata, Grindelia robusta, Copaifera officinalis, Myroxylon toluifera, Nasturtium officinale, própolis e mel em voluntários saudáveis

    OpenAIRE

    Soares,Aline K.A.; Carmo,Gardênia C.; Quental,Diana P.; Nascimento,Demétrius F.; Fernando A.F. Bezerra; Manoel O de Moraes; Moraes,Maria E. A.

    2006-01-01

    O fitoterápico Calmatoss® é um xarope composto por tinturas de guaco (Mikania glomerata), grindélia (Grindelia robusta), copaíba (Copaifera officinalis), bálsamo de Tolú (Myroxylon toluifera), álcoolatura de agrião (Nasturtium officinale), própolis e mel. Sua principal indicação é para o tratamento de afecções do trato respiratório por suas ações antimicrobianas, antitussígenas, expectorantes e broncodilatadora. O objetivo desse estudo foi avaliar a toxicologia clínica dessa preparação em vol...

  2. Avaliação da segurança clínica de um fitoterápico contendo Mikania glomerata, Grindelia robusta, Copaifera officinalis, Myroxylon toluifera, Nasturtium officinale, própolis e mel em voluntários saudáveis Clinical safety evaluation of a phytomedicine containing Mikania glomerata, Grindelia robusta, Copaifera officinalis, Myroxylon toluifera, Nasturtium officinale, honey and propolis in healthy volunteers

    Directory of Open Access Journals (Sweden)

    Aline K.A. Soares

    2006-12-01

    Full Text Available O fitoterápico Calmatoss® é um xarope composto por tinturas de guaco (Mikania glomerata, grindélia (Grindelia robusta, copaíba (Copaifera officinalis, bálsamo de Tolú (Myroxylon toluifera, álcoolatura de agrião (Nasturtium officinale, própolis e mel. Sua principal indicação é para o tratamento de afecções do trato respiratório por suas ações antimicrobianas, antitussígenas, expectorantes e broncodilatadora. O objetivo desse estudo foi avaliar a toxicologia clínica dessa preparação em voluntários saudáveis. Para isso realizou-se um ensaio clínico, não controlado com 24 voluntários de ambos os sexos, que receberam ambulatorialmente 15 mL do xarope quatro vezes ao dia, durante 21 dias ininterruptos. Os voluntários foram incluídos no estudo somente quando considerados saudáveis após avaliação clínica, exame físico e exames laboratoriais que antecederam o estudo. O xarope Calmatoss® foi bem tolerado pelos 24 voluntários não apresentando eventos adversos graves. Os exames clínicos, eletrocardiográficos e laboratoriais efetuados antes, durante e após o ensaio não evidenciaram sinais de toxicidade nos diversos órgãos e sistemas avaliados, confirmando a segurança da preparação para utilização em ensaios de eficácia terapêutica.Calmatoss® is a phytomedicine used in several respiratory tract pathologies treatment composed of seven medicinal plants such as Mikania glomerata, Grindelia robusta, Copaifera officinalis, Myroxylon toluifera, Nasturtium officinale, as well as honey and propolis. The present study investigated the chronic administration of 15 mL Calmatoss® syroup four times a day during 21 days for any toxic effect on healthy volunteers. The clinical trial consisted of an open study with 24 volunteers included in the study only when considered healthy after clinical evaluation, physical examination and laboratory tests, which preceded the study. The laboratory tests included: heamatologic

  3. Alterações ultraestruturais em larvas de Aedes aegypti submetidas ao diterpeno labdano, isolado de Copaifera reticulata (Leguminosae, e à uma fração rica em taninos de Magonia pubescens (Sapindaceae

    Directory of Open Access Journals (Sweden)

    Cleyde Ferreira Barreto Valotto

    2011-04-01

    Full Text Available INTRODUÇÃO: Dengue é um importante problema de saúde pública, em vários países, e tem como principal vetor o Aedes aegypti, mosquito mais adaptado às áreas urbanizadas. Apresenta-se, pela primeira vez, as alterações ultraestruturais em larvas de 3º estádio, desse mosquito, causadas pelos larvicidas naturais, um diterpeno labdano, extraído de Copaifera reticulata, e uma fração rica em taninos catéquicos, extraída de Magonia pubescens, evidenciando o mecanismo de ação dessas substâncias. MÉTODOS: Os experimentos foram realizados com larvas de 3º estádio em solução de 0,9ppm, do diterpeno (3-β-acetoxylabdan-8(17-13-dien-15-óico e de 3,7ppm, da fração majoritária de tanino catéquico de massa molecular 864Da. Obtiveram-se as substâncias através de fracionamentos cromatográficos sucessivos, identificadas por ressonância magnética nuclear de hidrogênio e espectrometria de massas. As larvas que atingiram estado letárgico foram coletadas e dissecadas e seus tubos digestórios fixados, desidratados, emblocados e polimerizados. Cortes ultrafinos foram feitos e contrastados com acetato de uranila 3% e citrato de chumbo, posteriormente, levados ao microscópio eletrônico. RESULTADOS: As principais alterações ultraestruturais provocadas pelos diterpeno e tanino sobre larvas de Aedes aegypti foram vacuolização citoplasmática, desorganização e degeneração celular, mudança estrutural dos microvilos e deslocamento das células da lâmina basal. CONCLUSÕES: O diterpeno e a fração rica em taninos catéquicos provocaram a morte das larvas de Aedes aegypti através da destruição celular no intestino médio.

  4. Effets de la vitesse et de la durée du remplissage du grain ainsi que de l'accumulation des assimilats de la tige dans l'élaboration du rendement du blé dur (Triticum durum Desf. dans les conditions de culture des hautesplaines orientales d'Algérie

    Directory of Open Access Journals (Sweden)

    Benmahammed A.

    2008-01-01

    Full Text Available Effects of speed and the duration of grain filling and the accumulation of the assimilates of the stem in developing the durum wheat yield (Triticum durum Desf. in the culture conditions of the high plains of eastern Algeria. The present study was led on the experimental site of station ITGC in Setif. The objective is to determine the differences of duration and speed of filling and the contribution of the assimilates of the stems to the yield of 5 durum wheat genotypes (Triticum durum Desf.. The year effect is significant, what explains the fluctuation of the conditions of one growth year to another. The grain yield is associated to the great quantity of assimilates stored and transferred from the stems to the grain filling. The Mbb genotype which has an important stem height transfers more assimilates. The genotypes ADS497 and Deraa present large standard leaves. The beginning of the active phase of the grain filling corresponds to the beginning of the foliar senescence. Mbb presents a slower foliar drying rate, the speed of drying stationary recorded by ADS497 is of -0.5957 cm2 per day. The speed of grain filling is negatively related to the duration of filling. The participation of the assimilates coming from the stem decreases when the environment allows the expression of a better grain yield.

  5. Ethnobotanical study of medicinal plants used by Ribeirinhos in the North Araguaia microregion, Mato Grosso, Brazil.

    Science.gov (United States)

    Ribeiro, Reginaldo Vicente; Bieski, Isanete Geraldini Costa; Balogun, Sikiru Olaitan; Martins, Domingos Tabajara de Oliveira

    2017-06-09

    Currently, in many traditional communities, such as the riverine community in the North Araguaia microregion (Mato Grosso, Brazil), plant knowledge and use represent the main, if not the only, therapeutic resource for the maintenance of health and/or treatment of diseases. This study aimed to identify and document species of medicinal plants used by local experts from riverine communities in the North Araguaia microregion in Mato Grosso State, and to further chemical and pharmacological studies on species selected based on searches in the relevant literature. This is a cross-sectional ethnobotanical study, with non-probabilistic sampling (n =60), that applied the snowball method to select local riverine experts who understand medicinal plant use. Socio-demographic, ethnobotanical and ethnopharmacological data (vernacular name, uses, geographical origin, habit, method of preparation and part used) on medicinal plants were collected during semi-structured interviews. The results were analyzed by descriptive and quantitative means: indices of use-report (UR) were used to select plant species with therapeutic potential. In total, 309 plant species belonging to 86 botanical families were cited; 73% were native to Brazil, and Fabaceae was the most representative family (11.3%). Arboreal was the predominant life form (37.2%). The leaf was the most used part (28.9%). Infusion was the most commonly reported method of preparation (31.3%). The plants reported in the survey were indicated for 18 of the 22 ICD-10 disease categories. The disease categories most commonly cited were the infectious and parasitic diseases (IPD, 718 UR), digestive system diseases (DSD, 565 UR) and respiratory system diseases (RSD, 504 UR), representing 16.6%, 13.1% and 11.7%, respectively of the total UR. Dysphania ambrosioides L. was the most sighted in the IPD category 50 UR. Copaifera langsdorffii Desf. (133), Lafoensia pacari A. St.-Hil. (131), and Cecropia pachystachya Trécul (126) were the

  6. Does inter-plant variation in sprouting time affect the growth/reproduction trade-off and herbivory in a tropical tree species?

    Directory of Open Access Journals (Sweden)

    Marcilio Fagundes

    Full Text Available ABSTRACT The timing of phenological events varies within and among populations, affecting the performance of individual plants differently. We evaluated the effects of relative variation in sprouting time on the display of reproductive events, vegetative growth and herbivory in Copaifera langsdorffii (Fabaceae. A total of 93 trees of C. langsdorffii was monitored daily to determine their sprouting time. We collected ten terminal branches of each plant to evaluate vegetative growth, production of defense compounds and insect herbivore damage. The sprouting time for the studied population lasted 67 days. Variation in sprouting time did not affect the probability of plants to enter the reproductive stage. Plants that entered the reproductive stage showed greater vegetative biomass. Variation in sprouting time had a negative relationship with branch growth and a positive relationship with the number of leaflets. Leaf phenol concentration did not vary in relation to sprouting time or plant phenology, but herbivory was higher in plants that sprouted later. The relationships among plant sprouting time, vegetative development and display of reproductive stage in C. langsdorffii are discussed. The results of this study also suggest that early sprouting prior to the rainy season is a strategy used by C. langsdorffii to escape herbivores attacks.

  7. Endodontics pastes formulated with copaiba oil: action on oral microbiota and dentin bridge formation in dogs

    Directory of Open Access Journals (Sweden)

    Fernanda Gosuen Gonçalves Dias

    2015-06-01

    Full Text Available This study analysed the effect of pastes formulated with calcium hydroxide P.A. and different vehicles (saline solution - paste A and Copaifera langsdorffii Desfon oil - paste B on oral microorganisms and dentin bridge formation in dogs. The antimicrobial action of the pastes and their components was analysed by the minimum inhibitory concentration in agar gel technique. The components were diluted and tested on fifteen standard strains of microorganisms associated with endodontic diseases. The microorganisms were cultivated and after incubation data was analysed using One-Way ANOVA and Turkey's test (P≤0.05. Four superior incisors of ten animals were used to evaluate dentin bridge formation. Two incisors were capped with paste A (GA and two with paste B (GB. After 90 days, the teeth were extracted for histological analysis and the degree of dentin bridge formation evaluated. Data was analysed by the Kruskal-Wallis test (P<0.05. The pastes and their components were classified in the following decreasing order of antimicrobial action: calcium hydroxide P.A., paste A, paste B and Copaifera langsdorffii Desfon oil. Calcium hydroxide P.A. showed significantly higher antimicrobial action than the pastes or their vehicles. No significant difference was observed between the two pastes in dentin bridge formation. Based on the microorganisms studied, it can be concluded that the pastes analysed showed similar antimicrobial potential but differed significantly from their individual components. No significant difference was observed in dentin bridge formation between the different pastes tested.

  8. Tombamento de mudas de espécies florestais causado por Sclerotium rolfsii Sacc Damping-off of forest species caused by Sclerotium rolfsii Sacc

    Directory of Open Access Journals (Sweden)

    Reginaldo Gonçalves Mafia

    2007-08-01

    Full Text Available O estudo objetivou avaliar a gama de hospedeiros de Sclerotium rolfsii por inoculação controlada das seguintes espécies florestais nativas e exóticas: Anadenanthera peregrina (angico-vermelho, Chorisia speciosa (paineira-rosa, Clitoria fairchildiana (sombreiro, Copaifera langsdorffii (copaíba, Delonix regia (flamboyant-vermelho, Enterolobium contortisiliquum (orelha-de-negro, Leucaena leucocephala (leucena, Mabea fistulifera (canudo-de-pito, Platymiscium pubescens (tamboril-da-mata, Senna macranthera (fedegoso, Spathodea campanulata (espatódea e Tabebuia avellanedae (ipê-roxo, bem como comprovar o tombamento de mudas em pré e pós-emergência. Todas as espécies foram suscetíveis ao tombamento de mudas causado por S. rolfsii, em pré e em pós-emergência.The host range of Sclerotium rolfsii was evaluated by controlled inoculation of the following native and exotic forest species: Anadenanthera peregrina (angico vermelho, Chorisia speciosa (paineira rosa, Clitoria fairchildiana (sombreiro, Copaifera langsdorffii (copaíba, Delonix regia (flamboyant vermelho, Enterolobium contortisiliquum (orelha de negro, Leucaena leucocephala (leucena, Mabea fistulifera (canudo-de-pito, Platymiscium pubescens (tamboril da mata, Senna macranthera (fedegoso, Spathodea campanulata (espatódea e Tabebuia avellanedae (ipê roxo. The fungus caused damping-off in pre and post emergence in all tested species.

  9. Growth and photosynthetic capacity in two woody species of cerrado vegetation under different radiation availability

    Directory of Open Access Journals (Sweden)

    Ronquim Carlos Cesar

    2003-01-01

    Full Text Available Seedlings of two woody species of cerrado vegetation, Copaifera langsdorffii and Eriotheca gracilipes, were studied under three different radiation availability (100, 80 and 30% transmittance. Full solar radiation brought about more biomass, higher total leaf area, higher maximal photosynthesis per crown on area or on mass bases and higher photosynthetic capacity on area bases. Only the photosynthetic capacity values on leaf mass bases were higher in both species under low radiation availability (80 and 30% transmittance. The differences of accumulated biomass appeared more clearly after 4 months of sowing but the root/shoot dry biomass ratio and height were maintained constant for both species independently of the available radiation. Cultivated under full solar radiation both species will be able to cover more suitable the two processes during seedling's phase: growth and defense.

  10. MATHEMATICAL MODELS AND CURVES OF EQUILIBRIUM MOISTURE CONTENT OF SEEDS OF JACARANDA-DA-BAHIA, ANGICO-VERMELHO AND ÓLEO-COPAÍBA

    Directory of Open Access Journals (Sweden)

    Paulo Cesar Corrêa

    2001-01-01

    Full Text Available The hygroscopic capacity of most of seeds and agricultural grains have already been studied, however, it can be observed in the specialized literature a lack of reports on equilibrium moisture content of seeds of jacaranda-da-bahia (Dalbergia nigra Fr. All., angico-vermelho (Anadenanthera macrocarpa Benth. and óleo-copaiba (Copaifera langsdorffii Benth.. This research objectived to determine the desorption curves for these seeds, and to adjust different mathematical models already traditionally used for another seeds, to the experimental data. The equation of Sigma-Copace, with the constants determined for the species of jacaranda-da-bahia and angico-vermelho, was the model that better adjusted to the experimental data, while for óleo-copaiba the of Henderson-Modified equation represented better the experimental data.

  11. An Ecological Comparison of Floristic Composition in Seasonal Semideciduous Forest in Southeast Brazil: Implications for Conservation

    Directory of Open Access Journals (Sweden)

    Sérgio de Faria Lopes

    2012-01-01

    Full Text Available We examined floristic patterns of ten seasonal semideciduous forest sites in southeastern Brazil and conducted a central sampling of one hectare for each site, where we took samples and identified all individual living trees with DBH (diameter at breast height, 1.30 m ≥4.8 cm. Arboreal flora totaled 242 species, 163 genera, and 58 families. Fabaceae (38 species and Myrtaceae (20 species were families with the largest number of species. Only Copaifera langsdorffii and Hymenaea courbaril occurred at all sites. Multivariate analysis (detrended correspondence analysis and cluster analysis using two-way indicator species analysis (TWINSPAN indicated the formation of a group containing seven fragments in which Siparuna guianensis was the indicator species. This analysis revealed that similarities between studied fragments were due mainly to the successional stage of the community.

  12. Anatomical and morphological modifications in response to flooding by six Cerrado tree species

    Directory of Open Access Journals (Sweden)

    Adilson Serafim de Oliveira

    2015-12-01

    Full Text Available Wetlands are common in the Cerrado (Brazilian savannas biome, however flooding of these wetlands impairs growth and development of most plants. We evaluated flood tolerance of typical Cerrado trees. Seedlings of Aspidosperma macrocarpon (Apocynaceae, Tabebuia rosea (Bignoniaceae, Handroanthus chrysotrichus (Bignoniaceae, Myracrodruon urundeuva (Anacardiaceae, Kielmeyera coriacea (Calophyllaceae and Copaifera langsdorffii (Fabaceae were flooded up to the stem base for 30 days. Stems with cortical cracks, secondary aerenchyma and hypertrophic lenticels were observed in flooded plants of M. urundeuva,H. chrysotrichus and T. rosea while adventitious roots were formed in flooded plants of T. rosea and H. chrysotrichus. However, only T. rosea developed aerenchyma in the root cortex. K. coriacea and A. macrocarpon were the most sensitive to flooding, showing a decrease in survival and necrosis of the leaves and roots. C. langsdorffii and M. urundeuva were less sensitive to flooding, although reductions in root biomass and symptoms of necrosis of the roots were noticeable in flooded seedlings. Flooded M. urundeuva seedlings also had a decrease in total leaf area, leaf biomass, total biomass and in stem growth. Flooding affected root development and reduced stem growth of H. chrysotrichus with symptoms of necrosis of the leaves and roots. T. rosea was the only species where symptoms of injury from flooding were not evident.

  13. Superação de dormência de sementes como estratégia para restauração florestal de pastagem tropical Seed dormancy overcoming as a strategy for forest restoration in tropical pasture

    Directory of Open Access Journals (Sweden)

    Silvia Rahe Pereira

    2013-02-01

    Full Text Available O objetivo deste trabalho foi avaliar a influência de tratamentos de superação da dormência de sementes sobre a taxa e o tempo de emergência de espécies arbóreas de Fabaceae, e sobre seu estabelecimento, quando reintroduzidas em pastagem, no Cerrado. Foram realizados experimentos em casa de vegetação e em campo (pastagem de Urochloa brizantha, com as espécies Mimosa caesalpiniifolia, Peltophorum dubium, Pterogyne nitens, Dimorphandra mollis, Copaifera langsdorffii e Hymenaea stigonocarpa, submetidas ou não aos seguintes tratamentos de superação de dormência: D. mollis e H. stigonocarpa, escarificação mecânica; C. langsdorffii e M. caesalpiniifolia, escarificação química com H2SO4; P. nitens, punção do tegumento; e P. dubium, imersão em água a 80ºC. O estabelecimento em campo foi monitorado por 21 meses. A superação de dormência promoveu, em casa de vegetação, maior emergência de quatro das seis espécies avaliadas, e, no campo, de cinco espécies. Além disso, reduziu o tempo de emergência das espécies e aumentou o recrutamento de M. caesalpiniifolia, P. nitens, D. mollis e H. stigonocarpa, aos 127 dias, e de H. stigonocarpa aos 659 dias. Os tratamentos de superação de dormência podem aumentar a eficiência da semeadura direta, em projetos de restauração de áreas degradadas no Cerrado, ao promover maior emergência das sementes e o estabelecimento das plantas.The objective of this work was to evaluate the influence of seed dormancy overcoming treatments on the rate and time of emergence of Fabaceae tree species, and on their recruitment when reintroduced in a tropical pasture, in the Brazilian Cerrado. Experiments were carried out in greenhouse and field (Urochloa brizantha pasture, with the species Mimosa caesalpiniifolia, Peltophorum dubium, Pterogyne nitens, Dimorphandra mollis, Copaifera langsdorffii and Hymenaea stigonocarpa, subjected or not to the following treatments of dormancy break: D. mollis and

  14. SOBREVIVÊNCIA E CRESCIMENTO DE SETE ESPÉCIES ARBÓREAS NATIVAS EM UMA ÁREA DEGRADADA DE FLORESTA ESTACIONAL DECIDUAL, NORTE DE MINAS GERAIS1

    Directory of Open Access Journals (Sweden)

    Yule Roberta Ferreira Nunes

    2015-10-01

    Full Text Available RESUMO Este trabalho objetivou avaliar o crescimento e sobrevivência de sete espécies arbóreas nativas em diferentes tratamentos, em uma área degradada na Reserva da COPASA (Juramento, MG. Para tal, foram utilizados aproximadamente 1,2 ha da área, onde foram plantadas 899 mudas, de sete espécies nativas (Anadenanthera colubrina, Copaifera langsdorffii, Dilodendron bipinatum, Myracrodruon urundeuva, Pterogyne nitens, Schinopsis brasiliensis e Senegalia polyphylla, acompanhadas durante 24 meses. A área foi dividida em cinco parcelas de 0,24 ha, que representaram os seguintes tratamentos: (T1 parcela semeada com capim (Brachiaria sp.; (T2 parcela onde as covas foram tratadas com condicionador de solo; (T3 parcela semeada com capim consorciado com leguminosa (Cajanus cajan; (T4 parcela semeada com leguminosa; e (T5 controle. A porcentagem de mortalidade foi maior no T2 e menor no T3, sendo as espécies C. langsdorffii (43,66% e S. brasiliensis (11,64% aquelas com maior e menor porcentagem de mortalidade, respectivamente. O crescimento (altura e diâmetro das mudas foi maior no T2 (24,32 ± 26,05 cm e 0,51 ± 0,37 mm, respectivamente e menor no T1 (10,82 ± 22,57 cm e 0,26 ± 0,27 mm; respectivamente. As espécies com maior crescimento em altura foram A. colubrina e S. polyphylla, já D. bipinatum e S. brasiliensis apresentaram maior crescimento em diâmetro. Pterogyne nitens apresentou o menor crescimento, além de alta mortalidade, mostrando baixa capacidade de estabelecimento em ambientes degradados.

  15. Análise estrutural e considerações sobre a dinâmica sucessional de dois fragmentos florestais semideciduais do Jardim Botânico Municipal de Bauru, SP, Brasil Structural analysis and considerations on the successional dynamic of two semideciduous forest fragments at the Municipal Botanical Garden of Bauru, SP, Brazil

    Directory of Open Access Journals (Sweden)

    Marcelo Henrique Ongaro Pinheiro

    2009-12-01

    Full Text Available Parâmetros fitossociológicos, como freqüência de classes de altura e de diâmetro, são muito utilizados em inferências sobre sucessão secundária em fitocenoses. Indivíduos abustivo-arbóreos com no mínimo 1,5 m de altura e fuste a 1,3 m, foram amostrados em 2.600 m² de floresta estacional semidecidual do Jardim Botânico Municipal de Bauru (JBMB. Informações sobre as freqüências de classes de diâmetro das cinco espécies com maior índice de valor de importância (Ocotea pulchella, Protium heptaphyllum, Copaifera langsdorffii, Platypodium elegans e Trichilia pallida e a classificação sucessional das populações mais numerosas também foram analisadas para inferências sobre as características sucessionais da comunidade estudada. As freqüências de classes de diâmetro de Vochysia tucanorum, espécie típica de savana, também foi estudada. As informações obtidas permitiram considerar que a floresta do JBMB encontra-se em estádio sucessional intermediário, e que, embora tenha sofrido com a ação do fogo no passado, algumas dessas populações estão conseguindo renovar-se.Phytosociological parameters, as the frequency of height and diameter classes, are commonly used to make inferences about secondary succession in given phytocenoses. Shrub and tree individuals higher than 1.5 m and with a bole length of at least 1.3 m were sampled in 2,600 m2 of semideciduous seasonal forest in the Municipal Botanical Garden of Bauru (JBMB. Information on the diameter class frequencies of five species with the highest Importance Value Index (Ocotea pulchella, Protium heptaphyllum, Copaifera langsdorffii, Platypodium elegans and Trichilia pallida and the more numerous species' successional classification were analyzed to make inferences about the successional features of the studied community. The diameter class frequencies of savannic species Vochysia tucanorum were also studied. The information obtained allowed to consider that the

  16. An efficient and rapid DNA minipreparation procedure suitable for PCR/SSR and RAPD analyses in tropical forest tree species

    Directory of Open Access Journals (Sweden)

    Ana Lilia Alzate-Marin

    2009-10-01

    Full Text Available An efficient and rapid DNA minipreparation modified method for frozen samples was developed for five tropical tree species: Copaifera langsdorffii, Hymenaea courbaril, Eugenia uniflora, Tabebuia roseo alba and Cariniana estrellensis. This procedure that dispenses the use of liquid nitrogen, phenol and the addition of proteinase K, is an adaptation of the CTAB-based DNA extraction method. The modifications included the use of PVP to eliminate the polyphenols, only one chloroform-isoamyl alcohol step and the addition of RNase immediately after extraction with chloroform. The yields of the DNA samples ranged from 25.7 to 42.1 µg from 100 mg leaf tissue. The DNA samples extracted by this method were successfully used for PCR (SSR and RAPD analyses in these five and other twelve tropical tree species.Este trabalho teve como objetivo otimizar um protocolo econômico, rápido e eficaz de minipreparação de DNA genômico, para as espécies florestais Copaifera langsdorffii (Óleo de Copaíba, Hymenaea courbaril (Jatobá, Eugenia uniflora (Pitanga, Tabebuia roseo alba (Ipê Branco e Cariniana estrellensis (Jequitibá Branco. Este método é uma adaptação da técnica de extração CTAB de Doyle e Doyle (1990, o qual consiste principalmente na adição de PVP para eliminar polifenoles, somente uma etapa de extração com clorofórmio-álcool isoamílico e a adição da RNase A imediatamente após a extração com clorofórmio. O método também dispensa o uso de nitrogênio líquido, o uso do fenol e a adição de proteinase K. Os DNAs das espécies florestais extraídos apresentaram alto rendimento e boa qualidade, com rendimento de 25.7 a 42.1 µg de DNA a partir de 100 mg de tecido foliar congelado. Com este protocolo, em apenas 1 dia de trabalho, uma pessoa pode completar o isolamento do DNA de aproximadamente 50 amostras de folhas (dependendo da capacidade da centrífuga. O DNA obtido pode ser usado para métodos de análise baseados em PCR (SSR e

  17. Crescimento e teor de metais de mudas de espécies arbóreas cultivadas em solo contaminado com metais pesados Growth and metal concentration of seedlings of woody species in a heavy metal contaminated soil

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Lara Lanza de Sá e Melo Marques

    2000-01-01

    Full Text Available O objetivo do trabalho foi avaliar o teor de metais pesados e o crescimento de mudas de 20 espécies arbóreas tropicais em solo com elevado grau de contaminação com metais pesados. Em casa de vegetação, as mudas foram transplantadas para vasos contendo 3,3 kg de misturas com diferentes proporções (0, 20, 40 e 60% v/v de solo contaminado. Verificou-se comportamento diferenciado das espécies quanto à inibição de crescimento e aos teores de metais na raiz e na parte aérea em decorrência da contaminação. Com base na produção de matéria seca da parte aérea, concluiu-se que apenas Myrsine umbellata, Cedrella fissilis, Tabebuia impetiginosa e Copaifera langsdorffii não foram afetadas pela contaminação, enquanto Hymenaea courbaril, Mimosa caesalpiniaefolia, Acacia mangium e Platypodium gonoacantha sofreram pequeno impacto. As demais espécies foram muito inibidas pela contaminação do solo, o que é causado pela absorção, na maioria dos casos, de Zn e Cd. Várias espécies apresentaram elevada capacidade de reter esses metais nas raízes, evitando sua translocação para a parte aérea.The objective of the paper was to evaluate metal content and ability to grow in soil with excess of heavy metals of seedlings of 20 woody species. In the greenhouse, seedlings were transplanted to pots with 3.3 kg of soil-mixes with different proportions (0, 20, 40, 60% v/v of a heavy metal contaminated soil. It was found that plant species behaved differently in terms of growth inhibition and metal content in the shoots and roots. Based upon the dry matter yield, only Myrsine umbellata, Cedrella fissilis, Tabebuia impetiginosa and Copaifera langsdorffii were not affected by increasing contamination, whereas Hymenaea courbaril, Mimosa caesalpiniaefolia, Acacia mangium and Platypodium gonoacantha were only slightly affected by it. All the other species were highly inhibited by the excess of metals in the soil, being such effects related, in most

  18. Evaluation of the antifungal activities of various extracts from Pistacia atlantica Desf

    Directory of Open Access Journals (Sweden)

    Mehraban Falahati

    2015-09-01

    Results: Based on GC/MS analysis, the main constituents of P. atlantica fruit extracts were &beta-myrcene (41.4%, &alpha-pinene (32.48% and limonene (4.66%, respectively, whereas the major constituents of P. atlantica leaf extracts were trans-caryophyllene (15.18%, &alpha-amorphene (8.1% and neo-allo-ocimene (6.21%, respectively. As the findings indicated, all the constituents exhibited both fungistatic and fungicidal activities, with MICs ranging from 6.66 to 26.66 mg/mL and MFCs ranging from 13.3 to 37.3 mg/mL, respectively. Among the evaluated extracts, the methanolic fresh fruit extract of P. atlantica was significantly more effective than other extracts (P<0.05. Conclusion: Based on the findings of the present study, novel antifungal agents need to be developed, and use of P. atlantica should be promoted in the traditional treatment of Candida infections.

  19. Final unioned polygons for the Deserado coal area, northwest Colorado (des*fing)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — These are shape files of final unioned polygon coverages used to calculate coal resources of the B and D coal zones, Lower White River coal field, Deserado...

  20. Fitotoxicidad del fosfonato en brinzales de encina Quercus ilex L. subsp. ballota (Desf.) Samp.

    OpenAIRE

    Jorge, Inmaculada; Porras Tejero, Carlos Javier; Jorrín-Novo, Jesús V.; Ariza-Mateos, David; Navarro Cerrillo, Rafael M.

    2007-01-01

    El fosfonato es un fertilizante foliar que ha sido utilizado con éxito en el control de P. cinnamomi en varias especies forestales. Aunque se considera que los fosfonatos tienen un bajo nivel de toxicidad, se han observado síntomas de daños en varias especies y utilizando distintos métodos de aplicación. En este trabajo se estudia la fitotoxicidad de los fosfonatos en brinzales de Quercus ilex. Se han ensayado dos concentraciones de fosfonato, 10 y 15 g l-1, y se han realizado medidas de la f...

  1. Comparative morphology of leaf epidermis in eight populations of Atlas Pistachio (Pistacia atlantica Desf., Anacardiaceae).

    Science.gov (United States)

    Belhadj, Safia; Derridj, Arezki; Aigouy, Thierry; Gers, Charles; Gauquelin, Thierry; Mevy, Jean-Philippe

    2007-10-01

    A comparative analysis was undertaken to conduct a micromorphological study of Pistacia atlantica leaves by comparing different populations grown under different climatic conditions. Leaf epidermis of eight wild populations was investigated under scanning electron microscope. Micromorphological characteristics (epidermis ornament, stomata type, waxes as well as trichomes) of the adaxial and abaxial leaf surfaces were examined. The epidermis ornament varied among populations and leaf surface, the abaxial leaf surface is reticulate with a striate surface. Messaad site shows a smooth uneven surface. The adaxial leaf surface is smooth but several ornamentations can be seen. The leaflet is amphistomatic; the stomata appeared to be slightly sunken. A variety of stomatal types were recorded; actinocytic and anomocytic types are the most frequent. The indumentum consisted of glandular and nonglandular trichomes. Unicellular glandular trichomes are recorded for P. atlantica leaves in this study. Their density is higher in Oued safene site, located at the highest altitude in comparison with the other populations. The wax occurred in all the sites and its pattern varied according to the populations studied, particularly between Berriane and Messaad. The morphological variability exhibited by the eight populations of P. atlantica may be interpreted as relevant to the ecological plasticity and the physiological mechanisms involved are discussed in this report.

  2. Anti-HIV-1 activities of the extracts from the medicinal plant Linum grandiflorum Desf

    DEFF Research Database (Denmark)

    Mohammed, Magdy M. D.; Christensen, Lars Porskjær; Ibrahim, Nabaweya A.

    2009-01-01

    As part of our screening of anti-AIDS agents from natural sources e.g. Ixora undulata, Paulownia tomentosa, Fortunella margarita, Aegle marmelos and Erythrina abyssinica, the different organic and aqueous extracts of Linum grandiflorum leaves and seeds were evaluated in vitro by the microculture ...

  3. [Competitiveness of hard wheat (Triticum durum Desf.) varieties against ripgut brome (Bromus rigidus Roth)].

    Science.gov (United States)

    Hamal, A; Benbella, M; Rzozi, S B; Bouhache, M; Msatef, Y

    2001-01-01

    Varieties with an excellent competitiveness against ripgut brome (Bromus rigidus Roth.) would be very important to reinforce others methods to control ripgut brome weed. This study was carried out in 1999-2000 season in a greenhouse experiment to test the aggressiveness degree of six varieties of hard wheat (Oum Rabia, Isly, Marzak, Karim, Sebou, and Massa) combined with ripgut brome. Plant density was fixed at 16 plants of wheat or Bromus for pure crop and 8 plants for wheat and 8 for Bromus mixture. The results showed that the numbers of kernels/spikes were higher in the mixture for on pure composition. For the kernel weight, the result was opposite except for Isly and Marzak varieties. Karim and Isly varieties obtained the highest grain yield and were more competitive in mixture composition but Sebou and Massa varieties were less competitive against ripgut brome. Results of ripgut brome productivity and water use efficiency were similar and were used to determine the aggressiveness coefficient of hard wheat varieties against ripgut brome. The reduction of the shoot dry matter of brome was 22 to 56% at flowering. The grain yield of brome was reduced from 57 to 81%.

  4. Behavior of Triticum durum Desf. arabinoxylans and arabinogalactan peptides during industrial pasta processing.

    Science.gov (United States)

    Ingelbrecht, J A; Verwimp, T; Grobet, P J; Delcour, J A

    2001-04-01

    Three industrial pasta processing lines for different products (macaroni, capellini and instant noodles) were sampled at three subsequent stages (semolina, extruded, and dried end products) in the process. Arabinoxylans (AX) and arabinogalactan peptides (AGP) were analyzed. Although very low endoxylanase activities were measured, the level of water-extractable AX (WE-AX) increased, probably because of mechanical forces. No change was observed in the level and structural characteristics of AGP. The WE-AX molecular weight (MW) profiles showed a very small shift toward lower MW profiles; those of AGP revealed no changes as a result of the production process. After separation of WE-AX and AGP, (1)H NMR analysis and gas chromatography of the alditol acetates obtained following hydrolysis, reduction, and acetylation revealed no changes in the arabinose substitution profile of the WE-AX samples during pasta processing. At optimal cooking times, WE-AX losses in the cooking water are small (maximally 5.9%). However, the loss of AGP is more pronounced (maximally 25.0%). Overcooking led to more losses of both components.

  5. Thin films of xyloglucans for BSA adsorption

    Energy Technology Data Exchange (ETDEWEB)

    Jo, T.A. [Department of Biochemistry and Molecular Biology, Federal University of Parana, Curitiba, PR (Brazil); Laboratory of Biopolymers, Department of Chemistry, Federal University of Parana, Curitiba, PR (Brazil); Petri, D.F.S. [Institute of Chemistry, University of Sao Paulo, Sao Paulo, SP (Brazil); Valenga, F. [Department of Biochemistry and Molecular Biology, Federal University of Parana, Curitiba, PR (Brazil); Laboratory of Biopolymers, Department of Chemistry, Federal University of Parana, Curitiba, PR (Brazil); Lucyszyn, N. [Laboratory of Biopolymers, Department of Chemistry, Federal University of Parana, Curitiba, PR (Brazil); Sierakowski, M.-R. [Laboratory of Biopolymers, Department of Chemistry, Federal University of Parana, Curitiba, PR (Brazil)], E-mail: mariarita.sierakowski@ufpr.br

    2009-03-01

    In this work, XG extracted from Tamarindus indica (XGT) and Copaifera langsdorffii (XGC) seeds were deposited onto Si wafers as thin films. The characteristics of XGT and XGC adsorbed layers were compared with a commercial XG sample (TKP, Tamarind kernel powder) by ellipsometry and atomic force microscopy (AFM). Moreover, the adsorption of oxidized derivative of XGT (To60) onto amino-terminated Si wafers and the immobilization of bovine serum albumin (BSA) onto polysaccharides covered wafers, as a function of pH, were also investigated. The XG samples presented molar ratios Glc:Xyl:Gal of 2.4:2.1:1 (XGC); 2.8: 2.3: 1 (XGT) and 1.9:1.9:1 (TKP). The structure of XGT and XGC was determined by O-methy alditol acetate derivatization and showed similar features, but XGC confirmed the presence of more {alpha}-D-Xyl branches due to more {beta}-D-Gal ends. XGT deposited onto Si adsorbed as fibers and small entities uniformly distributed, as evidenced by AFM, while TPK and XGC formed larger aggregates. The thickness of To60 onto amino-terminated surface was similar to that determined for XGT onto Si wafers. A maximum in the adsorbed amount of BSA occurred close to its isoelectric point (5.5). These findings indicate that XGT and To60 are potential materials for the development of biomaterials and biotechnological devices.

  6. Heavy-metal-contaminated industrial soil: Uptake assessment in native plant species from Brazilian Cerrado.

    Science.gov (United States)

    Meyer, Sylvia Therese; Castro, Samuel Rodrigues; Fernandes, Marcus Manoel; Soares, Aylton Carlos; de Souza Freitas, Guilherme Augusto; Ribeiro, Edvan

    2016-08-02

    Plants of the Cerrado have shown some potential for restoration and/or phytoremediation projects due to their ability to grow in and tolerate acidic soils rich in metals. The aim of this study is to evaluate the tolerance and accumulation of metals (Cd, Cu, Pb, and Zn) in five native tree species of the Brazilian Cerrado (Copaifera langsdorffii, Eugenia dysenterica, Inga laurina, Cedrela fissilis, Handroanthus impetiginosus) subjected to three experiments with contaminated soils obtained from a zinc processing industry (S1, S2, S3) and control soil (S0). The experimental design was completely randomized (factorial 5 × 4 × 3) and conducted in a greenhouse environment during a 90-day experimentation time. The plant species behavior was assessed by visual symptoms of toxicity, tolerance index (TI), translocation factor (TF), and bioaccumulation factor (BF). C. fissilis has performed as a Zn accumulator by the higher BFs obtained in the experiments, equal to 3.72, 0.88, and 0.41 for S1, S2, and S3 respectively. This species had some ability of uptake control as a defense mechanism in high stress conditions with the best behavior for phytoremediation and high tolerance to contamination. With economical and technical benefits, this study may support a preliminary analysis necessary for using native tree species in environmental projects.

  7. Medicinal Plants from Northeastern Brazil against Alzheimer's Disease

    Science.gov (United States)

    Ribeiro, Alan Bezerra; Alves, Daniela Ribeiro; Rodrigues, Ana Livya Moreira; dos Santos, Leonardo Hunaldo; de Menezes, Jane Eire Silva Alencar

    2017-01-01

    Alzheimer's disease (AD) has been linked with oxidative stress, acetylcholine deficiency in the brain, and inflammatory processes. In the northeast region of Brazil, various plants are used to treat several diseases associated with these processes; then an antioxidant test was performed with those plants in a previous work and twelve species with higher antioxidant activity were selected for AChE inhibition evaluation. The phenolic compounds content was determined by Folin–Ciocalteu test and flavonoid content with AlCl3 reagent using UV-visible spectrophotometry. The antioxidant activity was assessed analyzing the inhibitory activity against 2,2-diphenyl-1-picrylhydrazyl (DPPH) and 2,2-azinobis-3-ethylbenzothiazoline-6-sulfonate (ABTS) and by the β-carotene/linoleic acid system and acetylcholinesterase inhibition using qualitative and quantitative tests. The combination of better acetylcholinesterase inhibitory and antioxidant activities pointed out six species, in descending order, as the best potential sources of therapeutic agents against AD: Hancornia speciosa > Myracrodruon urundeuva > Copaifera langsdorffii > Stryphnodendron coriaceum > Psidium guajava > Mangifera indica. Besides, the phenolic compounds in the species probably contribute to these activities. However, further pharmacological studies to assess the specific applications of these plants against AD are required to confirm these results. PMID:28316633

  8. Medicinal Plants from Northeastern Brazil against Alzheimer's Disease.

    Science.gov (United States)

    Penido, Alexandre Batista; De Morais, Selene Maia; Ribeiro, Alan Bezerra; Alves, Daniela Ribeiro; Rodrigues, Ana Livya Moreira; Dos Santos, Leonardo Hunaldo; de Menezes, Jane Eire Silva Alencar

    2017-01-01

    Alzheimer's disease (AD) has been linked with oxidative stress, acetylcholine deficiency in the brain, and inflammatory processes. In the northeast region of Brazil, various plants are used to treat several diseases associated with these processes; then an antioxidant test was performed with those plants in a previous work and twelve species with higher antioxidant activity were selected for AChE inhibition evaluation. The phenolic compounds content was determined by Folin-Ciocalteu test and flavonoid content with AlCl3 reagent using UV-visible spectrophotometry. The antioxidant activity was assessed analyzing the inhibitory activity against 2,2-diphenyl-1-picrylhydrazyl (DPPH) and 2,2-azinobis-3-ethylbenzothiazoline-6-sulfonate (ABTS) and by the β-carotene/linoleic acid system and acetylcholinesterase inhibition using qualitative and quantitative tests. The combination of better acetylcholinesterase inhibitory and antioxidant activities pointed out six species, in descending order, as the best potential sources of therapeutic agents against AD: Hancornia speciosa > Myracrodruon urundeuva > Copaifera langsdorffii > Stryphnodendron coriaceum > Psidium guajava > Mangifera indica. Besides, the phenolic compounds in the species probably contribute to these activities. However, further pharmacological studies to assess the specific applications of these plants against AD are required to confirm these results.

  9. Medicinal Plants from Northeastern Brazil against Alzheimer’s Disease

    Directory of Open Access Journals (Sweden)

    Alexandre Batista Penido

    2017-01-01

    Full Text Available Alzheimer’s disease (AD has been linked with oxidative stress, acetylcholine deficiency in the brain, and inflammatory processes. In the northeast region of Brazil, various plants are used to treat several diseases associated with these processes; then an antioxidant test was performed with those plants in a previous work and twelve species with higher antioxidant activity were selected for AChE inhibition evaluation. The phenolic compounds content was determined by Folin–Ciocalteu test and flavonoid content with AlCl3 reagent using UV-visible spectrophotometry. The antioxidant activity was assessed analyzing the inhibitory activity against 2,2-diphenyl-1-picrylhydrazyl (DPPH and 2,2-azinobis-3-ethylbenzothiazoline-6-sulfonate (ABTS and by the β-carotene/linoleic acid system and acetylcholinesterase inhibition using qualitative and quantitative tests. The combination of better acetylcholinesterase inhibitory and antioxidant activities pointed out six species, in descending order, as the best potential sources of therapeutic agents against AD: Hancornia speciosa > Myracrodruon urundeuva > Copaifera langsdorffii > Stryphnodendron coriaceum > Psidium guajava > Mangifera indica. Besides, the phenolic compounds in the species probably contribute to these activities. However, further pharmacological studies to assess the specific applications of these plants against AD are required to confirm these results.

  10. Flavonoids modify root growth and modulate expression of SHORT-ROOT and HD-ZIP III.

    Science.gov (United States)

    Franco, Danilo Miralha; Silva, Eder Marques; Saldanha, Luiz Leonardo; Adachi, Sérgio Akira; Schley, Thayssa Rabelo; Rodrigues, Tatiane Maria; Dokkedal, Anne Ligia; Nogueira, Fabio Tebaldi Silveira; Rolim de Almeida, Luiz Fernando

    2015-09-01

    Flavonoids are a class of distinct compounds produced by plant secondary metabolism that inhibit or promote plant development and have a relationship with auxin transport. We showed that, in terms of root development, Copaifera langsdorffii leaf extracts has an inhibitory effect on most flavonoid components compared with the application of exogenous flavonoids (glycosides and aglycones). These compounds alter the pattern of expression of the SHORT-ROOT and HD-ZIP III transcription factor gene family and cause morpho-physiological alterations in sorghum roots. In addition, to examine the flavonoid auxin interaction in stress, we correlated the responses with the effects of exogenous application of auxin and an auxin transport inhibitor. The results show that exogenous flavonoids inhibit primary root growth and increase the development of lateral roots. Exogenous flavonoids also change the pattern of expression of specific genes associated with root tissue differentiation. These findings indicate that flavonoid glycosides can influence the polar transport of auxin, leading to stress responses that depend on auxin.

  11. Detection of adulterated copaiba (Copaifera multijuga Hayne oil-resins by refractive index and thin layer chromatography

    Directory of Open Access Journals (Sweden)

    Karol de S. Barbosa

    2009-03-01

    Full Text Available The refractive indices (RI of the eight samples of copaiba oils, collected for this study at RDS Tupé ranged from 1.50284 to 1.50786. The thin layer chromatography (TLC plates of these oils revealed with anisaldehyde-sulphuric acid reagent showed dark lilac stains with several small stains at low Rf and a large rounded stain at high Rf. On the other hand, the twelve copaiba oils purchased at local markets presented RI between 1.48176 and 1.50886, and the TLC plates, showed as general profile blue stains, with smaller superimposed stains at low Rf, bigger superimposed stains like elongated stain at high Rf and a colorless rounded stain at middle Rf. Among 12 purchased oils at local markets, a three oil-resins presented similar RI and TLC profile to those observed for collected copaiba oils; b six oils showed same RI and TLC profiles to those observed for soybean oil; c three samples presented RI near to those showed by copaiba oil-resin, however the TLC profile was near to profile observed for a prepared mixture soybean oil: copaiba oil, two samples with 3:1 proportion and one sample with 1:3 proportion. Therefore, the RI determination and the TLC profiles could be considered rapid and efficient procedures for detection of vegetal oil in the copaiba oil-resins.

  12. Establishment limitation of holm oak (Quercus ilex subsp ballota (Desf.) Samp.) in a Mediterranean savanna - forest ecosystem

    NARCIS (Netherlands)

    Smit, Christian; Diaz, Mario; Jansen, Patrick

    2009-01-01

    Tree recruitment in Mediterranean savannas is generally hampered, in contrast with the original oak forests where these savannas are derived from. We asked whether this difference in recruitment success can be explained by differential post-dispersal survival. For one year we monitored experimentall

  13. Determination of Variability Between Grain Yield and Yield Components of Durum Wheat Varieties (Triticum durum Desf. in Thrace Region

    Directory of Open Access Journals (Sweden)

    T. Kahraman

    2008-05-01

    Full Text Available Variability of grain yield and some yield components of 17 durum wheat varieties with native and exotic originated was investigated. This research was performed under rainfed conditions in three different environments (Tekirdağ, Lüleburgaz and Edirne during two growing years (2001-2002 and 2002-2003. Significant differences among cultivars, locations and production years were determined. The highest variations among characters were found in grain weight/spike, grains/spike, spike length and grain yield. In the first experimental year, there was a high positive significant correlation between grain yield and grain weight/spike, test weight and 1000 grain weight. In the second experimental year, grain yield showed positive and significant correlations with 1000 grain weight, test weight and stem length. The biggest differences among investigated cultivar of durum wheat were found in stem length, grains/spike and 1000 grain weight. Grain yield of examined cultivars depended mainly on 1000 grain weight, test weight, grain weight/spike and agroecological conditions during the growing period. However, location, production year and genotypes were the most important determinant of potential yield of cultivars. Ç 1252, Fuatbey 2000, Epidur, Kızıltan95, Aydın 93 and Altın 97 were found more suitable cultivars that the others for durum wheat production in Thrace Region.

  14. Effects of Water Regime on the Structure of Roots and Stems of Durum Wheat (Triticum durum Desf.

    Directory of Open Access Journals (Sweden)

    Amina Labdelli

    2014-01-01

    Full Text Available Yield improvement of durum wheat is considerably limited by the expression of environmental abiotic factors. Water deficits are one of these limiting factors. Plants develop various strategies to tolerate the effects of water deficit. Some of such mechanisms might occur in the root and stem systems. The present study aimed to investigate some anatomical traits contributing to the drought tolerance in the durum wheat. The anatomical variations of the meristem of roots and stems, as a response to water deficit, were evaluated. The results indicated that the enhancement of the intensity of water deficit was accompanied by profound structural changes in the piliferous zone of roots. Water deficit caused a significant decrease in the diameter of the newly formed adventitious roots, which can be explained by a reduction in the thickness of the cortical parenchyma, through the reduction of cell size. This action was usually a contrary effect in the principal adventitious roots. The study also showed that increasing the intensity of water deficit reduced the diameter of vessels in the primary xylem, thereby increasing the hydraulic resistance of roots and lowering the flow of sap.

  15. Flutuações temporais nos padrões de distribuição diamétrica da comunidade arbóreo-arbustivo e de 15 populações em um fragmento florestal Temporal fluctuations in the diametric distribution patterns of the trees and shrub community and 15 populations in a forest fragment

    Directory of Open Access Journals (Sweden)

    Evandro Luiz Mendonça Machado

    2010-08-01

    Full Text Available Objetivando caracterizar possíveis flutuações nos padrões de distribuição diamétrica foram analisadas, num intervalo de cinco anos (2000-2005, a comunidade e as populações das 15 espécies mais abundantes do compartimento arbóreo de um remanescente de Floresta Semidecídua. A distribuição diamétrica da comunidade apresentou alta concentração nas classes menores e diminuição acentuada no sentido das maiores (J-invertido, em ambos os inventários. As populações apresentaram padrões distintos, arbitrariamente distribuídos em dois grupos: Grupo 1, formado por espécies de menor porte e abundantes no sub-bosque, como Galipea jasminiflora, Allophylus edulis, Sebastiania commersoniana, Dendropanax cuneatus e Mollinedia widgrenii, e também espécies de árvores altas e pioneiras, como Acacia polyphylla e Piptadenia gonoacantha, cujas distribuições diamétricas seguiram o modelo J-invertido. Com exceção de Calycorectes acutatus, todas as demais espécies do Grupo 2 (Platycyamus regnellii, Cupania vernalis, Machaerium stipitatum, Machaerium villosum, Copaifera langsdorffii, Persea major e Cassia ferruginea eram de maior porte, cujos adultos predominavam no dossel da floresta, elevando a área basal e apresentando densidade de indivíduos menor nas classes diamétricas inferiores. No intervalo considerado, apenas D. cuneatus alterou seu padrão de distribuição (Grupo 1-Grupo 2, enquanto as demais os acentuaram. No Grupo 1, a síndrome de dispersão preferencial era anemocórica ou autocórica, ao passo que no Grupo 2 predominava a zoocoria. Assim, o remanescente, por apresentar área pequena, forma alongada e localização semiurbana associada a um regime de intensas perturbações, pode ter ocasionado empobrecimento da fauna dispersora, prejudicando a taxa de recrutamento.Aiming to characterize possible fluctuations in the patterns of diametric distribution, the community and the populations of the 15 most abundant tree species

  16. Análise físico-química do óleo-resina e variabilidade genética de copaíba na Floresta Nacional do Tapajós Physico-chemical analysis of the oleoresin and genetic variability of copaiba in the Tapajós National Forest, Brazil

    Directory of Open Access Journals (Sweden)

    Ederly Santos Silva

    2012-11-01

    Full Text Available O objetivo deste trabalho foi caracterizar o óleo-resina da copaíba (Copaifera reticulata e estimar, por meio de marcadores microssatélites, a variabilidade genética da espécie na Floresta Nacional do Tapajós, PA. A amostragem foi realizada em duas áreas, distanciadas de 5 km, em 136 árvores. A diversidade genética foi avaliada com seis marcadores microssatélites derivados de C. langsdorffii, e o óleo obtido de 30 árvores (15 de cada área foi caracterizado em termos físicos e químicos. O óleo C. reticulata apresenta aspecto líquido, fino, odor fraco e de coloração amarelo-dourada (73,3% das plantas, com viscosidade muito variável (18 a 187 Pa-s e densidade média de 0,975±0,049 g cm-3. O índice de acidez variou de 9,62 a 10,17 mg g-1 de KOH e o de saponificação de 100,63 a 109,84 mg g-1. A análise molecular identificou 78 alelos, com média de 13 por loco. A heterozigosidade esperada variou 0,59 a 0,85 (média de 0,75, com nível de endogamia de 0,375 a 0,419. Houve pouca diferenciação genética entre as populações das diferentes áreas de coleta (F ST = 0,030, mas a variabilidade foi maior entre os grupos genéticos detectados pelo programa Structure (F ST = 0,070. Essa maior variabilidade indica que não há ameaças à conservação genética da copaíba, em médio prazo.The objective of this work was to characterize the oleoresin of copaiba (Copaifera reticulata and to estimate genetic variability of the species in the Tapajós National Forest, PA, Brazil, using microsatellite markers. Sampling was performed in two areas, 5 km apart, in 136 trees. Genetic diversity was evaluated with six microsatellite markers derived from C. langsdorffii, and the oleoresin obtained from 30 trees (15 from each area was physically and chemically characterized. Oleoresin from C. reticulate has a liquid, thin aspect, with a weak odor and yellowish-gilded color (73.3% of the plants, highly variable viscosity (18 to 187 Pa-s, and mean

  17. Fitossociologia e estrutura diamétrica da mata de galeria do Taquara, na reserva ecológica do IBGE, DF Phytosociology and diametric estructure of Taquara gallery forest, at IBGE ecological reserve, DF

    Directory of Open Access Journals (Sweden)

    Manoel Cláudio da Silva Júnior

    2004-06-01

    Full Text Available (Florística e estrutura na mata do Taquara, Reserva Ecológica do IBGE, DF. As matas de Galeria, apesar de legalmente protegidas, vêm sendo sistematicamente substituídas visando a outras finalidades. As árvores (DAP³ 5 cm na mata de Galeria do córrego do Taquara, na Reserva Ecológica do IBGE, no Distrito Federal, foram amostradas pelo método de quadrantes, com 250 pontos, dispostos em linhas estabelecidas ao longo do comprimento do córrego, desde as margens até os limites entre a mata e o cerrado. A amostragem de 1.000 árvores resultou na composição florística, na fitossociologia e na distribuição dos diâmetros dos troncos. No total foram amostradas 110 espécies de 49 famílias. O índice de diversidade de Shannon & Wiener foi estimado em 4,25 nats.ind-1. As famílias mais importantes foram: Leguminosae (lato sensu, Rubiaceae, Anacardiaceae, Euphorbiaceae e Sapindaceae, enquanto as espécies principais foram: Tapirira guianensis, Copaifera langsdorffii, Lamanonia ternata, Anadenanthera colubrina var. cebil, Piptocarpha macropoda, Alibertia macrophylla, Matayba guianensis, Pera glabrata, Guettarda viburnioides e Ixora warmingii. As estimativas da densidade e da área basal total foram de 1.573 árvores.ha-1, e 38,5 m².ha-1 respectivamente. A distribuição diamétrica indicou uma curva tendendo para o `J' invertido, evidenciando os baixos níveis de distúrbios ocorridos na mata. Uma comparação florística conduzida entre 21 matas de Galeria no Distrito Federal apontou a mata do Taquara como uma área rica, com 110 (29,1% das 378 espécies listadas e similaridade de Sørensen variando entre 0,34 e 0,80, nas matas incluídas.(Floristics and structure of the, IBGE, Federal District, Brazil. Despite been protected by law gallery forests have been systematically replaced by other uses. The study focused on the Taquara gallery forest within the Ecological Reserve of the "Instituto Brasileiro de Geografia e Estatística" in the

  18. PHYTOSSOCIOLOGY AND DIAMETRIC ESTRUCTURE IN THE GALLERY FOREST OF PITOCO, IN THE ECOLOGICAL RESERVE OF IBGE, DF

    Directory of Open Access Journals (Sweden)

    Manoel Cláudio da Silva Júnior

    2005-06-01

    Full Text Available The gallery forest, in the cerrado region, has a very important function on the environmental and social equilibrium.Despite been protected by law, gallery forests have been systematically replaced by agriculture and other regional uses. One thousandtrees (DAP 5cm were sampled using point centered-quarter (PCQ method. Sampling lines were established, from the head to themouth of the stream and from the stream margins to the forest-cerrado border, of the Pitoco gallery forest, in the IBGE EcologicalReserve, in Federal District, Brazil. Results showed 99 species of 46 families in the area. The most important families were:Leguminosae, Vochysiaceae, Rubiaceae, Anacardiaceae, Euphorbiaceae, Lauraceae, Burseraceae, Moraceae, Annonaceae eSymplocaceae, while the most important species were: Callisthene major, Tapirira guianensis, Protium almecega, Copaifera langsdorffii,Sclerolobium paniculatum var. rubiginosum, Pseudolmedia guaranítica, Faramea cyanea, Emmotum nitens, Lamanonia ternata,Maprounea guianensis, excluding the group of dead trees which was ranked in the 5th position. Density and basal area were estimatedas 1971 trees.ha-1 and 38,8 m².ha-1 ,respectively. Diameter distribution showed a tendency to an inverted J curve revealing low levelsof disturbance in this gallery forest. A floristic comparison carried out with 21 gallery forests in the Federal District indicated Pitocogallery forest as a rich site including 99 (26,2% of the total of 378 species recorded, a Shannon & Weaver diversity index estimatedas 3,86 nats.ind-1 and Sørensen similarities ranging from 0,29 to 0,80 with DF gallery forests.

  19. Ensayos preliminares sobre la aptitud del cativo (prioria copaifera) para la elaboración de tableros de pajilla-cemento

    OpenAIRE

    Hoheisel Hannes; López G. Octavio

    2012-01-01

    Uno de los mayores problemas que afronta la industria maderera en la actualidad es el de la utilización de los desperdicios de madera resultantes de la elaboración de los productos básicos de la empresa, así como también la dificultad en la utilización integral del bosque debido a la abundancia de especies de poco o ningún valor comercial. En el presente estudio se analizan las posibilidades del Cativo para la elaboración de tableros de pajilla de madera y cemento, material éste que podría em...

  20. Development of COS-SNP and HRM markers for high-throughput and reliable haplotype-based detection of Lr14a in durum wheat (Triticum durum Desf.)

    OpenAIRE

    Terracciano, I.; Maccaferri, M.; Bassi, F; Mantovani, P; Šimková, H. (Hana); Doležel, J. (Jaroslav); Tuberosa, R

    2013-01-01

    Leaf rust (Puccinia triticina Eriks. & Henn.) is a major disease affecting durum wheat production. The Lr14a-resistant gene present in the durum wheat cv. Creso and its derivative cv. Colosseo is one of the best characterized leaf-rust resistance sources deployed in durum wheat breeding. Lr14a has been mapped close to the simple sequence repeat markers gwm146, gwm344 and wmc10 in the distal portion of the chromosome arm 7BL, a gene-dense region. The objectives of this study were: (1) to enric...

  1. Quantification of total phenols, flavonoides and tannins from Ziziphus jujuba (mill. and Ziziphus lotus (l. (Desf. Leaf extracts and their effects on antioxidant and antibacterial activities

    Directory of Open Access Journals (Sweden)

    Meriem Elaloui

    2017-01-01

    Full Text Available This work was performed to determine the biochemical composition, antioxidant and antimicrobial activities of leaf extracts collected from four different provenances: Mahdia and Mahres (Ziziphus jujuba; Kairouan and Rouhia (Ziziphus lotus. Total phenols, flavonoids, tannins contents and antioxidant activity were evaluated using the Folin ciocalteux, Aluminum trichloride, vanillin and scavenging activity on 2, 2-diphenyl-1-picrylhydrazyl (DPPH radicals methods, respectively. The antimicrobial activity was evaluated against three bacterial strains (Escherichia coli, Staphylococcus aureus and klebsiella pneumoniea and three fungal strains (Fusarium culmorum, Fusarium solani and Botrytis cinerea, according to well Agar diffusion method. Total phenols and flavonoids were present at levels of 21.98 mg GAE /g DW and 7.80 mg ER/g DW; respectively in Ziziphus lotus. These levels did not exceeded 13.70 mg GAE /g DW and 6.73 mg ER/g DW for Ziziphus jujuba. The tannin contents were present in equal levels (7.9 mg EC/g DW in two species. The high antioxidant activity (0.01 µg/ml was noted in Rouhia provenance. The Ziziphus lotus leaf extracts showed promising efficiency against all tested microorganisms with a zone of inhibition ranging between 22 and 23.5 mm. This study could validate the medicinal potential of Ziziphus specie and explain why tunisian people traditionally use it in medicine to treat several pathologies. Ziziphus leaf extracts may be suggested in foods and pharmaceutical industries. Leaf extracts proved also to be effective against tested microorganisms. So, an adequate toxicological study must be carried out to verify the possibility of using these plants for fighting microorganisms.

  2. The ozone-like syndrome in durum wheat (Triticum durum Desf.): Mechanisms underlying the different symptomatic responses of two sensitive cultivars.

    Science.gov (United States)

    Picchi, Valentina; Monga, Robert; Marzuoli, Riccardo; Gerosa, Giacomo; Faoro, Franco

    2017-03-01

    Colombo and Sculptur are two modern durum wheat cultivars that, in previous studies, proved to be very sensitive to ozone injury in terms of eco-physiological parameters and significant grain yield loss. Nevertheless, their response regarding leaf visible symptoms was very different; Sculptur showed almost no symptoms, even after several weeks of ozone exposure, whereas Colombo showed in a few weeks typical ozone-like symptoms (chlorotic/necrotic spots). The mechanisms underlying this different response has been studied with a biochemical and microscopical approach. Plants were grown in Open-Top Chambers (OTCs) and exposed to charcoal filtered and ozone enriched air. Flag leaves were analyzed at two phenological stages (pre- and post-anthesis). At pre-anthesis the ascorbate pool was significantly lower in Colombo, which also underwent an increase in the oxidized glutathione content and abundant H2O2 deposition in mesophyll cells around the substomatal chamber. No or scarce H2O2 was found at both phenological stages in ozone exposed leaf tissues of Sculptur, where stomata appeared often closed. In this cultivar, transmission electron microscopy showed that chloroplasts in apparently undamaged mesophyll cells were slightly swollen and presented numerous plastoglobuli, as a result of a mild oxidative stress. These results suggest that Sculptur leaves remains symptomless as a consequence of the higher content of constitutive ascorbate pool and the synergistic effect of stomata closure. Instead, Colombo shows chlorotic/necrotic symptoms because of the lower ROS (Reactive Oxygen Species) scavenging capacity and the less efficient stomata closure that lead to severe damages of groups of the mesophyll cells, however leaving the surrounding photosynthetic tissue functional. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  3. Elimination of browning exudate and in vitro development of shoots in Pistacia vera L. cv. mateur and Pistacia atlantica Desf. Culture

    Directory of Open Access Journals (Sweden)

    M. I. Trujillo

    2014-01-01

    Full Text Available We report diminution and/or elimination of browning exudate followed by in vitro establishment of in Pistacia vera cv. mateur and Pistacia atlantica explants. Soaking P. vera cv. mateur explants prior to culture in L-cysteine HCl for 15 min (100 µM inhibits blackening of the modified Murashige and Skoog medium - MS + 400 mg/l NH4NO3 - and of the explants; while shoot formation was increased. The browning in P. vera cv. mateur and P. atlantica explants dissolved when modified MS and Quoirin and Lepoivre - QL.4 - media were supplemented with activated charcoal (from 1 to 3 g l-1 and with 4 and 8 days of darkness. These treatments were enough to eliminate browning from the explants and to improve the shoots elongation, but symptoms of chlorosis were detected. On the other hand, AgNO3 (from 15 to 40 µ1V1 showed a very strong antibrowning effect on the medium and explants of P. atlantica. Thus shoot organogenesis was best achieved and the developing sturdy shoots had large and green leaves.

  4. Quality Characteristics of Wholemeal Flour and Bread from Durum Wheat (Triticum turgidum L subsp. durum Desf.) after Field Treatment with Plant Water Extracts.

    Science.gov (United States)

    Carrubba, Alessandra; Comparato, Andrea; Labruzzo, Andrea; Muccilli, Serena; Giannone, Virgilio; Spina, Alfio

    2016-09-01

    The use of selected plant water extracts to control pests and weeds is gaining growing attention in organic and sustainable agriculture, but the effects that such extracts may exert on the quality aspects of durum wheat are still unexplored. In 2014, 5 plant water extracts (Artemisia arborescens, Euphorbia characias, Rhus coriaria, Thymus vulgaris, Lantana camara) were prepared and distributed on durum wheat cv Valbelice to evaluate their potential herbicidal effects. After crop harvesting, the major physicochemical and technological parameters of wholemeal flours obtained from each treatment were measured and compared with those from chemical weeding and untreated controls. A baking test was also performed to evaluate the breadmaking quality. In wholemeal flours obtained after the treatment with plant extracts protein and dry gluten content were higher than in control and chemical weeding. Wholemeal flours obtained after chemical weeding reached the highest Mixograph parameters, and that from durum wheat treated with R. coriaria extract demonstrated a very high α-amylase activity. We concluded that the treatments with plant water extracts may influence many quality traits of durum wheat. This occurrence must be taken into account in overall decisions concerning the use of plant extracts in pest and weed management practice.

  5. Development of COS-SNP and HRM markers for high-throughput and reliable haplotype-based detection of Lr14a in durum wheat (Triticum durum Desf.).

    Science.gov (United States)

    Terracciano, Irma; Maccaferri, Marco; Bassi, Filippo; Mantovani, Paola; Sanguineti, Maria C; Salvi, Silvio; Simková, Hana; Doležel, Jaroslav; Massi, Andrea; Ammar, Karim; Kolmer, James; Tuberosa, Roberto

    2013-04-01

    Leaf rust (Puccinia triticina Eriks. & Henn.) is a major disease affecting durum wheat production. The Lr14a-resistant gene present in the durum wheat cv. Creso and its derivative cv. Colosseo is one of the best characterized leaf-rust resistance sources deployed in durum wheat breeding. Lr14a has been mapped close to the simple sequence repeat markers gwm146, gwm344 and wmc10 in the distal portion of the chromosome arm 7BL, a gene-dense region. The objectives of this study were: (1) to enrich the Lr14a region with single nucleotide polymorphisms (SNPs) and high-resolution melting (HRM)-based markers developed from conserved ortholog set (COS) genes and from sequenced Diversity Array Technology (DArT(®)) markers; (2) to further investigate the gene content and colinearity of this region with the Brachypodium and rice genomes. Ten new COS-SNP and five HRM markers were mapped within an 8.0 cM interval spanning Lr14a. Two HRM markers pinpointed the locus in an interval of COS-SNPs were mapped 2.1-4.1 cM distal to Lr14a. Each marker was tested for its capacity to predict the state of Lr14a alleles (in particular, Lr14-Creso associated to resistance) in a panel of durum wheat elite germplasm including 164 accessions. Two of the most informative markers were converted into KASPar(®) markers. Single assay markers ubw14 and wPt-4038-HRM designed for agarose gel electrophoresis/KASPar(®) assays and high-resolution melting analysis, respectively, as well as the double-marker combinations ubw14/ubw18, ubw14/ubw35 and wPt-4038-HRM-ubw35 will be useful for germplasm haplotyping and for molecular-assisted breeding.

  6. Ethnobotany of Heracleum persicum Desf. ex Fisch., an invasive species in Norway, or how plant names, uses, and other traditions evolve.

    Science.gov (United States)

    Alm, Torbjørn

    2013-06-24

    Heracleum persicum was introduced to Norway as an ornamental in the 1830's. Towards the end of the 19th century, it started spreading outside gardens, later to become a frequent sight in the major towns and settlements of North Norway - and a veritable pest plant. During the last 100 years or so, a substantial ethnobotanical tradition related to the species has evolved, demonstrating that folk knowledge is not only forgotten and lost, but also charting new terrain. This survey is based on data extracted from all relevant publications, including botanical literature, travel accounts, newspaper notes, etc., as far as they have come to my attention. In addition, information on vernacular names and various uses of the H. persicum in Norway has been extracted from my own, substantial archive of interviews, questionnaires, and correspondence related to the ethnobotany of Norway. Where extant, H. persicum tends to be known to everyone, even by city dwellers who otherwise generally neglect plants. People tend to love or hate it, and in Tromsø, the largest town of northern Norway, the species has become more or less emblematic of the city. Both here and in other areas of northern Norway, it is referred to by a variety of vernacular names, partly borrowed from other species, partly derived from the Latin genus name, and partly coined for this species only. In the latter group, tromsøpalme ('the palm of Tromsø') has proved by far the most popular invention. It was seemingly first used (and coined) by German soldiers during the World War II occupation of Norway, but now largely replaces other vernacular names. The plant is still popular with children, who frequently play in and with it, whereas adults have been more prone to speculate on its origins - and how to get rid of it. Salt is the most popular "herbicide" for this purpose. Over the years, H. persicum has accumulated at least twenty different vernacular names in Norway, and a variety of other traditions. By necessity, all these traditions are less than 180 years old, showing that even modern and urban societies may produce a substantial body of plant lore, which certainly merits ethnobotanical attention.

  7. Diagonal two-dimensional electrophoresis (D-2DE): a new approach to study the effect of osmotic stress induced by polyethylene glycol in durum wheat (Triticum durum Desf.).

    Science.gov (United States)

    Kacem, N S; Mauro, S; Muhovski, Y; Delporte, F; Renaut, J; Djekoun, A; Watillon, B

    2016-09-01

    Acclimatization to stress is associated with profound changes in proteome composition. The use of plant cell and tissue culture offers a means to investigate the physiological and biochemical processes involved in the adaptation to osmotic stress. We employed a new proteomic approach to further understand the response of calli to dehydration induced by polyethylene glycol (PEG6000). Calli of three durum wheat genotypes Djenah Khetifa, Oued Zenati and Waha were treated with two concentrations of polyethylene glycol to mimic osmotic stress. Changes in protein relative abundance were analyzed using a new electrophoretic approach named diagonal two-dimensional electrophoresis (D-2DE), combined with mass spectrometry. Total proteins were extracted from 30-day-old calli from three durum wheat genotypes that showed contrasting levels of drought stress tolerance in the field. The combination of one-dimensional electrophoresis and D-2DE gave a specific imprint of the protein extracts under osmotic stress, as well as characterizing and identifying individual target proteins. Of the variously expressed proteins, three were selected (globulin, GAPDH and peroxidase) and further analyzed using qRT-PCR at the transcriptome level in order to compare the results with the proteomic data. Western blot analysis was used to further validate the differences in relative abundance pattern. The proteins identified through this technique provide new insights as to how calli respond to osmotic stress. Our method of study provides an original and relevant approach of analyzing the osmotic-responsive mechanisms at the cellular level of durum wheat with agronomic perspectives.

  8. Plantas medicinais referenciadas por raizeiros no município de Jataí, estado de Goiás

    Directory of Open Access Journals (Sweden)

    L.F. SOUZA

    Full Text Available RESUMO Este trabalho objetivou pesquisar as plantas medicinais referenciadas por raizeiros do município de Jataí-GO, evidenciando o Valor de Uso Reportado (VUR e a conexão com os níveis filogenéticos atuais. Com cerca de 200 anos de história, Jataí localiza-se no Planalto Central do Brasil, Sudoeste de Goiás (17°52’53’’S e 51°42’52’’W, tendo atualmente, como principal fonte de renda o agronegócio. Para a seleção dos raizeiros e coleta dos dados aplicou-se o método bola de neve e a técnica de entrevistas semiestruturadas. Determinou-se a etnoespécie, parte usada, uso, modo de preparo, sintomas / doenças relacionando aos sistemas corporais. Foram reportadas 515 referências etnobotânicas para 112 etnoespécies principalmente dos clados Fabídeas, Lamídeas, e Campanulídeas. Sobressaíram as etnoespécies Pé-de-perdiz (Croton antisyphilliticus, Sangra-dágua (C. urucurana, Pau-terra-de-folha-larga (Qualea grandiflora, Erva-de-Santa Maria (Chenopodium album, Amaro-leite (Operculina alata, Algodãozinho-do-campo (Cochlospermum regium, Cavalinha (Equisetum hiemale e Jaborandi (Piper aduncum, com VUR maior que 10. Os sistemas corporais mais importantes com relação ao número de etnoespécies relatadas foram respiratório, digestivo, circulatório e tegumentar. As etnoespécies mais versáteis em uso nos sistemas corporais foram Copaíba (Copaifera langsdorffii, Pé-de-perdiz (Croton antisyphiliticus, Cavalinha (Equisetum hiemale, Alecrim (Rosmarinus officinalis e Fruta-de-lobo (Solanum paniculatum. A prática da medicina tradicional em Jataí evidencia a conexão entre a escolha de plantas e os níveis filogenéticos derivados. Algumas destas etnoespécies estão na listagem de plantas medicinais que o Ministério da Saúde do Brasil escolheu para a realização de monografias, fato que fortalece o valor do conhecimento do uso da flora nas práticas da medicina tradicional.

  9. Fungitoxic activity avaliation of the hexane and methanol extracts of copaiba plant leavesCopaifera langsdorffi Desfon Avaliação da atividade fungitóxica dos extratos foliares hexânico e metanólico da Copaifera langsdorffi Desfon

    Directory of Open Access Journals (Sweden)

    Ana Carolina Lourenço Amorim

    2004-04-01

    Full Text Available The fungitoxicity of hexane and methanol extracts of copaiba plants were evaluated by biological tests against the phytopathogens Colletotrichum gloeosporioides and Bipolaris sorokiniana. These extracts were chosen because they presented the highest yields in the extraction at room temperature. The biological material was obtained from the Department of Phytopathology of the UFLA, transplanted in BDA (C. gloeosporioides and PCA (B. sorokiniana culture media and incubated in a germination chamber with control of light and temperature. Five treatments (0/100/200/400/800 ppm were used with three repetitions of each, and four mutually perpendicular radii, were measured in centimeters from the mycelial center. The formula for the Mycelial Growth Index (MGI was applied to the values obtained for statistical analyses. A 32% reduction in the growth of B. sorokiniana was observed in the presence of the methanol extract, while the hexane extract was effective against both of the phytopathogens, resulting in a 49% reduction in the growth of B. sorokiniana and an 18% reduction in the growth of C. gloeosporioides.Avaliou-se a fungitoxicidade dos extratos hexânico e metanólico do óleo copaíba por meio de ensaios biológicos contra os fitopatógenos Colletotrichum gloeosporioides e Bipolaris sorokiniana. Os referidos extratos foram escolhidos em razão dos melhores rendimentos obtidos na extração a frio. O material biológico foi obtido na UFLA no Departamento de Fitopatologia, repicado em meio de cultura BDA (C. gloeosporioides e PCA (B. sorokiniana e incubados em câmara de germinação com controle de temperatura e luz. Empregaram-se cinco tratamentos (0/100/200/400/800 ppm, realizando-se três repetições e avaliando-se quatro raios, medidos em centímetros, a partir do micélio central. Os valores aferidos foram aplicados à fórmula do Índice de Crescimento Micelial (ICM para as análises estatísticas. Observou-se que o extrato metanólico apresentou uma tendência à redução de 32% contra o B. sorokiniana, ao passo que o hexânico foi eficaz para ambos os fitopatógenos, apresentado uma tendência à redução de 49% para o B. sorokiniana e 18% para o C. gloeosporioides.

  10. Efeito dos óleos vegetais de andiroba (Carapa sp. e Copaíba (Copaifera sp. sobre forídeo, pragas de colméias, (Diptera: Phoridae na Amazônia Central Effect of andiroba (Carapa sp. and copaiba's (Copaifera sp. vegetable oils on phorides, hives's prague (Diptera: Phoridae in Central Amazonia

    Directory of Open Access Journals (Sweden)

    Delci da Costa Brito Freire

    2006-01-01

    Full Text Available O conhecimento de substâncias repelentes para forídeos é um passo importante para a meliponicultura brasileira, pois esses insetos podem causar sérios danos às colméias de abelhas nativas. Os óleos de copaíba e andiroba, naturalmente encontrados na região amazônica, são muito utilizados pelos povos tradicionais da região como repelentes de insetos. Foi observado o efeito de dois óleos vegetais (andiroba e copaíba sobre a postura de ovos por fêmeas de forídeos em condições de laboratório. A postura das fêmeas foi realizada preferencialmente no substrato pólen e diferiu estatisticamente dos substratos contendo óleo de andiroba ou copaíba, nos quais houve considerável diminuição (até nenhuma postura, e do substrato contendo mel. Esses óleos são uma boa alternativa no controle preventivo e curativo dessa praga em colônias de Meliponineos, devido ao seu efeito repelente, ao baixo custo e disponibilidade na Região Amazônica.The knowlegment of repellants substances to phoride flies is an important step to the Brazilian stinglessbee beekeeping due to the serious damage to the native bee hives they can do. The copaiba and andiroba oils, found commonly in the Amazon region, are very employed by the traditional people as insects' repellants. We observed the effect of these oils over the phoride's laying in laboratory conditions. The female phoride's eggs occurred preferentially in the pollen substrate and statistically differed from those containing andiroba and copaiba oils, which was strongly reduced (until none eggs were laid, and from the substrate containing honey. These oils showed to be quite good alternative for this plague's preventive and curative control in stingless bee hives due to its repellant effect, low cost, and availability to get it in the region.

  11. LIDAR-based estimation of leaf area index on Holm oak [Quercus ilex L. subsp. ballota (Desf.) Samp.] trees; Aplicacion de imagenes LIDAR para la estimacion de indices de superficie foliar (LAI) en encinas [Quercus ilex L. subsp. Ballota (Desf.) Samp.

    Energy Technology Data Exchange (ETDEWEB)

    Navarro Cerrillo, R. M.; Sanchez de la Orden, M.; Gomez Bonilla, J.; Garcia-Ferrer, A.; Hernandez Clemente, R.; Lanjeri, S.

    2010-07-01

    The aim of this paper was to estimate Leaf Area Index (LAI) of Quercus ilex by calculating the laser-intercepted rate through the forest canopy using LiDAR data. LAI was measured in 40 trees with a hemispheric camera (NIKON Coolpix 4500) and coincided with the acquisition of LIDAR data. The LiDAR-derived LAILIDAR was then estimated by applying a value of the inverse of the coefficient of extinction of 1/K 1.48. The in-field LAI values varied between 1.01 m{sup 2} m{sup -}2 and 1.61 m{sup 2} m{sup -}2. From a comparison of the LiDAR-derived to the field-derived LAI, the coefficients of the determination for the coefficient of extinction of 1.48 was R{sup 2} = 0.60 (RMSE = 0.16) for quadratic and R{sup 2} = 0.62 (RMSE = 0.21) for potential correlations. The change in accuracy was attributed to the density of leaves, the interference by stems, and the vertical number of branches in the forest stands. The LIDAR sensor technique gives a satisfactory result in the obtainment of leaf parameters in Holm oak trees, although its generalisation on field studies depends on its cost and suitability to be applied over large surfaces. (Author) 33 refs.

  12. A Newly Recorded Species of Pogostemon Desf. (Lamiaceae) from China%中国刺蕊草属(唇形科)植物一新记录种

    Institute of Scientific and Technical Information of China (English)

    姚纲; 邓云飞; 葛学军

    2013-01-01

    报道了中国唇形科(Lamiaceae)刺蕊草属一新记录种--香薷状刺蕊草(Pogostemon elsholtzioides Benth.),该种在中国产于西藏墨脱县,凭证标本保存在PE。该种在喜马拉雅地区分布广泛,与特产于云南西北部地区的狭叶刺蕊草(P. dielsianus Dunn)的主要区别为:花萼钟形,长3~3.5 mm,花萼齿长为花萼筒的1/3~1/2,花冠长约4.5 mm。%Pogostemon elsholtzioides Benth. is newly recorded from China. It was discovered in Mêdog Xian, Xizang, China. Its vouchers are kept in the herbarium of Institute of Botany, Chinese Academy of Sciences (PE). The species is widely distributed in Himalayan regions. It is similar to P. dielsianus Dunn in habit, but differs from it in having calyx campanulate, 3-3.5 mm long, the ratio of the length of calyx teeth and calyx tube is 1/3-1/2, corolla ca. 4.5 mm long.

  13. The occurrence of fungi on roots and stem bases of common wheat (Triticum aestivum ssp. vulgare L. and durum wheat (Triticum durum Desf. grown under two levels of chemical protection

    Directory of Open Access Journals (Sweden)

    Irena Kiecana

    2012-12-01

    Full Text Available Investigations were carried out in 2007-2009 on the plots of the Felin Experimental Station belonging to the University of Life Science in Lublin. The studies comprised two cultivation lines of durum wheat (Triticum durum L.: STH 716 and STH 717, as well as the 'Tonacja' cultivar of common wheat (T. aestivum ssp. vulgare L.. Two levels of chemical protection were applied in the cultivation: minimal and complex protection. Infection of wheat roots and stem bases was recorded in each growing season at hard dough stage (87 in Tottman's scale, 1987. After three years of study, the mean disease indexes for the analyzed wheat genotypes in the experimental treatment with minimal protection were 31.13, 30.43 and 38.83 for, respectively, the 'Tonacja' cultivar and the cultivation lines of T. durum STH 716 and STH 717. In the experimental combination with complex protection, after three years of study the disease indexes ranged from 25.26 (T. durum STH 716 to 30.83 (T. durum STH 717. The results of mycological analysis of diseased plants showed that Fusarium spp., especially F. culmorum, F. avenaceum as well as Bipolaris sorokiniana and Rhizoctonia solani, caused root rot and necrosis of wheat stem bases. The analyzed chemical protection levels did not significantly influence grain yield of the investigated genotypes of T. aestivum and T. durum.

  14. Genotype × Environment interaction for antioxidants and phytic acid contents in bread and durum wheat as influenced by climate

    National Research Council Canada - National Science Library

    Gordana Brankovic; Vesna Dragicevic; Dejan Dodig; Miroslav Zoric; Desimir Knezevic; Sladana Zilic; Srbislav Dencic; Gordana Surlan

    2015-01-01

    .... Fifteen bread wheat (Triticum aestivum L.) and 15 durum wheat (Triticum durum Desf.) genotypes were evaluated across six environments to determine contents of phytic acid (PA), inorganic P (P^sub...

  15. ARTIGO 1

    African Journals Online (AJOL)

    user

    2012-03-22

    Mar 22, 2012 ... selection of populations resistant to pesticides (Yu, 2006;. Yu and McCord .... Extracts from leaves and fruit peels of C. langsdorffii were dissolved .... 75, 125, 250, 500 and 1,000 µg/ml, which were determined in previous tests.

  16. Avaliação toxicológica do óleo-resina de copaíba em ratos : estudos de toxidade aguda, neurotoxidade e embriofetotoxidade

    OpenAIRE

    Sachetti,Camile Giaretta

    2011-01-01

    Conhecida popularmente como copaíba, o gênero Copaifera L., Fabaceae, é uma das plantas com uso medicinal mais conhecido e utilizado no Brasil. Embora haja vários estudos mostrando algumas das atividades farmacológicas desse óleo-resina, existem poucos trabalhos relacionados à sua toxicidade. No presente estudo, ratas Wistar foram expostas a diferentes doses do óleo-resina de Copaifera reticulata, via gavagem, dissolvida em Tween 80 2%, para se avaliar sua toxicidade aguda e neurotóxica, seu ...

  17. Durum wheat and barley productivity in saline-drought environments

    NARCIS (Netherlands)

    Katerji, N.; Mastrorilli, M.; Hoorn, van J.W.; Lahmer, F.Z.; Hamdy, A.; Oweis, T.

    2009-01-01

    In two Successive years, durum wheat (Triticum turgidum Desf.) and barley (Hodeum vulgare L.) were tested in a factorial salinity-drought experiment, combining three levels of salinity and two levels of drought. The two drought treatments were obtained by applying irrigation water when the pre-dawn

  18. On the presence of Vicia vicioides in Alicante

    Directory of Open Access Journals (Sweden)

    Pérez-Haase, A.

    2008-12-01

    Full Text Available Please read the Spanish version of this Abstract.

    En el presente trabajo se actualiza el conocimiento corológico de la leguminosa Vicia vicioides (Desf. Cout. en la provincia de Alicante, aportando información sobre cinco nuevas poblaciones, que se añaden a la única localidad conocida previamente.

  19. First report of Fusarium hostae causing crown rot of wheat (Triticum spp.) in Turkey

    Science.gov (United States)

    Crown rot disease of wheat is caused by a complex of Fusarium species. To identify species associated with crown rot in Turkey, crowns and stems of bread wheat (Triticum aestivum L.) and durum wheat (T. durum Desf.) were collected from the Central and Southeast Anatolia, Black Sea, Aegean, Mediterr...

  20. Interactive effects of nitrogen fertilization and irrigation on grain yield, canopy temperature, and nitrogen use efficiency in overhead sprinkler-irrigated Durum Wheat

    Science.gov (United States)

    Nitrogen and irrigation management are crucial in the production of high protein irrigated durum wheat (Triticum durum Desf.) in arid regions. However, as the availability of irrigation water decreases and potential costs and regulation of nitrogen (N) increase, there is a need to understand how ir...

  1. Bioatividade de plantas medicinais no controle de Sclerotinia isolado de Stevia rebaudiana (Bert.) Bertoni

    OpenAIRE

    DINIZ, S. P. S. S.; Utumi, H.; Bonzanini, F.; Bueno, M.S.

    2005-01-01

    The microorganism Sclerotinia was isolated from roots of Stevia rebaudiana (Bert.) Bertoni in plantations in the northwest of Parana and submitted to the cultivation in the presence of extracts and vegetable balsams of Tarragon (Artemisia draconculus), Thyme (Thymus vulgaris), Manjerona (Origanum majorona), Mint citrata (Mintpiperita var. citrata), Purple Basil (Ocimum basilicum L.), Andiroba (Carapa guanensis) and Copaíba (Copaifera reticulata Ducke). The first five oils were extracted by st...

  2. Antibacterial Activity of Copaiba Oil Gel on Dental Biofilm

    OpenAIRE

    Simões, Cláudia A.C.G.; Conde, Nikeila C. de Oliveira; Venâncio, Gisely N.; Milério, Patrícia S.L.L.; Bandeira, Maria F.C.L.; da Veiga Júnior, Valdir F.

    2016-01-01

    Amazonian biodiversity products that have been used for years in folk medicine, have emerged as feasible and promising alternatives for the inhibition of microorganisms in dental biofilm. Copaiba oil, a phytotherapic agent widely used by the Amazonian populations, is known for its antibacterial, anti-inflammatory, anesthetic, healing and antitumor medicinal properties. Objective: The aim of this study was to evaluate the in vitro antibacterial activity of copaiba oil (Copaifera multijuga) gel...

  3. INSETICIDAL OILS FROM AMAZON PLANTS IN CONTROL OF FALL ARMYWORM

    Directory of Open Access Journals (Sweden)

    ANA CLÁUDIA VIEIRA DOS SANTOS

    2016-01-01

    Full Text Available The potential insecticidal of oils from southwestern Amazon plants against Spodoptera frugiperda (J. E. Smith, 1797 (Lepidoptera: Noctuidae was investigated. Initial bioassays were performed with undiluted oils from 11 plant species. The efficacy of the oils was evaluated against eggs and third-instar caterpillars of S. frugiperda. The oils of Copaifera sp. (Leguminosae, Orbignya phalerata (Arecaceae, and Carapa guianensis (Meliaceae displayed a high efficacy against the caterpillars and were used in subsequent concentration-response bioassays, at concentrations established through preliminary tests. The highest nonlethal concentrations of oils and the lowest lethal concentrations were calculated. A completely randomized design was adopted in both bioassays. The LC50 of the oils varied from 7.50 to 60.84% (v/v. Copaifera sp. oil had the highest toxicity and was 6.84-fold more toxic than O. phalerata oil and 8.11-fold more toxic than Carapa guianensis oil. In general, oils from Copaifera sp., O. phalerata, and Carapa guianensis were effective in controlling S. frugiperda caterpillars under laboratory conditions, and are good candidates for use in integrated management programs of corn pests.

  4. Antibacterial Activity of Daucus crinitus Essential Oils along the Vegetative Life of the Plant

    OpenAIRE

    Bendiabdellah, Amel; DIB, Mohammed El Amine; Meliani, Nawel; Muselli, Alain; Nassim, Djabou; Tabti, Boufeldja; Costa, Jean

    2013-01-01

    The essential oils from the aerial parts of Daucus crinitus Desf. were analyzed at three developmental stages (early vegetative, early flowering, and full flowering). Oil yield was found to vary depending on the stage of development, and the highest content of oil (0.15% w/w) was obtained at full flowering. The chemical composition of essential oils studied by GC and GC-MS showed a total of 71 compounds: 27 aliphatic compounds, 18 sesquiterpene hydrocarbons, 9 hydrocarbons monoterpene, 5 oxyg...

  5. Growth and nutrition of Tetraclinis articulata (Vahl) Mast. cultivated in different rhizosphere soils collected from Tetraclinis stand

    OpenAIRE

    Abbas, Y.; Bakkali Yakhlef, SE.; Prin, Y.; Arahou, M.; Abourouh, M.; Duponnois, R.

    2013-01-01

    Five representative plant species (Withania frutescens Pauquy, Lavandula multifida L., Pistacia atlantica Desf., Olea europaea L. subsp. oleaster (Hoffmanns. & Link) Negodi and Tetraclinis articulata [Vahl] Mast.) were selected from Moroccan Tetraclinis woodland in order to evaluate their mycorrhizal potential and to compare the impact of their rhizosphere soil on growth and nutrition of Tetraclinis articulata seedlings. We observed that roots of selected plants were highly colonized by Arbus...

  6. Flavonol 3-O-Glycosides from Three Algerian Bupleurum Species

    OpenAIRE

    Reguia Bencheraiet; Ahmed Kabouche; Zahia Kabouche; Rachid Touzani; Maurice Jay

    2012-01-01

    Flavonoids distribution in three algerian Bupleureum (Apiaceae) species has been investigated. Quercetin (1), quercetin 3-rutinoside (2) and isorhamnetin 3-rutinoside (3) were found in the endemic species B. plantagineum Desf. Three kaempferol glycosides, kaempferol 3-glucoside (4), kaempferol 3-galactoside (5), kaempferol 3-rutinoside (6) and three quercetin glycosides, quercetin 3-rutinoside (2), quercetin 3-glucoside (7) and quercetin 3-galactoside (8), have been isolated from B. fruticosu...

  7. IMPROVING WHEAT TRITICUM AESTIVUM L. BY INTERSPECIFIC AND INTERGENERIC HYBRIDIZATION WITH POACEAE FAMILY SPECIES

    Directory of Open Access Journals (Sweden)

    Czaplicki A.Z.

    2012-08-01

    Full Text Available The related species of the family Poaceae (Triticeae are the source of unprecedented new genes that allow the extension of genetic variation of common wheat Triticum aestivum L. These species have similar homoeologous chromosomes and rDNA sequences very similar to T. aestivum L. [1-3]. This allows the introgression of alien genes and their incorporation into the genomes A, B and D of wheat, where they can function permanently in the wheat genetic systems. Many of them have already been transferred to the varieties of T. aestivum L. [4].The experimental material consisted of 28 lines of winter wheat obtained using the interspecific and intergeneric hybridization of T. aestivum L. with alien species T. durum Desf., T. timopheevii Zhuk., Lolium perenne L. and Aegilops speltoides Taush. Among them, 15 lines were developed from the cross-combination with tetraploid species (AABB T. durum Desf., 4 lines from the combination with other tetraploid species of different genome composition (AAGG T. timopheevii Zhuk., 4 lines from cross with L. perenne L. and 5 lines were the double hybrids (three-generic derived with two related species, T. durum Desf. (AABB and Ae. speltoides Taush (BB.The anther culture method was used for obtaining DH lines from these interspecific and intergeneric hybrids. In in vitro culture 124 green plants were regenerated. The method of cluster analysis grouped hybrids in terms of comprehensive general similarity of the studied traits.

  8. Tumores em certos híbridos do gênero nicotiana

    Directory of Open Access Journals (Sweden)

    F. G. Brieger

    1942-01-01

    Full Text Available The present paper gives some observations on the tumour formation and other abnormalities observed in the interspecific hybrids, Nicotiana glauca x N. Langsdorffii and N. glauca x N. Sanderae. Without entering into a detailed discussion of the literature and the various speculations proposed by Kostoff and Whitaker about the causes of tumour formations or on the relations between "spontaneous" and pathogenic tumours (Kostoff, Levine and others, two new observations are described. 1 The abnormalities in the two above mentioned hybrids are quite different. As already reported by other authors, the hybrids N. glauca x N. Langsdorffii are initially quite normal and vigorous, while tumours and other proliferations, on the stem, the stem base and the root appear more or less frequently in older plants. Tumours on leaf are rare and flowers are normal (fig. 1,2,7 and 10. The hybrids N. glauca x N. Sanderae are very different from the former. These remain either weak and rachitic, forming early large tumours at the stem base and on the root (fig. 5 and 6 right half. Numerous shoots with more or less normal leaves may arise from these tumours (fig. 11 and 12. Or the plants show an extremely vigorous and abnormal ramification with a number of serial axial shoots developing in each leaf axis (fig. 3 and 4. The leaves are frequently deformed and the flowers exhibit abnormally coloured patches. When crossing N. glauca with F1 (N. Langsdorffii x N. Sanderae the offspring could clearly be divided into two groups : plants exactly as described for N. glauca x N. Langsdorffii and others which correspond to the types of N. glauca x N. Sanderae. Thus it seems that we are dealing with a monogenic differences, each species, N. Langsdorffii and N. Sanderae, being homozygous for one allele each. These alleles have no phenotypic effect in either pure species, but only in hybrids when combined with the genom of N. glauca. The situation is somewhat similar to the sublethal

  9. Activities of the Pharmaceutical Technology Institute of the Oswaldo Cruz Foundation with medicinal, insecticidal and insect repellent plants.

    Science.gov (United States)

    Gilbert, B; Teixeira, D F; Carvalho, E S; De Paula, A E; Pereira, J F; Ferreira, J L; Almeida, M B; Machado, R da S; Cascon, V

    1999-01-01

    In addition to original research, Far-Manguinhos, the Pharmaceutical Division of the Brazilian Ministry of Health's Oswaldo Cruz Foundation (FIOCRUZ), devotes major attention to the finalising of products for use in public health campaigns or, under contract, for private industrial development. Emphasis is on standardisation, adequate supply, safety in use and efficacy. Among the products discussed in this summary of some of its activities in the chemical and pharmaceutical fields are medicinal plants Bidens pilosa, Cymbopogon citratus, Copaifera species, Mentha crispa, Phyllanthus tenellus Roxb. and other Phyllanthus species, insecticidal plants, Lonchocarpus urucu and Quassia amara, and the insect antifeedant plants Carapa guianensis and Pterodon emarginatus.

  10. Plantas medicinais: a necessidade de estudos multidisciplinares

    Directory of Open Access Journals (Sweden)

    Maciel Maria Aparecida M.

    2002-01-01

    Full Text Available This paper presents a program emphasizing ethnopharmacological approaches that could allow great success in the study of medicinal plants. The minimum ethnopharmacological research team should consist of a botanist, a chemist and a pharmacologist with each carrying the responsibility for answering in sequential fashion critical questions. The chemical composition and pharmacological properties of the very efficient medicinal plant Croton cajucara were investigated according to ethnopharmacological approaches. The study with this Croton proved to be both efficient and successful. This happy situation was only possible because a multidisciplinary team was involved getting the research done correctly. The ethnopharmacological study involving one other especies Copaifera will be cited.

  11. Quality of Bread from Composite Flour of Sorghum and Hard White Winter Wheat

    Directory of Open Access Journals (Sweden)

    R.F. Abdelghafor

    2011-02-01

    Full Text Available This study was carried out to investigate the baking properties of whole, decorticated sorghum- (Sorghum bicolor - wheat (Triticum aestivum Desf. composite flours as well as to determine the physical characteristics and organoleptic quality of pan and balady breads made from those flours. Whole and decorticated sorghum flours were used to replace 0, 5, 10, 15, and 20% by weight of bread wheat flour. Sensory evaluation results showed that up to 20% wheat replacement with whole or decorticated sorghum flour produced acceptable pan and balady breads. Decreases, however, were noted in all sensory properties except odor.

  12. Danish environmental support fund for Eastern Europe. Co-operation development 1991-1996 and programme priority areas

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-08-01

    The publication gives an account of environmental co-operation between Denmark and 12 countries in Eastern Europe. The basis of co-operation is a country programme, describing present and future priority areas in the recipient countries, as an expression of common understanding between the Danish Environmental Protection Agency and the Ministry of Environment in the recipient countries. The publication also describe the environmental efforts made in 1991-1996 under the Danish Environmental Support Fund for Eastern Europe (DESF) administered by the DEPA. (au)

  13. Etica profesional en el ejercicio del derecho

    OpenAIRE

    Barreto Quinteros, Adolfo Frank

    2007-01-01

    En su exposición escrita la autora resume: La familia, El estado, normativas morales, legales. Moralidad juridica, derechos, conciencia, dignidad mora, el Código de Etica Ecuatoriana. Nuestro desfío?..Fomentar el desarrollo de aptirudes éticas del profesional que le hagan sujeto de cambio y construcción, persiguiento una sociedad humana igualitaria con seguridad jurídica. Pedimos reformas a las leyes que dan lugar a incorrecciones, `retendiendo una sociedad humana igualitaria, con seguridad ...

  14. Efectos alelopáticos de extractos acuosos de arvenses sobre la germinación de trigo duro y Lolium rigidum

    OpenAIRE

    López Sariego, María del Carmen; Urbano Fuentes-Guerra, José María; López Martínez, Nuria

    2015-01-01

    Se han analizado los efectos alelopáticos de extractos acuosos de varias plantas sobre trigo duro (Triticum durum Desf.) y Lolium rigidum Gaud., y la germinación conjunta de las semillas de ambas especies. Los resultados han mostrado que varios extractos estimularon el desarrollo radicular y del hipocótilo, siendo el efecto proporcional a la concentración del extracto, destacando Urtica sp., Chenopodium murale, Sinapis arvensis y Diplotaxis virgata, mientras que Matricaria chamomilla inhibió ...

  15. Stability Valuation of Some Mixtures between Foliar Fertilizers and Combined Herbicides for the Grain Yield of Durum Wheat

    OpenAIRE

    DELCHEV, Grozi; ZHELYAZKOVA, Tsenka; STOYANOVA, Antonia

    2014-01-01

    The research was conducted during 2010 - 2012 on pellic vertisol soil type. Under investigation was Bulgarian durum wheat cultivar Predel, which belongs to Triticum durum var. valenciae Desf. Factor A included years of investigation. Factor B included no treated check and 3 foliar fertilizers - Lactofol O 8 l ha-1, Terra-sorb - 3 l ha-1, Humustim - 1 l ha-1. Factor C included weeded no treated check and 3 combined herbicides – Axial one - 1 l ha-1, Hussar max OD – 1 l ha-1, Palace 75 WG - 250...

  16. Antibacterial Activity of Daucus crinitus Essential Oils along the Vegetative Life of the Plant

    OpenAIRE

    Bendiabdellah, Amel; DIB, Mohammed El Amine; Meliani, Nawel; Muselli, Alain; Nassim, Djabou; Tabti, Boufeldja; Costa, Jean

    2013-01-01

    The essential oils from the aerial parts of Daucus crinitus Desf. were analyzed at three developmental stages (early vegetative, early flowering, and full flowering). Oil yield was found to vary depending on the stage of development, and the highest content of oil (0.15% w/w) was obtained at full flowering. The chemical composition of essential oils studied by GC and GC-MS showed a total of 71 compounds: 27 aliphatic compounds, 18 sesquiterpene hydrocarbons, 9 hydrocarbons monoterpene, 5 oxyg...

  17. Decontamination Systems Information and Research Program. Quarterly technical progress report, July 1--September 30, 1993

    Energy Technology Data Exchange (ETDEWEB)

    1993-10-01

    Progress reports are presented for the following projects: systematic assessment of the state of hazardous waste clean-up technologies; site remediation technologies--drain-enhanced soil flushing (DESF) for organic contaminants removal; excavation systems for hazardous waste sites; chemical destruction of polychlorinated biphenyls; development of organic sensors--monolayer and multilayer self-assembled films for chemical sensors; Winfield Lock and Dam remediation; Winfield cleanup survey; assessment of technologies for hazardous waste site remediation--non-treatment technologies and pilot scale test facility implementation; assessment of environmental remediation storage technology; assessment of environmental remediation excavation technology; assessment of environmental remediation monitoring technology; and remediation of hazardous sites with steam reforming.

  18. Fatores de risco comportamentais acumulados para doenças cardiovasculares no sul do Brasil Factores de riesgo conductuales acumulados en enfermedades cardiovasculares en el sur de Brasil Accumulated behavioral risk factors for cardiovascular diseases in Southern Brazil

    OpenAIRE

    Ludmila Correa Muniz; Bruna Celestino Schneider; Inácio Crochemore Mohnsam da Silva; Alicia Matijasevich; Iná Silva Santos

    2012-01-01

    OBJETIVO: Estimar a prevalência e identificar fatores associados ao acúmulo de comportamentos de risco para doenças cardiovasculares entre adultos. MÉTODOS: Estudo transversal de base populacional com amostra representativa de 2.732 adultos de ambos os sexos de Pelotas, RS, em 2010. Os fatores de risco comportamentais investigados foram: tabagismo; inatividade física no lazer; consumo habitual de gordura aparente da carne; e consumo diário de embutidos, carne vermelha e leite integral. O desf...

  19. Flavonol 3-O-Glycosides from Three Algerian Bupleurum Species

    Directory of Open Access Journals (Sweden)

    Reguia Bencheraiet

    2012-01-01

    Full Text Available Flavonoids distribution in three algerian Bupleureum (Apiaceae species has been investigated. Quercetin (1, quercetin 3-rutinoside (2 and isorhamnetin 3-rutinoside (3 were found in the endemic species B. plantagineum Desf. Three kaempferol glycosides, kaempferol 3-glucoside (4, kaempferol 3-galactoside (5, kaempferol 3-rutinoside (6 and three quercetin glycosides, quercetin 3-rutinoside (2, quercetin 3-glucoside (7 and quercetin 3-galactoside (8, have been isolated from B. fruticosum L. while isorhamnetin (9, isorhamnetin 3-galactoside (10 and isorhamnetin 3-galactorhamnoside (11 were found in B. spinosum L. Seven flavonols are reported here for the first time from the genus.

  20. AcEST: DK950003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available release 39.9) Link to BlastX Result : TrEMBL tr_hit_id Q9ZVS4 Definition tr|Q9ZVS4|Q9ZVS.......................done Score E Sequences producing significant alignments: (bits) Value tr|Q9ZVS4|Q9ZVS4_A...canase ... 106 1e-21 tr|Q3KU27|Q3KU27_NICLS Nectarin IV OS=Nicotiana langsdorffii x N... 106 2e-21 tr|Q9ZVS5|Q9ZVS...rotein OS=Oryza... 75 5e-12 tr|B7FFG6|B7FFG6_MEDTR Putative uncharacterized protein (Fragmen... 72 4e-11 >tr|Q9ZVS4|Q9ZVS... F CL S+ N KG++ FG P Sbjct: 178 MAGLGRTRISLPSQFSAEFSFPRKFAVCLSSSTNSKGVVLFGDGP 222 >tr|Q9ZVS5|Q9ZVS5_ARATH F1

  1. Pollen irradiation and possible gene transfer in Nicotiana species

    DEFF Research Database (Denmark)

    Engvild, Kjeld Christensen

    1985-01-01

    Progeny from crosses of Nicotiana langsdorffii with gamma irradiated pollen of Nicotiana alata ‘Crimson Bedder’ showed skewed segregation in the F2 favoring the maternal parent. This is probably not gene transfer in a strict sense, rather just an extreme case of reduced transmission of irradiated...... chromosomes, leading to massive overrepresentation of maternal genes. Gene transfer or mutational loss may explain some anomalous F1 plants. Segregation in the F2 progeny showed the presence of several genes from the irradiated pollen. Crosses of Nicotiana sylvestris, N. plumbaginifolia N. paniculata......, and Petunia parodii with irradiated pollen from N. alata and Petunia hybrida showed no evidence of gene transfer, nor did experiments with irradiated mentor pollen. This indicates that gene transfer with irradiated pollen between non-crossing species or between species giving sterile hybrids is probably...

  2. Plant protoplast fusion and growth of intergeneric hybrid cells.

    Science.gov (United States)

    Kao, K N; Constabel, F; Michayluk, M R; Gamborg, O L

    1974-01-01

    Interspecific and intergeneric fusions of plant protoplasts were induced by polyethylene glycol (PEG) 1540 or 4000. The frequency of heterokaryocyte formation (or rate of fusion) was much higher when PEG was eluted with a high pH-high Ca(2+) solution or a salt solution than when it was eluted with a protoplast culture medium. The frequency of heterokaryocyte formation was also affected by the types of enzymes used for wall degradation, duration of enzyme incubation and molality of the PEG solutions.The maximum frequency of heterokaryocyte formation was 23% for V. hajastana Grossh.-soybean (Glycine max L.) and barley (Hordeum vulgare L.)-soybean, 35% for pea (Pisum sativum L.)-soybean, 20% for pea-V. hajastana, 14% for corn (Zea mays L.)-soybean and 10% for V. villosa Roth-V. hajastana.40% of the barley-soybean, corn-soybean and pea-soybean heterokaryocytes divided at least once. Some divided many times and formed clusters of up to 100 cells in 2 weeks. The heterokaryocytes of soybean-V. hajastana, V. villosa-V. hajastana also divided. Of the PEG-treated protoplasts of N. langsdorffii and N. glauca 13.5% developed into tumor-like calli. The morphology of these calli was very much like that of the tumors produced on amphidiploid plants of N. langsdorffii x glauca.Nuclear staining indicated that heterokaryocytes of V. hajastana-soybean, pea-soybean, corn-soybean and barley-soybean could undergo mitosis. Nuclear divisions in a heterokaryocyte were usually synchronized or almost synchronized. Nuclear fusion and true hybrid formation usually occurred during the first mitotic division after protoplast fusion. A hybrid of barley-soybean in third cell division was observed. The frequency of heterokaryocytes which underwent nuclear fusion has not been determined. Multipole formation and chimeral cell colonies were also observed.

  3. Expressing foreign genes in the pistil: a comparison of S-RNase constructs in different Nicotiana backgrounds.

    Science.gov (United States)

    Murfett, J; McClure, B A

    1998-06-01

    Transgenic plant experiments have great potential for extending our understanding of the role of specific genes in controlling pollination. Often, the intent of such experiments is to over-express a gene and test for effects on pollination. We have examined the efficiency of six different S-RNase constructs in Nicotiana species and hybrids. Each construct contained the coding region, intron, and downstream sequences from the Nicotiana alata S(A2)-RNase gene. Among the six expression constructs, two utilized the cauliflower mosaic virus (CaMV) 35S promoter with duplicated enhancer, and four utilized promoters from genes expressed primarily in pistils. The latter included promoters from the tomato Chi2;1 and 9612 genes, a promoter from the N. alata S(A2)-RNase gene, and a promoter from the Brassica SLG-13 gene. Some or all of the constructs were tested in N. tabacum, N. plumbaginifolia, N. plumbaginifolia x SI N. alata S(C10)S(c10) hybrids, N. langsdorffii, and N. langsdorffii x SC N. alata hybrids. Stylar specific RNase activities and S(A2)-RNase transcript levels were determined in transformed plants. Constructs including the tomato Chi2;1 gene promoter or the Brassica SLG-13 promoter provided the highest levels of S(A2)-RNase expression. Transgene expression patterns were tightly regulated, the highest level of expression was observed in post-anthesis styles. Expression levels of the S(A2)-RNase transgenes was dependent on the genetic background of the host. Higher levels of S(A2)-RNase expression were observed in N. plumbaginifolia x SC N. alata hybrids than in N. plumbaginifolia.

  4. In Vitro Schistosomicidal Activity of Some Brazilian Cerrado Species and Their Isolated Compounds

    Directory of Open Access Journals (Sweden)

    Nayanne Larissa Cunha

    2012-01-01

    Full Text Available Miconia langsdorffii Cogn. (Melastomataceae, Roupala montana Aubl. (Proteaceae, Struthanthus syringifolius (Mart. (Loranthaceae, and Schefflera vinosa (Cham. & Schltdl. Frodin (Araliaceae are plant species from the Brazilian Cerrado whose schistosomicidal potential has not yet been described. The crude extracts, fractions, the triterpenes betulin, oleanolic acid, ursolic acid and the flavonoids quercetin 3-O-β-D-rhamnoside, quercetin 3-O-β-D-glucoside, quercetin 3-O-β-D-glucopyranosyl-(1-2-α-L-rhamnopyranoside and isorhamnetin 3-O-β-D-glucopyranosyl-(1-2-α-L-rhamnopyranoside were evaluated in vitro against Schistosoma mansoni adult worms and the bioactive n-hexane fractions of the mentioned species were also analyzed by GC-MS. Betulin was able to cause worm death percentage values of 25% after 120 h (at 100 μM, and 25% and 50% after 24 and 120 h (at 200 μM, respectively; besides the flavonoid quercetin 3-O-β-D-rhamnoside promoted 25% of death of the parasites at 100 μM. Farther the flavonoids quercetin 3-O-β-D-glucoside and quercetin 3-O-β-D-rhamnoside at 100 μM exhibited significantly reduction in motor activity, 75% and 87.5%, respectively. Biological results indicated that crude extracts of R. montana, S. vinosa, and M. langsdorffii and some n-hexane and EtOAc fractions of this species were able to induce worm death to some extent. The results suggest that lupane-type triterpenes and flavonoid monoglycosides should be considered for further antiparasites studies.

  5. In Vitro Schistosomicidal Activity of Some Brazilian Cerrado Species and Their Isolated Compounds

    Science.gov (United States)

    Cunha, Nayanne Larissa; Uchôa, Camila Jacintho de Mendonça; Cintra, Lucas Silva; de Souza, Herbert Cristian; Peixoto, Juliana Andrade; Silva, Claudia Peres; Magalhães, Lizandra Guidi; Gimenez, Valéria Maria Meleiro; Groppo, Milton; Rodrigues, Vanderlei; da Silva Filho, Ademar Alves; Andrade e Silva, Márcio Luís; Cunha, Wilson Roberto; Pauletti, Patrícia Mendonça; Januário, Ana Helena

    2012-01-01

    Miconia langsdorffii Cogn. (Melastomataceae), Roupala montana Aubl. (Proteaceae), Struthanthus syringifolius (Mart.) (Loranthaceae), and Schefflera vinosa (Cham. & Schltdl.) Frodin (Araliaceae) are plant species from the Brazilian Cerrado whose schistosomicidal potential has not yet been described. The crude extracts, fractions, the triterpenes betulin, oleanolic acid, ursolic acid and the flavonoids quercetin 3-O-β-D-rhamnoside, quercetin 3-O-β-D-glucoside, quercetin 3-O-β-D-glucopyranosyl-(1-2)-α-L-rhamnopyranoside and isorhamnetin 3-O-β-D-glucopyranosyl-(1-2)-α-L-rhamnopyranoside were evaluated in vitro against Schistosoma mansoni adult worms and the bioactive n-hexane fractions of the mentioned species were also analyzed by GC-MS. Betulin was able to cause worm death percentage values of 25% after 120 h (at 100 μM), and 25% and 50% after 24 and 120 h (at 200 μM), respectively; besides the flavonoid quercetin 3-O-β-D-rhamnoside promoted 25% of death of the parasites at 100 μM. Farther the flavonoids quercetin 3-O-β-D-glucoside and quercetin 3-O-β-D-rhamnoside at 100 μM exhibited significantly reduction in motor activity, 75% and 87.5%, respectively. Biological results indicated that crude extracts of R. montana, S. vinosa, and M. langsdorffii and some n-hexane and EtOAc fractions of this species were able to induce worm death to some extent. The results suggest that lupane-type triterpenes and flavonoid monoglycosides should be considered for further antiparasites studies. PMID:22924053

  6. Controle de autenticidade de óleos de copaíba comerciais por cromatografia gasosa de alta resolução Authenticity control of commercial copaiba oils by high resolution gas chromatography

    Directory of Open Access Journals (Sweden)

    Valdir F. Veiga Jr.

    1997-12-01

    Full Text Available Copaiba oil is a resin extracted from the trunk of trees of Copaifera species which grow in Brazil where it is widely used in popular medicine as an anti-inflammatory, antiseptic anti-bactericidal, diuretic, dermatological, expectorant, and anti-infective. The comparative study of the composition of commercial copaiba oils was carried out by high resolution gas chromatography (HRGC and high resolution gas chromatography-mass spectrometry (HRGC-MS analysis. The commercial oils were compared with authentic oils, collected from the southeast and northern regions of Brazil. Sixteen commercial oils were analysed and two of them revealed adulterations with fatty acids. Using the chromatographic profile of authentic copaiba species oils, it is possible to analyse commercial oils and determine the authenticity of these materials.

  7. Experiencias dendroclimáticas con árboles de ecosistemas contrastantes de Colombia

    Directory of Open Access Journals (Sweden)

    Jorge Ignacio del Valle

    2012-01-01

    Full Text Available Este trabajo presenta los resultados de diferentes investigaciones dendroclimáticas realizadas en tres ecosistemas contrastantes de Colombia. Se emplearon técnicas dendrocronológicas y densitogramas computarizados para obtener las cronologías de crecimiento y densidad, respectivamente. Se encontraron asociaciones significativas entre las cronologías, las variables climáticas locales y el ENSO, por ejemplo: la densidad de los anillos de crecimiento de Rhizophora mangle con la precipitación; el ancho de los anillos de crecimiento de Parkinsonia praecox y Capparis odoratissima con la precipitación, la temperatura del aire y la temperatura superficial del mar, y el ancho de los anillos de crecimiento de Prioria copaifera con las alturas limnimétricas del río Atrato. Dichos resultados demuestran la aplicabilidad y el potencial de la dendroclimatología en regiones tropicales.

  8. Experiencias dendroclimáticas con árboles de ecosistemas contrastantes de Colombia

    Directory of Open Access Journals (Sweden)

    Herrera David Andrés

    2012-12-01

    Full Text Available Este trabajo presenta los resultados de diferentes investigaciones dendroclimaticas realizadas en tres ecosistemas contrastantes de Colombia. Se emplearon técnicas dendrocronologicas y densitogramas computarizados para obtener las cronologías de crecimiento y densidad, respectivamente. Se encontraron asociaciones significativas entre las cronologías, las variables climáticas locales y el ENSO, por ejemplo: la densidad de los anillos de crecimiento de Rhizophora mangle con la precipitación; el ancho de los anillos de crecimiento de Parkinsonia praecox y Capparis odoratissima con la precipitación, la temperatura del aire y la temperatura superficial del mar, y el ancho de los anillos de crecimiento de Prioria copaifera con las alturas limnimetricas del rio Atrato. Dichos resultados demuestran la aplicabilidad y el potencial de la dendroclimatologia en regiones tropicales.

  9. Study of fossil wood from the Middle–Late Miocene sediments of Dhemaji and Lakhimpur districts of Assam, India and its palaeoecological and palaeophyto-geographical implications

    Indian Academy of Sciences (India)

    R C Mehrotra; S K Bera; S K Basumatary; G Srivastava

    2011-08-01

    In order to reconstruct the palaeoclimate, a number of fossil wood pieces were collected and investigated from two new fossil localities situated in the Dhemaji and Lakhimpur districts of Assam. They belong to the Tipam Group considered to be of Middle–Late Miocene in age and show affinities with Gluta (Anacardiaceae), Bischofia (Euphorbiaceae), Bauhinia, Cynometra, Copaifera-Detarium-Sindora, Millettia-Pongamia, and Afzelia-Intsia (Fabaceae). The flora also records a new species of Bauhinia named Bauhinia miocenica sp. nov. The assemblage indicates a warm and humid climate in the region during the deposition of the sediments. The occurrence of some southeast Asian elements in the fossil flora indicates that an exchange of floral elements took place between India and southeast Asia during the Miocene.

  10. La Ecuación de Crecimiento de Von Bertalanffy en la Determinación de la Edad y el Crecimiento de Arboles Tropicales

    Directory of Open Access Journals (Sweden)

    Del Valle Jorge Ignacio

    1986-06-01

    Full Text Available En este artículo se propone un método para obtener curvas de incremento y de crecimiento diamétrico de especies tropicales de edad desconocida, así como para determinar la edad de árboles sin anillos de crecimientos anuales, basándose para ello en la ecuación de crecimiento de von Bertalanffy, también conocida como de Richards y Chapman. Así mismo se demuestra cómo otros métodos previamente publicados se pueden reducir a casos particulares del aquí propuesto. Finalmente se aplica el método a dos especies de árboles de américa tropical: Tabebuia rosea y Prioria copaifera.

  11. [Seed germination and seedling survival and growth in swamps dominated by palms Raphia tae- digera (Arecaceae) in Tortuguero plains, Costa Rica].

    Science.gov (United States)

    Myers, Ronald L

    2013-09-01

    In the marshes dominated by palms, seeds face anaerobic substrates and long flooding periods. Some tree species are capable of growing both in flooded swamps and in areas with lower influence of the flood. I studied the potential settlement of various tree species in different macrohabitats in the Tortuguero floodplain using three experiments: (1) Manicaria saccifera and Raphia taedigera seed germination in palm-swamps and forests of slopes; (2) germination of R. taedigera seeds along a microtopographic gradient; and (3) seed germination and seedling height growth of six woody species (Dipteryx oleifera, Pterocarpus officinalis, Prioria copaifera, Pentaclethra macroloba, Carapa guianensis and Crudia acuminata) and two palms (R. taedigera and Manicaria saccifera) under different forest and swamp habitats. In the first experiment, I found that the palms germinated much earlier in the slope forest than in the palm-swamp. In the second experiment, in drier plots (less effect of flooding) germination began earlier than in the more humid plots. In the third experiment, woody species germinated faster than the studied palms, and some species do not tolerate flooded areas (marshes and swamps), so they cannot germinate or survive in them. Other woody species were removed from the slope forest, probably due to seed predators. Based on the presence or absence of these species in the environment of study were divided into: (1) obliged swamp species (R. taedigera and M saccifera), (2) swamp intolerant (D. oleifera), and (3) facultative wetland species (P officinalis, P copaifera, P macroloba, C. guianensis). Crudia acuminata does not seem to follow any of these categories.

  12. New Cyclolignans from Origanumglandulosum Active Against b -amyloid Aggregation

    Directory of Open Access Journals (Sweden)

    Abdelkader Basli

    2014-05-01

    Full Text Available Origanum glandulosum Desf is an endemic flavoring herb widely distributed in North Africa that is commonly used in traditional medicine. This oregano species is rich in essential oils but little is known about its phenolic composition. In the present study, a crude extract of O. glandulosum was prepared in order to isolate and investigate its neuroprotective potential to inhibit β-amyloid peptide (Aβ aggregation. The three major compounds of the extract were isolated: rosmarinic acid and two cyclolignans in Origanum genus, globoidnan A and a new derivative named globoidnan B. Rosmarinic acid and globoidnan A showed significant anti-aggregative activity against β amyloid aggregation (IC50 7.0 and 12.0 µM, respectively. In contrast, globoidnan B was found to be less active.

  13. Levels, spatial variation and compartmentalization of trace elements in brown algae Cystoseira from marine protected areas of Crimea (Black Sea).

    Science.gov (United States)

    Kravtsova, Alexandra V; Milchakova, Nataliya A; Frontasyeva, Marina V

    2015-08-15

    Levels of Al, Sc, V, Co, Ni, As, Br, Rb, Sr, Ag, Sb, I, Cs, Ba, Th and U that were rarely or never studied, as well as the concentrations of classically investigated Mn, Fe and Zn in brown algae Cystoseira barbata C. Ag. and Cystoseira crinita (Desf.) Bory from the coastal waters of marine protected areas (Crimea, Black Sea), were determined using neutron activation analysis. Spatial variation and compartmentalization were studied for all 19 trace elements (TE). Concentrations of most TE were higher in "branches" than in "stems". Spatial variations of V, Co, Ni and Zn can be related to anthropogenic activities while Al, Sc, Fe, Rb, Cs, Th and U varied depending on chemical peculiarities of the coastal zone rocks. TE concentrations in C. crinita from marine protected areas near Tarkhankut peninsula and Cape Fiolent, identified as the most clean water areas, are submitted as the background concentrations. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Rolul bibliotecarilor în sprijinirea activităţii clinice Şi de cercetare din perspectiva medicilor

    Directory of Open Access Journals (Sweden)

    Octavia-Luciana Madge

    2015-01-01

    Full Text Available În contextul unei cercetări mai ample desfăŞurate la nivelul medicilor cu privire la practicile lor de informare Şi a utilizării resurselor de informare electronice, acest articol analizează posibilitatea unei colaborări între medicii din clinici universitare Şi bibliotecarii medicali. De asemenea, explorează punctele de vedere ale medicilor cu privire la rolul posibil al bibliotecarilor medicali de la Biblioteca Centrală a Universităţii de Medicină Şi Farmacie „Carol Davila” – BucureŞti Şi posibila lor integrare ca membri în echipele clinice Şi de cercetare.

  15. Elemental mapping of biofortified wheat grains using micro X-ray fluorescence

    Science.gov (United States)

    Ramos, I.; Pataco, I. M.; Mourinho, M. P.; Lidon, F.; Reboredo, F.; Pessoa, M. F.; Carvalho, M. L.; Santos, J. P.; Guerra, M.

    2016-06-01

    Micro X-ray fluorescence has been used to obtain elemental maps of biofortified wheat grains. Two varieties of wheat were used in the study, Triticum aestivum L. and Triticum durum desf. Two treatments, with different nutrient concentration, were applied to the plants during the whole plant growth cycle. From the obtained elemental maps it was possible to extract information regarding the plant's physiological processes under the biofortification procedures. Both macro and micronutrients were mapped, providing useful insight into the posterior food processing mechanisms of this biofortified staple food. We have also shown that these kind of studies can now be performed with laboratory benchtop apparatus, rather than using synchrotron radiation, increasing the overall attractiveness of micro X-ray fluorescence in the study of highly heterogeneous biological samples.

  16. Primary studies on tissue culture from mature embryos in diploid and tetraploid wheat

    Institute of Scientific and Technical Information of China (English)

    Ruiming BI; Honggang WANG

    2008-01-01

    Using mature embryos (MEs) as the explants,the callus induction,embryogenic callus differentiation,plantlet regeneration and culture efficiency in diploid and tetraploid wheat of four genotypes were studied.The tested four genotypes wheat included cultivable emmer wheat ( Triticum dicoccum Schuble),durum wheat ( Triticum durum Desf.) and the common wheat progenitors Triticum dicoccoides and Triticum aegilopides.Results indicated that there were significant differences in the efficiency of callus induction,callus differentiation and plant regeneration among the tested genotypes.The efficiency of differentiation and regeneration shows strong genotype dependence.The rates of callus induction,embryogenic callus differentiation,plantlet regeneration and culture efficiency respectively were 95.00%,90.00%,32.40%,and 27.70% in cultivable emmer wheat,which were significantly higher than other tested genotypes.Therefore,this study has provided a basis for genetic transformation,gene cloning and molecular plant breeding in wheat and other related species.

  17. Effects of Ephedrine and Ephedra fragilis Crude Extracts on Human Peripheral Lymphocytes

    Directory of Open Access Journals (Sweden)

    E Attard

    2009-01-01

    Full Text Available Ephedra fragilis Desf. (Ephedraceae, a locally cultivated medicinal plant, is a source of ephedrine and pseudoephedrine, two important alkaloids, which have long played an important pharmacological role. The present study investigated the in vitro effects of ephedrine and the Ephedra branch extract on unstimulated lymphocytes. Ephedra alkaloids were extracted from various plant parts and after phytochemical analysis, the brine shrimp lethality test was used to determine the activity of the extracts. The LC 50 of the branch extract was 581.395 μg/ml, showing no statistical difference from that of ephedrine (208.203 μg/ml. The ephedrine and extract did not show toxic effects on lymphocytes but exhibited immunostimulant activity. Although ephedrine cannot be used as an immune booster, it can be used as a lead drug for further immunological research.

  18. The Use of Austenitic Stainless Steel versus Monel (Ni-Cu) Alloy in Pressurized Gaseous Oxygen (GOX) Life Support Systems.

    Science.gov (United States)

    1985-03-01

    FLOW TEST 3 K1.. NW UNITS Ao A L R UPPER WSTF CAL. DUE DISPLAY STORGE" -INGE RANE 10 DATE 0 TT-01 Des.F TYPE K iSEG0ETED) 0 0 0 0 YES YESI TT-1" 3 D...1U 0 0 0 0 YES YESI TY-103 De,.F TYPE X (SEGMETED) 0 0 0 0 YES MD5 rr-115 0.,.F TYPE K(SGMNTED 0 0 0 0 YES MD6 TT-118 0.g.F TYPE K (SEGIMTD) 0 0 0 0...10000 2654 05/08/85 YES NO12 PT-1004 PSIA -1.1727 .241900 0 300 1110 07/25/85 YES YESis PT-126 PSIA -3.9401 .233270 0 J00 1303 07/25/18 YES YES17 INT.8

  19. Pollen tube branching in the ovary of five species of Oenothera

    Directory of Open Access Journals (Sweden)

    Renata Śnieżko

    2014-02-01

    Full Text Available Flowers of Oenothera hookeri Torr. et Gray, Oe. brevistylis and Oe. lamarkiana de Vries were pollinated after anthesis by insects. Oe. biennis L., Oe. suaveolens Desf and sulfurea were selfpollinated in the buds. Pollen morphology was slightly different: Oe. hookeri have regular, triporated pollen, often germinating through two pores; in Oe. suaveolens many pollen grains had callose patches on the intine; in Oe. brevistylis tetraporated pollen were more often than in other species; in Oe. lamarckiana many pollen grains were empty; in Oe. biennis and Oe. suaveolens pollen grain size and viability varied. The pollen tube growth and fertilization were similar in 5 species and can be considered as typical for Oenothera. In the ovary pollen tubes branched and changed their growth direction. Near micropyle they formed short branches to the inner integument. In the nucellus the pollen tube became swollen.

  20. Avaliação das propriedades de painéis aglomerados produzidos com resíduos de serrarias de nove espécies de madeiras tropicais da Amazônia Evaluation of the properties of particleboard made from sawmill waste of nine tropical wood species of Amazon

    Directory of Open Access Journals (Sweden)

    Setsuo Iwakiri

    2012-03-01

    Full Text Available Esta pesquisa teve como objetivo avaliar a qualidade de painéis aglomerados produzidos com resíduos de processamento em serraria de nove espécies de madeiras tropicais da Amazônia. As espécies estudadas foram: Scleronema micranthum Ducke (Cardeiro, Ecclinusa guianensis Eyma (Caucho, Scleronema sp. (Castanha-de-paca, Copaifera multijuga Hayne (Copaíba, Ocotea sp. (Louro, Ocotea guianensis Aubl (Louro-espinho, Caryocar villosum Pers. (Piquiarana, Couratari oblongifolia Ducke & R. Knuth (Tauari e Virola surinamensis Rol. Warb (Virola. Foram produzidos painéis experimentais com densidade nominal de 0,75 g.cm-3, utilizando a resina uréia-formaldeído na proporção de 8% de sólidos - base peso seco das partículas. Os painéis foram prensados com pressão específica de 4,0 MPa, temperatura de 160 ºC e tempo de prensagem de oito minutos. As avaliações dos resultados de ensaios obtidos nesta pesquisa indicam a viabilidade técnica de utilização das nove espécies provenientes de florestas tropicais da Amazônia na produção de painéis de madeira aglomerada, com destaque para Ecclinusa guianensis Eyma (Caucho que, de uma forma geral, apresentou melhores resultados de propriedades físico-mecânicas.This research was developed to evaluate the quality of particleboards manufactured from sawmill waste of nine tropical wood species of Amazônia. The following species were studied: Scleronema micranthum Ducke (Cardeiro, Ecclinusa guianensis Eyma (Caucho, Scleronema sp. (Castanha-de-paca, Copaifera multijuga Hayne (Copaíba, Ocotea sp. (Louro, Ocotea guianensis Aubl (Louro-espinho, Caryocar villosum Pers. (Piquiarana, Couratari oblongifolia (Tauari e Virola surinamensis Rol. Warb (Virola. The experimental boards were manufactured with the nominal density of 0.75 g.cm-3, using the urea-formaldehyde resin in the proportion of 8% of solid content based on oven dried wood particles. The boards were pressed at the specific pressure of 40 kgf

  1. Caesalpinioideae (leguminosae lenhosas na Estação Ambiental de Volta Grande, Minas Gerais, Brasil Woody Caesalpinioideae (leguminosae species at the Estação Ambiental de Volta Grande, Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Fabiana Luiza Ranzato Filardi

    2009-12-01

    Full Text Available Este trabalho apresenta o levantamento florístico das Caesalpinioideae lenhosas nas formações de Cerrado e de Floresta Semidecidual, da Estação Ambiental de Volta Grande. A área de estudo, localizada no Triângulo Mineiro, faz parte do complexo da Usina Hidrelétrica Estadual de Volta Grande, reúne 391 ha e retrata 30 anos de regeneração natural. Foram registrados 14 táxons da subfamília, reunidos em 11 gêneros e quatro tribos. Caesalpinieae foi a tribo mais representada (Dimorphandra Schott, Diptychandra Tul, Peltophorum (Vogel Benth., Pterogyne Tul. e Tachigali Aubl., seguida por Cassieae (Apuleia Mart., Chamaecrista Moench e Senna Mill., Detarieae (Copaifera L. e Hymenaea L. e Cercideae (Bauhinia L.. O gênero mais representativo foi Senna (4 spp., enquanto os demais foram representados por uma espécie cada. Apresentam-se chave para identificação, descrições e ilustrações, além de comentários sobre a distribuição geográfica dos táxons encontrados.This work presents the floristic survey of woody Caesalpinioideae taxa in the "Cerrado" and Semideciduous Forest vegetation, at the Estação Ambiental de Volta Grande. The area of study is located in the Triângulo Mineiro and belongs to the Companhia Energética de Minas Gerais. It covers 391 ha and represents 30 years of natural regeneration. Fourteen taxa were reported for the subfamily, distributed in 11 genera and four tribes. Caesalpinieae was the most representative tribe (Dimorphandra Schott, Diptychandra Tul., Peltophorum (Vogel Benth., Pterogyne Tul. and Tachigali Aubl., followed by Cassieae (Apuleia Mart., Chamaecrista Moench and Senna Mill., Detarieae (Copaifera L. and Hymenaea L. and Cercideae (Bauhinia L.. The most representative genus was Senna (4 spp.. Each one of the others was represented by one species. Identification key, descriptions and illustrations are presented for the sampled taxa, besides comments about their geographical distribution.

  2. Medicinal plant extracts on the control of Diabrotica speciosa (Coleoptera: Chrysomelidae Extratos de plantas medicinais no controle de Diabrotica speciosa (Coleoptera: Chrysomelidae

    Directory of Open Access Journals (Sweden)

    F.S. Barbosa

    2013-01-01

    Full Text Available The aim of this study was to evaluate the insecticidal effect of aqueous, alcoholic, and oil extracts from leaves of eight medicinal plants against Diabrotica speciosa prepared at five concentrations. The extracts that used commercial soybean oil as solvent showed the highest D. speciosa mortality due to the solvent itself, regardless of the used plants and their concentrations. Thus, commercial soybean oil was discarded as solvent since at these volumes it would cause serious phytotoxicity problems. After 24 hours of exposure of the pest to the extracts, the highest D. speciosa mortality values were observed for Copaifera langsdorfii and Chenopodium ambrosioides extracts, both in 5% alcohol, and Artemisia verlotorum, in 10% water. However, in the last mortality assessment (48 h, C. langsdorfii extract in 5% alcohol showed higher mortality of this pest, followed by C. ambrosioides extract in 5% alcohol, compared to the remaining plants.O objetivo deste trabalho foi avaliar o efeito inseticida de extratos aquosos, alcoólicos e oleosos de folhas de oito plantas medicinais contra Diabrotica speciosa preparadas em cinco concentrações. Os extratos que utilizaram óleo de soja comercial como solvente apresentaram as maiores mortalidades de D. speciosa em função do próprio óleo, independentemente das plantas utilizadas em suas concentrações. Sendo assim, o óleo de soja comercial foi descartado como solvente, pois nestes volumes acarretaria sérios problemas de fitotoxidade. Após 24 horas de exposição da praga aos extratos, os maiores valores de mortalidade de D. speciosa foram observados nos extratos de Copaifera Langsdorfii e de Chenopodium ambrosioides, ambos em álcool 5%, e de Artemisia verlotorum, em água 10%. Entretanto, na última avaliação de mortalidade (48 h, o extrato de C. langsdorfii em álcool a 5% apresentou maior mortalidade dessa praga, seguida pelo extrato alcoólico a 5% de C. ambrosioides comparada às demais plantas.

  3. Estudo de toxicologia clínica de um fitoterápico a base de associações de plantas, mel e própolis Clinical toxicology study of a phytomedicine syrup composed of plants, honey and propolis

    Directory of Open Access Journals (Sweden)

    Janaina P. Tavares

    2006-09-01

    Full Text Available O estudo objetivou avaliar a segurança clínica do uso de uma formulação fitoterápica composta da associação de Mikania glomerata, Mentha piperita, Eucalyptus globulus e Copaifera multijuga, incorporadas à própolis e mel para tratar doenças respiratórias. O ensaio clínico consistiu de um estudo aberto, com 26 voluntários adultos de ambos os sexos, que receberam quatro doses orais de 15 mL de Saratosse®, durante 28 dias ininterruptos. Os voluntários foram incluídos somente se considerados saudáveis, após exames clínico e complementares que antecederam o estudo. A avaliação laboratorial incluía análises hematológicas, bioquímicas e sorológicas. A mesma avaliação foi repetida após cada semana de tratamento e no pós-estudo, sete dias após a última administração. Os resultados foram submetidos à Análise de Variância (teste de Dunnett, obtendo-se, a menor diferença significante (p The aim of this study is to evaluate the safety of the use of a phytomedicine syrup (Saratosse® composed of several medicinal plants: Mikania glomerata, Mentha piperita, Eucalyptus globulus and Copaifera multijuga, along with honey and propolis to treat respiratory diseases. The clinical trial consisted of an open study with 26 adult volunteers of both sexes, who were given an oral dose of 15 mL of Saratosse® for 28 consecutive days, four times a day. Only volunteers who were found healthy after a clinical and physical examination were included. The laboratory tests included: hematological, biochemical and serological analysis. This evaluation was repeated after each week of treatment and seven days after the last administration. ANOVA analysis (Dunnett's test showed a significant difference, albeit at low statistical level (p < 0.05. Significant differences to the pre-study were not shown by hemoglobin, SGOT, SGPT, creatinine and leukocytes analysis. Laboratorial tests results were within their maximum and minimum reference values. On

  4. Quantificação e Avaliação das Principais Espécies Florestais Licenciadas no Estado do Acre de 2005 a 2012

    Directory of Open Access Journals (Sweden)

    Flávia Alessandra Pinheiro da Rocha Cordeiro e Silva

    Full Text Available O presente trabalho teve como objetivo avaliar, identificar e quantificar os 15 principais gêneros e espécies florestais exploradas legalmente no estado do Acre, na Amazônia brasileira, bem como analisar o número de autorizações emitidas para exploração de florestas manejadas, o volume de madeira e a área de manejo licenciada pelo Instituto de Meio Ambiente do Acre de janeiro de 2005 a agosto de 2012. Os dados coletados demonstraram que a área e o volume de madeira licenciados apresentaram um crescimento no período analisado, atingindo o ápice em 2010 e 2011, respectivamente. Os 15 principais gêneros e espécies licenciados foram: cumaru-ferro (Dipteryx spp., garapeira (Apuleia spp., sumaúma (Ceiba spp., açacu (Hura crepitans L., matamatá (Eschweilera spp., jatobá (Hymenaea spp., tauari (Couratari spp., manitê (Brosimun spp., caucho (Castilla ulei Warb., cedro (Cedrela spp., guariúba (Clarisia racemosa Ruiz e Pav., faveira (Parkia spp., copaíba (Copaifera spp., guaribeiro (Phyllocarpus riedelii Tul. e abiurana (Pouteria spp..

  5. Changes in the structure due to strong winds in forest areas in the Pantanal, Brazil

    Directory of Open Access Journals (Sweden)

    Suzana Maria Salis

    2012-09-01

    Full Text Available The Pantanal climate presents marked seasonality and eventually strong winds occur, especially in the beginning of the rainy season, which may last from September or October until April. A phytosociological study was conducted to evaluate the effects of a strong wind on the composition and structure of two forest formations in Pantanal wetland, a semideciduous forest (19º 15’ 32’’S and 55º 45’ 23.7’’W and a forested savanna - “cerradão” (19° 17’ 21’’S and 55º 45’ 8.9’’W, with trees with diameter at breast height (DBH ≥ 5 cm. After the strong wind, a reduction of 6% of the basal area and volume in the semideciduous forest was observed, mainly due to the uprooting of Xylopia aromatica trees. In the forested savanna, the basal area and volume reduction was even higher; an estimated 10%, representing 69 uprooted trees per hectare, mainly of Copaifera martii trees. In both areas it was observed that the uprooted trees presented an average height and diameter bigger than the trees that remained intact. Usually, the trees that were uprooted presented higher wood density and the species that had broken branches had a lower density.

  6. Growth tree rings as bioindicator of environmental pollution employing SR-TXRF

    Energy Technology Data Exchange (ETDEWEB)

    Faria, Bruna Fernanda; Moreira, Silvana [Universidade Estadual de Campinas (UNICAMP), Campinas, SP (Brazil). Faculdade de Engenharia, Arquitetura e Urbanismo]. E-mail: silvana@fec.unicamp.br; Vives, Ana Elisa Sirito de [Universidade Metodista de Piracicaba (UNIMEP), Santa Barbara D' Oeste, SP (Brazil)]. E-mail: aesvives@unimep.br; Medeiros, Jean Gabriel da Silva; Tomazello Filho, Mario [Universidade de Sao Paulo (USP), SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz]. E-mail: jeangm@esalq.usp.br; Zucchi, Orgheda Luiza Araujo Domingues [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Ciencias Farmaceuticas]. E-mail: olzucchi@fcfrp.usp.br

    2007-07-01

    The present work has the aim to evaluate the use of tree ring as a bioindicator of the environmental pollution in urban and industrial areas. The sampling was made in a area located at the Forest Park, in the Bauru city, Sao Paulo state/Brazil. The area was contaminated by battery industries residues, which was interdicted by the Environmental Control Agency of the Sao Paulo State (CETESB), on March, 2002. Trees of Copaifera langsdorffi L. species were sampling in two different sites. The first one is near to the industry and other site 1700 m far. Synchrotron Radiation Total Reflection X-Ray Fluorescence technique (SR-TXRF) was employed to identify and quantify the metals of toxicological importance in the wood samples. The analysis was performed in the Brazilian Synchrotron Light Laboratory using a white beam for excitation and a hyperpure germanium detector for X-ray detection. In wood samples Cr, Co, Ni, Cu, Zn, As and Pb were determined. (author)

  7. Do edaphic aspects alter vegetation structures in the Brazilian restinga?

    Directory of Open Access Journals (Sweden)

    Francisco Soares Santos-Filho

    2013-09-01

    Full Text Available The vegetation of the Brazilian restinga (coastal woodland presents a variety of species and different characteristics, encompassing fields, fruit groves and forests on quartzarenic neosols. We hypothesised that the structure of the restinga landscape along the coast of the state of Piauí is influenced by edaphic factors and presents a pattern similar to that of other northeastern restingas. We evaluated three restingas in Piauí, using the quarter method to determine their structure. Composite soil samples were collected to determine their chemical and physical properties. Edaphic variables were correlated with plant species by canonical correspondence analysis (CCA. Phytosociological data for all three areas indicated regenerating vegetation comprising several small individuals, 82.5% of which showed a diameter at ground level < 13 cm. We also observed considerable tillering. In two of the areas, there was a predominance of Fabaceae species, such as Caesalpinia pyramidalis and Copaifera martii. Although the structural characteristics of the restingas studied were similar to those of other northeastern restingas, the former showed lower Shannon diversity indices (2.18-2.44. The CCA indicated that species distribution was influenced by edaphic factors such as pH, aluminium content and amount of organic matter. The restingas studied were similar to others along the Brazilian coast.

  8. Antileishmanial activity of diterpene acids in copaiba oil

    Directory of Open Access Journals (Sweden)

    Adriana Oliveira dos Santos

    2013-02-01

    Full Text Available Leishmaniasis is a neglected tropical disease. According to the World Health Organization, there are approximately 1.5-two million new cases of cutaneous leishmaniasis each year worldwide. Chemotherapy against leishmaniasis is based on pentavalent antimonials, which were developed more than a century ago. The goals of this study were to investigate the antileishmanial activity of diterpene acids in copaiba oil, as well as some possible targets of their action against Leishmania amazonensis. Methyl copalate and agathic, hydroxycopalic, kaurenoic, pinifolic and polyaltic acids isolated from Copaifera officinales oleoresins were utilised. Ultrastructural changes and the specific organelle targets of diterpenes were investigated with electron microscopy and flow cytometry, respectively. All compounds had some level of activity against L. amazonensis. Hydroxycopalic acid and methyl copalate demonstrated the most activity against promastigotes and had 50% inhibitory concentration (IC50 values of 2.5 and 6.0 µg/mL, respectively. However, pinifolic and kaurenoic acid demonstrated the most activity against axenic amastigote and had IC50 values of 3.5 and 4.0 µg/mL, respectively. Agathic, kaurenoic and pinifolic acid caused significant increases in plasma membrane permeability and mitochondrial membrane depolarisation of the protozoan. In conclusion, copaiba oil and its diterpene acids should be explored for the development of new antileishmanial drugs.

  9. Antileishmanial activity of diterpene acids in copaiba oil

    Science.gov (United States)

    dos Santos, Adriana Oliveira; Izumi, Erika; Ueda-Nakamura, Tânia; Dias-Filho, Benedito Prado; da Veiga-Júnior, Valdir Florêncio; Nakamura, Celso Vataru

    2013-01-01

    Leishmaniasis is a neglected tropical disease. According to the World Health Organization, there are approximately 1.5-two million new cases of cutaneous leishmaniasis each year worldwide. Chemotherapy against leishmaniasis is based on pentavalent antimonials, which were developed more than a century ago. The goals of this study were to investigate the antileishmanial activity of diterpene acids in copaiba oil, as well as some possible targets of their action against Leishmania amazonensis. Methyl copalate and agathic, hydroxycopalic, kaurenoic, pinifolic and polyaltic acids isolated from Copaifera officinales oleoresins were utilised. Ultrastructural changes and the specific organelle targets of diterpenes were investigated with electron microscopy and flow cytometry, respectively. All compounds had some level of activity against L. amazonensis. Hydroxycopalic acid and methyl copalate demonstrated the most activity against promastigotes and had 50% inhibitory concentration (IC50) values of 2.5 and 6.0 µg/mL, respectively. However, pinifolic and kaurenoic acid demonstrated the most activity against axenic amastigote and had IC50 values of 3.5 and 4.0 µg/mL, respectively. Agathic, kaurenoic and pinifolic acid caused significant increases in plasma membrane permeability and mitochondrial membrane depolarisation of the protozoan. In conclusion, copaiba oil and its diterpene acids should be explored for the development of new antileishmanial drugs. PMID:23440116

  10. Study of homeopathic high dilutions of copaiba oil Estudio de altas diluiciones homepaticas de lo azeite de copaiba Estudo de altas diluições homeopáticas do óleo de copaíba

    Directory of Open Access Journals (Sweden)

    Aline Pinto Pereira

    2009-03-01

    Full Text Available The discovery of new drugs has led to a need to develop techniques to control the occurrence of toxic and collateral effects. This has enabled the advancement of homeopathic therapeutics as it presents major advantages against these effects. This study was designed to explore the effects of high dilutions of Copaifera (copaiba oil on inflammation. This study considered the way the high dilutions were obtained (triturated form or mother-tincture-MT. The preparations were administered orally. The effects of the dilutions were tested using the rat paw edema induced by carrageenan; granuloumatous tissue induction and the edema induced by Croton oil. The high dilutions of copaiba oil obtained from both trituration and MT produced a statistically significant inhibitory effect of the carrageenan edematogenic process compared to control. The maximum effect was observed with dilution 30cH, with inhibition of edema by 73%, whereas indomethacin was 55%. Subcutaneous implantation of cotton pellets have induced a granulomatous tissue, evaluated 7 days after implantation. Daily treatment with dexamethasone produced 53% inhibition on the formation of granulomatous tissue. The 6cH dilution of copaiba oil inhibited in a statistically significant way the formation of granulomatous tissue compared to the control (18% and 16%, respectively. Edema in Croton-oil induced dermatitis was intense. Groups treated with dexamethasone and dilutions of copaiba oil presented similar responses, with inhibition by 57% and 48% respectively. Based on the results obtained in this study, it may be suggest that the Copaiba oil high dilutions possess an anti-inflammatory property supporting its use in the treatment of inflammatory disorders. Keywords: Copaifera langsdorffi; Copaifera; Copaiba; Homeopathic dilutions; anti-inflammatory, dermatitis.   Estudo de altas diluições homeopáticas do óleo de copaíba Resumo A descoberta de novas drogas

  11. Genetic Variations of Gliadin and HMW Glutenins Subunits in Durum Wheat%硬粒小麦(Triticum durum)贮藏蛋白的遗传变异分析

    Institute of Scientific and Technical Information of China (English)

    王含彦; 魏育明; 颜泽洪; 郑有良

    2006-01-01

    对来源于美、中、俄及埃塞阿比亚等22个国家的142份硬粒小麦材料的种子贮藏蛋白位点及遗传变异进行了研究.供试的硬粒小麦(Triticum durum Desf)材料共检测出37条醇溶蛋白条带,无1条带纹为所有材料共有,多态性达到100%,说明硬粒小麦具有丰富的醇溶蛋白等位变异.聚类分析将142份供试材料分为3个大类,材料间遗传差异大小在不同的国家有所不同,表明醇溶蛋白带型与地理来源有一定关系.高分子量谷蛋白电泳共分离出14种亚基和15种亚基组合,但是优质亚基所占比例不高,这可能是因为硬粒小麦加工用途的特殊性,使得多年的育种并未太多改变硬粒小麦高分子量谷蛋白亚基等位变异的频率,促成优质亚基的累计.%The wheat baking quality is controlled by the content and composition of wheat endosperm proteins. To exploit new genetic resources and provide fundamental materials for the improvement of bread wheat quality, the genetic variations of the storage proteins in 142 durum wheat (Triticum durum Desf.) accessions from 22 countries were characterized by A-PAGE and SDS-PAGE. A total of 37 gliadin bands were detected, among which all bands(100%) were polymorphic. Furthermore, 142 accessions could be divided into three major groups using the clustering analysis, indicating that the gliadin variations among durum wheat were associated with their geographic origin. Fourteen high-molecular-weight (HMW) glutenin subunits alleles and fifteen subunits combinations were identified. Glu-A1-c(null) was observed at the highest frequency among the 4 Glu-A1 alleles, and Glu-B1-b and Glu-B1-e were the major subunits encoded by Glu-B1.

  12. Plants traditionally used for industrial and artisanal purposes in the Arribes del Duero (Spain

    Directory of Open Access Journals (Sweden)

    González, José Antonio

    2015-12-01

    Full Text Available The present ethnobotanical study, performed between 2005 and 2009 at the Natural Park of the Arribes del Duero (Salamanca-Zamora, Spain, documents the traditional use for technological purposes of 68 vascular plants belonging to 33 families. We interviewed 80 people of different ages native to the zone (mean 72. For each plant species we provide the vernacular terms, the parts used, and the uses made of them (furniture, the elaboration of household utensils, plant fibres, etc.. The species most frequently cited were Quercus ilex L. subsp. ballota (Desf. Samp., Q. pyrenaica Willd., Ulmus minor Mill. and Olea europaea L. The results of this study confirm the persistence of a rich traditional knowledge in Spanish rural communities; a type of knowledge that affords abundant data for improving and adapting modern production activities to a sustainable model of development, above all as regards the rational consumption of raw materials.El presente estudio etnobotánico, llevado a cabo entre 2005 y 2009 en el Parque Natural de Arribes del Duero (Salamanca-Zamora, España, documenta el uso tradicional con fines tecnológicos de 68 plantas vasculares, pertenecientes a 33 familias. Se entrevistaron a 80 personas nativas de la zona y de diferentes edades (media de 72 años. Para cada especie de planta se proporcionan sus nombres vernáculos, las partes utilizadas y los usos a que son destinadas (fabricación de muebles, elaboración de utensilios domésticos, fibras vegetales, etc.. Las especies más frecuentemente citadas fueron Quercus ilex L. subsp. ballota (Desf. Samp., Q. pyrenaica Willd., Ulmus minor Mill. y Olea europaea L. El presente estudio confirma la permanencia de un rico conocimiento tradicional en las comunidades rurales españolas, conocimiento que proporciona abundantes datos para mejorar y adecuar las actividades modernas de producción al modelo de desarrollo sostenible, sobre todo en relación al consumo racional de materias primas.

  13. High molecular weight glutenin subunits in some durum wheat cultivars investigated by means of mass spectrometric techniques.

    Science.gov (United States)

    Muccilli, Vera; Lo Bianco, Marisol; Cunsolo, Vincenzo; Saletti, Rosaria; Gallo, Giulia; Foti, Salvatore

    2011-11-23

    The primary structures of high molecular weight glutenin subunits (HMW-GS) of 5 Triticum durum Desf. cultivars (Simeto, Svevo, Duilio, Bronte, and Sant'Agata), largely cultivated in the south of Italy, and of 13 populations of the old spring Sicilian durum wheat landrace Timilia (Triticum durum Desf.) (accession nos. 1, 2, 3, 4, 7, 8, 9, 13, 14, 15, SG1, SG2, and SG3) were investigated using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOFMS) and reversed-phase high performance liquid chromatography/nanoelectrospray ionization mass spectrometry (RP-HPLC/nESI-MS/MS). M(r) of the intact proteins determined by MALDI mass spectrometry showed that all the 13 populations of Timilia contained the same two HMW-GS with 75.2 kDa and 86.4 kDa, whereas the other durum wheat cultivars showed the presence of the expected HMW-GS 1By8 and 1Bx7 at 75.1 kDa and 83.1 kDa, respectively. By MALDI mass spectrometry of the tryptic digestion peptides of the isolated HMW-GS of Timilia, the 1Bx and 1By subunits were identified as the NCBInr Acc. No AAQ93629, and AAQ93633, respectively. Sequence verification for HMW-GS 1Bx and 1By both in Simeto and Timilia was obtained by MALDI mass mapping and HPLC/nESI-MSMS of the tryptic peptides. The Bx subunit of Timila presents a sequence similarity of 96% with respect to Simeto, with differences in the insertion of 3 peptides of 5, 9, and 15 amino acids, for a total insertion of 29 amino acids and 25 amino acid substitutions. These differences in the amino acidic sequence account for the determined Δm of 3294 Da between the M(r) of the 1Bx subunits in Timilia and Simeto. Sequence alignment between the two By subunits shows 10 amino acid substitutions and is consistent with the Δm of 148 Da found in the MALDI mass spectra of the intact subunits.

  14. INTERVIU CU WILHELM SCHUSTER, MEMBRU BIOCOOP SIBIU

    Directory of Open Access Journals (Sweden)

    Liliana Foca

    2012-05-01

    Full Text Available Acest interviu a fost realizat în cadrul Conferinţei Economia socială - model inovator pentru promovarea incluziunii active a persoanelor defavorizate care s-a desfăşurat în perioada 12-14 octombrie 2012 în Bucureşti şi a reunit ini¬ţiatori şi promotori ai activităţilor de economie socială din România şi alte state europene.Wilhelm Schuster este membru BIOCOOP şi îşi desfăşoară activitatea în co-muna Moşna, judeţul Sibiu. Acesta deţine o fermă ecologică în cadrul căreia lucrează împreună cu familia şi are ca obiect de activitate comercializarea de produse organice regionale. Experienţa domnului Wilhelm Schuster este complexă datorită participării la numeroase întâlniri şi schimburi de ex-perien¬ţă ale fermierilor organizate în Europa şi Statele Unite ale Americii.[ ] În cadrul acestui interviu domnul Wilhelm Schuster a prezentat succint co-ope¬rativa comercială BIOCOOP punând accentul pe aspecte precum: scopul înfiinţării cooperativei, principalele realizări, obstacolele întâmpinate pe parcursul derulării activităţii şi modalităţile de promovare a cooperativelor în general. Domnul Schuster apreciază că BIOCOOP poate fi considerat un model de succes pentru economia socială românească şi recomandă consumatorilor să cumpere cu încredere produse organice regionale.

  15. Ethnobotanical investigations on plants used in folk medicine in the regions of Constantine and Mila (North-East of Algeria).

    Science.gov (United States)

    Ouelbani, Rayene; Bensari, Souheir; Mouas, Toma Nardjes; Khelifi, Douadi

    2016-12-24

    Constantine and Mila regions have been investigated in an ethnobotanical study for the first time. A total of 102 medicinal plants have been cited to treat human ailments. Twenty-eight new species of 31 common plants with 151 new therapeutic applications and 12 new cited species including one endemic specie Zygophyllum cornutum Coss were found as compared to other Algerian regions. In addition, to the best of our knowledge, 369 new medicinal uses of 75 known plants, were reported for the first time in the Mediterranean basin. This study is aimed at contributing to safeguard world cultural heritage and document ethnomedicinal uses of plants in Algeria and the Mediterranean basin; data on the national and global uses in the world were obtained to extract new potential species for further phytochemical and clinical investigations. The survey was carried out in two cities in the northeast of Algeria: Constantine and Mila. It was based on semi-structured interviews of 79 local informants. Data were analyzed using quantitative indices, namely, informant consensus factor, fidelity level (FL), use value (UV), and relative frequency citation (RFC), to evaluate the reliability and richness of herbal knowledge in the region. The interviewed persons used 102 plant species belonging to 90 genera and distributed among 53 families, represented mainly by Lamiaceae, Apiaceae, and Asteraceae (30%, 13%, and 10%, respectively), which were used to treat 14 ailment categories. The category of most frequent ailments (16%) was digestive disorders (diarrhea, constipation, and stomach bloating). The highest RFC was found for Origanum glandulosum Desf. With regard to the fidelity level, a higher FL was found for Tilia cordata Mill. (100%), followed by Artemisia herba alba Asso. with an FL of 95.74% and Punica granatum L. with an FL of 93.09%) to treat gastrointestinal system diseases, and Aloe sp. L. with an FL of 96.67% for skin diseases. The highest UV was found for Origanum glandulosum

  16. Glucanases and chitinases as causal agents in the protection of Acacia extrafloral nectar from infestation by phytopathogens.

    Science.gov (United States)

    González-Teuber, Marcia; Pozo, María J; Muck, Alexander; Svatos, Ales; Adame-Alvarez, Rosa M; Heil, Martin

    2010-03-01

    Nectars are rich in primary metabolites and attract mutualistic animals, which serve as pollinators or as an indirect defense against herbivores. Their chemical composition makes nectars prone to microbial infestation. As protective strategy, floral nectar of ornamental tobacco (Nicotiana langsdorffii x Nicotiana sanderae) contains "nectarins," proteins producing reactive oxygen species such as hydrogen peroxide. By contrast, pathogenesis-related (PR) proteins were detected in Acacia extrafloral nectar (EFN), which is secreted in the context of defensive ant-plant mutualisms. We investigated whether these PR proteins protect EFN from phytopathogens. Five sympatric species (Acacia cornigera, A. hindsii, A. collinsii, A. farnesiana, and Prosopis juliflora) were compared that differ in their ant-plant mutualism. EFN of myrmecophytes, which are obligate ant-plants that secrete EFN constitutively to nourish specialized ant inhabitants, significantly inhibited the growth of four out of six tested phytopathogenic microorganisms. By contrast, EFN of nonmyrmecophytes, which is secreted only transiently in response to herbivory, did not exhibit a detectable inhibitory activity. Combining two-dimensional sodium dodecyl sulfate-polyacrylamide gel electrophoresis with nanoflow liquid chromatography-tandem mass spectrometry analysis confirmed that PR proteins represented over 90% of all proteins in myrmecophyte EFN. The inhibition of microbial growth was exerted by the protein fraction, but not the small metabolites of this EFN, and disappeared when nectar was heated. In-gel assays demonstrated the activity of acidic and basic chitinases in all EFNs, whereas glucanases were detected only in EFN of myrmecophytes. Our results demonstrate that PR proteins causally underlie the protection of Acacia EFN from microorganisms and that acidic and basic glucanases likely represent the most important prerequisite in this defensive function.

  17. Dormancy as exaptation to protect mimetic seeds against deterioration before dispersal

    Science.gov (United States)

    Brancalion, Pedro H. S.; Novembre, Ana D. L. C.; Rodrigues, Ricardo R.; Marcos Filho, Júlio

    2010-01-01

    Background and Aims Mimetic seeds simulate the appearance of fleshy fruits and arilled seeds without producing nutritive tissues as a reward for seed dispersers. In this strategy of seed dispersal, seeds may remain attached to the mother plant for long periods after maturity, increasing their availability to naïve seed dispersers. The hypothesis that seed coat impermeability in many tropical Fabaceae with mimetic seeds serves as an exaptation to protect the seeds from deterioration and rotting while awaiting dispersal was investigated. Methods Seed coat impermeability was evaluated in five mimetic-seeded species of tropical Fabaceae in south-eastern Brazil (Abarema langsdorffii, Abrus precatorius, Adenanthera pavonina, Erythrina velutina and Ormosia arborea) and in Erythrina speciosa, a ‘basal’ species in its genus, which has monochromatic brown seeds and no mimetic displays. Seed hardness was evaluated as a defence against accelerated ageing (humid chamber at 41 °C for 144 h). Seed development and physiological potential of O. arborea was evaluated and the effect of holding mature seeds in pods on the mother plant in the field for a period of 1 year under humid tropical conditions was compared with seeds stored under controlled conditions (15 °C and 40 % relative air humidity). Key Results All five mimetic-seeded species, and E. speciosa, showed strong coat impermeability, which protected the seeds against deterioration in accelerated ageing. Most O. arborea seeds only became dormant 2 months after pod dehiscence. Germination of seeds after 1 year on the plant in a humid tropical climate was 56 %, compared with 80 % for seeds stored in controlled conditions (15 °C, 45 % relative humidity). Seedling shoot length after 1 year did not differ between seed sources. Conclusions Dormancy acts in mimetic-seeded species as an exaptation to reduce seed deterioration, allowing an increase in their effective dispersal period and mitigating the losses incurred by low

  18. Degradation of Total Petroleum Hydrocarbon in Phytoremediation Using Terrestrial Plants

    Directory of Open Access Journals (Sweden)

    Mushrifah Idris

    2014-06-01

    Full Text Available This study focused on the total petroleum hydrocarbon (TPH degradation in phytoremediation of spiked diesel in sand. The diesel was added to the sand that was planted with terrestrial plants. Four selected terrestrial plants used were Paspalum vaginatum Sw, Paspalums crobiculatum L. varbispicatum Hack, Eragrotis atrovirens (Desf. Trin. ex Steud and Cayratia trifolia (L. Domin since all the plants could survive at a hydrocarbon petroleum contaminated site in Malaysia. The samplings were carried out on Day 0, 7, 14, 28, 42 and 72. The analysis of the TPH was conducted by extracting the spiked sand using ultrasonic extraction. The determination of the TPH concentration in the sand was performed using GC-FID. The degradation of TPH depends on the plant species and time of exposure. The highest percentage degradation by P. vaginatum, P. scrobiculatum, E. atrovirens and C. trifolia were 91.9, 74.0, 68.9 and 62.9%, respectively. In conclusion, the ability to degrade TPH by plants were P. vaginatum > P. scrobiculatum > E. atrovirens> C. trifolia.

  19. Phenolic content, antioxidant capacity and antimicrobial activity of leaf extracts from Pistacia atlantica.

    Science.gov (United States)

    Rigane, Ghayth; Ghazghazi, Hanene; Aouadhi, Chedia; Ben Salem, Ridha; Nasr, Zouheir

    2017-03-01

    The aim of this study was to investigate the secondary metabolites related to Pistacia atlantica Desf as well as their biological activities. Results show that using ethanol as a solvent exhibited the highest content of total phenolics and flavonoids (68.23 mg GAE g(-1) of DW and 44 mg RE g(-1) of DW), followed by aqueous one (20.07 mg GAE g(-1) of DW and 15 mg RE g(-1) of DW). Good correlation (Data not shown) was obtained between the DPPH radical-scavenging activities and total phenolics contents. Many similarities were observed between the results of the DPPH (IC50 = 32 and 200 μg mL(-1)) and ABTS (IC50 = 42 and 300 μg mL(-1)) assays. All tested extracts contained phenolic compounds exhibited an antimicrobial effect against Gram-positive and Gram-negative bacteria. Further, researches for identification and purification of phenolic compounds are required.

  20. CRIZA IDENTITĂȚII UMANE ÎN POSTMODERNITATE

    Directory of Open Access Journals (Sweden)

    Eudochia SAHARNEANU

    2015-12-01

    Full Text Available Postmodernismul, inaugurat la începutul anilor '60, recunoaşte natura traumatizată, alienată a existenţei umane. Într-o societate care se caracterizează prin „acceptarea totală a efemerului, fragmentării, discontinuităţii şi haoticului” [13, p.110], identitatea umană este decentrată, deconstruită, devalorizată. Principalele coordonate pe care s-a desfăşurat acest proces de postmodernizare a concepţiei despre om sunt: căutarea subiectivităţii individului, psihanaliza şi teoriile limbajului, hipertehnologizarea societăţii. O analiză a acestora va arată modul în care a contribuit fiecare la conturarea relativismu­lui antropologic postmodern. CRISIS OF HUMAN IDENTITY IN POSTMODERNITYPostmodernism, which opened in the early 60s, recognizes the traumatized, alienated human existence. In a society characterized by „total acceptance of the ephemeral, fragmentation, discontinuity and chaotic” human identity is de-centered, deconstructed, devalued. Main coordinates to place the process of post- modernization of the concept of man am: seeking subjectivity individual psychoanalysis and theories of language, hypertechnologization society. Their analysis will show how each contributed to the shaping of anthropological postmodern relativism.

  1. Relationships among the A Genomes of Triticum L. Species as Evidenced by SSR Markers, in Iran

    Directory of Open Access Journals (Sweden)

    Simon G. Krattinger

    2010-11-01

    Full Text Available The relationships among 55 wheat accessions (47 accessions collected from Iran and eight accessions provided by the Institute of Plant Biology of the University of Zurich, Switzerland belonging to eight species carrying A genome (Triticum monococcum L., T. boeoticum Boiss., T. urartu Tumanian ex Gandilyan, T. durum Desf., T. turgidum L., T. dicoccum Schrank ex Schübler, T. dicoccoides (Körn. ex Asch. & Graebner Schweinf. and T. aestivum L. were evaluated using 31 A genome specific microsatellite markers. A high level of polymorphism was observed among the accessions studied (PIC = 0.77. The highest gene diversity was revealed among T. durum genotypes, while the lowest genetic variation was found in T. dicoccoides accessions. The analysis of molecular variance (AMOVA showed a significant genetic variance (75.56% among these accessions, representing a high intra-specific genetic diversity within Triticum taxa in Iran. However, such a variance was not observed among their ploidy levels. Based on the genetic similarity analysis, the accessions collected from Iran were divided into two main groups: diploids and polyploids. The genetic similarity among the diploid and polyploid species was 0.85 and 0.89 respectively. There were no significant differences in A genome diversity from different geographic regions. Based on the genetic diversity analyses, we consider there is value in a greater sampling of each species in Iran to discover useful genes for breeding purposes.

  2. Forage potential of winter cereal/legume intercrops in organic farming

    Directory of Open Access Journals (Sweden)

    Marco Mariotti

    2006-09-01

    Full Text Available This research was performed to assess the potential of cereal/legume intercropping to enhance forage yield and quality when compared with cereal sole crops under the constrains imposed by UE organic farming regulations. Sole crops (SC and intercrops (IC of two winter cereals, barley (Hordeum vulgare L. and durum wheat (Triticum durum Desf., and two legumes, white lupin (Lupinus albus L. and common vetch (Vicia sativa L., were evaluated at two harvest times for dry matter yield (DMY, crude protein concentration (CPC, and nitrogen yield (NY. Yield values and dry matter concentration (DMC were generally higher when cereals were at the hard dough compared to the late milk stage. On average, intercropping increased forage yield by 72%, NY by 190%, and CPC by 40 g kg-1, compared to cereal sole crops, but the choice of legume species affected the yield advantage and the composition of forage. Land equivalent ratio (LER of intercrops was always higher than 1, ranging from 1.39 to 1.61. Intercropping also enhanced weed suppression, compared to sole crop.

  3. Plant Regeneration of Ziziphus spina-christi by in vivo and in vitro Methods

    Institute of Scientific and Technical Information of China (English)

    M.H.ASSAREH; H.SARDABI; F.SABBAGHZADEH

    2005-01-01

    Christ's thorn (Ziziphus spina-christi L. Desf.) is ecologically and economically important in Iran. Since it is a crosspollinated plant with a wide range of genetic variability, an investigation was carried out to determine the best method for mass and clonal propagation. Three vegetative methods were examined, including 1) cutting, where shoots with a 22-25 cm length and three shoot diameters were treated with two culture media; 2) layering, where air layering and trench layering treatments consisted of three growth regulators at three levels of concentration; and 3) tissue culture with nodal segments bearing axillary buds that were removed from shoots of mature trees at different seasons. Several experiments were carried out to determine the best disinfectant chemical, the best culture method, the best season, the appropriate explant characteristics and media type. Rooting was successful only on the sandy beds for cuttings with more than 8.0 mm diameter. For the trench layering method, only one specimen in one replicate rooted a very small root, while for the air layering method, only seedlings with growth regulator treatments rooted successfully. The best season for explant harvesting was determined as mid summer, and among the disinfecting treatments, Ca(OCl)2 at a concentration of 0.5 g kg-1 for 20 minutes was the best. There were no significant differences for shoot weight and length with a Murashige and Skoog (MS) medium with and without a hormone.

  4. NADP-malate Dehydrogenase Isoforms of Wheat Leaves under Drought: Their Localization, and Some physicochemical and Kinetic Properties

    Directory of Open Access Journals (Sweden)

    H.G. Babayev

    2015-09-01

    Full Text Available Changes in sub-cellular localization, isoenzyme spectrum and kinetic characteristics of NADP-malate dehydrogenase (NADP-MDH, EC 1.1.1.82 in Triticum durum Desf. genotypes with contrasting drought tolerance have been studied. In chloroplast and cytosol fractions of mesophyll cells of wheat flag leaves 70-75% and 25-30% of the total NADP-MDH activity were found to be localized, respectively. Three isoforms of NADP-MDH with molecular weights of 66, 74 and 86 kDa were revealed in the chloroplast fraction, whereas in the cytosolic fraction molecular weights of the isoenzymes were found to be 42, 66 and 74 kDa. Drought caused the formation of a new 90 kDa isoform of the enzyme in the chloroplast fraction in anthesis phase of ontogenesis. In the drought-tolerant genotype the appearance of the new isoform in the chloroplast fraction was accompanied by a more rapid increase in Km and Vmax contrary to the chloroplast fraction of the drought-sensitive genotype manifesting a slight decrease in these parameters, suggesting one of the adaptive traits in forming drought tolerance in C3 plants.

  5. Effects of Heat Stress on Metabolite Accumulation and Composition, and Nutritional Properties of Durum Wheat Grain

    Directory of Open Access Journals (Sweden)

    Anna Maria de Leonardis

    2015-12-01

    Full Text Available Durum wheat (Triticum turgidum (L. subsp. turgidum (L. convar. durum (Desf. is momentous for human nutrition, and environmental stresses can strongly limit the expression of yield potential and affect the qualitative characteristics of the grain. The aim of this study was to determine how heat stress (five days at 37 °C applied five days after flowering affects the nutritional composition, antioxidant capacity and metabolic profile of the grain of two durum wheat genotypes: “Primadur”, an elite cultivar with high yellow index, and “T1303”, an anthocyanin-rich purple cultivar. Qualitative traits and metabolite evaluation (by gas chromatography linked to mass spectrometry were carried out on immature (14 days after flowering and mature seeds. The effects of heat stress were genotype-dependent. Although some metabolites (e.g., sucrose, glycerol increased in response to heat stress in both genotypes, clear differences were observed. Following the heat stress, there was a general increase in most of the analyzed metabolites in “Primadur”, with a general decrease in “T1303”. Heat shock applied early during seed development produced changes that were observed in immature seeds and also long-term effects that changed the qualitative and quantitative parameters of the mature grain. Therefore, short heat-stress treatments can affect the nutritional value of grain of different genotypes of durum wheat in different ways.

  6. [Herbological studies on Chinese crude drug Ma-huang. Part 1-On the botanical origin of Ma-huang in ancient China and the origin of Japanese Ma-huang].

    Science.gov (United States)

    Yoshizawa, Chieko; Kitade, Makiko; Mikage, Masayuki

    2005-01-01

    The botanical origin of a Chinese crude drug Ma-huang in ancient China and the origin of Japanese Ma-huang were herbologically studied. The results showed that the plants of Ephedra sinica Stapf, E. intermedia Schrenk & C. A. Meyer and E. equisetina Bunge were used as Ma-huang in China, and the first species was considered to be of high quality. The characters of Mao-zhou Ma-huang and Tong-zhou Ma-huang printed in Tu-jing-ben-cao, published in the Song Dynasty in China, were identified as E. likiangensis Florin and E. intermedia, respectively, and both species were recognized as excellent Ma-huang in the Ming Dynasty. The word origin of Katsune-kusa, the Japanese name for Ma-huang in the Heian Era, was etymologically considered as meaning the plant having reddish brown roots. In Japan, the plant of Equisetum ramosissimum Desf. var.japonicum Milde, of the family Equisetaceae, was substituted for Ma-huang in the middle of Edo Era, and it was designated that this action was based on the confusion of Ephedra plants and Equisetum plants those days in China.

  7. Susceptibility of different European populations of Tribolium confusum (coleoptera: Tenebrionidae) to five diatomaceous earth formulations.

    Science.gov (United States)

    Vayias, B J; Athanassiou, C G; Kavallieratos, N G; Buchelos, C Th

    2006-10-01

    Laboratory bioassays were conducted to evaluate the susceptibility of seven populations (strains) of the confused flour beetle, Tribolium confusum Jacquelin du Val (Coleoptera: Tenebrionidae), to five commercially available diatomaceous earth (DE) formulations: Insecto, Protect-It, Protector, PyriSec, and SilicoSec. These DEs were applied on wheat, Triticum durum Desf., at two dose rates, 500 and 1000 ppm. The six beetle strains were obtained from Denmark, United Kingdom, Greece, Germany, Italy, and Portugal, whereas a seventh strain came from the Greek strain after laboratory selection with SilicoSec-treated wheat for six generations. Adults of the above-mentioned strains were exposed for 7 d to wheat treated with each DE formulation, and mortality was assessed after exposure. For all DE-dose combinations, significant differences were noted in mortality levels among strains. Generally, the strains from Denmark, United Kingdom, and Germany were the most susceptible to the DEs used, whereas the strain from Portugal was the least susceptible. No significant differences were noted in susceptibility level between the initial Greek strain and the laboratory-selected Greek strain, with the exception of Protector, where the selected strain was significantly more tolerant than the initial strain for both dose rates tested.

  8. EFICIENTIZAREA SISTEMULUI DE ACHIZIŢII PUBLICE DIN REPUBLICA MOLDOVA ÎN CONTEXTUL PREVEDERILOR LEGISLATIVE ALE UE

    Directory of Open Access Journals (Sweden)

    Elena RUSU

    2016-12-01

    Full Text Available Autorul abordează întregul sistem de achiziţii publice ca un instrument necesar şi important de eficientizare a acestora în contextul prevederilor legislative ale UE. În baza analizei procesului de achiziţii publice în contextul prevederilor legislative ale UE autorul a constatat prezenţa unor nereguli şi disfuncţionalităţi la organizarea şi desfăşurarea procedu­rilor de achiziţii publice la nivel naţional. Ca urmare, sunt propuse unele direcţii eficiente care ar contribui la crearea unui sistem eficace de achiziţii publice pe baza principiilor de reglementare a acestora aplicate în UE.EFFICIENT PUBLIC PROCUREMENT SYSTEM IN THE REPUBLIC OF MOLDOVA IN THE CONTEXT OF THE EU LEGISLATIONAuthor deals with the whole system of public procurement as a necessary and important tool to streamline them in the context of the EU legislation. Based on the analysis of the procurement process in the context of the EU legislation, the author found the presence of irregularities and failures in organization and conduct of procurement procedures at national level, the conclusion was proposed some ways effective contribute to creating an effective procurement system based on the principles of solving them applied in the EU.

  9. Development of a method for the direct fermentation of semolina by selected sourdough lactic acid bacteria.

    Science.gov (United States)

    Alfonzo, Antonio; Urso, Valeria; Corona, Onofrio; Francesca, Nicola; Amato, Gaetano; Settanni, Luca; Di Miceli, Giuseppe

    2016-12-19

    Three obligately heterofermentative lactic acid bacteria (LAB) strains (Lactobacillus sanfranciscensis PON100336, Leuconostoc citreum PON10079 and Weissella cibaria PON10030) were used in this study as a multi-species starter culture for sourdough production. The starter inoculum was prepared and propagated in sterile semolina extract (SSE) broth. Acidification kinetics, microbiological counts detected on specific media for sourdough LAB, polymorphic profile comparison and species-specific PCRs evidenced a stability of the liquid inoculum over time determining its suitability for direct addition to semolina. In order to validate this innovative method for the production of durum wheat (Triticum durum Desf) sourdoughs, 15 semolinas (from ten old and five modern genotypes cultivated in Sicily, southern Italy) were used to prepare the SSEs and to produce sourdoughs and finally breads. Chemical and microbiological analyses of the sourdoughs and the evaluation of the quality parameters (weight loss, height, crumb and crust colour, image analysis and volatile organic compound generation) of the resulting breads indicated that the direct addition of the liquid inocula propagated in SSE is a valuable method to stabilise the production of sourdoughs. The differences registered during the technological characterisation of the breads were underlined by the sensory tests and the multivariate analysis and are mainly imputable to the type of semolina.

  10. Fungal trunk pathogens associated with wood decay of pistachio trees in Iran

    Directory of Open Access Journals (Sweden)

    Hamid Mohammadi

    2015-06-01

    Full Text Available Over the growing seasons of 2011–2013, various pistachio (Pistacia vera L. cv. Fandoghi, and wild pistachio (P. atlantica Desf. subsp. mutica trees were inspected in Iran to determine the aetiology of trunk diseases with specific reference to species of Phaeoacremonium and Botryosphaeriaceae spp. Samples were collected from branches of trees exhibiting yellowing, defoliation, canker and dieback, as well as wood discoloration in cross sections. Fungal trunk pathogens were identified using morphological and cultural characteristics as well as comparisons of DNA sequence data of the ITS and TEF-1α (for Botryosphaeriaceae species and β-tubulin gene (for Phaeoacremonium species regions. Phaeoacremonium parasiticum was the dominant species followed by Phaeoacremonium aleophilum, Botryosphaeria dothidea, Neofusicoccum parvum, Phaeoacremoniumcinereum, Phaeoacremonium viticola and Dothiorella viticola. Pathogenicity tests were undertaken to determine the role of these species on pistachio under field conditions. Neofusicoccum parvum and Pm. aleophilum caused the longest and smallest lesions respectively. This study represents the first report on the occurrence and pathogenicity of Phaeoacremonium species on P. vera cv. Fandoghi. This also represents the first report of Pleurostomophora sp. on pistachio and Pm. parasiticum and D. viticola on wild pistachio.

  11. Evaluation of Inter-Specific Hybrid of P. atlantica and P. vera L. cv. ‘Badami - Riz-e-Zarand’ as Pistachio rootstock to Salinity Stress According to Some Growth Indices and Eco-physiological and Biochemical Parameters

    Directory of Open Access Journals (Sweden)

    Hamid Reza Karimi

    2014-08-01

    Full Text Available In order to evaluate the inter-specific hybrid of P. atlantica Desf. and P. vera L. cv. ‘Badami- Riz-e- Zarand’ to salinity stress, a factorial experiment was conducted based on completely randomized design with 0, 60 and 120 mM of salinity levels of sodium chloride, calcium chloride and magnesium chloride (3:2:1 with four replications on ‘Qazvini’, ‘Badami-Riz-e-Zarand’ and inter-specific of P. atlantica Ч P. vera cv. ‘Badami-Rize-Zarand’ rootstocks of pistachio. The results showed that salinity has increased proline content of leaves. Chlorophyll index, relative water content of leaf, leaf area, shoot and root fresh and dry weight, stem diameter and number of leaves were decreased by increasing salinity. Rootstocks responded differently to salinity, so that the most reduction in chlorophyll index, leaf area and leaf number were observed in ‘Badami-Riz-e-Zarand’ rootstock and the least reduction was observed in the hybrid.

  12. Characterization of Wheat Random Amplified Polymorphic DNA Markers Associated with the H11 Hessian Fly Resistance Gene

    Institute of Scientific and Technical Information of China (English)

    Dhia Bouktila; Maha Mezghani; Mohamed Marrakchi; Hanem Makni

    2006-01-01

    In Tunisia, the Hessian fly Mayetiola destructor Say is a major pest of durum wheat (Triticum durum Desf.)and bread wheat (T. aestivum L.). Genetic resistance is the most efficient and economical method of control of this pest. To date, 31 resistance genes, designated H1-H31, have been identified in wheat. These genes condition resistance to the insect genes responsible for virulence. Using wheat cultivars differing for the presence of an individual Hessian fly resistance gene and random amplified polymorphic DNA (RAPD) analysis,we have identified a polymorphic 386-bp DNA marker (Xgmib1-1A.1) associated with the H11 Hessian fly resistance gene. Blast analysis showed a high identity with a short region in the wild wheat (T. monococcum)genome, adjacent to the leaf rust resistance Lr10 gene. A genetic linkage was reported between this gene (Lr10) and Hessian fly response in wheat. These data were used for screening Hessian fly resistance in Tunisian wheat germplasm. Xgmib1-1A.1-like fragments were detected in four Tunisian durum and bread wheat varieties. Using these varieties in Hessian fly breeding programs in Tunisia would be of benefit in reducing the damage caused by this fly.

  13. Free Radical Scavenging Fingerprints of Selected Aromatic and Medicinal Tunisian Plants Assessed by Means of TLC-DPPH(•) Test and Image Processing.

    Science.gov (United States)

    El Euch, Salma Kammoun; Cieśla, Łukasz; Bouzouita, Nabiha

    2014-01-01

    Aqueous-methanol extracts prepared from 10 Tunisian plant species were analyzed for the presence of potent direct antioxidants. The analyzed species included: Anacyclus clavatus Desf., Erica multiflora L., Cistus salvifolius L., Centaurium erythraea Rafn., Marrubium vulgare L., Lavandula stoechas L., Artemisia campestris L., Origanum majorana L., Salvia officinalis L., and Pistacia lentiscus L. All the extracts were chromatographed on the RP18 W plates with methanol-water-acetic acid (48 + 47 + 5, v/v/v) mobile phase. Upon completion of the chromatographic development and the drying step, the plates were stained with a chloroform solution of 2, 2-diphenyl-1-picrylhydrazyl radical (DPPH(•)). An image processing protocol, with use of Sorbfil TLC Videodensitometer, was applied to quantitatively measure the activity of polyphenols and to screen complex samples for the presence of free radical scavengers. The activity of the individual compounds was compared with that of rutin, used as a standard. The TLC-DPPH(•) test showed that C. salvifolius had the most potent antioxidant activity, as it possessed the highest activity coefficient (calculated as the sum of the areas under the peaks of all active compounds/area under peak of rutin). The proposed procedure may be used to differentiate potent chain-breaking antioxidants and compounds propagating radical chain reactions.

  14. Effects of Sorghum Flour Addition on Chemical and Rheological Properties of Hard White Winter Wheat

    Directory of Open Access Journals (Sweden)

    Ranya F. Abdelghafor

    2013-11-01

    Full Text Available This study was carried out to investigate the chemical and rheological properties of different blends prepared using hard white winter wheat (HWWW; Triticum aestivum Desf. and whole or decorticated sorghum (Sorghum bicolor. Whole and decorticated sorghum were used to replace 5, 10, 15 and 20% of wheat flour. Wheat samples had higher protein, moisture and calcium values and lower fat, ash, carbohydrates, iron and phosphorous values compared to whole and decorticated sorghum flours. Decortication of sorghum grains decreased moisture, ash, fat, crude protein, iron and phosphorous content, but increased carbohydrate content. Farinogram properties such as dough water absorption, development time and stability and Farinograph quality number decreased as the amount of substituted sorghum increased; whereas mixing tolerance index increased. Moreover, at fixed gluten levels, as sorghum flour increased in the blend, wet gluten, dry gluten and gluten index decreased. Increasing sorghum in the blend also decreased energy, resistance to extension and extensibility of the dough, but contributed to an increase in the ratio of resistance to extensibility. Furthermore, as fermentation time increased, energy, resistance to extension and the ratio number of energy to extension increased, whereas extensibility decreased.

  15. CADRUL INSTITUȚIONAL CU IMPACT ASUPRA ECONOMIEI SOCIALE

    Directory of Open Access Journals (Sweden)

    Simona Maria Stănescu

    2013-07-01

    Full Text Available Articolul trece în revistă instituțile internaționale și naționale cu impact asupra domeniului economiei sociale. Întrebarea de cercetare care a stat la baza acestui demers științific este: ce instituții au responsabilități în activitățile specifice privind înființarea, funcționazare și, nu în ultimul rând sprijinirea activității entităților de economie socială. Din punct de vedere metodologic, cercetarea se bazează pe analiza documentelor sociale publice, metode calitative și cantitative. Principala limitare metodologică a unui astfel de demers este acela că nu surprinde gradul de asumare al responsabilităților și eficiența activităților desfășurate de către instituțiile identificate. Acest subiect poate reprezenta fără îndoială un subiect de cercetare pentru viitor.

  16. Study of growth and development features of ten ground cover plants in Kish Island green space in warm season

    Directory of Open Access Journals (Sweden)

    S. Shooshtarian

    2016-05-01

    Full Text Available Having special ecological condition, Kish Island has a restricted range of native species of ornamental plants. Expansion of urban green space in this Island is great of importance due to its outstanding touristy position in the South of Iran. The purpose of this study was to investigate the growth and development of groundcover plants planted in four different regions of Kish Island and to recommend the most suitable and adaptable species for each region. Ten groundcover species included Festuca ovina L., Glaucium flavum Crantz., Frankenia thymifolia Desf., Sedum spurium Bieb., Sedum acre L., .Potentilla verna L., Carpobrotus acinaciformis (L. L. Bolus., Achillea millefolium L., Alternanthera dentata Moench. and Lampranthus spectabilis Haw. Evaluation of growth and development had been made by measurement of morphological characteristics such as height, covering area, leaf number and area, dry and fresh total weights and visual scoring. Physiological traits included proline and chlorophyll contents evaluated. This study was designed in factorial layout based on completely randomized blocks design with six replicates. Results showed that in terms of indices such as covering area, visual quality, height, total weight, and chlorophyll content, Pavioon and Sadaf plants had the most and the worst performances, respectively in comparison to other regions’ plants. Based on evaluated characteristics, C. acinaciformis, L. spectabilis and F. thymifolia had the most expansion and growth in all quadruplet regions and are recommend for planting in Kish Island and similar climates.

  17. Managementul cunoaşterii în biblioteci

    Directory of Open Access Journals (Sweden)

    Octavia-Luciana Madge

    2010-01-01

    Full Text Available Noua economie a cunoaşterii a dus la schimbări semnificative în managementul diferitelor tipuri de organizaţii ale societăţii, inclusiv al bibliotecilor şi serviciilor de informare, dar şi al resurselor de care acestea se ocupă. Articolul abordează procesul de management al cunoaşterii care poate ajuta bibliotecile să se adapteze mai bine la noile cerinţe ale erei digitale şi să vină în întâmpinarea nevoilor utilizatorilor. Sunt, de asemenea, prezentate şi rezultate ale unor cercetări recente pe tema managementului cunoaşterii desfăşurate în România şi în străinătate la nivelul profesioniştilor din domeniul biblioteconomiei şi ştiinţei informării, dar şi exemple de proiecte prin care acest proces a fost implementat în practica unor biblioteci.

  18. Garenoxacin activity against isolates form patients hospitalized with community-acquired pneumonia and multidrug-resistant Streptococcus pneumoniae.

    Science.gov (United States)

    Jones, Ronald N; Sader, Helio S; Stilwell, Matthew G; Fritsche, Thomas R

    2007-05-01

    Community-acquired pneumonia (CAP) continues to cause significant morbidity worldwide, and the principal bacterial pathogens (Streptococcus pneumoniae and Haemophilus influenzae) have acquired numerous resistance mechanisms over the last few decades. CAP treatment guidelines have suggested the use of broader spectrum agents, such as antipneumococcal fluoroquinolones as the therapy for at-risk patient population. In this report, we studied 3087 CAP isolates from the SENTRY Antimicrobial Surveillance Program (1999-2005) worldwide and all respiratory tract infection (RTI) isolate population of pneumococci (14665 strains) grouped by antibiogram patterns against a new des-F(6)-quinolone, garenoxacin. Results indicated that garenoxacin was highly active against CAP isolates of S. pneumoniae (MIC(90), 0.06 microg/mL) and H. influenzae (MIC(90), 99.9% of strains were inhibited at pneumoniae strains to penicillin or erythromycin; however, coresistances were high among the beta-lactams (penicillins and cephalosporins), macrolides, tetracyclines, and trimethoprim/sulfamethoxazole. Analysis of S. pneumoniae isolates with various antimicrobial resistance patterns to 6 drug classes demonstrated that garenoxacin was active against >99.9% (MIC, pneumoniae that have created therapeutic dilemmas for all RTI presentations. Garenoxacin appears to be a welcome addition to the CAP treatment options, particularly for the emerging MDR pneumococci strains.

  19. VIOLENŢA DOMESTICĂ ÎN VIZIUNEA TINERILOR

    Directory of Open Access Journals (Sweden)

    Aliona ONOFREI

    2017-01-01

    Full Text Available În articol sunt analizate datele studiului Opinia tinerilor din Republica Moldova privitor la violenţa domestică desfăşurat în perioada 1-15 martie 2015, pe un eşantion de 120 de studenţi ai Universităţii de Stat din Moldova. Sunt prezentate opiniile studenţilor referitoare la violenţa în familie, cauzele ce stau la baza fenomenului dat, consecinţele, precum şi acţiunile tinerilor cu privire la combaterea acestui flagel.DOMESTIC VIOLENCE IN VISION OF YOUNG PEOPLEIn the article the authors are analyzing the results of the study "Opinion of Moldovan youth regarding domestic violence." conducted on March 1–15th, on a sample of 120 students of Moldova State University. Here are presented the students’ opinion about their attitude regarding domestic violence, as well as causes underlying this phenomenon, consequences and actions of youth on combating this phenomenon.

  20. ASPECTE PRIVIND AUDITUL PERFORMANŢEI ÎN REPUBLICA MOLDOVA

    Directory of Open Access Journals (Sweden)

    Iulia CAPRIAN

    2015-12-01

    Full Text Available Auditul performanţei se concentrează pe determinarea faptului dacă activităţile, proiectele / programele / procesele se desfăşoară conform principiilor economicităţii, eficienţei şi eficacităţii şi dacă mai este loc pentru îmbunătăţiri. Acesta se realizează prin compararea performanţei în funcţie de setul de criterii prestabilite, precum şi prin analiza cauzelor ce determină apariţia problemelor sau devierilor de la aceste criterii, scopul principal fiind de a răspunde unor întrebări-cheie ale auditului şi de a furniza recomandări cu privire la îmbunătăţirile care se pot face.CERTAIN ASPECTS OF PERFORMANCE AUDIT IN THE REPUBLIC OF MOLDOVAPerformance auditing focuses on determining whether the activities, projects / programs / processes are conducted according to the principles of economy, efficiency and effectiveness and whether there is room for improvement; it is conducted by comparing performance on the basis of set criteria, as well as by analysis of the causes of the emergence of problems or deviations from these criteria, the main purpose being to answer certain key questions relevant for the audit and provide recommendations on improvements that can be made.

  1. Los mayas del altiplano: supervivencia indígena en Chiapas y Guatemala

    Directory of Open Access Journals (Sweden)

    Lovell, W. George

    2002-06-01

    Full Text Available En el contexto americano, pocos grupos indígenas han demostrado la capacidad de sobrevivir a lo largo de la historia como los mayas del altiplano. Hoy día en Chiapas existen más de un millón de indígenas mayas, un número que asciende a cinco o seis millones en el caso de Guatemala. Los pueblos mayas han respondido a la invasión y a la dominación para conservar elementos importantes de su cultura. Este artículo discute las formas en que los mayas del altiplano se han adaptado para sobrevivir a casi cinco siglos de conquista, identificando tres fases claves en su trayectoria histórica: (1 la experiencia colonial, que abarca los años entre 1524 y 1821; (2 una época de reforma y revolución, que corre de 1821 a 1954; y (3 un período de marginalización y descuido desde 1954 en adelante. Pese al desfío, los mayas del altiplano están equipados culturalmente para perdurar.

  2. Assessment of heavy metals accumulation by spontaneous vegetation: Screening for new accumulator plant species grown in Kettara mine-Marrakech, Southern Morocco.

    Science.gov (United States)

    Midhat, Laila; Ouazzani, Naaila; Esshaimi, Mouhsine; Ouhammou, Ahmed; Mandi, Laila

    2017-02-01

    The present paper aims to perform a screening of native plants growing in Kettara mine-Marrakech (Southern Morocco) for its phytoremediation. Plants and soil samples were collected and analyzed for Pb, Zn, Cu and Cd concentrations at several sites in the mine. The results showed that the soil in the vicinity of Kettara mine is deficient in major elements and contain toxic levels of metals. Spontaneously growing native plants were botanically identified and then classified into 21 species and 14 families. Significant difference was observed among the average concentrations of four heavy metals (Pb, Zn, Cu and Cd) in plants (p ≤ 0.05). Six plants of 21 species namely Hammada scoparia (Pomel) Iljin, Hirschfeldia incana (L.) Lagreze-Fossat, Lamarckia aurea (L.) Moench, Calendula algeriensis Boiss. & Reuter, Aizoon hispanicum L. and Melilotus sulcata Desf. were considered as the best-performing specimens due to their high ability to accumulate multiple metals in their shoots and roots without sustaining toxicity. This was confirmed by the transfer factors generally higher than 1. Using the most common criteria to classify the hyperaccumulator plants, these species can be classified as new accumulator plants of many heavy metals and be potentially used as remediation tools of metal-contaminated sites.

  3. Redox agents and N-ethylmaleimide affect protein polymerization during laboratory scale dry pasta production and cooking.

    Science.gov (United States)

    Bruneel, Charlotte; Buggenhout, Joke; Lagrain, Bert; Brijs, Kristof; Delcour, Jan A

    2016-04-01

    Durum wheat (Triticum durum Desf.) semolina gluten proteins consist of monomeric gliadin and polymeric glutenin and determine the quality of pasta products made therefrom. During pasta drying, glutenin starts polymerizing already below 60 °C (65% relative humidity (RH)), whereas gliadin only is incorporated in the protein network at temperatures exceeding 68 °C (68% RH) through thiol (SH)/disulfide (SS) exchange reactions. Removal of free SH groups in glutenin by adding 2.3 μmol KBrO3 or KIO3 per g dry matter semolina protein (g protein) or 13.8 μmol N-ethylmaleimide/g protein reduces gliadin-glutenin cross-linking during pasta drying and/or cooking and yields cooked pasta of high quality. Introducing free SH groups by adding 13.8 μmol glutathione/g protein increases gliadin-glutenin cross-linking during pasta processing, resulting in cooked pasta of lower quality. We hypothesize that too much gliadin incorporation in the glutenin network during pasta processing tightens the protein network and results in lower cooking quality.

  4. Effects of Heat Stress on Metabolite Accumulation and Composition, and Nutritional Properties of Durum Wheat Grain

    Science.gov (United States)

    de Leonardis, Anna Maria; Fragasso, Mariagiovanna; Beleggia, Romina; Ficco, Donatella Bianca Maria; de Vita, Pasquale; Mastrangelo, Anna Maria

    2015-01-01

    Durum wheat (Triticum turgidum (L.) subsp. turgidum (L.) convar. durum (Desf.)) is momentous for human nutrition, and environmental stresses can strongly limit the expression of yield potential and affect the qualitative characteristics of the grain. The aim of this study was to determine how heat stress (five days at 37 °C) applied five days after flowering affects the nutritional composition, antioxidant capacity and metabolic profile of the grain of two durum wheat genotypes: “Primadur”, an elite cultivar with high yellow index, and “T1303”, an anthocyanin-rich purple cultivar. Qualitative traits and metabolite evaluation (by gas chromatography linked to mass spectrometry) were carried out on immature (14 days after flowering) and mature seeds. The effects of heat stress were genotype-dependent. Although some metabolites (e.g., sucrose, glycerol) increased in response to heat stress in both genotypes, clear differences were observed. Following the heat stress, there was a general increase in most of the analyzed metabolites in “Primadur”, with a general decrease in “T1303”. Heat shock applied early during seed development produced changes that were observed in immature seeds and also long-term effects that changed the qualitative and quantitative parameters of the mature grain. Therefore, short heat-stress treatments can affect the nutritional value of grain of different genotypes of durum wheat in different ways. PMID:26703576

  5. Technological properties of bakers' yeasts in durum wheat semolina dough.

    Science.gov (United States)

    Giannone, Virgilio; Longo, Chiara; Damigella, Arcangelo; Raspagliesi, Domenico; Spina, Alfio; Palumbo, Massimo

    2010-04-01

    Properties of 13 Saccharomyces cerevisiae strains isolated from different sources (traditional sourdoughs, industrial baking yeasts etc.) were studied in dough produced with durum wheat (Sicilian semolina, variety Mongibello). Durum wheat semolina and durum wheat flour are products prepared from grain of durum wheat (Triticum durum Desf.) by grinding or milling processes in which the bran and germ are essentially removed and the remainder is comminuted to a suitable degree of fineness. Acidification and leavening properties of the dough were evaluated. Strains isolated from traditional sourdoughs (DSM PST18864, DSM PST18865 and DSM PST18866) showed higher leavening power, valuable after the first and second hours of fermentation, than commercial baking yeasts. In particular the strain DSM PST 18865 has also been successfully tested in bakery companies for the improvement of production processes. Baking and staling tests were carried out on five yeast strains to evaluate their fermentation ability directly and their resistance to the staling process. Amplified fragment length polymorphism (fAFLP) was used to investigate genetic variations in the yeast strains. This study showed an appreciable biodiversity in the microbial populations of both wild and commercial yeast strains.

  6. Decontamination Systems Information and Research Program. Quarterly technical progress report, January 1--March 31, 1994

    Energy Technology Data Exchange (ETDEWEB)

    1994-05-01

    West Virginia University (WVU) and the US DOE Morgantown Energy Technology Center (METC) entered into a Cooperative Agreement on August 29, 1992 entitled ``Decontamination Systems Information and Research Programs.`` Stipulated within the Agreement is the requirement that WVU submit to METC a series of Technical Progress Reports on a quarterly basis. This report comprises the first Quarterly Technical Progress Report for Year 2 of the Agreement. This report reflects the progress and/or efforts performed on the sixteen (16) technical projects encompassed by the Year 2 Agreement for the period of January 1 through March 31, 1994. In situ bioremediation of chlorinated organic solvents; Microbial enrichment for enhancing in-situ biodegradation of hazardous organic wastes; Treatment of volatile organic compounds (VOCs) using biofilters; Drain-enhanced soil flushing (DESF) for organic contaminants removal; Chemical destruction of chlorinated organic compounds; Remediation of hazardous sites with steam reforming; Soil decontamination with a packed flotation column; Use of granular activated carbon columns for the simultaneous removal of organics, heavy metals, and radionuclides; Monolayer and multilayer self-assembled polyion films for gas-phase chemical sensors; Compact mercuric iodide detector technology development; Evaluation of IR and mass spectrometric techniques for on-site monitoring of volatile organic compounds; A systematic database of the state of hazardous waste clean-up technologies; Dust control methods for insitu nuclear and hazardous waste handling; Winfield Lock and Dam remediation; and Socio-economic assessment of alternative environmental restoration technologies.

  7. Salicylic Acid and Calcium Treatments Improves Wheat Vigor, Lipids and Phenolics Under High Salinity.

    Science.gov (United States)

    Yücel Candan, Nilgün; Heybet Elif, Haklı

    2016-12-01

    Seed vigor is a complex physiological trait required to ensure the rapid and uniform emergence of plants in the field under different environmental conditions. Therefore, salicylic acid (SA, 0.5 mM) and calcium (Ca2+, 50 mM) priming were used as exogenous growth enhancers to stimulate wheat (Triticum durum Desf. cv. Yelken) seed vigor under high salinity. The main aim was to address whether priming of wheat with SA, Ca2+ and SA+Ca (SA, 0.5 mM + Ca2+, 50 mM; their combination) could bring about supplementary agronomic benefits particularly under stressful environments such as salinity. Exogenous application of SA or Ca2+ alone improved plant behavior in the presence of salinity stress. Nevertheless, the best results in terms of growth, seed vigor and total phenolic - flavonoids, chlorophyll - carotenoids contents and phenylalanine ammonia-lyase (PAL), ascorbic acide oxidase (AAO) activities and lipid peroxidation levels (LPO) were obtained in response to the combined SA+Ca treatment.

  8. Quantitative inheritance of resistance to Septoria tritici blotch in durum wheat in Tunisia

    Directory of Open Access Journals (Sweden)

    Samia Berraies

    2014-03-01

    Full Text Available Septoria tritici blotch, causal agent Mycosphaerella graminicola (Fuckel J. Schrot. (anamorph: Zymoseptoria tritici Desm., is the major foliar disease of wheat (Triticum aestivum L. in Tunisia causing frequent epidemics on T. turgidum L. var. durum (Desf. Bowden, and important yield and grain quality losses. To determine the inheritance of resistance to septoria, a cross was made using resistant ('Salim' and susceptible ('Karim' cultivars. Parents, and the 149 derived recombinant lines, were tested for resistance to septoria under field conditions during the 2009 and 2010 crop seasons. The inheritance of resistance to septoria was quantitative where a continuous and normal distribution (W = 0.93 was shown among segregate progenies. During 2009 and 2010 crop seasons, the mean disease severities of recombinant inbred lines (RILs ranged from 29.1% to 41.8%, respectively, and 53% of RILs were associated with lower disease severity than the mid-parent value. The severity was significantly affected by Genotype x Year interaction (p < 0.01. Broad sense heritability was 0.55 suggesting a quantitative inheritance of resistance to M. graminicola. These results would imply that genetic resistance to STB could be attributed to additive gene effects. Thus, using identified sources of tolerance to STB in a breeding program would enhance the development of cultivars that are adapted to the prevailing isolates in field conditions.

  9. Phytotoxic, clastogenic and bioaccumulation effects of the environmental endocrine disruptor bisphenol A in various crops grown hydroponically.

    Science.gov (United States)

    Ferrara, Giuseppe; Loffredo, Elisabetta; Senesi, Nicola

    2006-04-01

    The effects of the endocrine disruptor bisphenol A (BPA) at concentrations of 10 and 50 mg l(-1) were evaluated on the germination and morphology, micronuclei (MN) content in root tip cells and BPA bioaccumulation of hydroponic seedlings of broad bean (Vicia faba L.), tomato (Lycopersicon esculentum Mill.), durum wheat (Triticum durum Desf.) and lettuce (Lactuca sativa L.) after 6 and 21 days of growth. In general, BPA at any dose used did not inhibit germination and early growth (6 days) of seedlings of the species examined, with the exception of primary root length of tomato which decreased at the higher BPA dose. In contrast, an evident phytotoxicity was induced by BPA in all species after 21 days of growth with evident morphological anomalies and significant reductions of the lengths and fresh and dry weights of shoots and roots of seedlings. With respect to the nutrient medium without seedlings, BPA concentration decreased markedly during the growth period in the presence of broad bean and tomato seedlings, and limitedly in the presence of durum wheat and, especially, lettuce. Further, the presence of BPA measured in roots and shoots of broad bean and tomato after 21-day growth indicated that bioaccumulation of BPA had occurred. The number of MN in broad bean and durum wheat root tip cells increased markedly by treatment with BPA at both concentrations, thus suggesting a potential clastogenic activity of BPA in these species.

  10. Factors controlling carbon metabolism and humification in different soil agroecosystems.

    Science.gov (United States)

    Doni, S; Macci, C; Peruzzi, E; Ceccanti, B; Masciandaro, G

    2014-01-01

    The aim of this study was to describe the processes that control humic carbon sequestration in soil. Three experimental sites differing in terms of management system and climate were selected: (i) Abanilla-Spain, soil treated with municipal solid wastes in Mediterranean semiarid climate; (ii) Puch-Germany, soil under intensive tillage and conventional agriculture in continental climate; and (iii) Alberese-Italy, soil under organic and conventional agriculture in Mediterranean subarid climate. The chemical-structural and biochemical soil properties at the initial sampling time and one year later were evaluated. The soils under organic (Alberese, soil cultivated with Triticum durum Desf.) and nonintensive management practices (Puch, soil cultivated with Triticum aestivum L. and Avena sativa L.) showed higher enzymatically active humic carbon, total organic carbon, humification index (B/E(3)s), and metabolic potential (dehydrogenase activity/water soluble carbon) if compared with conventional agriculture and plough-based tillage, respectively. In Abanilla, the application of municipal solid wastes stimulated the specific β-glucosidase activity (extracellular β-glucosidase activity/extractable humic carbon) and promoted the increase of humic substances with respect to untreated soil. The evolution of the chemical and biochemical status of the soils along a climatic gradient suggested that the adoption of certain management practices could be very promising in increasing SOC sequestration potential.

  11. Factors Controlling Carbon Metabolism and Humification in Different Soil Agroecosystems

    Directory of Open Access Journals (Sweden)

    S. Doni

    2014-01-01

    Full Text Available The aim of this study was to describe the processes that control humic carbon sequestration in soil. Three experimental sites differing in terms of management system and climate were selected: (i Abanilla-Spain, soil treated with municipal solid wastes in Mediterranean semiarid climate; (ii Puch-Germany, soil under intensive tillage and conventional agriculture in continental climate; and (iii Alberese-Italy, soil under organic and conventional agriculture in Mediterranean subarid climate. The chemical-structural and biochemical soil properties at the initial sampling time and one year later were evaluated. The soils under organic (Alberese, soil cultivated with Triticum durum Desf. and nonintensive management practices (Puch, soil cultivated with Triticum aestivum L. and Avena sativa L. showed higher enzymatically active humic carbon, total organic carbon, humification index (B/E3s, and metabolic potential (dehydrogenase activity/water soluble carbon if compared with conventional agriculture and plough-based tillage, respectively. In Abanilla, the application of municipal solid wastes stimulated the specific β-glucosidase activity (extracellular β-glucosidase activity/extractable humic carbon and promoted the increase of humic substances with respect to untreated soil. The evolution of the chemical and biochemical status of the soils along a climatic gradient suggested that the adoption of certain management practices could be very promising in increasing SOC sequestration potential.

  12. Antibacterial Activity of Daucus crinitus Essential Oils along the Vegetative Life of the Plant

    Directory of Open Access Journals (Sweden)

    Amel Bendiabdellah

    2013-01-01

    Full Text Available The essential oils from the aerial parts of Daucus crinitus Desf. were analyzed at three developmental stages (early vegetative, early flowering, and full flowering. Oil yield was found to vary depending on the stage of development, and the highest content of oil (0.15% w/w was obtained at full flowering. The chemical composition of essential oils studied by GC and GC-MS showed a total of 71 compounds: 27 aliphatic compounds, 18 sesquiterpene hydrocarbons, 9 hydrocarbons monoterpene, 5 oxygenated monoterpenes, 5 phenolic compounds, 4 oxygenated sesquiterpenes, 2 oxygenated diterpenes, and 01 diterpene hydrocarbons. Whatever the analyzed stage, phenolic compounds were the most abundant group. Their level significantly increased during ripening and varied from 36.4 to 82.1%. Antimicrobial activities of oils were tested on four different microorganisms. The oils of various phenological stages showed high activity against Candida albicans (30 mm and Staphylococcus aureus (11–28 mm bacteria strains which are deemed very dangerous and very difficult to eliminate. Thus, they represent an inexpensive source of natural antibacterial substances that may potentially be used in pathogenic systems.

  13. Investigation on use of superabsorbent materials in forest seedling establishment

    Directory of Open Access Journals (Sweden)

    Jaafar Hosseinzadeh

    2016-09-01

    Full Text Available The establishment of appropriate trees in arid and semi-arid regions that are at risk of desertification is an important stepto control soil erosion and reforestation of degraded lands.The success of tree planting, especially in the Zagros forests due to low rainfall, shortage of water resources or difficult access conditions, is not satisfied.One way to overcome this problem is use of absorbent polymers, which increase the water holding capacity of light soils and will enhance the success of vegetation development programs.In this study, the use of a water-absorbent polymer or hydrogel (brand ofHerbosorb to help in reforestation and the establishment of three species of forest trees: oak (Quercusbrantii L., pistachio (PistaciaatlanticaDesf. and hackberry (CeltiscaucasicaWilld., that are native plants and resistant to the conditions, in lower edge of the ruined land of Zagros forests,Ilamprovince, is tested.The factorial experiment in a completely randomized design with three replications was conducted and it was determined the effect of two factors superabsorbent and species.The results showed that there is no significant difference in survival between the species,but the difference between the treated superabsorbent at 95% is significant and shows that the superabsorbent has a positive effect (about 17% on survival. According to the same habitat requirements of species,interaction between tree species and superabsorbent treatment was not significant in this study.

  14. 汾河中上游地区禾本科植物调查%Investigation of Gramineae in the Middle and the Upper Reaches of the Fenhe River

    Institute of Scientific and Technical Information of China (English)

    岳建英; 郭春燕; 李晋川; 卢宁; 王翔; 李倩冉

    2015-01-01

    禾本科(Gramineae)是种子植物中最有经济价值的科.报道了汾河中上游地区禾本科植物42属78种(含种下等级7个),其中,含种数最多的属为鹅观草属RoegneriaC.Koch.(7种,1变种),其次为早熟禾属Poa L.(6种),含有4种的属为狗尾草属Setaria Beauv.、披碱草属Elymus L.,含有3种的属有芨芨草属Achnatherum Beauv.、马唐属Digitaria Hall.、画眉草属Eragrostis Beauv.、隐子草属Cleistogenes Keng(1变种)、稗属Echinochloa Beauv.(1变种)、针茅属Stipa L(1变种),含有2种的属有荩草属Arthraxon Beauv.、拂子茅属Calamagrostis Adans.、羊草属Leymus Hochst.、棒头草属Polypogon Desf.、高粱属Sorghum Moench、野青茅属Deyeuxia Clartion(3变种),含有1种的属最多,达25属.

  15. Early and Late Heat Shock Proteins in Wheats and Other Cereal Species 1

    Science.gov (United States)

    Necchi, Ada; Pogna, Norberto E.; Mapelli, Sergio

    1987-01-01

    Coleoptiles and roots of 3-day-old seedlings from five cereal species (Triticum aestivum L., T. durum Desf., Hordeum vulgare L., Secale cereale L., and Triticale) respond to heat shock at 40°C by synthesizing a new set of 13 strong bands (as revealed by one-dimensional sodium dodecyl sulfate gel electrophoresis) as well as some 20°C proteins. Heat shock proteins (HSPs) belong to three different size groups: high molecular mass HSPs in the 103 to 70 kilodalton range, intermediate molecular mass HSPs in the 62 to 32 kilodalton range, and low molecular mass HSPs about 17 to 16 kilodalton in size. At the beginning of the heat shock coleoptiles show a reduced ability to synthesize intermediate molecular mass HSPs but after 4 hours at 40°C they exhibit fully developed HSP patterns identical to that found in roots. Synthesis of early HSPs declines after 7 hours of treatment followed by the appearance of a new set of 12 protein bands (late HSPs) in the ranges 99 to 83, 69 to 35, and 15 to 14 kilodaltons. After 12 hours at 40°C, three other late HSPs of 89, 45, and 38 kilodalton are induced. The induction of late HSPs after 7 hours at 40°C appears to be associated with an enhancement of radioactive methionine incorporation into proteins. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 PMID:16665614

  16. Phytodesalination of a moderately-salt-affected soil by Sulla carnosa.

    Science.gov (United States)

    Jlassi, Arwa; Zorrig, Walid; El Khouni, Amine; Lakhdar, Abdelbasset; Smaoui, Abderrazak; Abdelly, Chedly; Rabhi, Mokded

    2013-01-01

    The aim of this investigation was to evaluate the ability of the indifferent halophyte Sulla carnosa Desf. to desalinize a moderately-salt-affected soil. Seeds were sown on a fertile soil added or not with 1.5 g NaCl. kg(-1). Analogous treatments without plantation (control and salinized) were also used. Plant culture was performed under greenhouse conditions in non-perforated pots containing 10 kg soil each and irrigated with non-saline tap water. After 80 days of treatment, shoots were harvested. Soil samples were also collected after division of soil column in each pot into two horizons. Our results showed that salt addition increased electrical conductivity of saturation paste extract (ECe)from 3.3 to 8.4 dS. m(-1) and soluble sodium concentration from 0.32 to 1.15 g. kg(-1) soil in the upper horizon. In the lower horizon however, Na+ concentration was quasi-constant and then ECe was less increased. Plant culture inversed this pattern of sodium accumulation and salinity. Its productivity and phytodesalination capacity in 80 days were 5.0 t DW. ha(-1) and 0.3 t Na+. ha(-1) (24% of the added quantity), respectively. Interestingly, sodium dilution within biomass (41.5-45.6 mg. g(-1) DW) and the non-altered nutrition make this plant suitable for forage as second use after phytodesalination.

  17. Mutations in Durum Wheat SBEII Genes affect Grain Yield Components, Quality, and Fermentation Responses in Rats.

    Science.gov (United States)

    Hazard, Brittany; Zhang, Xiaoqin; Naemeh, Mahmoudreza; Hamilton, M Kristina; Rust, Bret; Raybould, Helen E; Newman, John W; Martin, Roy; Dubcovsky, Jorge

    2015-01-01

    Increased amylose in wheat (Triticum ssp.) starch is associated with increased resistant starch, a fermentable dietary fiber. Fermentation of resistant starch in the large intestine produces short-chain fatty acids that are associated with human health benefits. Since wheat foods are an important component of the human diet, increases in amylose and resistant starch in wheat grains have the potential to deliver health benefits to a large number of people. In three replicated field trials we found that mutations in starch branching enzyme II genes (SBEIIa and SBEIIb) in both A and B genomes (SBEIIa/b-AB) of durum wheat [T. turgidum L. subsp. durum (Desf.) Husn.] resulted in large increases of amylose and resistant starch content. The presence of these four mutations was also associated with an average 5% reduction in kernel weight (P = 0.0007) and 15% reduction in grain yield (P = 0.06) compared to the wild type. Complete milling and pasta quality analysis showed that the mutant lines have an acceptable quality with positive effects on pasta firmness and negative effects on semolina extraction and pasta color. Positive fermentation responses were detected in rats (Rattus spp.) fed with diets incorporating mutant wheat flour. This study quantifies benefits and limitations associated with the deployment of the SBEIIa/b-AB mutations in durum wheat and provides the information required to develop realistic strategies to deploy durum wheat varieties with increased levels of amylose and resistant starch.

  18. Production of aneuhaploid and euhaploid sporocytes by meiotic restitution in fertile hybrids between durum wheat Langdon chromosome substitution lines and Aegilops tauschii

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Fertile F1 hybrids were obtained between durum wheat (Triticum durum Desf.) Langdon (LDN) and its 10 disomic substitution (LDN DS) lines with Aegilops tauschii accession AS60 without embryo rescue. Selfed seedset rates for hybrids of LDN with AS60 were 36.87% and 49,45% in 2005 and 2006, respectively. Similar or higher selfed seedset rates were observed in the hybrids of ID (1A), 1D (1B), 3D (3A), 4D (4B), 7D (TA), and 2D (2B) with AS60, while lower in hybrids of 3D (3B) + 3BL, 5D (5A) + 5AL, 5D (5B) + 5B and 6D (6B) + 6BS with AS60 compared with the hybrids of LDN with AS60. Observation of male gametogenesis showed that meiotic restitution, both first-division restitution (FDR) and single-division meiosis (SDM) resulted in the formation of functional unreduced gametes, which in turn produced seeds. Both euhaploid and aneuhaploid gametes were produced in Fi hybrids. This suggested a strategy to simultaneously transfer and locate major genes from the ancestral species T. turgidum or Ae. tauschii. Moreover, there was no significant difference in the aneuhaploid rates between the F1 hybrids of LDN and LDN DS lines with AS60, suggesting that meiotic pairing between the two D chromosomes in the hybrids of LDN DS lines with AS60 did not promote the formation of aneuhaploid gametes.

  19. A REVISION OF MALESIAN CAESALPINIA, INCLUDING MEZONEURON*(LEGUMINOSAE-CAESALPLNIACEAE

    Directory of Open Access Journals (Sweden)

    T. A. HATTINK

    1974-12-01

    Full Text Available This is the first taxonomic revision of this pantropical genus ofprickly climbers for the area, the Solomons inclusive. It deals with21 species, of which 19 ore native (dealt with over the whole of theirarea, and 2 are widely naturalized, viz C. pulckerrima and C. sappan.Also mentioned are 3 occasional introductions. Full descriptions are given,keys to the native and to the cultivated species, the complete synonymyand typification with all important later references. Many new deductionshave been made, some from adjacent regions.New species are C. opptrsitifolia, from Borneo, with truly oppositeleaves and C Bolomonewsis from the Solomons; new combinations arebased on M. fwfuracewm. Prain, C. hymenocarpa based on M, hymeno-C. mindorevigiit based on M. •miTtdor^jtse Merr., C. pubeecens based onM. pubescens Desf., C. scorteckinii baaed on M. scortechinii F.v.M. fromQueensland and now on record from New Guinea, the last one closelyresembling C. brachycarpa, another new combination based on M. braehy-carpmn Benth, from New South Wales.No subdivisions of the genus are adopted or proposed. The long-standing nomenclatural confusion hetween C. bonduc, C. bonducella,C. cristrt, and C. major has been visualized in a diagram. Specimens ofimportance for the knowledge of the area have been cited. Extreme andintergrading specimens are discussed. Eeference is made to the mainIndexes to all names and all specimens are given.

  20. The Diversity of Caddisflies (Insecta, Trichoptera Species in TimiȘ River Catchment Area (Western Romania

    Directory of Open Access Journals (Sweden)

    Pârvu Mălina

    2013-12-01

    Full Text Available Diversitatea speciilor de trichoptere în zona bazinului hidrografic al râului Timiş. În vederea determinării rolului de bioindicatori al comunităților de macronevertebrate bentonice, cercetători din întreaga lume au desfășurat studii de analiză a structurii, dinamicii și diversității diferitelor grupe, alături de cele privind factorii fizico-chimici. În prezentul studiu, au fost identificate 21 specii de trichoptere în stadiul larvar. Valorile abundenței numerice procentuale, ale frecvenței și diversității biologice privind larvele de trichoptere identificate au variat în raport cu modificările parametrilor fizico-chimici specifici fiecărei stații de colectare a probelor. Valorile parametrilor fizico-chimici monitorizați în bazinul hidrografic al Timișului au corespuns limitelor Ordinului Ministrului Apelor și Protecției Mediului 161/2006, care prevede starea ecologică a corpurilor de apă, fiind identificate câteva excepții.

  1. Water stress and cell wall polysaccharides in the apical root zone of wheat cultivars varying in drought tolerance.

    Science.gov (United States)

    Leucci, Maria Rosaria; Lenucci, Marcello Salvatore; Piro, Gabriella; Dalessandro, Giuseppe

    2008-07-31

    Glycosyl composition and linkage analysis of cell wall polysaccharides were examined in apical root zones excised from water-stressed and unstressed wheat seedlings (Triticum durum Desf.) cv. Capeiti ("drought-tolerant") and cv. Creso ("drought sensitive"). Wall polysaccharides were sequentially solubilized to obtain three fractions: CDTA+Na(2)CO(3) extract, KOH extract and the insoluble residue (alpha-cellulose). A comparison between the two genotypes showed only small variations in the percentages of matrix polysaccharides (CDTA+Na(2)CO(3) plus KOH extract) and of the insoluble residues (alpha-cellulose) in water-stressed and unstressed conditions. Xylosyl, glucosyl and arabinosyl residues represented more than 90 mol% of the matrix polysaccharides. The linkage analysis of matrix polysaccharides showed high levels of xyloglucans (23-39 mol%), and arabinoxylans (38-48 mol%) and a low amount of pectins and (1-->3), (1-->4)-beta-D-glucans. The high level of xyloglucans was supported by the release of the diagnostic disaccharide isoprimeverose after Driselase digestion of KOH-extracted polysaccharides. In the "drought-tolerant" cv. Capeiti the mol% of side chains of rhamnogalacturonan I and II significantly increased in response to water stress, whereas in cv. Creso, this increase did not occur. The results support a role of the pectic side chains during water stress response in a drought-tolerant wheat cultivar.

  2. Soluble free phenolic compound contents and antioxidant capacity of bread and durum wheat genotypes

    Directory of Open Access Journals (Sweden)

    Žilić Slađana

    2013-01-01

    Full Text Available The objective of this study was to determine phenolic compounds and the total antioxidant capacity in the grain of ten bread (T. aestivum L. and ten durum (T. durum Desf. wheat genotypes. Soluble free forms of total phenolics, flavonoids, PVPP (polyvinylpolypyrrolidone bound phenolics, proanthocyanidins and phenolic acids were investigated. In addition, the correlation coefficients between total antioxidant capacities and the concentration of different soluble free phenolic compounds, as well as between soluble free total phenolics and phenolic acids, flavonoids and PVPP bound phenolics were determined. Significant differences in the content of aceton/water extractable total phenolics, PVPP bound phenolics and phenolic acids between and within two wheat species were found. On the average, durum wheat samples had about 1.19-fold higher total phenolic compounds and about 1.5-fold higher PVPP bound phenolics than bread wheat samples. Three phenolic acids, ferulic, caffeic and chlorogenic, were detected in wholemeal bread wheat. Caffeic acid was not found in durum wheat samples whilst ferulic acid was the most abundant. Proanthocyanidins in bread and durum wheat genotypes were not detected. The antioxidant capacity measured as the DPPH radical scavenging activity was similar in wholemeal of bread and durum wheat, however, significant differences were observed among genotypes within species. [Projekat Ministarstva nauke Republike Srbije, br. 31069

  3. SOLUȚIONAREA „CHESTIUNII ARMENEȘTI” DE CĂTRE GUBERNATORUL BASARABIEI S.D. URUSOV (1903-1904

    Directory of Open Access Journals (Sweden)

    Valentin ARAPU

    2017-08-01

    Full Text Available Gubernatorul Basarabiei S.D. Urusov a soluționat „chestiunea armenească” pe cale amiabilă. Armenii basarabeni au acceptat să cedeze statului rus o parte din bani și proprietăți, păstrându-și intacte privilegiile și statutul de odinioară. În Basarabia, spre deosebire de alte gubernii în care au existat tensiuni în acest sens, grație unei politici abile și tolerante, promovate față de armeni de către S.D. Urusov, procesul de expropriere parțială a comunității armenești s-a desfășurat calm și fără excese.SETTLEMENT OF THE „ARMENIAN ISSUE” BY THE GOVERNOR OF BESSARABIA S.D. URUSOV (1903-1904The governor of Bessarabia S.D. Urusov settled the „Armenian issue” in an amicable way. Armenians from Bessarabiaagreed to cede to Russian state some money and properties, in order to keep intact the privileges and status they held. In Bessarabia, unlike other gubernias, where there were tensions in this regard, thanks to skilful and tolerant policy, promoted by S.D. Urusov, the process of partial expropriation of the Armenian community was held calmly and without excesses.

  4. Resistance to Soil-borne cereal mosaic virus in durum wheat is controlled by a major QTL on chromosome arm 2BS and minor loci.

    Science.gov (United States)

    Maccaferri, Marco; Ratti, Claudio; Rubies-Autonell, Concepcion; Vallega, Victor; Demontis, Andrea; Stefanelli, Sandra; Tuberosa, Roberto; Sanguineti, Maria Corinna

    2011-08-01

    Soil-borne cereal mosaic (SBCM) is a viral disease, which seriously affects hexaploid as well as tetraploid wheat crops in Europe. In durum wheat (Triticum durum Desf.), the elite germplasm is characterized by a wide range of responses to SBCMV, from susceptibility to almost complete resistance. In this study, the genetic analysis of SBCMV resistance was carried out using a population of 181 durum wheat recombinant inbred lines (RILs) obtained from Meridiano (resistant) × Claudio (moderately susceptible), which were profiled with SSR and DArT markers. The RILs were characterized for SBCMV response in the field under severe and uniform SBCMV infection during 2007 and 2008. A wide range of disease reactions (as estimated by symptom severity and DAS-ELISA) was observed. A large portion of the variability for SBCMV response was explained by a major QTL (QSbm.ubo-2BS) located in the distal telomeric region of chromosome 2BS near the marker triplet Xbarc35-Xwmc661-Xgwm210, with R(2) values ranging from 51.6 to 91.6%. The favorable allele was contributed by Meridiano. Several QTLs with minor effects on SBCMV response were also detected. Consistently with the observed transgressive segregation, the resistance alleles at minor QTLs were contributed by both parents. The presence and effects of QSbm.ubo-2BS were validated through association mapping in a panel of 111 elite durum wheat accessions.

  5. Effects of Heat Stress on Metabolite Accumulation and Composition, and Nutritional Properties of Durum Wheat Grain.

    Science.gov (United States)

    de Leonardis, Anna Maria; Fragasso, Mariagiovanna; Beleggia, Romina; Ficco, Donatella Bianca Maria; de Vita, Pasquale; Mastrangelo, Anna Maria

    2015-12-19

    Durum wheat (Triticum turgidum (L.) subsp. turgidum (L.) convar. durum (Desf.)) is momentous for human nutrition, and environmental stresses can strongly limit the expression of yield potential and affect the qualitative characteristics of the grain. The aim of this study was to determine how heat stress (five days at 37 °C) applied five days after flowering affects the nutritional composition, antioxidant capacity and metabolic profile of the grain of two durum wheat genotypes: "Primadur", an elite cultivar with high yellow index, and "T1303", an anthocyanin-rich purple cultivar. Qualitative traits and metabolite evaluation (by gas chromatography linked to mass spectrometry) were carried out on immature (14 days after flowering) and mature seeds. The effects of heat stress were genotype-dependent. Although some metabolites (e.g., sucrose, glycerol) increased in response to heat stress in both genotypes, clear differences were observed. Following the heat stress, there was a general increase in most of the analyzed metabolites in "Primadur", with a general decrease in "T1303". Heat shock applied early during seed development produced changes that were observed in immature seeds and also long-term effects that changed the qualitative and quantitative parameters of the mature grain. Therefore, short heat-stress treatments can affect the nutritional value of grain of different genotypes of durum wheat in different ways.

  6. A systematic assessment of the state of hazardous waste clean-up technologies. Quarterly technical progress report, April 1--June 30, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Berg, M.T.; Reed, B.E.; Gabr, M.

    1993-07-01

    West Virginia University (WVU) and the US DOE Morgantown Energy Technology Center (METC) entered into a Cooperative Agreement on August 29, 1992 entitled ``Decontamination Systems Information and Research Programs.`` Stipulated within the Agreement is the requirement that WVU submit to METC a series of Technical Progress Report for Year 1 of the Agreement. This report reflects the progress and/or efforts performed on the following nine technical projects encompassed by the Year 1 Agreement for the period of April 1 through June 30, 1993: Systematic assessment of the state of hazardous waste clean-up technologies; site remediation technologies -- drain-enhanced soil flushing (DESF) for organic contaminants removal; site remediation technologies -- in situ bioremediation of organic contaminants; excavation systems for hazardous waste sites; chemical destruction of polychlorinated biphenyls; development of organic sensors -- monolayer and multilayer self-assembled films for chemical sensors; Winfield lock and dam remediation; Assessments of Technologies for hazardous waste site remediation -- non-treatment technologies and pilot scale test facility implementation; and remediation of hazardous sites with stream reforming.

  7. Ethnoveterinary knowledge of the inhabitants of Marajó Island, Eastern Amazonia, Brazil Conhecimento etnoveterinário dos habitantes da Ilha de Marajó, Amazônia Oriental, Brasil

    Directory of Open Access Journals (Sweden)

    Maria Vivina Barros Monteiro

    2011-01-01

    Full Text Available There have been ethnoveterinary reports from around the world investigating plant usage in therapeutic protocols; however, there is no information regarding the ethnoveterinary practices in Brazilian Amazonia. The objective of this work was to register and document the ethnoveterinary knowledge of the inhabitants of the Island of Marajó, eastern Amazonia, Brazil. In the study, interviews were conducted with 50 individuals, with the application of semi-structured questionnaires that were quantitatively analyzed using descriptive statistic methods of frequency distribution. Use-value was calculated to determine the most important species. Samples of plants that were reported to have medicinal value were collected and identified by botanical classification. Fifty plants, distributed among 48 genera and 34 families, were indicated for 21 different medicinal uses. The family Asteraceae had the largest number of reported species; Carapa guianensis Aubl., Copaifera martii Hayne, Crescentia cujete L., Caesalpinia ferrea Mart., Chenopodium ambrosioides L., Jatropha curcas L. and Momordica charantia L. were species with highest use- value. The plant parts that were more commonly utilized for the preparation of ethnoveterinary medicines were the leaves (56%, bark (18%, roots (14%, seeds (14% and fruit (8%. With regard to usage, tea was reported as a usage method by 56% of the informants; most preparations (90.9% utilized only a single plant. In addition to medicinal plants, informants reported using products of animal and mineral origin. The present study contributed to the construction of an inventory of Marajó Island's ethnoveterinary plants, which might be the basis for future scientific validation studies.Em várias partes do mundo existem relatos etnoveterinários sobre a utilização de plantas em protocolos terapêuticos, entretanto não existem informações disponíveis sobre a etnoveterinária praticada na Amazônia brasileira. Desta forma

  8. Prospeção de inibidores de serinoproteinases em folhas de leguminosas arbóreas da floresta Amazônica Prospecting serine proteinase inhibitors in leaves from leguminous trees of the Amazon forest

    Directory of Open Access Journals (Sweden)

    Larissa Ramos Chevreuil

    2011-03-01

    Full Text Available Os inibidores de proteinases são proteínas extensivamente investigadas nos tecidos de estocagem, mas pouco prospectadas em outros tecidos vegetais. O objetivo deste estudo foi detectar a presença de inibidores de serinoproteinases em extratos foliares de quinze espécies de leguminosas arbóreas da Amazônia. As espécies estudadas foram: Caesalpinia echinata, C. ferrea, Cedrelinga cateniformis, Copaifera multijuga, Dinizia excelsa, Enterolobium contortisiliquum, E. maximum, E. schomburgkii, Leucaena leucocephala, Ormosia paraensis, Parkia multijuga, P. pendula, P. platycephala, Swartzia corrugata e S. polyphylla. Folhas foram coletadas, secas a 30ºC durante 48 h, trituradas e submetidas à extração com NaCl (0,15 M, 10% p/v resultando no extrato total. Ensaios foram executados para determinar a concentração de proteínas e detectar a atividade inibitória contra a tripsina e quimotripsina bovina. Os teores de proteínas bruta e solúvel nos extratos foliares variaram de 7,9 a 31,2% e 1,3 a 14,8%, respectivamente. A atividade inibitória sobre a tripsina e quimotripsina foi observada em todos os extratos foliares. Contudo, nos extratos de E. maximum, L. leucocephala, P. pendula, S. corrugata e S. polyphylla a inibição foi maior sobre a tripsina, enquanto o extrato de P. multijuga foi mais efetivo contra a quimotripsina. Nós concluímos que nos extratos foliares de leguminosas arbóreas têm inibidores de serinoproteinases e exibem potencial aplicações biotecnológicas.The proteinase inhibitors are proteins extensively investigated in tissue storage, but few prospected in other plant tissues. The aim of this study was to detect the presence of serine proteinase inhibitors in leaf extracts from fifteen species of leguminous trees of the Amazon forest. The species studied were Caesalpinia echinata, C. ferrea, Cedrelinga cateniformis, Copaifera multijuga, Dinizia excelsa, Enterolobium contortisiliquum, E. maximum, E. schomburgkii

  9. Efeito in vitro de compostos de plantas sobre o fungo Colletotrichum gloeosporioides Penz: isolado do maracujazeiro In vitro effect of plant compounds on the fungus Colletotrichum gloeosporioides Penz: isolated from passion fruit

    Directory of Open Access Journals (Sweden)

    André Costa da Silva

    2009-01-01

    Full Text Available Neste trabalho, objetivou-se avaliar o efeito de extratos e óleos essenciais de quatorze plantas medicinais e ou nativas, conhecidas popularmente no Norte de Minas Gerais, sobre a germinação de esporos e crescimento micelial do fungo Colletotrichum gloeosporioides. Foram utilizados no teste de inibição do crescimento micelial, os extratos aquosos de alecrim (Rosmarinus officinalis, erva baleeira (Cordia verbenacea, joá (Solanum sisymbriifolium, quebra-pedra (Phyllanthus corcovadensis, erva botão (Eclipta alba e açafrão da índia (Curcuma longa obtidos por meio do processo de infusão; óleo essencial de alecrim de vargem (Família Lamiaceae, alecrim pimenta (Lippia sidoides, alfavaca cravo (Ocimum gratissimum, lippia (Lippia citriodora, goiaba branca (Psidium guajava, capim santo (Cymbopogon citratus; óleo resina de copaíba (Copaifera langsdorffi; hidrolatos de alecrim de vargem, goiaba vermelha (Psidium guajava, lippia, capim santo, goiaba branca, alfavaca cravo; manipueira de (Manihot esculenta. Também foram testados esses mesmos hidrolatos e os óleos essenciais na germinação dos esporos do fungo. Todos os tratamentos foram realizados in vitro, cultivando-se o fungo em meio de cultura BDA acrescido de 100μL dos compostos vegetais. No teste de inibição da germinação, todos os óleos essenciais impediram a germinação do fungo. No entanto, os hidrolatos não tiveram esse efeito. No teste de crescimento micelial, os óleos essenciais de todas as plantas inibiram completamente o crescimento do fungo, exceto o óleo da goiaba branca. Os extratos aquosos, a manipueira, o óleo resina e os hidrolatos, também não foram eficientes sobre o crescimento do patógeno. Esses resultados indicam o potencial antifúngico de alguns óleos essenciais de plantas medicinais.The objective of the work was to evaluate the effect of extracts and essential oils of fourteen medicinal and or native plants popularly known in the North of Minas

  10. Assessing the extent of "conflict of use" in multipurpose tropical forest trees: a regional view.

    Science.gov (United States)

    Herrero-Jáuregui, Cristina; Guariguata, Manuel R; Cárdenas, Dairon; Vilanova, Emilio; Robles, Marco; Licona, Juan Carlos; Nalvarte, Walter

    2013-11-30

    In the context of multiple forest management, multipurpose tree species which provide both timber and non-timber forest products (NTFP), present particular challenges as the potential of conflicting use for either product may be high. One key aspect is that the magnitude of conflict of use can be location specific, thus adding complexity to policy development. This paper focuses on the extent to which the potential for conflict of use in multipurpose tree species varies across the Amazonian lowland forests shared by Peru, Bolivia, Colombia, Ecuador and Venezuela, emphasizing the economic dimension of conflict. Based on a review of the current normative and regulatory aspects of timber and NTFP extraction in the five countries, the paper also briefly discusses the opportunities and constraints for harmonization of timber and NTFP management of multipurpose species across the region. It was found that about half of the 336 timber species reviewed across the five countries also have non-timber uses. Eleven timber species are multipurpose in all five countries: Calophyllum brasiliense, Cedrela odorata, Ceiba pentandra, Clarisia racemosa, Ficus insipida, Jacaranda copaia, Schefflera morototoni, Simarouba amara and Terminalia amazonia. Seven other multipurpose species occurred only in either Venezuela (Tabebuia impetiginosa, Spondias mombin, Pentaclethra macroloba, Copaifera officinalis, Chlorophora tinctoria, Carapa guianensis) or Ecuador (Tabebuia chrysantha). Four multipurpose tree species presented the highest potential of conflict of use across the region: Dipteryx odorata, Tabebuia serratifolia, Hymenaea courbaril and Myroxylon balsamum yet these were not evenly distributed across all five countries. None of the five studied countries have specific legislation to promote sustainable use of any of the multipurpose species reported here and thus mitigate potential conflict of use; nor documented management options for integration or else segregation of both their

  11. Interspecific variation in xylem vulnerability to cavitation among tropical tree and shrub species.

    Science.gov (United States)

    Lopez, Omar R; Kursar, Thomas A; Cochard, Hervé; Tyree, Melvin T

    2005-12-01

    In tropical moist forests, seasonal drought limits plant survival, productivity and diversity. Drought-tolerance mechanisms of tropical species should reflect the maximum seasonal water deficits experienced in a particular habitat. We investigated stem xylem vulnerability to cavitation in nine tropical species with different life histories and habitat associations. Stem xylem vulnerability was scored as the xylem water potential causing 50 and 75% loss of hydraulic conductivity (P50 and P75, respectively). Four shade-tolerant shrubs ranged from moderately resistant (P50=-1.9 MPa for Ouratea lucens Kunth. Engl.) to highly resistant to cavitation (P50=-4.1 MPa for Psychotria horizontalis Sw.), with shallow-rooted species being the most resistant. Among the tree species, those characteristic of waterlogged soils, Carapa guianensis Aubl., Prioria copaifera Griseb. and Ficus citrifolia Mill., were the most vulnerable to cavitation (P50=-0.8 to -1.6 MPa). The wet-season, deciduous tree, Cordia alliodora (Ruiz and Pav.) Oken., had resistant xylem (P50=-3.2 MPa), whereas the dry-season, deciduous tree, Bursera simaruba (L.) Sarg. was among the most vulnerable to cavitation (P50=-0.8 MPa) of the species studied. For eight out of the nine study species, previously reported minimum seasonal leaf water potentials measured in the field during periods of drought correlated with our P50 and P75 values. Rooting depth, deciduousness, soil type and growth habit might also contribute to desiccation tolerance. Our results support the functional dependence of drought tolerance on xylem resistance to cavitation.

  12. Interannual variation in rainfall, drought stress and seedling mortality may mediate monodominance in tropical flooded forests.

    Science.gov (United States)

    Lopez, Omar R; Kursar, Thomas A

    2007-11-01

    Flood tolerance is commonly regarded as the main factor explaining low diversity and monodominance in tropical swamps. In this study we examined seedling mortality in relation to seasonality, i.e., flooding versus drought, of the dominant tree species (Prioria copaifera), and three associated species (Pterocarpus officinalis, Carapa guianensis and Pentaclethra macroloba), in seasonally flooded forests (SFF) in Darien, Panama. Seedling mortality differed among species, years and seasons. Prioria seedlings experienced the lowest overall mortality, and after 3 years many more Prioria seedlings remained alive than those of any of the associated species. In general, within species, larger seedlings had greater survival. Seed size, which can vary by close to 2 orders of magnitude in Prioria, had a confounding effect with that of topography. Large-seeded Prioria seedlings experienced 1.5 times greater mortality than small-seeded seedlings, as large-seeded Prioria seedlings were more likely to be located in depressions. This finding suggests that seed size, plant size and topography are important in understanding SFF regeneration. For all species, seedling mortality was consistently greater during the dry season than during flooding. For Prioria, dry season seedling mortality was correlated with drought stress, that is, high mortality during the long El Niño dry season of 1998 and the normal dry season of 2000, but very low dry season mortality during the mild dry season of 1999. Prioria's ability to dominate in seasonally flooded forest of Central America is partly explained by its low drought-related mortality in comparison to associated species.

  13. Avaliação de danos por insetos em toras estocadas em indústrias madeireiras de Manaus, Amazonas, Brasil

    Directory of Open Access Journals (Sweden)

    Abreu Raimunda Liége Souza de

    2002-01-01

    Full Text Available Em seis indústrias madeireiras de Manaus, Amazonas, foi realizado um trabalho de pesquisa, com a utilização de um questionário,para averiguar as condições de uso e processamento da madeira e as medidas preventivas contra o ataque de insetos. Foram realizados, também,um levantamento da ocorrência de insetos em 19 espécies de madeiras utilizadas por essas indústrias e a avaliação do dano provocado pelas principais espécies de Coleoptera (besouros e Isoptera (cupins. Das respostas apuradas, constatou-se que nenhuma das empresas visitadas emprega qualquer produto para prevenir o ataque de insetos às toras, assim como a secagem e a estocagem das toras são feitas de forma incorreta, contribuindo para aumentar a intensidade de ataque de insetos. Foram encontradas uma família de cupins e 16 de besouros, ressaltando que destas apenas cinco causam danos à madeira. Do total de 13 espécies de insetos coletados, destacam-se Xyleborus affinis Eichhoff e Platypus parallelus (Fabricius, encontradas em 18 espécies madeireiras, sendo conseqüentemente responsáveis pela maioria dos danos nas toras X. volvulus (Fabricius e Platypus sp. foram encontradas em cinco espécies; X. ferrugineus (Fabricius em três espécies; Minthea rugicolis Walk, Minthea sp. e Nasutitermes corniger (Motschulsky em duas, e Dinoderus bifoveolatus Wollaston, Anoplotermes sp.; e Cnesinus sp. em uma. As espécies de madeiras que sofreram maior grau de deterioração, causada principalmente por coleópteros, foram Ceiba pentandra (L. Gaertn. e Copaifera multijuga Hayne, seguidas por Couroupitaguianensis Aubl., Calophyllum brasiliense Cambess., Cedrela odorata L., Hevea brasiliensis Müll. Arg., Hura crepitans L., Hymenolobium sp., Maquira coriacea (Karsten C.C. Berg, Nectandra sp., Virolasurinamensis Warb. e Vochysia sp.

  14. The profile of Brazilian agriculture as source of raw material to obtain organic cosmetics

    Directory of Open Access Journals (Sweden)

    Neila de Paula Pereira

    2017-05-01

    Full Text Available With one of the most notable floras in the world for sustainable research, the Brazilian Amazon region currently counts on financial incentives from the Brazilian Government for private national and foreign businesses. The ongoing implantation of a Biocosmetics Research and Development Network (REDEBIO aims to stimulate research involving natural resources from the Brazilian states that make up the zone defined as “Amazônia Legal”. The objective of this region, still under development in Brazil, is principally to aggregate value to products manufactured in small local industries through the use of sustainable technology currently being established. Certain certified raw materials already included in the country’s sustainability program, have also begun to be cultivated according to the requirements of organic cultivation (Neves, 2009. The majority are species of Amazonian vegetation: Euterpe oleracea (Açai, Orbignya martiana (Babaçu, Theobroma grandi-florum (Cupuaçu, Carapas guianensis (Andiroba, Pentaclethra macroloba (Pracaxi, Copaifera landesdorffi (Copaiba, Platonia insignis (Bacuri, Theobroma cacao (Cacao, Virola surinamensis (Ucuuba and Bertholletia excelsa (Brazil nut. These generate phytopreparations, such as oils, extracts, and dyes that are widely used in the manufacture of Brazilian organic cosmetics with scientifically proven topical and capillary benefits. In the final balance, Brazilian organic cosmetics should continue to gain force over the next few years, especially with the regulation of the organic cosmetics market that is being drafted by the Brazilian Ministry of Agriculture. Moreover, lines of ecologically aware products that provide quality of life for both for rural and metropolitan communities show a tendency to occupy greater space in the market.

  15. Trade-offs among forest value components in community forests of southwestern Amazonia

    Directory of Open Access Journals (Sweden)

    Christopher Baraloto

    2014-12-01

    Full Text Available Contemporary conservation interventions must balance potential trade-offs between multiple ecosystem services. In tropical forests, much attention has focused on the extent to which carbon-based conservation provided by REDD+ policies can also mitigate biodiversity conservation. In the nearly one-third of tropical forests that are community owned or managed, conservation strategies must also balance the multiple uses of forest products that support local livelihoods. Although much discussion has focused on policy options, little empirical evidence exists to evaluate the potential for trade-offs among different tropical forest value components. We assessed multiple components of forest value, including tree diversity, carbon stocks, and both timber and nontimber forest product resources, in forest communities across the trinational frontier of Brazil, Peru, and Bolivia. We installed 69 0.5-ha vegetation plots in local communities, and we characterized 15 components of forest value for each plot. Principal components analyses revealed two major axes of forest value, the first of which defined a trade-off between diversity of woody plant communities (taxonomic and functional versus aboveground biomass and standing timber volume. The second axis described abundance of commercial species, with strong positive loadings for density of timber and nontimber forest products, including Brazil nut (Bertholletia excelsa and copaiba oil (Copaifera spp.. The observed trade-off between different components of forest value suggests a potential for management conflicts prioritizing biodiversity conservation versus carbon stocks in the region. We discuss the potential for integrative indices of forest value for tropical forest conservation.

  16. Sleeping site preferences in tufted capuchin monkeys (Cebus apella nigritus).

    Science.gov (United States)

    Di Bitetti, M S; Vidal, E M; Baldovino, M C; Benesovsky, V

    2000-04-01

    The characteristics and availability of the sleeping sites used by a group of 27 tufted capuchin monkeys (Cebus apella nigritus) were studied during 17 months at the Iguazu National Park, Argentina. We tested different hypotheses regarding possible ultimate causes of sleeping-site selection. Most sleeping sites were located in areas of tall, mature forest. Of the 34 sleeping sites the monkeys used during 203 nights, five were more frequently used than the others (more than 20 times each, constituting 67% of the nights). Four species of tree (Peltophorum dubium, Parapiptadenia rigida, Copaifera langsdorfii and Cordia trichotoma) were the most frequently used. They constituted 82% of all the trees used, though they represent only 12% of the trees within the monkeys' home range which had a diameter at breast height (DBH) > 48.16 cm (1 SD below the mean DBH of sleeping trees). The sleeping trees share a set of characteristics not found in other trees: they are tall emergent (mean height +/- SD = 31.1+/-5.2 m) with large DBH (78.5+/-30.3 cm), they have large crown diameter (14+/-5.5 m), and they have many horizontal branches and forks. Adult females usually slept with their kin and infants, while peripheral adult males sometimes slept alone in nearby trees. We reject parasite avoidance as an adaptive explanation for the pattern of sleeping site use. Our results and those from other studies suggest that predation avoidance is a predominant factor driving sleeping site preferences. The patterns of aggregation at night and the preference for trees with low probability of shedding branches suggest that social preferences and safety from falling during windy nights may also affect sleeping tree selection. The importance of other factors, such as seeking comfort and maintaining group cohesion, was not supported by our results. Other capuchin populations show different sleeping habits which can be explained by differences in forest structure and by demographic differences.

  17. Plant extracts for controlling the post-harvest anthracnose of banana fruit

    Directory of Open Access Journals (Sweden)

    M.E.S. Cruz

    2013-01-01

    Full Text Available In banana, fruit rot is incited by Colletotrichum musae which has been the most serious post-harvest disease of immature and mature fruit. The usual control by fungicides prohibited in many countries reduces their commercial value. Therefore, two experiments were conducted to evaluate the antimicrobial activity of alternative products to the synthetic fungicides. First, berries naturally infected by anthracnose were immersed into Azadirachta indica and citric extracts at 2 and 4% (v/v for 3 minutes and stored for 11 days under environmental conditions. Next, other berries were immersed into essential oil emulsions of Allium sativum, Copaifera langsdorfii, Cinnamomum zeylanicum and Eugenia caryophyllata at 5% for 3 minutes but stored for 11 days. Berries immersed into distilled water were used as control-treatments. The percentage of disease incidence observed in the control-treatment was similar to the ones observed in the extract of A. indica at 2%. The control-treatment showed disease severity of 75.13% and the percentage of disease control was 20.85%. Fruit immersed into distilled water presented less effectiveness than the ones immersed into citric extracts, which promoted the highest effectiveness. Citric extract at 4% was the most efficient treatment because the disease incidence was 19.44%, the disease severity was 9.34% and the disease control was 90.16%. Less severity and, consequently, more disease control were achieved by immersing the berries into the emulsion of essential oil of A. sativum, followed by treatments with C. langsdorfii, E. caryophyllata and C. zeylanicum.

  18. PREGĂTIREA STUDENŢILOR ÎN VEDEREA FORMĂRII COMPETENŢEI DE CONSILIERE PSIHOPEDAGOGICĂ

    Directory of Open Access Journals (Sweden)

    Valeria PASCARU-GONCEAR

    2017-03-01

    Full Text Available Experienţa mai multor ţări indică asupra faptului că introducerea activităţilor de consiliere psihopedagogică realizate de profesori sau grupuri de profesori, specialişti în depăşirea şi rezolvarea problemelor educaţionale, nu doar facilitează activitatea cadrelor didactice, dar şi îmbunătăţeşte procesul instructiv-educativ. Deoarece consilierea psihopedagogică este realizată în special de către cadrele didactice în şcoală, în scopul asigurării unui nivel optim al procesului de pregă­tire al studenţilor, viitoare cadre didactice, competente a desfăşura activităţi de consiliere psihopedagogică, instituţiile de învăţământ superior propun programe şi activităţi multidimensionale.Formarea studenţilor este un proces prin care se asigură calitatea educaţiei, pe parcursul căruia candidaţii dobândesc cunoştinţe teoretice şi îşi formează abilităţi practice necesare desfăşurării activităţii lor. Însă, oricât de multe cunoştinţe în domeniu ar avea studentul, dacă el nu dispune de abilităţi practice de soluţionare optimă a problemelor de învăţare, calitatea şi eficienţa muncii acestuia lasă de dorit. Deci, transpunerea în practică a cunoştinţelor de specialitate ţine de calităţile personale ale individului. Aceste calităţi capătă contururi şi se structurează într-un stil specific în procesul de formare/dezvoltare a competenţei de consiliere psihopedagogică.PREPARING STUDENTS TO TRAINING PSYCHO-PEDAGOGICAL SKILLSThe experience of many countries indicates that the introduction of psycho-pedagogical activities carried out by teachers or groups of teachers and specialists in overcoming educational problem solving, not only facilitates the work of teachers, but also improves the educational process. Because counseling psycho is mainly driven by teachers in schools in order to ensure an optimal level of training process of students, future teachers competent to

  19. Storage quality in different brines of pickled capers (Capparis spp.

    Directory of Open Access Journals (Sweden)

    Özcan, Musa

    1999-08-01

    Full Text Available Middle sized buds of Capparis spinosa L. var. spinosa and Capparis ovata Desf. var. canescens (Coss. Heywood collected from wild plants were pickled for two months. The buds after the fermentation were processed in 10% and 20% brines. Storage stability of the fermented capers was determined by physical, chemical and microbiological analysis at certain interval in 10 and 20% old or fresh brines 180 days. Storaged in 10% and 20% old or fresh brines for 180 days of pickled buds of both species maintained the product quality in all samples. Acidity was higher in old brine during storage. Lactic acid bacteria (LAB growth was observed only in 10% fresh brine, it decreased from initial and 30 days at C. ovata and C. spinosa, respectively. C. spinosa, compared with C. ovata was desirable due to low sediment and more firm texture. During storage of buds in fresh brines, sediment and off-flavour were not observed for both species. Pickled products can be stored in fresh brine long-term containing at least 10% salt concentration.

    Se encurtieron durante dos meses botones florales de tamaño intermedio de Capparis spinosa L. var. spinosa y Capparis ovata Desf. var. canescens (Coss recogidos de plantas silvestres. Las alcaparras después de la fermentación se conservaron en salmueras del 10% y 20%. Las alcaparras fermentadas fueron mantenidas durante 180 días en salmueras usadas o recién preparadas (frescas del 10 y 20%, determinándose a intervalos la estabilidad durante la conservación por análisis físicos, químicos y microbiológicos. La calidad del producto se mantuvo en todas las muestras de alcaparras fermentadas durante los 180 días, tanto en 10% como en 20% y en salmueras usadas o frescas. La acidez durante la conservación fue mayor en salmueras usadas. El crecimiento de bacterias del ácido láctico se observó sólo en salmueras frescas del 10

  20. Macropropagation and micropropagation of Ziziphus spina-christi Macropropagação e micropropagação de Ziziphus spina-christi

    Directory of Open Access Journals (Sweden)

    Mohammad Hassan Assareh

    2005-05-01

    Full Text Available Christ's thorn (Ziziphus spina-christi (L. Desf. is a cross-pollinated plant with a wide range of genetic variability in nature and, for this reason, vegetative propagation assumes importance for improvement programs. The objective of this work was to evaluate cutting, T budding and tissue culture methods for this species. Shoots of 22-25 cm length were treated by two culture media and three shoot diameters for cutting trial. The T budding treatments consisted of three and five collection dates in spring and autumn, respectively. Tissue culture nodal segments bearing axillary buds were removed from shoots of mature trees at different seasons. Experiments to determine the best disinfectant chemical, appropriate conditions and materials to prevent phenolic compound exudation, explant characteristics, media type and cytokinin-auxin ratios were carried out. Successful rooting happened only on the sand beds and with cuttings greater than 8 mm diameter. The effects of T budding seasons on budtake percentage were significantly different. The best time for explant harvesting was mid of summer. Amount of rooting on media containing IBA as well as activated charcoal and disinfection with Ca(OCl2 at concentration of 5% for 20 minutes were the best treatments.Ziziphus spina-christi (L. Desf. é uma planta de polinização cruzada com grande variabilidade genética na natureza e, por isso, sua propagação vegetativa assume importância para o melhoramento genético. O objetivo deste trabalho foi avaliar os métodos de estaquia, borbulhia em T e cultura de tecido na propagação vegetativa desta espécie. No ensaio de estaquia, partes aéreas da planta com 22-25 cm foram cultivadas em dois meios de cultura e com três diâmetros. O ensaio de borbulhia consistiu na coleta do material em três datas na primavera e em cinco datas no outono. Os segmentos nodais contendo gemas axilares foram removidos da parte aérea de árvores maduras, em diferentes esta

  1. Organic Versus Conventional Methods of Fertilization and Weed Control in a Long Term Rotation of Cereals in Semiarid Spain Comparación de Métodos Convencionales y Orgánicos de Fertilización y Control de Malezas en una Rotación de Larga Duración de Cereales en Secano, España

    Directory of Open Access Journals (Sweden)

    Gabriel Pardo

    2011-06-01

    Full Text Available Under semiarid conditions the response of cereal crops to chemical fertilizers and weed control practices with herbicides is often reduced. In fact, the economic profitability of agricultural production in many dryland regions is critically affected by high costs of inputs and low crop yields. As a solution, cropping systems like organic farming, obtaining similar yields and promoting environmental sustainability by reducing fertilizer and herbicides, could be an alternative to conventional systems. In this study, 23 trials were performed in five semiarid regions of Spain during 5 yr to compare different fertilizers and weed control methods on durum wheat (Triticum durum Desf. and barley (Hordeum vulgare L. yields. The following rotation pattern was developed on the experimental plots: fallow-barley-ground ploughed vetch (Vicia sativa L.-durum wheat. Plots either received organic fertilizer, chemical fertilizer, or no fertilizer. In addition, three levels of weed control were applied in cereal plots: flex-tine harrow tillage, conventional herbicide, and no weeding. The results indicated that neither the fertilization nor the weed control have effect on the yield crop.En condiciones de clima semiárido, la agricultura de cereal tiene una reducida rentabilidad debido a los escasos rendimientos y elevados costes de abonos y herbicidas. Dado que las condiciones climáticas impiden incrementar estos rendimientos, la viabilidad económica y la sostenibilidad ambiental de la agricultura en estas regiones pasan por reducir el coste de los insumos o por conseguir precios del producto superiores mediante la obtención de un certificado ecológico para su comercialización. En este artículo se presentan los resultados de 23 ensayos de un experimento de 5 años localizado en cinco zonas semiáridas representativas de la agricultura española de secano. El objetivo del trabajo fue comparar los efectos de diferentes métodos de fertilización y control de

  2. Accelerated Burn Wound Closure in Mice with a New Formula Based on Traditional Medicine.

    Science.gov (United States)

    Mehrabani, Mehrnaz; Seyyedkazemi, Seyyed Mohsen; Nematollahi, Mohammad Hadi; Jafari, Elham; Mehrabani, Mitra; Mehdipour, Mohammad; Sheikhshoaee, Zahra; Mandegary, Ali

    2016-11-01

    A combination of the oils of sesame, hemp, wild pistachio, and walnut has been used for treatment of skin disorders, including wound burns, in some parts of Kerman, Iran. Evaluation of this remedy in the form of a pharmaceutical formulation in animal models can pave the way for its future application in wound burn healing in humans. This experimental study investigated the healing potential of a new formula (NF) based on folk medicine from Iran for the treatment of third degree burns in mice. The formula was a combination of the oils of four plants: sesame (Sesamum indicum L.), wild pistachio (Pistacia atlantica Desf.), hemp (Cannabis sativa L.), and walnut (Juglans regia L.). Twenty-four mice were selected based on simple random sampling. Twenty-five percent of the total body surface area was burned by exposure to boiling water, according to the Walker-Mason method. NF and silver sulfadiazine (the positive control) were applied topically twice a day for 21 days. The burned area in the negative control group was left untreated. Epithelialization time and the percent of wound contraction were measured during the treatment period. The process of wound repairing was evaluated using histological (H and E and trichrome staining) and immunohistological (anti-pancytokeratin) methods. When compared to the controls, NF significantly improved wound contraction after day 10. Epithelialization time in the NF group was significantly faster than in the other groups (20 vs. 25.5 days) (P < 0.001). Histopathological and immunohistochemical findings confirmed the efficacy of the NF. A new therapeutic remedy was introduced for the treatment of burn wounds. Further clinical and molecular studies are suggested to determine the exact mechanism(s) involved in the burn wound healing effect of NF.

  3. Agriculture intensification decreases soil C content and respiration activity in a Mediterranean Vertisol

    Science.gov (United States)

    Farina, Roberta; Francaviglia, Rosa; Felici, Barbara; Renzi, Gianluca; Troccoli, Antonio

    2016-04-01

    Adoption of intensive and non-conservative farming practices in Mediterranean areas, often causes a strong reduction of soil organic C, with major side effects on soil functioning and CO2 emissions to atmosphere. The purpose of our research was to evaluate the effect of durum wheat-(Triticum durum Desf.) (DW) based rotations, common in Southern Italy, on soil organic C content and soil potential respiration, after 19 years of cultivation. The rotation experiment was carried out since 1992 in Foggia (Apulia, Italy) at the experimental farm of the Cereal Research Centre in a clayey vertisol. Here we report results concerning two rotations, among seven: continuous durum wheat (CDW) and bare fallow-durum wheat-durum wheat- (BF-DW-DW) compared with an adjoining soil, covered with permanent grassland undisturbed, since 1972, considered at steady state. Results showed a negative trend of soil C in both rotations. The C reduction respect to the undisturbed soil (14.5 g C kg-1 of soil) were 0.15 and 0.13% for CDW and BF-DW-DW, respectively. Daily soil potential respiration was always higher in the undisturbed soil: it was 13.65, 10.46 and 8.64 mg C-CO2/kg soil day-1, for undisturbed soil, BF-DW-DW and DWC respectively. The cumulative respiration in 28 days for CDW and BF-DW-DW rotations compared with undisturbed soil was lower by 23 and 32%, respectively. Among the two rotations compared, BF-DW-DW showed to be slightly more conservative than the DWC rotation for soil C, even though none of the two rotations was able to keep the soil C level at values comparable to steady state, due both to soil disturbance and to lower C inputs respect to the permanent cover.

  4. A quantitative and molecular examination of Tuber melanosporum mycorrhizae in Quercus ilex seedlings from different suppliers in Spain

    Directory of Open Access Journals (Sweden)

    P. Alvarado

    2013-07-01

    Full Text Available Aim of study: The aim of the work was to determine the degree of mycorrhization of Quercus ilex L. subsp. ballota (Desf. Samp. by the black truffle fungus T. melanosporum Vittad. by quantitative and molecular analyses.Area of study: seedlings inoculated by different Spanish suppliers.Material and methods: The internal transcribed spacers (ITS of mycorrhizae from different plants were amplified by nested PCR involving fluorescently-labelled primers, and the amplicons either directly sized by ARISA or analysed by TRFLP following their digestion with restriction endonucleases. TRFLP analysis distinguished between mycorrhizae of T. melanosporum, T. indicum Cooke & Massee and T. borchii Vittad., as suggested possible by virtual (in silico TRFLP analysis and real TRFLP analysis of the ascomata of these species.Main results: Significant differences between suppliers were detected in terms of the mean number of mycorrhizae established per plant and percentage mycorrhization. These results allowed the following quality standards for 2 year-old plants to be proposed: a good quality: >3000 mycorrhizae/plant, >40% mycorrhization, b medium (acceptable: >3000 mycorrhizae/plant, >30% mycorrhization, c low quality: <3000 mycorrhizae/plant or <30% mycorrhization, always supposing the mycorrhizae counted represent the species of interest as confirmed by the presence of its DNA and the absence of DNA belonging to contaminating species. Finally, a new microsatellite allelic map obtained from the analysis of several T. melanosporum populations across Spain was used to provide a tool capable of determining the geographic origin of the fungi used to inoculate plants.Research highlights: The proposed quality standards can be useful for the evaluation and certification of commercialized Q. ilex plants mycorrhized with T. melanosporum.Keywords: mycorrhiza; certification; truffle; TRFLP; fungi.

  5. A quantitative and molecular examination of Tuber melanosporum mycorrhizal in Quercus ilex seedlings from different suppliers in Spain

    Energy Technology Data Exchange (ETDEWEB)

    Alvaro, P.; Manjon, J. L.

    2013-09-01

    Aim of study: The aim of the work was to determine the degree of mycorrhization of Quercus ilex L. subsp. ballota (Desf.) Samp. by the black truffle fungus T. melanosporum Vittad. by quantitative and molecular analyses. Area of study: seedlings inoculated by different Spanish suppliers. Material and methods: The internal transcribed spacers (ITS) of mycorrhizae from different plants were amplified by nested PCR involving fluorescently-labelled primers, and the amplicons either directly sized by ARISA or analysed by TRFLP following their digestion with restriction endonucleases. TRFLP analysis distinguished between mycorrhizae of T. melanosporum, T. indicum Cooke and Massee and T. borchii Vittad., as suggested possible by virtual (in silico) TRFLP analysis and real TRFLP analysis of the ascomata of these species. Main results: Significant differences between suppliers were detected in terms of the mean number of mycorrhizae established per plant and percentage mycorrhization. These results allowed the following quality standards for 2 yearold plants to be proposed: a) good quality: > 3,000 mycorrhizae/plant, > 40% mycorrhization, b) medium (acceptable): > 3,000 mycorrhizae/plant, > 30% mycorrhization, c) low quality: < 3,000 mycorrhizae/plant or <30% mycorrhization, always supposing the mycorrhizae counted represent the species of interest as confirmed by the presence of its DNA and the absence of DNA belonging to contaminating species. Finally, a new microsatellite allelic map obtained from the analysis of several T. melanosporum populations across Spain was used to provide a tool capable of determining the geographic origin of the fungi used to inoculate plants. Research highlights: The proposed quality standards can be useful for the evaluation and certification of commercialized Q. ilex plants mycorrhized with T. melanosporum. (Author)

  6. Irrigation with saline-sodic water: effects on two clay soils

    Directory of Open Access Journals (Sweden)

    Giovanna Cucci

    2013-05-01

    Full Text Available The results of a 4-year experiment aimed at evaluating the effect of irrigation with saline-sodic water on the soil are reported. The research was carried out at the Campus of the Agricultural Faculty of Bari University (Italy on 2 clay soils (Bologna – T1 and Locorotondo – T2. The soils were cropped to borlotto bean (Phaseolus vulgaris L., capsicum (Capsicum annuum L., sunflower (Helianthus annuus L., wheat (Triticum durum Desf grown in succession; the crops were irrigated with 9 saline-sodic types of water and subjected to two different leaching fractions (10% and 20% of the watering volume. The 9 solutions were obtained dissolving in de-ionised water weighted amounts of sodium chloride (NaCl and calcium chloride (CaCl2, deriving from the combination of 3 saline concentrations and 3 sodicity levels. The crops were irrigated whenever the water lost by evapotranspiration from the soil contained in the pots was equal to 30% of the soil maximum available water. The results showed that, though the soils were leached during the watering period, they showed a high salt accumulation. Consequently, the saturated soil extract electrical conductivity increased from initial values of 0.65 and 0.68 dS m-1 to 11.24 and 13.61 dS m-1 at the end of the experiment, for the soils T1 and T2, respectively. The saline concentration increase in irrigation water caused in both soils a progressive increase in exchangeable sodium, and a decrease in exchangeable calcium and non-significant variations in exchangeable potassium (K and magnesium (Mg.

  7. Effects of antimony and arsenic on antioxidant enzyme activities of two steppic plant species in an old antimony mining area.

    Science.gov (United States)

    Benhamdi, Asma; Bentellis, Alima; Rached, Oualida; Du Laing, Gijs; Mechakra, Aicha

    2014-04-01

    The present work was undertaken to determine strategies and antioxidant enzyme activities involved in the adaptation of two wild steppic plants (Hedysarum pallidum Desf. and Lygeum spartum L.) to the toxic environment of the abandoned antimony mining area of Djebel Hamimat (Algeria). For this purpose, soils and plants were collected in different zones coinciding with a Sb and As concentrations gradient in the soil. Antimony (Sb) and arsenic (As) were analyzed by ICP-OES in the soils and the aboveground parts and roots of the plants. Malondialdehyde (MDA) and antioxidant enzyme activities were measured by spectrometry. Results show levels of Sb and As exceptionally high in most soil and plant samples. The two species accumulate differently Sb and As in their above and belowground parts. MDA levels, in the two parts of both species, increase significantly with increasing soil Sb and As concentrations, but they are significantly higher in H. pallidum than in L. spartum. The activities of antioxidant enzymes differ significantly according to the soil metalloid concentrations, the plant species considered and the plant part. Apart from superoxide dismutase (SOD) whose activity is, overall, higher in H. pallidum than in L. spartum, the activities of all the other enzymes studied (glutathione S-transferase (GST), catalase (CAT), peroxidase (POD), and ascorbate peroxidase (APX)) are generally higher in L. spartum than in H. pallidum. For both species, APX and GST are overall more active in the upper parts than in the roots, while it is the reverse for SOD and CAT. POD is more active in the upper parts than in the roots of L. spartum and the reverse applies to H. pallidum. It appears that the two studied plant species use different tolerance strategies to protect themselves against elevated As and Sb concentrations.

  8. МАССР В 1932-1934 ГОДАХ: БОРЬБА С КЛАССОВЫМ ВРАГОМ НА «КУЛЬТУРНОМ ФРОНТЕ»

    Directory of Open Access Journals (Sweden)

    Людмила БУРМЕНКО

    2016-12-01

    Full Text Available RASSM ÎN ANII 1932-1934: LUPTA CU DUŞMANUL DE CLASĂ PE „FRONTUL CULTURAL”În articol se face o încercare de a reconstitui situaţia social-politică ce s-a creat în RASSM în 1932-1934, perioadă în care bântuia foametea şi se desfăşura campania de căutare a duşmanului de clasă.Autorul constantă că în felul acesta autorităţile vroiau să direcţioneze responsabilitatea pentru toate greşelile în „construcţia socialistă” pe seama unui duşman interior. Printre „inamicii” din RASSM se înscria şi o parte a intelectua­li­tăţii acuzată de sabotaj pe „frontul cultural”.MASSR IN 1932-1934 YEARS: STRUGGLE AGAINST THE CLASS ENEMY ON THE "CULTURAL FRONT"The social and political situation in MASSR in 1932-1934 when a company was held to find the class enemy during starvation us considered in this article.The author notes that the authorities, in such a way, tried to shift their responsibility for all the mistakes in socialist construction. A part of the intelligentsia being charged with sabotage at the cultural front occurred to be among «the enemies» of the MASSR.

  9. ARMONIZAREA MANAGEMENTULUI ACHIZIŢIILOR PUBLICE DIN REPUBLICA MOLDOVA LA DIRECTIVELE UE

    Directory of Open Access Journals (Sweden)

    Maria COJOCARU

    2016-12-01

    Full Text Available În acest articol sunt abordate probleme ce vizează reforma sistemului de achiziţii publice al Republicii Moldova şi al României, armonizarea legislaţiei şi a procesului de achiziţii publice la normele europene. Întru realizarea scopului şi sarcinilor propuse au fost aplicate diferite metode de cercetare: monografică, comparativă, metoda grafică. Cercetarea procesului de achiziţii publice, în contextul prevederilor legislative ale Uniunii Europene, a permis autorilor să constate prezenţa unor nereguli şi disfuncţionalităţi în organizarea şi desfăşurarea procedurilor de achiziţii publice la nivel naţional. În concluzie, au fost formulate sugestii menite să contribuie la perfecţionarea managementului achiziţiilor publice din Republica Moldova.HARMONIZATION OF PROCUREMENT MANAGEMENT IN MOLDOVA TO EU DIRECTIVESIn this article the author presents a studio on the reform of the procurement system of Moldova and Romania, har­monization of legislation and the process of European procurement rules. In achieving established goals were applied different research methods: monographic, comparative graphical method. Research the procurement process in the con­text of the legislative European Union (EU, allowed the author to declare the presence of irregularities and failures in organization and conduct of procurement procedures at national level. In conclusion, suggestions were made that would help to improve the management of public procurement in Moldova.

  10. Identification and Quantification of Heavy Metals Concentrations in Pistacia

    Directory of Open Access Journals (Sweden)

    Gholamhossein DAVARYNEJAD

    2013-12-01

    Full Text Available The levels of heavy metals are very important in pistachio nuts, because the edible nuts have an important and increasing role in human nutrition. Pistachio is one of the native nuts of Iran which contains high genetic resources, but there is insufficient information regarding nutritional properties and other elements like heavy metals. The objective of the present study was to investigate and compare heavy metals contents in the kernels of various pistachio samples including; ‘Daneshmandi’, ‘Sephid’, ‘Garmeh’, ‘Momtaz’, ‘Ahmad Aghaei’, ‘Badami Zarand’, Pistacia atlantica Desf. (‘Baneh’, Pistacia vera ‘Sarakhs’ and chance seedling as ‘Non-grafted 1’, ‘Non-grafted 2’ and ‘Non-grafted 3’. Inductively coupled plasma emission spectrophotometer (ICP was used for the determination of aluminium, chromium, nickel, copper, strontium, arsenic, cadmium and cobalt concentrations in pistachio kernels. This study showed that there were significant differences among the samples in all measured heavy metals except the arsenic, cadmium and cobalt. The content of aluminium varied from 3.22 to 9.59 (mg kg-1 of dry matter and chromium concentration from 0.60 to 1.86 (mg kg-1 of dry matter. The nickel content of examined pistachio samples was found between 0.43 and 3.63 (mg kg-1 of dry matter and copper ranged from 3.20 to 12.33 (mg kg-1 of dry matter. The strontium content was observed between 4.96 and 24.93 (mg kg-1 of dry matter. The contents of arsenic, cadmium and cobalt not reported, because their amounts were lower than the detection limit of the applied measuring method (ICP. These data demonstrated that the concentrations of heavy metals in pistachios varied by cultivar.

  11. Effects of Heterogeniety on Spatial Pattern Analysis of Wild Pistachio Trees in Zagros Woodlands, Iran

    Science.gov (United States)

    Erfanifard, Y.; Rezayan, F.

    2014-10-01

    Vegetation heterogeneity biases second-order summary statistics, e.g., Ripley's K-function, applied for spatial pattern analysis in ecology. Second-order investigation based on Ripley's K-function and related statistics (i.e., L- and pair correlation function g) is widely used in ecology to develop hypothesis on underlying processes by characterizing spatial patterns of vegetation. The aim of this study was to demonstrate effects of underlying heterogeneity of wild pistachio (Pistacia atlantica Desf.) trees on the second-order summary statistics of point pattern analysis in a part of Zagros woodlands, Iran. The spatial distribution of 431 wild pistachio trees was accurately mapped in a 40 ha stand in the Wild Pistachio & Almond Research Site, Fars province, Iran. Three commonly used second-order summary statistics (i.e., K-, L-, and g-functions) were applied to analyse their spatial pattern. The two-sample Kolmogorov-Smirnov goodness-of-fit test showed that the observed pattern significantly followed an inhomogeneous Poisson process null model in the study region. The results also showed that heterogeneous pattern of wild pistachio trees biased the homogeneous form of K-, L-, and g-functions, demonstrating a stronger aggregation of the trees at the scales of 0-50 m than actually existed and an aggregation at scales of 150-200 m, while regularly distributed. Consequently, we showed that heterogeneity of point patterns may bias the results of homogeneous second-order summary statistics and we also suggested applying inhomogeneous summary statistics with related null models for spatial pattern analysis of heterogeneous vegetations.

  12. EFFECTS OF HETEROGENIETY ON SPATIAL PATTERN ANALYSIS OF WILD PISTACHIO TREES IN ZAGROS WOODLANDS, IRAN

    Directory of Open Access Journals (Sweden)

    Y. Erfanifard

    2014-10-01

    Full Text Available Vegetation heterogeneity biases second-order summary statistics, e.g., Ripley's K-function, applied for spatial pattern analysis in ecology. Second-order investigation based on Ripley's K-function and related statistics (i.e., L- and pair correlation function g is widely used in ecology to develop hypothesis on underlying processes by characterizing spatial patterns of vegetation. The aim of this study was to demonstrate effects of underlying heterogeneity of wild pistachio (Pistacia atlantica Desf. trees on the second-order summary statistics of point pattern analysis in a part of Zagros woodlands, Iran. The spatial distribution of 431 wild pistachio trees was accurately mapped in a 40 ha stand in the Wild Pistachio & Almond Research Site, Fars province, Iran. Three commonly used second-order summary statistics (i.e., K-, L-, and g-functions were applied to analyse their spatial pattern. The two-sample Kolmogorov-Smirnov goodness-of-fit test showed that the observed pattern significantly followed an inhomogeneous Poisson process null model in the study region. The results also showed that heterogeneous pattern of wild pistachio trees biased the homogeneous form of K-, L-, and g-functions, demonstrating a stronger aggregation of the trees at the scales of 0–50 m than actually existed and an aggregation at scales of 150–200 m, while regularly distributed. Consequently, we showed that heterogeneity of point patterns may bias the results of homogeneous second-order summary statistics and we also suggested applying inhomogeneous summary statistics with related null models for spatial pattern analysis of heterogeneous vegetations.

  13. Two-Dimensional Electrophoretic Analysis of Soluble Leaf Proteins of a Salt-sensitive (Triticum aestivum) and a Salt-tolerant (T. Durum) Cultivar in Response to NaCl Stress

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    In this research, 3-day-old etiolated wheat seedlings of Triticum aestivum L. cv. Ceyhan-99 (salt-sensitive) and T. durum Desf. cv. Firat-93 (salt-tolerant) were grown in control and salt (150 mmol/L NaCl) treatments at a 15/25℃ temperature regime in the light for 12 days. Soluble proteins extracted from the first leaf tissues of two cultivars were analyzed by twodimensional (2-D) electrophoresis in order to detect NaCl-induced changes. The soluble leaf protein profiles of cultivars were observed to be similar. However, quantitative differences in 74 proteins were detected in the salt treatment group,compared to the control. Among the 74 protein spots, 14 were common for two cultivars. As a result of NaCl treatment, two low-molecular-weight (LMW) proteins (28.9 and 30.0 kDa) and one intermediate-molecular-weight (IMW) protein (44.3 kDa)in cv. Ceyhan-99 and six LMW proteins (18.6, 19.4, 25.7, 25.9, 26 and 27.6 kDa) in cv. Firat-93 were newly synthesized. The newly synthesized proteins were specific to each cultivar. In the Firat-93 cultivar, four proteins with LMW (24.8-27.9 kDa)were completely lost in NaCl treatment. Moreover, these four protein spots were not observed in both protein profiles of cv. Ceyhan-99. Most of these proteins were in acidic character (pi <6.0-6.9) and low molecular weight (<31.6 kDa). It is suggested that the newly synthesized or completely lost LMW proteins may be important for cultivars differing in sensitivity towards NaCl.

  14. Modulation of pancreatic MIN6 insulin secretion and proliferation and extrapancreatic glucose absorption with Achillea santolina, Eryngium creticum and Pistacia atlantica extracts: in vitro evaluation

    Directory of Open Access Journals (Sweden)

    Lara Majdalawi

    2012-06-01

    Full Text Available Objective: The present in vitro studies aimed to investigate the pancreatic and extrapancreatic effects of crude aqueous extracts (AE of Achillea santolina L, Eryngium creticum Lam, and Pistacia atlantica Desf utilized in Jordan diabetes ethnomedicine. Methods: Bioassays of β-cell proliferation and insulin secretion as well as glucose diffusion as possible modes of action were recruited. Results: Similar to L-alanine insulinotropic efficacy in MIN6 β-cell, glucose-stimulated Ca2+ regulated- insulin secretion was potentiated by AEs of E.creticum (0.01 mg/ml and P.atlantica (0.01, 0.1 and 0.5 mg/ml. A.santolina AE, however, was found ineffective. Comparable to glucagon-like peptid-1-enhanced β-cell proliferation in 2-day treatment wells, a dose dependent augmentation of bromodeoxyuridine incorporation was obtained with the A.santolina AE (0.05-1 mg/ml, and E.creticum AE (0.1, 0.5 and 1 mg/ml. P.atlantica concentrations lacked pancreatic proliferative capacity. While A.santolina and E.creticum AEs proved inactive, P.atlantica inhibited dose dependently overnight glucose movement in vitro, as effectively as guar gum diffusional hindrance in a simple glucose dialysis model. Conclusion: Current findings signify the in vitro diverse therapeutic antidiabetes properties of the selected medicinal plants. Future directives may assess the use of A.santolina, E.creticum and P.atlantica as new potential sources of functional foods or nutraceuticals or active leads into diabetes type 2 pharmacotherapy. [J Exp Integr Med 2012; 2(3.000: 245-254

  15. Wild food plants used in traditional vegetable mixtures in Italy.

    Science.gov (United States)

    Guarrera, P M; Savo, V

    2016-06-05

    Mixtures of wild food plants, part of the Mediterranean diet, have potential benefits for their content in bioactive compounds, minerals and fibers. In Italy, wild plants are still consumed in various ways, for their taste, effects on health and nutritional value. In this paper, we provide a list of wild plants used in vegetable mixtures, indicating their phytochemical and nutritional profile, highlighting those not yet studied. We provide a first complete review of traditional uses of wild food plants used as vegetables and their preparations (e.g., salads, soups, rustic pies). We also highlight their phytochemical constituents. We carried out an extensive literature review of ethnobotanical publications from 1894 to date for finding plants used in traditional vegetable mixtures. We also performed an online search for scientific papers providing the phytochemical profile of plants that were cited at least twice in recipes found in the literature. We list a total of 276 wild taxa used in traditional vegetable mixtures, belonging to 40 families. Among these, the most represented are Asteraceae (88), Brassicaceae (33), Apiaceae (21), Amaranthaceae (12). Many plants are cited in many recipes across several Italian regions. Among the most cited plant we note: Reichardia picroides (L.) Roth, Sanguisorba minor Scop., Taraxacum campylodes G. E. Haglund, Urtica dioica L. Tuscany is the region with the highest number of food recipes that incorporate wild plants used as vegetables. We also list the phytochemical constituents and some pharmacological activities of the plants cited at least twice. Finally, we discuss topics such as the taste of plants used in the recipes. Nineteen edible wild plants, such as Asparagus albus L., Campanula trachelium L., Hypochaeris laevigata (L.) Benth. & Hook f., Phyteuma spicatum L., Scolymus grandiflorus Desf., are not yet studied as regards their phytochemical and nutritional profile. Some plants should be avoided due to the presence of

  16. POSIBILITĂŢI DE ORGANIZARE ŞI UTILIZARE A PRACTICII CONTROLULUI FINANCIAR-FISCAL ÎN CONDIŢIILE REPUBLICII MOLDOVA

    Directory of Open Access Journals (Sweden)

    Iulia CAPRIAN

    2016-12-01

    Full Text Available Importanţa deosebită a controlului financiar-fiscal este determinată de faptul că acesta este exercitat în virtutea drep­tu­lui pe care societatea îl are de a-şi apăra interesele fundamentale. Asigu­rarea resurselor financiare necesare statului se realizează prin sistemul fiscal, respectiv prin cele două funcţii principale ale acestuia: funcţia socială şi funcţia de control. Controlul financiar-fiscal, prin pârghiile oferite de sistemul fiscal sub forma impozitelor şi taxe­lor, penetrează activi­tă­ţile agentului economic, stabilind modul în care acesta respectă legalitatea şi dacă desfăşoară o activitate econo­mică eficientă.OPPORTUNITIES TO ORGANIZE AND TO USE OF THE FINANCIAL AND FISCAL CONTROL`S PRACTICE IN THE CONDITIONS OF THE REPUBLIC OF MOLDOVAThe particular importance of the financial and fiscal control is determined by the fact that it is exercised under the right of the society to protect its fundamental interests. The insurance of financial resources for the state`s needs is accomplished by the fiscal system, respectively by its two main functions: social function, and control function. Based on the leverorges offered by the fiscal system in the form of taxes and duties, the financial and fiscal control penetrates the activities of the economic agent, identifying the way in which this one respects the law and if it has an economic efficient activity.

  17. Anadolu'ya Ait Makarnalık Buğdaylardan Cinslerarası Melezleme (Buğday x Mısır ile Elde Edilen Katlanmış Haploid (Doubled Haploid Hatların Tarımsal Kapasiteleri

    Directory of Open Access Journals (Sweden)

    A Şenay

    2009-03-01

    Full Text Available Bu çalışmada yerel makarnalık buğday çeşitlerden (T.durum Desf. Kunduru 1149, Berkmen 469 ve Çakmak 79 ve bunlardan elde edilen katlanmış haploid hatların tarla koşullarında tarımsal kapasiteleri, varyans analizi ve EKÖF testi ile karşılaştırıldı. Kunduru 1149'dan üretilen katlanmış haploid hatlar arasında, bitki yaşam oranı, başak çıkış zamanı, bitki boyu, başak uzunluğu, kardeşlenme sayısı, başakta başakçık sayısı, başakta tane sayısı, 100-tane ağırlığı, bitkide tane verimi ve hasat indeksi bakımından önemli farklılıklar bulundu. 'Berkmen 469'dan üretilen katlanmış haploid hatlar bitkide tane verimi ve kardeş sayısı dışında (P<0.05 morfolojik özelliklerin çoğunda önemli bir farklılık bulunmadı. Bu denemede 'Çakmak 79' dan üretilen hatlar arasında da hiçbir morfolojik özellikte önemli farklılık bulunmadı.

  18. Accelerated Burn Wound Closure in Mice with a New Formula Based on Traditional Medicine

    Science.gov (United States)

    Mehrabani, Mehrnaz; Seyyedkazemi, Seyyed Mohsen; Nematollahi, Mohammad Hadi; Jafari, Elham; Mehrabani, Mitra; Mehdipour, Mohammad; Sheikhshoaee, Zahra; Mandegary, Ali

    2016-01-01

    Background A combination of the oils of sesame, hemp, wild pistachio, and walnut has been used for treatment of skin disorders, including wound burns, in some parts of Kerman, Iran. Evaluation of this remedy in the form of a pharmaceutical formulation in animal models can pave the way for its future application in wound burn healing in humans. Objectives This experimental study investigated the healing potential of a new formula (NF) based on folk medicine from Iran for the treatment of third degree burns in mice. The formula was a combination of the oils of four plants: sesame (Sesamum indicum L.), wild pistachio (Pistacia atlantica Desf.), hemp (Cannabis sativa L.), and walnut (Juglans regia L.) Methods Twenty-four mice were selected based on simple random sampling. Twenty-five percent of the total body surface area was burned by exposure to boiling water, according to the Walker-Mason method. NF and silver sulfadiazine (the positive control) were applied topically twice a day for 21 days. The burned area in the negative control group was left untreated. Epithelialization time and the percent of wound contraction were measured during the treatment period. The process of wound repairing was evaluated using histological (H and E and trichrome staining) and immunohistological (anti-pancytokeratin) methods. Results When compared to the controls, NF significantly improved wound contraction after day 10. Epithelialization time in the NF group was significantly faster than in the other groups (20 vs. 25.5 days) (P < 0.001). Histopathological and immunohistochemical findings confirmed the efficacy of the NF. Conclusions A new therapeutic remedy was introduced for the treatment of burn wounds. Further clinical and molecular studies are suggested to determine the exact mechanism(s) involved in the burn wound healing effect of NF. PMID:28191338

  19. Growth and nutrition of Tetraclinis articulata (Vahl Mast. cultivated in different rhizosphere soils collected from Tetraclinis stand

    Directory of Open Access Journals (Sweden)

    Abbas, Y.

    2013-01-01

    Full Text Available Five representative plant species (Withania frutescens Pauquy, Lavandula multifida L., Pistacia atlantica Desf., Olea europaea L. subsp. oleaster (Hoffmanns. & Link Negodi and Tetraclinis articulata [Vahl] Mast. were selected from Moroccan Tetraclinis woodland in order to evaluate their mycorrhizal potential and to compare the impact of their rhizosphere soil on growth and nutrition of Tetraclinis articulata seedlings. We observed that roots of selected plants were highly colonized by Arbuscular Mycorrhizal (AM fungi. Lavandula multifida roots showed the highest colonization percentage (100%. We recovered AM fungal spores from the rhizosphere soils of the five plant species and we found that the spores number from L. multifida and T. articulata rhizosphere was significantly different from that of other plants. We assessed the mycorrhizal potential of the indigenous soils by using the Most Probable Number (MPN approach. We found that MPN in soils collected near the five plant species was significantly higher than the one in the bare soil. The average of MPN per 100 g of dry soil was 11.8 (from 5.6 to 25.0 in the bare soil and 228.5 (from 108.0 to 476.0 in L. multifida rhizosphere. This result indicates that the soil surrounding the target plants can be used as inoculum for mycorrhization. We conducted a nursery experiment in which L. multifida soil yielded a high mycorrhizal percentage in T. articulata plants, thus contributing to improve the plant growth. However, the highest formation of arbuscules in T. articulata grown in Lavandula soil did not significantly affect the growth or the nutrition of plants compared to Tetraclinis soil, except for potassium concentration. Our investigation clearly showed that L. multifida soil can be used as biofertilizer to inoculate nurseries for T. articulata production. This will greatly contribute to sustain Tetraclinis woodland.

  20. CONSIDERAŢII PRIVIND CONTABILITATEA STOCURILOR ÎN ORGNIZAŢIILE NECOMERCIALE

    Directory of Open Access Journals (Sweden)

    Lidia CAUŞ

    2016-12-01

    Full Text Available Pentru desfăşurarea activităţilor sale statutare organizaţiile necomerciale utilizează diverse active circulante aflate în posesia acestora. Stocurile reprezintă elemente contabile importante antrenate în activitatea entităţilor. În practica con­tabilă a acestor organizaţii există multe probleme privind contabilizarea stocurilor. În cadrul contabilităţii acestor elemente trebuie soluţionate multiple probleme privind recunoaşterea, evaluarea, utilizarea conturilor contabile, privind mişcarea stocurilor. În scopul soluţionării problemelor menţionate se recomandă: concretizarea recunoaşterii şi evaluării stocurilor în conformitate cu specificul activităţii organizaţiilor necomerciale, precum şi reflectarea schemelor de înregistrări contabile aferente mişcării stocurilor în funcţie de particularităţile activităţii entităţilor necomerciale.CONSIDERATIONS REGARDING INVENTORY ACCOUNTING IN NON-COMMERCIAL ORGANIZATIONSIn order to perform their statutory activities, the non-profit organizations use various current assets that they possess. The inventories represent important accounting elements involved in the entities activity. In accounting practice of these organizations, there are many issues with bookkeeping for inventories. The process of inventory bookkeeping involves solving multiple issues regarding recognition, measurement, the use of bookkeeping account stock flow. In order to solve the mentioned problems it is recommended: the concretization of recognition and measurement of inventories in accordance with the specific activity of non-profit organizations and presentation of accounting records schemes of the stock flow based on specific features of non-business entities. 

  1. Plants and other natural products used in the management of oral infections and improvement of oral health.

    Science.gov (United States)

    Chinsembu, Kazhila C

    2016-02-01

    Challenges of resistance to synthetic antimicrobials have opened new vistas in the search for natural products. This article rigorously reviews plants and other natural products used in oral health: Punica granatum L. (pomegranate), Matricaria recutita L. (chamomile), Camellia sinensis (L.) Kuntze (green tea), chewing sticks made from Diospyros mespiliformis Hochst. ex A.D.C., Diospyros lycioides Desf., and Salvadora persica L. (miswak), honey and propolis from the manuka tree (Leptospermum scoparium J.R. Forst. & G. Forst.), rhein from Rheum rhabarbarum L. (rhubarb), dried fruits of Vitis vinifera L. (raisins), essential oils, probiotics and mushrooms. Further, the review highlights plants from Africa, Asia, Brazil, Mexico, Europe, and the Middle East. Some of the plants' antimicrobial properties and chemical principles have been elucidated. While the use of natural products for oral health is prominent in resource-poor settings, antimicrobial testing is mainly conducted in the following countries (in decreasing order of magnitude): India, South Africa, Brazil, Japan, France, Egypt, Iran, Mexico, Kenya, Switzerland, Nigeria, Australia, Uganda, and the United Kingdom. While the review exposes a dire gap for more studies on clinical efficacy and toxicity, the following emerging trend was noted: basic research on plants for oral health is mainly done in Brazil, Europe and Australia. Brazil, China, India and New Zealand generally conduct value addition of natural products for fortification of toothpastes. African countries focus on bioprospecting and primary production of raw plants and other natural products with antimicrobial efficacies. The Middle East and Egypt predominantly research on plants used as chewing sticks. More research and funding are needed in the field of natural products for oral health, especially in Africa where oral diseases are fuelled by human immunodeficiency virus/acquired immunodeficiency syndrome (HIV/AIDS).

  2. CURTEA PENALĂ INTERNAŢIONALĂ ÎN LUMINA PREVEDERILOR STATUTULUI DE LA ROMA

    Directory of Open Access Journals (Sweden)

    Ludmila DUMNEANU

    2016-03-01

    Full Text Available Curtea Penală Internaţională – instituţie centrală a justiţiei penale internaţionale, constituie, totodată, elementul pri­mordial al dreptului internaţional contemporan şi al sistemelor naţionale în domeniul dreptului penal. Segmentul-cheie în materie îl constituie procesul de ratificare şi implementare a Statutului dela Romade către state, în parte de către Republica Moldova. Un adevărat fenomen localizat în priorităţile activităţii guvernelor statelor, instituţiilor internaţio­nale şi naţionale, ONG-urilor (cca 800, personalităţilor etc. Evenimentul a fost precedat de-a lungul timpului de orga­nizarea şi desfăşurarea conferinţelor, întrunirilor, elaborarea de studii, avize, rapoarte; procesul totuşi continuă şi este catalogat a fi încă „viu”. THE INTERNATIONAL PENAL COURT IN THE LIGHT OF THE PROVISIONS OF THE ROME STATUTETheInternational Penal Court– the main institution of the international criminal justice, represents the major element of the contemporary international law and of the national systems regarding the penal law. The key part in this matter is represented by the process of ratification and implementation of the Statute of Rome by the states, partly, by theRepublicofMoldova. It is a real phenomenon in the priorities of the activities of different governments, national and international institutions, NGOs (around 800, personalities, etc. This event has been preceded through the years by the organization of conferences, meetings, research studies, notifications, reports; the process is still under development, being considered still „functioning”. 

  3. Registration of Durum Wheat Germplasm Lines with Combined Mutations in SBEIIa and SBEIIb Genes Conferring Increased Amylose and Resistant Starch.

    Science.gov (United States)

    Hazard, Brittany; Zhang, Xiaoqin; Naemeh, Mahmoudreza; Dubcovsky, Jorge

    2014-08-25

    Durum wheat [Triticum turgidum L. subsp. durum (Desf.) Husn.], used in pasta, couscous, and flatbread production, is an important source of starch food products worldwide. The amylose portion of the starch forms resistant starch complexes that resist digestion and contribute to dietary fiber. Increasing the amount of amylose and resistant starch in wheat by mutating the STARCH BRANCHING ENZYME II (SBEII) genes has potential to provide human health benefits. Ethyl methane sulfonate mutations in the linked SBEIIa and SBEIIb paralogs were combined on chromosomes 2A (SBEIIa/b-A; Reg. No. GP-968, PI 670159), 2B (SBEIIa/b-B; Reg. No. GP-970, PI 670161), and on both chromosomes (SBEIIa/b-AB; Reg. No. GP-969, PI 670160) in the tetraploid wheat cultivar Kronos, a semidwarf durum wheat cultivar that has high yield potential and excellent pasta quality. These three double and quadruple SBEII-mutant lines were compared with a control sib line with no SBEII mutations in two field locations in California. The SBEIIa/b-AB line with four mutations showed dramatic increases in amylose (average 66%) and resistant starch (average 753%) relative to the control. However, the SBEIIa/b-AB line also showed an average 7% decrease in total starch and an 8% decrease in kernel weight. The release by the University of California-Davis of the durum wheat germplasm combining four SBEIIa and SBEIIb mutations will accelerate the deployment of these mutations in durum wheat breeding programs and the development of durum wheat varieties with increased resistant starch.

  4. Cadmium Contents of Soils, Durum, and Bread Wheats in Harran Plain, Southeast Turkey

    Science.gov (United States)

    Büyükkılıç, Asuman; Mermut, Ahmet; Faz Cano, Angel; Carmona Garces, Doria

    2010-05-01

    Turkey is growing significant amount of durum wheat (Triticum turgidum durum - (Desf.)Husn) which is widely used for making pasta, spaghetti, noodles etc. Objective of this study were to: 1) determine Cd concentrations of the soils, durum and bread wheats grown in the Harran plain, southeast Turkey and 2) evaluate this element in terms of food safety. Soil samples from the selected 16 profiles, grains, roots, and leaves of durum and bread wheats were taken for analyses. Total Cd contents of the soils were below the threshold values. The soils in the northern part of the plain have more than 0.2 ppm of Cd. Carbonate and clay contents are > 15% and 40% respectively and have substantial amounts of Fe-oxy-hydroxides. Three phosphorus fertilizer samples, frequently used in the area, had > 2 ppm of Cd. As expected, the amounts of Cd in bread wheat were lower than durum wheat. However, the Cd contents in durum wheat grains in the area studied were 100 ?g kg-1) and similar to the drum grains from Italy. Some samples in Italy even had 71 ?g kg-1. These were attributed to the presence of high amounts of carbonates, Fe-oxy-hydroxides, and clay in the soils we studied. In the surface soil, Zn contents were between 21.5 and 72.8 mg kg-1.This could be another reason for lower contents of Cd in our durum wheat. Our study confirms that durum wheat grown in the Harran plain southeast Turkey has a better quality, therefore advantageous; in terms of food safety from the standpoint of Cd contents.

  5. Estimating grain yield losses caused by septoria leaf blotch on durum wheat in Tunisia

    Directory of Open Access Journals (Sweden)

    Samia Berraies

    2014-12-01

    Full Text Available Septoria leaf blotch (SLB, caused by Zymoseptoria tritici (Desm. Quaedvlieg & Crous, 2011 (teleomorph: Mycosphaerella graminicola (Fuckel J. Schrot., is an important wheat disease in the Mediterranean region. In Tunisia, SLB has become a major disease of durum wheat (Triticum turgidum L. subsp. durum [Desf.] Husn. particularly during favorable growing seasons where significant yield losses and increase of fungicides use were recorded over the last three decades. The objectives of this study were to evaluate the effect of SLB severity on grain yield of new elite durum wheat breeding lines and to measure the relative effect of fungicide control on grain yield. Experiments were conducted during 2007-2008 and 2008-2009 cropping seasons. A set of 800 breeding lines were screened for reaction to SLB under natural infection at Beja research station. To estimate the disease effect, correlation between disease severity at early grain filling stage and grain yield was performed. Results showed that susceptible varieties yield was significantly reduced by SLB. Average yield reduction was as high as 384 and 325 kg ha-1 for every increment in disease severity on a 0-9 scale in both seasons, respectively. A negative correlation coefficient varied between -0.61 and -0.66 in both seasons. Treated and untreated trials conducted during 2008-2009 and 2009-2010 showed that yield of treated plots increased by 50% on the commonly cultivated susceptible varieties. The results of this investigation suggested that septoria incidence is related to large grain yield losses particularly on susceptible high yielding cultivars. However, appropriate fungicide application at booting growth stage could be beneficial for farmers. The development and use of more effective fungicide could be sought to alleviate the disease effects and therefore could be considered as a part of the integrated pest management and responsible use strategy on septoria leaf blotch in Tunisia.

  6. Transcription profiling of the model cyanobacterium Synechococcus sp. strain PCC 7002 by NextGen (SOLiD™ Sequencing of cDNA

    Directory of Open Access Journals (Sweden)

    Marcus eLudwig

    2011-03-01

    Full Text Available The genome of the unicellular, euryhaline cyanobacterium Synechococcus sp. PCC 7002 encodes about 3200 proteins. Transcripts were detected for nearly all annotated open reading frames by a global transcriptomic analysis by Next-Generation (SOLiDTM sequencing of cDNA. In the cDNA samples sequenced, ~90% of the mapped sequences were derived from the 16S and 23S ribosomal RNAs and ~10% of the sequences were derived from mRNAs. In cells grown photoautotrophically under standard conditions (38 °C, 1% (v/v CO2 in air, 250 µmol photons m-2 s-1, the highest transcript levels (up to 2% of the total mRNA for the most abundantly transcribed genes (e. g., cpcAB, psbA, psaA were generally derived from genes encoding structural components of the photosynthetic apparatus. High light exposure for one hour caused changes in transcript levels for genes encoding proteins of the photosynthetic apparatus, Type-1 NADH dehydrogenase complex and ATP synthase, whereas dark incubation for one hour resulted in a global decrease in transcript levels for photosynthesis-related genes and an increase in transcript levels for genes involved in carbohydrate degradation. Transcript levels for pyruvate kinase and the pyruvate dehydrogenase complex decreased sharply in cells incubated in the dark. Under dark anoxic (fermentative conditions, transcript changes indicated a global decrease in transcripts for respiratory proteins and suggested that cells employ an alternative phosphoenolpyruvate degradation pathway via phosphoenolpyruvate synthase (ppsA and the pyruvate:ferredoxin oxidoreductase (nifJ. Finally, the data suggested that an apparent operon involved in tetrapyrrole biosynthesis and fatty acid desaturation, acsF2-ho2-hemN2-desF, may be regulated by oxygen concentration.

  7. Genotype x Environment interaction for antioxidants and phytic acid contents in bread and durum wheat as influenced by climate

    Directory of Open Access Journals (Sweden)

    Gordana Brankovic

    2015-06-01

    Full Text Available Antioxidants prevent oxidative stress and exert positive health effects. However, phytic acid among them decreases micronutrients absorption, representing also antinutrient to human and non-ruminant animals. Fifteen bread wheat (Triticum aestivum L. and 15 durum wheat (Triticum durum Desf. genotypes were evaluated across six environments to determine contents of phytic acid (PA, inorganic P (Pi, total yellow pigment, total soluble phenolic compounds, free protein sulfhydryl groups (PSH, and also phytic acid P/Pi (Pp/Pi. The objective of this study was to quantify, for each trait the effects of environment, genotype, and their interaction; and the influence of climatic factors on the Genotype x Environment interaction (GEI by the use of the factorial regression. GEI (P < 0.001 prevailed as source of variation over genotype (P < 0.001 in determining PA content in bread and durum wheat (44.3% and 34.7% of sum of squares-SS, respectively, PSH content in bread and durum wheat (27% and 28.4% of SS, respectively and total soluble phenolic compounds content in durum wheat (35.5% of SS. The major contribution to the GEI represented climatic variables during stages of stem elongation for PA and phenolic compounds, and also flowering, fertilization, grain formation and grain filling for PSH. Total yellow pigment and Pi contents in bread and durum wheat were predominantly determined by genotype (P < 0.001. Models of climatic variables proved to be efficient in the explanation of more than 92% of the SS of GEI for PA and antioxidants contents.

  8. Impact of microbial inoculation on biomass accumulation by Sulla carnosa provenances, and in regulating nutrition, physiological and antioxidant activities of this species under non-saline and saline conditions.

    Science.gov (United States)

    Hidri, R; Barea, J M; Mahmoud, O Metoui-Ben; Abdelly, C; Azcón, Rosario

    2016-08-20

    Bacteria (Pseudomonas sp. and Bacillus sp.) and/or the arbuscular mycorrhizal (AM) fungus Rhizophagus intraradices were able to improve growth, physiological and biochemical characteristics of four Sulla carnosa Desf. provenances (Sidi khlif, Thelja, Kalbia and Kerker) from Tunisia under both saline and non-saline conditions. S. carnosa is a salt-tolerant legume plant, native from North Africa. The intrinsic bacterial characteristics evidenced the fitness of these bacteria to support salt stress and to stimulate plant growth. Bacillus sp. produced more indol acetic acid (IAA) than Pseudomonas sp. and showed a great surviving capacity under salt conditions supporting its capacity to improve plant growth under stress conditions. The microorganisms applied also have a different potential to increase the nutritional and related plant growth parameters. It is noticeable that some provenances reached the highest level of growth when inoculated with Bacillus sp. in Sidi khlif or by Bacillus plus AMF in Kalbia, which increased shoot by 318% and root by 774%. In contrast, in Thelja and Kerker the impact of the test microorganisms was mainly evidenced at increasing nutritional and physiological functions. Salinity reduced some growth and physiological variables as stomatal conductance, photosynthetic pigments and photosynthetic efficiency and increased electrolyte leakage. However, the microbial inoculants compensated these detrimental effects in a degree depending on the S. carnosa provenance. These microorganisms also orchestrate antioxidant activities involved in adaptative responses in S. carnosa provenances. The intrinsic ability of inoculants allow us to select the provenance/microorganism combination which maximizes S. carnosa growth, nutrition and physiological/biochemical responses under salt and non-salt conditions. The results obtained support that the target microbial inocula are beneficial for the ecological stability if this Mediterranean legume.

  9. 2-DE proteomics analysis of drought treated seedlings of Quercus ilex supports a root active strategy for metabolic adaptation in response to water shortage.

    Science.gov (United States)

    Simova-Stoilova, Lyudmila P; Romero-Rodríguez, Maria C; Sánchez-Lucas, Rosa; Navarro-Cerrillo, Rafael M; Medina-Aunon, J Alberto; Jorrín-Novo, Jesús V

    2015-01-01

    Holm oak is a dominant tree in the western Mediterranean region. Despite being well adapted to dry hot climate, drought is the main cause of mortality post-transplanting in reforestation programs. An active response to drought is critical for tree establishment and survival. Applying a gel-based proteomic approach, dynamic changes in root proteins of drought treated Quercus ilex subsp. Ballota [Desf.] Samp. seedlings were followed. Water stress was applied on 20 day-old holm oak plantlets by water limitation for a period of 10 and 20 days, each followed by 10 days of recovery. Stress was monitored by changes in water status, plant growth, and electrolyte leakage. Contrary to leaves, holm oak roots responded readily to water shortage at physiological level by growth inhibition, changes in water status and membrane stability. Root proteins were extracted using trichloroacetate/acetone/phenol protocol and separated by two-dimensional electrophoresis. Coomassie colloidal stained gel images were analyzed and spot intensity data subjected to multivariate statistical analysis. Selected consistent spots in three biological replicas, presenting significant changes under stress, were subjected to MALDI-TOF mass spectrometry (peptide mass fingerprinting and MS/MS). For protein identification, combined search was performed with MASCOT search engine over NCBInr Viridiplantae and Uniprot databases. Data are available via ProteomeXchange with identifier PXD002484. Identified proteins were classified into functional groups: metabolism, protein biosynthesis and proteolysis, defense against biotic stress, cellular protection against abiotic stress, intracellular transport. Several enzymes of the carbohydrate metabolism decreased in abundance in roots under drought stress while some related to ATP synthesis and secondary metabolism increased. Results point at active metabolic adjustment and mobilization of the defense system in roots to actively counteract drought stress.

  10. 2-DE proteomics analysis of drought treated seedlings of Quercus ilex supports a root active strategy for metabolic adaptation in response to water shortage

    Directory of Open Access Journals (Sweden)

    Lyudmila Petrova Simova-Stoilova

    2015-08-01

    Full Text Available Holm oak is a dominant tree in the western Mediterranean region. Despite being well adapted to dry hot climate, drought is the main cause of mortality post-transplanting in reforestation programs. An active response to drought is critical for tree establishment and survival. Applying a gel-based proteomic approach, the dynamic changes in root proteins of drought treated Quercus ilex subsp. Ballota [Desf.] Samp. seedlings were followed. Water stress was applied on 20 day-old holm oak plantlets by water limitation for a period of 10 and 20 days, each followed by 10 days of recovery. Stress was monitored by changes in water status, plant growth and electrolyte leakage. Contrary to leaves, holm oak roots responded readily to water shortage at physiological level by growth inhibition, changes in water status and membrane stability. Root proteins were extracted using trichloroacetate/acetone/phenol protocol and subjected to two-dimensional electrophoresis. Coomassie colloidal stained gel images were analysed and spot intensity data subjected to multivariate statistical analysis. Selected consistent spots in the three biological replicas, presenting significant changes under stress, were subjected to MALDI-TOF mass spectrometry (peptide mass fingerprinting and MS/MS. For protein identification, combined search was performed with MASCOT search engine over NCBInr Viridiplantae and Uniprot databases. Data are available via ProteomeXchange with identifier PXD002484. Identified proteins were classified into functional groups: metabolism, protein biosynthesis and proteolysis, defence against biotic stress, cellular protection against abiotic stress, intracellular transport. Several enzymes of the carbohydrate metabolism decreased in abundance in roots under drought stress while some related to ATP synthesis and secondary metabolism increased. Results point at active metabolic adjustment and mobilization of the defence system in roots to actively counteract

  11. Accumulation of Dry Matter and Nitrogen in Durum Wheat During Grain Filling as Affected by Temperature and Nitrogen Rate

    Directory of Open Access Journals (Sweden)

    Laura Ercoli

    2009-03-01

    Full Text Available Durum wheat (Triticum durum Desf. is commonly grown in mediterranean conditions, where temperature stress during grain filling can limit productivity. This study was conducted to assess the effect of optimal and too high temperature during grain filling on the patterns of accumulation of dry matter and N of durum wheat plants grown at different levels of N fertilization. Two durum wheat varieties, Appio and Creso, were grown in controlled environment conditions and in pots with three rates of nitrogen fertilizer (not applied, normal amount, and high amount and two air temperature regimes during grain filling (20/15 °C and 28/23 °C day/night. Results showed that the duration of the intervals between the main maturity stages within grain filling were both genotype-specific and temperature- dependent, while N rate did not modify the timing of grain development. The two genotypes responded to temperature by increasing the rate of development, but the thermal timing of development was unchanged with the two temperature regimes. The higher temperature reduced grain growth and increased N accumulation in grain. However, these effects were recorded only in fertilized plants. Nitrogen availability modified the growth of the plant during the whole cycle, in that increased N fertilizer at seeding resulted in a greater plant size at anthesis and in a greater accumulation rate of dry matter and N in grain during grain filling. Grain yield and kernel weight were better expressed at 20/15 °C, while grain protein concentration was favoured under the 28/23 °C temperature regime. Nitrogen fertilization increased the sensitivity of plants to high temperature. Thus, the role of N fertilization under heat stress may be more important than under optimal temperatures.

  12. Accumulation of Dry Matter and Nitrogen in Durum Wheat During Grain Filling as Affected by Temperature and Nitrogen Rate

    Directory of Open Access Journals (Sweden)

    Marco Mariotti

    2011-02-01

    Full Text Available Durum wheat (Triticum durum Desf. is commonly grown in mediterranean conditions, where temperature stress during grain filling can limit productivity. This study was conducted to assess the effect of optimal and too high temperature during grain filling on the patterns of accumulation of dry matter and N of durum wheat plants grown at different levels of N fertilization. Two durum wheat varieties, Appio and Creso, were grown in controlled environment conditions and in pots with three rates of nitrogen fertilizer (not applied, normal amount, and high amount and two air temperature regimes during grain filling (20/15 °C and 28/23 °C day/night. Results showed that the duration of the intervals between the main maturity stages within grain filling were both genotype-specific and temperature- dependent, while N rate did not modify the timing of grain development. The two genotypes responded to temperature by increasing the rate of development, but the thermal timing of development was unchanged with the two temperature regimes. The higher temperature reduced grain growth and increased N accumulation in grain. However, these effects were recorded only in fertilized plants. Nitrogen availability modified the growth of the plant during the whole cycle, in that increased N fertilizer at seeding resulted in a greater plant size at anthesis and in a greater accumulation rate of dry matter and N in grain during grain filling. Grain yield and kernel weight were better expressed at 20/15 °C, while grain protein concentration was favoured under the 28/23 °C temperature regime. Nitrogen fertilization increased the sensitivity of plants to high temperature. Thus, the role of N fertilization under heat stress may be more important than under optimal temperatures.

  13. ARTA INTERVIULUI CULTURAL: SPECIFIC, CONŢINUT ŞI TEHNICI DE REALIZARE

    Directory of Open Access Journals (Sweden)

    Laura TUGAREV

    2015-11-01

    Full Text Available Orice interviu cultural trebuie să trezească următoarele întrebări: În ce constă noutatea pentru cititor? Ce aspecte din tematica culturală dorim să dezvoltăm în interviu? Tema propusă pentru abordare, asigură ea oare varietate şi interes pentru lectură? Găsim interviul cultural ca o specie a genului publicistic care se face văzut tot mai des în paginile ziarelor de profil sau în paginile tematice ale cotidienelor, având menirea să informeze, să culturalizeze şi să relaxeze. Prin intermediul unui dialog viabil se pun în vileag abilităţile profesioniste veritabile ale jurnalistului, pentru că de modul abordării, de felul de a adresa întrebări, precum şi de atmosfera de comunicare stabilită cu intervievatul va ţine buna desfăşurare a interviului propriu-zis.THE ART OF THE CULTURAL INTERVIEW: MEANING, CHARACTERISTICS AND CONDUCTING TECHNIQUESAny cultural interview should answer arise the following questions: What is new important for the reader? What issues will be tackled/addressed in the interview? Is the subject of the interview able to generate readers’ interest? The cultural interview represents a unique type of journalistic genre, aiming at informing, enlightening and, in the same time relaxing the reader, usually found in the pages of cultural newspapers, magazines and other periodical publications. As the high degree of professionalism of the reporter assures the viability of the relation journalist-interviewer, the first should possess the abilities to address questions carefully, to choose the best suitable approach towards the interviewer, as well as to make a relaxed atmosphere, thus setting the prerequisites for a successful interview.

  14. Essential oils and crude extracts from Chrysanthemum trifurcatum leaves, stems and roots: chemical composition and antibacterial activity.

    Science.gov (United States)

    Sassi, Ahlem Ben; Skhiri, Fethia Harzallah; Chraief, Imed; Bourgougnon, Nathalie; Hammami, Mohamed; Aouni, Mahjoub

    2014-01-01

    The essential oils from the leaves, stems and roots of Chrysanthemum trifurcatum (Desf.) Batt. and Trab. var. macrocephalum (viv.) were obtained by hydrodistillation and their chemical compositions were analysed by gas chromatography (GC) and gas chromatography-mass spectrometry (GC-MS), in order to get insight into similarities and differences as to their active composition. A total of fifty compounds were identified, constituting 97.84%, 99.02% and 98.20% of total oil composition of the leaves, stems and roots, respectively. Monoterpene hydrocarbons were shown to be the main group of constituents of the leaves and stems parts in the ratio of 67.88% and 51.29%, respectively. But, the major group in the roots oil was found to be sesquiterpene hydrocarbons (70.30%). The main compounds in leaves oil were limonene (26.83%), γ-terpinene (19.68%), α-pinene (9.7%) and α-terpenyl acetate (7.16%). The stems oil, contains mainly limonene (32.91%), 4-terpenyl acetate (16.33%) and γ-terpinene (5.93%), whereas the main compounds in roots oil were α-calacorene (25.98%), α-cedrene (16.55%), β-bourbobene (14.91%), elemol (7.45%) and 2-hexenal (6.88%). The crude organic extracts of leaves, stems and roots, obtained by maceration with solvents of increasing polarity: petroleum ether, ethyl acetate and methanol, contained tannins, flavonoids and alkaloids. Meanwhile, essential oils and organic extracts were tested for antibacterial activities against eight Gram-positive and Gram-negative strains, using a microdilution method. The oil and methanolic extact from C. trifurcatum leaves showed a great potential of antibacterial effect against Bacillus subtilis and Staphylococcus epidermidis, with an IC50 range of 31.25-62.5 µg/ml.

  15. COMPOSICIÓN FLORÍSTICA Y ESTRUCTURA DE LOS BOSQUES RIBEREÑOS DE LA CUENCA BAJA DEL RÍO PAUTO, CASANARE, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Diego Mauricio Cabrera-Amaya

    2016-01-01

    Full Text Available Se caracterizó la composición florística y aspectos de la estructura de la vegetación en bosques ribereños de la cuenca baja del río Pauto (Colombia, Casanare utilizando la información de nueve parcelas de 20 x 50 m (1000 m², se midieron el diámetro a la altura del pecho (DAP, la altura total y cobertura de la copa. Se analizó la riqueza y los valores de importancia por especie y por familia. Se realizó un análisis para establecer una clasificación local de los tipos de bosque, los cuales se describieron en términos de clases diamétricas y altimétricas, diagramas estructurales e índice de predominio fisionómico. Se registraron 185 especies, 127 géneros y 56 familias, la mayor riqueza florística se agrupó en las familias Rubiaceae, Moraceae, Myrtaceae, Fabaceae y Bignoniaceae y en los géneros Ficus, Piper, Psychotria e Inga. Las familias con mayor IVF fueron Arecaceae, Fabaceae, Euphorbiaceae, Moraceae y Verbenaceae. Las especies más importantes según su IVI fueron: Attalea butyracea, Clarisia biflora, Sarcaulus brasiliensis, Dendropanax arboreus e Inga interrupta. Se encontraron seis comunidades, de las cuales sólo la primera se ha mencionado con anterioridad: 1 Palmar de Mauritia flexuosa y Euterpe precatoria, 2 Bosque de galería de Copaifera pubiflora y Homalium racemosum, 3 Bosque de vega de Discocarpus spruceanus y Sloanea terniflora, 4 Bosque de vega de Attalea butyracea y Garcinia madruno, 5 Bosque de galería de Attalea butyracea e Inga interrupta, y 6 Bosque de vega Attalea butyracea y Clarisia biflora. Los bosques presentan múltiples estratos con alturas del dosel desde los 18 m sobre las riberas de los caños, hasta 25 m en las vegas de los ríos. La riqueza y la composición concuerdan con los patrones florísticos de la Orinoquía colombiana, especialmente a nivel de familia, pero son menos las coincidencias a nivel de género y especie. La concentración de individuos en clases diamétricas pequeñas es

  16. A flora melitófila de uma área de dunas com vegetação de caatinga, Estado da Bahia, Nordeste do Brasil The bee flora of caatinga vegetation on sand dunes in Bahia State, Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Ana Tereza Araújo Rodarte

    2008-06-01

    Full Text Available As espécies melitófilas de uma área de caatinga foram caracterizadas quanto à morfologia e recursos florais, floração e abelhas visitantes. As coletas foram realizadas, durante quatro dias consecutivos, em fevereiro, abril, junho, agosto, outubro e dezembro/2000 (10º47'37'S e 42º49'25'W. A área foi percorrida das 06:00 às 17:00 h, seguindo dois transectos paralelos (com 450 m × 100 m e 550 m × 100 m e distando 50 m entre si, abrangendo 10 ha. As 42 espécies melitófilas identificadas (55% da flora local foram visitadas por 2.924 indivíduos de 41 espécies abelhas. As famílias Caesalpiniaceae e Malpighiaceae foram as mais visitadas. As espécies predominantemente visitadas por 35 espécies de abelhas, correspondendo a 78% do total de indivíduos foram: Byrsonima blanchetiana Miq., Copaifera coriacea Mart., Senna macranthera, Peltogyne pauciflora Benth., Senna gardneri (Benth. H.S. Irwin & Barneby, Serjania comata, Mouriri pusa (Gardner, Jatropha mutabilis (Pohl. Baill., Maytenus rigida Mart. e Turnera calyptrocarpa Urb. (24% da flora apícola. A produção de flores dessas espécies representou 95% do total. Em geral, os aspectos básicos da morfologia floral das espécies: pequenas, dispostas em inflorescências, zigomorfas, de cores alva e rosa, monoclinas e com deiscência longitudinal das anteras, não diferiram em relação à flora local, corroborando o seu caráter generalista. O predomínio de interações generalistas deve-se à abundância local de abelhas eussociais nativas (Meliponinae e Apis mellifera. Embora a produção de flores tenha sido maior na estação chuvosa, as abelhas foram mais abundantes no período seco, indicando que o recurso não limitou a atividade das abelhas. As plantas do estrato arbustivo e herbáceo floresceram mais intensamente no período seco e chuvoso, respectivamente, gerando um grau de compartimentalização no padrão de uso dos recursos pelas abelhas. Esse padrão pode favorecer a

  17. Prioritizing quantitative trait loci for root system architecture in tetraploid wheat.

    Science.gov (United States)

    Maccaferri, Marco; El-Feki, Walid; Nazemi, Ghasemali; Salvi, Silvio; Canè, Maria Angela; Colalongo, Maria Chiara; Stefanelli, Sandra; Tuberosa, Roberto

    2016-02-01

    Optimization of root system architecture (RSA) traits is an important objective for modern wheat breeding. Linkage and association mapping for RSA in two recombinant inbred line populations and one association mapping panel of 183 elite durum wheat (Triticum turgidum L. var. durum Desf.) accessions evaluated as seedlings grown on filter paper/polycarbonate screening plates revealed 20 clusters of quantitative trait loci (QTLs) for root length and number, as well as 30 QTLs for root growth angle (RGA). Divergent RGA phenotypes observed by seminal root screening were validated by root phenotyping of field-grown adult plants. QTLs were mapped on a high-density tetraploid consensus map based on transcript-associated Illumina 90K single nucleotide polymorphisms (SNPs) developed for bread and durum wheat, thus allowing for an accurate cross-referencing of RSA QTLs between durum and bread wheat. Among the main QTL clusters for root length and number highlighted in this study, 15 overlapped with QTLs for multiple RSA traits reported in bread wheat, while out of 30 QTLs for RGA, only six showed co-location with previously reported QTLs in wheat. Based on their relative additive effects/significance, allelic distribution in the association mapping panel, and co-location with QTLs for grain weight and grain yield, the RSA QTLs have been prioritized in terms of breeding value. Three major QTL clusters for root length and number (RSA_QTL_cluster_5#, RSA_QTL_cluster_6#, and RSA_QTL_cluster_12#) and nine RGA QTL clusters (QRGA.ubo-2A.1, QRGA.ubo-2A.3, QRGA.ubo-2B.2/2B.3, QRGA.ubo-4B.4, QRGA.ubo-6A.1, QRGA.ubo-6A.2, QRGA.ubo-7A.1, QRGA.ubo-7A.2, and QRGA.ubo-7B) appear particularly valuable for further characterization towards a possible implementation of breeding applications in marker-assisted selection and/or cloning of the causal genes underlying the QTLs.

  18. Wheat Production and Wheat Rust Management in Canada

    Institute of Scientific and Technical Information of China (English)

    Xue Allen G; Chi Dawn T; Zhang Shu-zhen; Li Zuo-fu

    2012-01-01

    Wheat is Canada's the largest crop with most of the production in the western Canadian Prairie Provinces of Manitoba, Saskatchewan and Alberta. There were approximately 10 million (M) hectares (hm2) seeded to wheat in Canada, including 7 M hm2 of hexaploid spring wheat (Triticum aestivum L.), 2 M hm2 of durum wheat (T. turgidum L. ssp. durum (Desf.) Husn.), and 1 M hm2 of winter wheat (T. aestivum). Within hexaploid wheat there has been diversification into a number of market classes based on different end-use quality criteria. The predominant spring bread wheat class has been the Canada Western Red Spring (CWRS) class. Historically, the disease of major concern in wheat was stem rust, caused by Puccinia graminis f. sp. tritici. The first significant stem rust resistant cultivar in Canada was Thatcher, grown extensively from 1939 until the early 1970s. Thatcher, however, was very susceptible to leaf rust, caused by Puccinia triticina. Over years, improved resistance to both stem and leaf rust was achieved with the release of cultivars with additional genes for resistance, primarily Sr2, Sr6, Sr7a, Sr9b, Lr13, Lr14a, Lr16, and Lr34. The genetic resistance has adequately controlled stem rust but leaf rust continues to cause significant loss, partially due to changes in the P. triticina population which reduced the effectiveness of resistance genes such as Lr13 and Lr16. Stripe rust on wheat, caused by Puccinia striiformis f. sp. tritici, was historically a problem under irrigation in southern Alberta, but since 2000, it has been found annually in the central Canadian prairies and southern Ontario. The genetic basis of resistance to stripe rust in most Canadian wheat cultivars has not been determined, although Yr18 provides partial resistance in many cultivars. In the future, other rust diseases, such as wheat stripe rust, or highly virulent new pathotypes of current rust pathogens, such as P. graminis f. sp. tritici race Ug-99, may pose

  19. MECANISME DE INFLUENŢĂ A PUBLICITĂŢII TELEVIZATE ASUPRA COPIILOR

    Directory of Open Access Journals (Sweden)

    Vasilica Magdalena SOMEŞFĂLEAN

    2015-12-01

    Full Text Available Influenţând atitudini, comportamente şi valori, televiziunea este considerată unul dintre cei mai mari „formatori”. După cum arată şi studiile desfăşurate în multe ţări, copiii sunt expuşi la reclame, la fel ca la orice alte programe, fără să facă de multe ori diferenţa, de unde şi posibilitatea unui impact direct asupra comportamentului lor. Chiar înainte să meargă, să vorbească, să citească sau să scrie, copiii sunt o ţintă directă pentru publicitari, pentru că reprezintă 3 pieţe: piaţa cumpărătorilor, a influenţatorilor şi piaţa viitorului. Scopul acestei lucrări este de a sublinia mecanismele prin care copiii sunt influenţaţi de reclamele televizate, în măsura în care au o putere de cumpărare semnificativă, care-i face cumpărători, mai mult sau mai puţin autonomi, în funcţie de vârsta lor.INFLUENCING CHILDREN THROUGH TELEVISION ADVERTISINGInfluencing attitudes, behaviours and values, television is considered one of the greatest „educators”. As proved by vast research conducted in many countries, children tend to expose to advertising as to any other television shows, watching it with eyes confort, without making the difference, hence the increased predictability of a direct impact of advertising on the childish spirit and behavior. Even before walking, talking, reading or writing, children are considered a first target for advertisers, as they represent three valuable markets: buyers’ market, influence market and future market. The aim of this paper is to highlight the mechanisms through which children are influenced by TV advertising, as they have a fairly significant purchasing power, which makes them play a purchaser, more or less autonomous, depending on their age.

  20. AQUATER Software as a DSS for Irrigation Management in Semi-Arid Mediterranean Areas

    Directory of Open Access Journals (Sweden)

    Marco Acutis

    2010-06-01

    Full Text Available Irrigation management at district or regional scale can be dealt using ecological process-based models and remote sensing data. Simulation crop models simulate at a certain time step the main biophysical variables determining crop photosynthesis and water consumption rates. The research consists in an integrated approach to combine field data, simulation crop model and remote sensing information. Detailed data sets related to topography, soil, climate and land cover were collected and organized into a Geographic Information System, which is routinely updated with remotely sensed images. The code implementation of these two models allows for an improvement of simulation reliability for the crop types considered in the present study in Mediterranean area. Remote sensing images detected by optical and radar satellite sensors at different spatial scales (from 10 to 50 m have been collected over the analyzed crop cycles. Therefore, remote sensing information about land use and leaf area index (LAI are assimilated dynamically by the model, to increase the effectiveness of simulation. The integration of crop and water dynamics models with the updated remote sensing information is a Decision Support Systems, AQUATER software, able to integrate remote sensing images, to estimate crop and soil variables related to drought, and subsequently to assimilate these variables into a simulation model at district scale. The significant final outputs are estimated values of evapotranspiration, plant water status and drought indicators. The present work describes the structure of AQUATER software and reports some application results over 2006 and 2007 cropping seasons in Capitanata, South-East Italy. This region has been divided in simulation units cropped by tomato (Lycopersicon lycopersicum L., sugar beet (Beta vulgaris L. var. saccharifera and durum wheat (Triticum durum Desf.. Two types of comparison have been carried out: (i between some tomato observed and

  1. Effect of ultraviolet radiation on chlorophyll, carotenoid, protein and proline contents of some annual desert plants.

    Science.gov (United States)

    Salama, Hediat M H; Al Watban, Ahlam A; Al-Fughom, Anoud T

    2011-01-01

    Investigation was carried out to find whether enhanced ultraviolet radiation influences the Malva parviflora L., Plantago major L., Rumex vesicarius L. and Sismbrium erysimoids Desf. of some annual desert plants. The seeds were grown in plastic pots equally filled with a pre-sieved normal sandy soil for 1 month. The planted pots from each species were randomly divided into equal groups (three groups). Plants of the first group exposed to white-light tubes (400-700 nm) 60 w and UV (365 nm) 8 w tubes. The second group was exposed to white-light tubes (400-700 nm) 60 w and UV (302 nm) 8 w tubes. The third group was exposed to white-light tubes (400-700 nm) 60 w and UV (254 nm) 8 w tubes, respectively, for six days. The results indicated that the chlorophyll contents were affected by enhanced UV radiation. The chlorophyll a, b, and total contents were decreased compared with the control values and reduced with the enhanced UV radiation, but the carotenoid was increased compared with the control and also reduced with the enhanced UV radiation. So, the contents of chlorophylls varied considerably. M. parviflora showed the highest constitutive levels of accumulated chlorophyll a, b, and total chlorophyll (0.463, 0.307 and 0.774 mg g(-1) f w) among the investigated plant species. P. major showed the lowest constitutive levels of the chloroplast pigments, 0.0036, 0.0038 and 0.0075 mg g(-1) f w for chlorophyll a, b, and total chlorophyll at UV-365 nm, respectively. The protein content was decreased significantly in both root and shoot systems compared with the control values but, it was increased with increasing wave lengths of UV-radiation of all tested plants. R. vesicarius showed the highest protein contents among the investigated plants; its content was 3.8 mg g(-1) f w at UV-365 nm in shoot system. On the other hand, decreasing ultraviolet wave length induced a highly significant increase in the level of proline in both root and shoot of all

  2. Selenium removal and mass balance in a constructed flow-through wetland system.

    Science.gov (United States)

    Gao, S; Tanji, K K; Lin, Z Q; Terry, N; Peters, D W

    2003-01-01

    A field study on the removal of Se from agricultural subsurface drainage was conducted from May 1997 to February 2001 in the Tulare Lake Drainage District (TLDD) of San Joaquin Valley, California. A flow-through wetland system was constructed consisting of ten 15- x 76-m unlined cells that were continuously flooded and planted with either a monotype or combination of plants, including sturdy bulrush [Schoenoplectus robustus (Pursh) M.T. Strong], baltic rush (Juncus balticus Willd.), smooth cordgrass (Spartina alterniflora Loisel.), rabbitsfoot grass [Polypogon monspeliensis (L.) Desf.], salt-grass lDistichlis spicata (L.) Greene], cattail (Typha latifolia L.), tule [Schoenoplectus acutus (Muhl. ex Bigelow) A. Löve & D. Löve], and widgeon grass (Ruppia maritima L.). One cell had no vegetation planted. The objectives of this research were to evaluate Se removal efficiency of each wetland cell and to carry out a mass balance on Se. The inflow drainage water to the cells had average annual Se concentrations of 19 to 22 microg L(-1) dominated by selenate [Se(VI), 95%]. Average weekly water residence time varied from about 3 to 15 d for Cells 1 through 7 (target 7 d), 19 to 33 d for Cells 8 and 9 (target 21 d), and 13 to 18 d for Cell 10 (target 14 d). Average weekly Se concentration ratios of outflow to inflow ranged from 0.45 to 0.79 and mass ratio (concentration x water volume) from 0.24 to 0.52 for year 2000, that is, 21 to 55% reduction in Se concentration and 48 to 76% Se removal in mass by the wetland, respectively. The nonvegetated cell showed the least Se removal both in concentration and in mass. The global mass balance showed that on the average about 59% of the total inflow Se was retained within the cells and Se outputs were outflow (35%), seepage (4%), and volatilization (2%). Independent measurements of the Se retained in the cells totaled 53% of the total Se inflow: 33% in the surface (0-20 cm) sediment, 18% in the organic detrital layer above the

  3. BEST INTERESTS OF THE CHILD FOR CHILDREN IN CONTACT WITH THE LAW. VICTIMS AND WITNESSES

    Directory of Open Access Journals (Sweden)

    Augustina BOLOCAN-HOLBAN

    2015-11-01

    Full Text Available From the moment a child victim/witness comes into contact with the justice system, he/she should be fully informed about the process they may have to go through as this can reduce any feelings of insecurity or anxiety that the child may have. Knowing when and where they will be interviewed and who by, how the justice process works, when they will be required to testify, who will be present, and the protection measures available for them both at an initial interview and when giving their testimony can have a positive impact on the quality of the statement they make. Providing a child with information can empower the child and allow him or her to feel more in control of an unfamiliar situation.INTERESELE PRIORITARE ALE COPILULUI, VICTIMĂ ŞI MARTOR AL INFRACŢIUNII Din momentul în care copilul interacţionează, pentru prima dată, cu sistemul de justiţie, acesta trebuie să fie informat pe deplin despre întregul proces pe care îl va parcurge, pentru a evita orice sentimente de nesiguranţă şi anxietate pe care le poate simţi. El trebuie să fie informat despre modalitatea de audiere, despre persoana care va realiza audierea; el trebuie să cunoască cum se desfăşoară întregul proces, care este procedura de a depune declaraţii, măsurile de protecţie ce sunt asigurate copilului – toate acestea pot avea o influenţă pozitivă asupra calităţii declaraţiilor făcute. Informarea copilului despre întregul proces îl va încuraja şi îi va permite să deţină controlul într-o situaţie mai puţin familiară.

  4. Pre-World War II Romania from Latvian Perspective: An Envoy's views

    Directory of Open Access Journals (Sweden)

    Ēriks Jēkabsons

    2011-08-01

    Full Text Available Abstract:The paper approaches the working environment and observations of Latvian envoy Ludvigs Ēķis in Romania from the autumn of 1939 when the Latvian Legation was opened in Bucharest until the summer of 1940 when the State of Latvia was liquidated. The main focus is on the Latvian-Romanian relations in this period of time, the Romanian foreign and economical policy and the reaction of Romanian statesmen and society to the events and processes of the first stage of World War: the policy of Soviet Union, Germany and Hungary, the Soviet-Finnish War and other conflicts in region and in Europe. The article is based on the materials stored in the State Archives of Latvia and particularly on Ludvigs Ekis’ reports. In a time when war was raging in Europe, Romania, too, was subject to considerable international pressure. Some similarities can be detected between the developments in this region and in the Baltic States.Rezumat:Lucrarea abordează mediul de lucru şi observaţiile ministrului leton în România Ludvigs Ēķis începând din toamna anului 1939, cand Legaţia letonă a fost deschisă la Bucureşti, până în vara anului 1940, când statul leton a fost lichidat. Lucrarea se va concentra în principal asupra relaţiilor letono-române în această perioadă de timp, asupra politicii externe şi a celei economice, a reacţiei oamenilor de stat şi a societăţii româneşti faţă de evenimente şi procese desfăşurate în prima etapă a primului război mondial: politicile Uniunii Sovietice, Germaniei şi Ungariei, Războiul sovieto-finlandez şi alte conflicte regionale şi europene. Articolul se bazează pe materiale păstrate în arhivele de stat din Letonia şi în special pe rapoartele lui Ludvigs Ēķis. Într-un moment în care războiul făcea ravagii în Europa, România a fost, de asemenea, supusă unor presiuni internaţionale considerabile. Unele similitudini pot fi detectate între evoluţiile din această regiune

  5. Insight into durum wheat Lpx-B1: a small gene family coding for the lipoxygenase responsible for carotenoid bleaching in mature grains

    Directory of Open Access Journals (Sweden)

    Cattivelli Luigi

    2010-11-01

    Full Text Available Abstract Background The yellow colour of pasta products is one of the main criteria used by consumers to assess pasta quality. This character is due to the presence of carotenoid pigments in semolina. During pasta processing, oxidative degradation of carotenoid pigments occurs mainly due to lipoxygenase (LOX. In durum wheat (Triticum durum Desf., two Lpx-1 genes have been identified on chromosome 4B, Lpx-B1.1 and Lpx-B1.2, and evidences have been reported that the deletion of Lpx-B1.1 is associated with a strong reduction in LOX activity in semolina. In the present study, we characterised the Lpx-B1 gene family identified in a durum wheat germplasm collection and related the distribution and expression of the Lpx-B1 genes and alleles to variations in LOX activity in the mature grains. Results In addition to the already known Lpx-B1.1 and Lpx-B1.2 genes, a new gene was identified, Lpx-B1.3, along with three different Lpx-B1.1 alleles, Lpx-B1.1a, Lpx-B1.1b and the partially deleted Lpx-B1.1c. Screening of the germplasm collection showed that all of the genotypes have one of the three Lpx-B1.1 alleles, associated with either Lpx-B1.2 or Lpx-B1.3, thus showing that in this collection the two genes are alternatives. Therefore, based on Lpx-B1 distribution, three different haplotypes were distinguished: haplotype I, carrying Lpx-B1.3 and the Lpx-B1.1b allele; haplotype II carrying Lpx-B1.2 and the Lpx-B1.1a allele; and haplotype III carrying Lpx-B1.2 and the Lpx-B1.1c allele. Determination of Lpx-B1 transcript abundance and total LOX activity in mature grains revealed differences among these three haplotypes: haplotypes I, II and III showed high, intermediate and low levels, respectively, of functional Lpx-B1 transcripts and enzymatic activity. Conclusions In this germplasm collection, the Lpx-B1 gene family accounts for most of the total LOX activity in the mature grains. Information on these Lpx-B1 haplotypes provides significant improvement for

  6. Changes of Root Hydraulic Conductivity and Root/Shoot Ratio of Durum Wheat and Barley in Relation to Nitrogen Availability and Mercury Exposure

    Directory of Open Access Journals (Sweden)

    Giovanna Angelino

    2011-02-01

    Full Text Available The aim of this research was to verify, on whole plant level and during all the plant cycle, the hypothesis that nitrogen deficiency reduces root hydraulic conductivity through the water channels (aquaporins activity, and that the plant reacts by changing root/shoot ratio. Root hydraulic conductivity, plant growth, root/shoot ratio and plant water status were assessed for durum wheat (Triticum durum Desf. and barley (Hordeum vulgare L., as influenced by nitrogen availability and HgCl2 treatment. On both species during the plant cycle, nitrogen deficiency induced lower root hydraulic conductivity (-49 and -66% respectively for barley and wheat and lower plant growth. On wheat was also observed cycle delay, lower plant nitrogen content, but not lower leaf turgor pressure and epidermic cell dimension. The lower plant growth was due to lower plant dimension and lower tillering. Root /shoot ratio was always higher for nitrogen stressed plants, whether on dry matter or on surface basis. This was due to lower effect of nitrogen stress on root growth than on shoot growth. On wheat HgCl2 treatment determined lower plant growth, and more than nitrogen stress, cycle delay and higher root/shoot ratio. The mercury, also, induced leaf rolling, lower turgor pressure, lower NAR, higher root cell wall lignification and lower epidermic cell number per surface unity. In nitrogen fertilized plants root hydraulic conductivity was always reduced by HgCl2 treatment (-61 and 38%, respectively for wheat and barley, but in nitrogen unfertilized plants this effect was observed only during the first plant stages. This effect was higher during shooting and caryopsis formation, lower during tillering. It is concluded that barley and durum wheat react to nitrogen deficiency and HgCl2 treatment by increasing the root/shoot ratio, to compensate water stress due to lower water root conductivity probably induced by lower aquaporin synthesis or inactivation. However, this

  7. Gleditsia species: An ethnomedical, phytochemical and pharmacological review.

    Science.gov (United States)

    Zhang, Jian-Ping; Tian, Xin-Hui; Yang, Yong-Xun; Liu, Qing-Xin; Wang, Qun; Chen, Li-Ping; Li, Hui-Liang; Zhang, Wei-Dong

    2016-02-03

    The plants in the genus Gleditsia, mainly distributed in central and Southeast Asia and North and South America, have been used as local and traditional medicines in many regions, especially in China, for the treatment of measles, indigestion, whooping, smallpox, arthrolithiasis, constipation, diarrhea, hematochezia, dysentery, carbuncle, etc. This present paper systemically reviews the miscellaneous information surrounding its traditional use, phytochemistry and pharmacology to provide opportunities and recommendations for the future research. The scientific literatures were systematically searched from scientific databases (PubMed, Scopus, Elsevier, SpringerLink, SciFinder, Google Scholar and others). In addition, the ethnopharmacological information on this genus was mainly acquired from Chinese and Korean herbal classics, and library catalogs. More than 60 compounds including triterpenes, sterols, flavonoids, alkaloids, phenolics and their derivatives were isolated from Gleditsia japonica Miq., Gleditsia sinensis Lam., Gleditsia caspica Desf. and Gleditsia triacanthos L. Among these compounds, triterpenoid saponins were the main constituents of Gleditsia species. Moreover, the crude extracts and purified molecules were tested, revealing diverse biological activities such as anti-tumor, anti-inflammatory, anti-allergic, anti-hyperlipidemic, analgesic, antimutagenic, antioxidant, anti-HIV, antibacterial, antifungal activities, etc. Among these biological studies, the possible mechanisms of antitumor action are stressed in this review, and these include causing cytotoxicity to cancer cells, inhibition of proliferation of cancer cells by affecting their growth, regeneration and apoptosis, inhibition of basic fibroblast growth factor (bFGF) and nitric oxide (NO), modulation of the oncogenic expression and telomerase activity results, inhibition of the expression of pro-angiogenic proteins, as well as down-regulation of intra/extracellular proangiogenic modulators

  8. Influence of Previous Crop on Durum Wheat Yield and Yield Stability in a Long-term Experiment

    Directory of Open Access Journals (Sweden)

    Anna Maria Stellacci

    2011-02-01

    Full Text Available Long-term experiments are leading indicators of sustainability and serve as an early warning system to detect problems that may compromise future productivity. So the stability of yield is an important parameter to be considered when judging the value of a cropping system relative to others. In a long-term rotation experiment set up in 1972 the influence of different crop sequences on the yields and on yield stability of durum wheat (Triticum durum Desf. was studied. The complete field experiment is a split-split plot in a randomized complete block design with two replications; the whole experiment considers three crop sequences: 1 three-year crop rotation: sugar-beet, wheat + catch crop, wheat; 2 one-year crop rotation: wheat + catch crop; 3 wheat continuous crop; the split treatments are two different crop residue managements; the split-split plot treatments are 18 different fertilization formulas. Each phase of every crop rotation occurred every year. In this paper only one crop residue management and only one fertilization treatment have been analized. Wheat crops in different rotations are coded as follows: F1: wheat after sugar-beet in three-year crop rotation; F2: wheat after wheat in three-year crop rotation; Fc+i: wheat in wheat + catch crop rotation; Fc: continuous wheat. The following two variables were analysed: grain yield and hectolitre weight. Repeated measures analyses of variance and stability analyses have been perfomed for the two variables. The stability analysis was conducted using: three variance methods, namely the coefficient of variability of Francis and Kannenberg, the ecovalence index of Wricke and the stability variance index of Shukla; the regression method of Eberhart and Russell; a method, proposed by Piepho, that computes the probability of one system outperforming another system. It has turned out that each of the stability methods used has enriched of information the simple variance analysis. The Piepho

  9. 一个迟发性非综合征型常染色体显性遗传性聋家系表型特征及致病基因初步探讨%A Preliminary Study of Phenotypic Characteristics and Causative Genes in a Family with Late-onset Nonsyndromic Autosomal Dominant Hereditary Hearing Loss

    Institute of Scientific and Technical Information of China (English)

    王鸿涵; 刘亚兰; 卢焰梅; 贺楚峰; 冯永; 王行炜; 梅凌云; 陈红胜; 蒋璐; 门美超; 张华; 李海波

    2012-01-01

    Objective To analyze the clinical phenotype of a pedigree with late - onset hereditary hearing loss, and investigate the disease- causing genes of this family. Methods The detailed medical history information of the participants in a large Hunan Province family with hereditary hearing loss were collected. Physical and augdio logical examination were administered.Two individuals were carried out Computed tomography (CT) scan of the temporal bone, The participants' inrormation was sorted, out and the geoalogica tree map was charted. Alter revie wiog the literature, we speculated oo geoes that could lead to desfness sccordiog to pheootype of this family. Some candidate geoes codiog regioo were amplified by polymerase chain reaction (PCR) using geocmic DNA which was extracted from the proband's peripheral blood. PCR products were purified by exopeptidase. Ao ABI 3730XL geoetic soslyzer was used for direct sequeociog, and data was analyzed usiog DNASTAR-Lasergeoe SeqMan Pro software. Results The family tree showed that this was 30 autosomal domioant non-syodromic deafoess pedigree. Clioical fea tures were remarkably similar amoog subjects. All of them were operated oo for "buzz-like" tinnitus between 9 and 25 years old, and then for bilateral hearing loss. Pure tone audiometry examination showed the hearing loss be gan at the higher frequencies,then the lower frequencies with the aggravation of hearing loss. Conclusion Pedigree analysis suggested this family conformed to the characteristics of autosomal dominant hereditary pattern. The causa tive gene of this family needs more exploration.%目的 分析一个迟发性遗传性聋大家系的临床表型,探讨该家系耳聋患者的致病基因.方法 对一个湖南籍耳聋大家系成员进行详细的病史资料采集、体格检查、听力学检查,其中两名患者做了颞骨CT检查.绘制家系图.以先证者外周血基因组DNA为模板对候选致病基因进行涵盖全部编码序列聚

  10. SPECIFICUL ACTIVITĂŢII SPECIALE DE INVESTIGAŢIE ŞI ACŢIUNII DE URMĂRIRE PENALĂ ÎNTREPRINSE PENTRU ADMINISTRAREA PROBELOR LA CERCETAREA CRIMELOR CIBERNETICE

    Directory of Open Access Journals (Sweden)

    Svetlana PURICI

    2016-03-01

    Full Text Available Importanţa investigării „criminalităţii informatice” este dictată nu doar de progresul tehnic, dar în special de prezenta bază normativă în reglementările internaţionale şi în legile naţionale ale Republicii Moldova, precum: Legea cu privire la informatică, Legea privind accesul la informaţie etc., reguli ce trebuie aplicate şi care se vor reflecta în viaţa noastră, în special în procesul de apărare a drepturilor în judecată – moment în care importanţa şi influenţa „investigării crimina­lităţii cibernetice” este remarcată în procesul penal. Forma electronică a remiterii informaţiilor favorizează posibilitatea interceptării la distanţă a informaţiilor fără un oarecare transfer vizual al obiectelor materiale. Între activitatea specială de investigaţie în cadrul investigării crimelor cibernetice şi procesul penal există o legătură reciprocă, menirea primei fiind contribuţia nemijlocită la buna desfăşurare a procesului penal, prin cercetarea obiectivă, imparţială şi multilaterală a faptelor pasibile de pedeapsă penală, astfel asigurându-se aplicarea echitabilă a justiţiei. THE SPECIFICITY OF SPECIAL INVESTIGATIVE ACTIVITIES AND PROSECUTION ACTIONS TAKEN FOR THE ADMINISTRATION OF EVIDENCE ON RESEARCH OF CYBERCRIMESThe interest of the “cybercrime investigations” is given not only by the results of the technical progress, but especially by the existent, normative ground in the internaţional and especially national laws in Republic of Moldova, such as: The Law on informatics, The Law on access to information etc., rules that have to be applied and that will have effect on our life, in particular in the stage of defending the rights in the judicial way – the moment where the importance and the influence of “cybercrime investigations” in the penal procedural law is remarked. Electronic form of the information submission promotes distinctly to a possibility of distant

  11. ISTEMUL INFRACTIUNILOR ECONOMICE ÎN REPUBLICA MOLDOVA Noţiuni generale privind infracţiunile economice

    Directory of Open Access Journals (Sweden)

    Isabela Monalisa SAMSON

    2015-11-01

    Full Text Available „Este o axiomă faptul că activitatea criminală din domeniul afacerilor economico-financiare nu se desfăşoară şi nici nu se finalizează la vedere. Peste tot în lume se produce o sumă impresionantă de acte ilegale, de combinaţii infracţionale în zona subterană a societăţii, zonă în care serviciile de informaţii şi autorităţile de aplicare a legii pătrund cu mare difi-cultate pentru a sesiza şi a cerceta cu adevărat ce se întâmplă” [5, p.7]. Articolul 126 din Constituţie, caracterizând economia Republicii Moldova ca o economie de piaţă, are în vedere economia naţională. În acelaşi context reglementar este statuat că statul trebuie să asigure, printre altele: libertatea co-merţului şi activităţii de întreprinzător; protecţia concurenţei loiale; crearea unui cadru favorabil valorificării tuturor factorilor de producţie; protejarea intereselor naţionale în activitatea economică, financiară şi valutară etc.[4]. Aşadar, conceptul de economie naţională a Republicii Moldova este o categorie economică fundamentală, care desemnează ansamblul de resurse naturale şi umane, de activităţi productive, de schimb şi servicii, constituite ca ramuri sau domenii de activitate economică pe teritoriul Republicii Moldova, ca rezultat al dezvoltării forţelor de producţie şi al diviziunii sociale a muncii, în cadrul frontierelor ţării.SYSTEM ECONOMIC CRIMES IN MOLDOVA General terms of economic crime"It is an axiom that work Criminal economic and financial affairs not take place nor ends in view. Across the world produces an impressive amount of illegal acts, the combinations criminal underground in the company area the intelligence and enforcement authorities Law penetrate with great difficulty to apprehend and investigate really what is happening" [5, p.7]. Article 126 of the Constitution, characterizing the Moldovan economy as a market economy, the national economy envisages the same

  12. UNELE PRECIZĂRI PRIVIND IMPRUDENŢA ÎN CAUZELE CU PRIVIRE LA LIPSIREA DE VIAŢĂ: STUDIU DE DREPT PENAL COMPARAT

    Directory of Open Access Journals (Sweden)

    Vladislav MANEA

    2016-03-01

    Full Text Available În acest articol autorii scot în evidenţă aspectele generale şi particularităţile infracţiunilor contra vieţii săvârşite din imprudenţă. Unei analize minuţioase este supusă problema imprudenţei în legislaţiile străine; de asemenea, imprudenţa, este tratată şi sub aspectul atitudinii mentale a făptuitorului faţă de infracţiune la momentul săvârşirii acesteia. Actua­li­tatea temei investigate este determinată de progresele tehnologice şi ştiinţifice din care societatea umană are numai de câştigat, fapt ce poate fi observat prin metodele de tratament al unor maladii sau stări patologice; prin modul şi tehnicile de desfăşurare a muncii sau chiar prin simpla deservire efectuată de anumiţi subiecţi (fiind utilizate gadgeturi, drone etc., de unde pornesc nu doar aspectele pozitive, dar şi cele negative care se manifestă prin infracţiune. A fost analizată literatura juridică de specialitate din Republica Moldova, România şi din Federaţia Rusă, de asemenea şi practica judi­ciară în domeniu. Totodată, sunt formulate concluzii şi recomandări menite să contribuie la o mai bună înţelegere a circumstanţei „lipsire de viaţă din imprudenţă”.Some explanations regarding the imprudence in the cases concerning manslaughter: study of the comparative criminal law This article is intended to highlight the general and particularities aspects of criminal offence of the negligent manslaughter in accordance with the legislation of the foreign countries, also this study is intended to analyze the imprudent manslaughter, in another aspect, namely the mental attitude of the perpetrator at the time the crime was committed. The novelty of the investigation can be expressed in the fact that there are taking into account the scientific and technological advancement of human society, method and techniques of conducting maintenance work or simply being used by certain subjects gadgets, drones, etc. from

  13. Climate Change and Projected Impacts in Agriculture: an Example on Mediterranean Crops

    Science.gov (United States)

    Ferrise, R.; Moriondo, M.; Bindi, M.

    2009-04-01

    Recently, the availability of multi-model ensemble prediction methods has permitted the assignment of likelihoods to future climate projections. This allowed moving from the scenario-based approach to the risk-based approach in assessing the effects of climate change, thus providing more useful information for decision-makers that, as reported by Schneider (2001), need probability estimates to assess the seriousness of the projected impacts. The probabilistic approach to evaluate crop response to climate change mainly consists in applying an impact model (such as crop growth model) to a very large number of climate projections so to provide a probabilistic distribution of the variable selected to evaluate the impact. By comparing the outputs of the multi-simulation with a critical threshold (such as minimum yield below which it is not admissible to fall), it is possible to evaluate the risk related to future climate conditions. Unfortunately, such an approach is a time-consuming process due to the large number of model runs needed for such a procedure. An alternative method relies on the set up of impact response surfaces (RS) with respect to key climatic variables on which a probabilistic representation of projected changes in the same climatic variables may be overlaid (Fronzek et al. 2008). This approach was exploited within the ENSEMBLES EU Project aiming at assessing climate change impact on typical Mediterranean crops. This work presents the results of the project with a particular concerning about the assessment of risk, of durum wheat (T. turgidum L. subsp. durum (Desf.) Husn) and grapevine (Vitis vinifera L.) yield falling below fixed thresholds, using probabilistic information about future climate. Methodology The simple mechanistic crop growth models, SIRIUS Quality (Jamieson et al., 1998) and VITE-model (Bindi et al., 1997a,b), were selected to respectively simulate durum wheat and grapevine yields in present and future scenarios. SIRIUS Quality is a

  14. AMENINȚAREA SAU VIOLENȚA SĂVÂRȘITĂ ASUPRA UNEI PERSOANE CU FUNCȚIE DE RĂSPUNDERE SAU A UNEI PERSOANE CARE ÎȘI ÎNDEPLINEȘTE DATORIA OBȘTEASCĂ (art.349 DIN CODUL PENAL: ANALIZĂ DE DREPT PENAL

    Directory of Open Access Journals (Sweden)

    Vitalie STATI

    2017-07-01

    Full Text Available Obiectul studiului de față îl formează elementele constitutive și circumstanțele agravante ale infracțiunilor specificate la art.349 CP RM. În rezultatul analizei efectuate, se stabilește că obiectul juridic special al acestor infracţiuni are un caracter multiplu. Se relevă că victimă a infracţiunilor prevăzute la art.349 CP RM este, după caz: a persoana cu funcţie de răs­pundere; b persoana care îşi îndeplineşte datoria obştească; c ruda apropiată a persoanei cu funcţie de răspundere sau a persoanei care îşi îndeplineşte datoria obştească. Se arată că, în cazul infracţiunilor specificate la art.349 CP RM, legătura dintre comiterea infrac­ţiunii şi activitatea de serviciu sau obştească a victimei are un caracter obligatoriu. De fiecare dată, la calificare, urmează să se verifice dacă au fost încălcate sau nu regle­mentările care stabilesc condiţiile şi limitele îndeplinirii de către victimă a obligaţiilor de serviciu sau obşteşti. Doar în lipsa unor asemenea încălcări poate fi aplicat art.349 CP RM. Se ajunge la concluzia că art.349 CP RM nu poate fi aplicat în cazul în care, la momentul comiterii infrac­ţiu­nii, făptuitorul nu-şi dădea seama că: a săvârşeşte infracţiunea asupra unei persoane cu funcţie de răspundere care îşi desfăşoară activitatea în cadrul unei autorităţi publice, a unei persoane care îşi îndeplineşte datoria obştească sau a unei rude apropiate a acestora; b infracţiunea pe care o săvârşeşte are legătură cu i activitatea de serviciu a persoanei cu funcţie de răspundere care îşi desfăşoară activitatea în cadrul unei autorităţi publice sau cu ii activitatea obştească a persoanei care îşi îndeplineşte datoria obştească. Se argumentează că răzbunarea în legătură cu îndeplinirea de către victimă a datoriei obşteşti poate deter­mina comiterea infracţiunilor prevăzute la art.349 CP RM. Totodată, r

  15. CONSIDERAȚII TEORETICE ȘI PRACTICE PRIVIND INFRACȚIUNILE DE PRACTICARE ILEGALĂ A ACTIVITĂȚII DE ÎNTREPRINZĂTOR (art.241 DIN CODUL PENAL

    Directory of Open Access Journals (Sweden)

    Vitalie STATI

    2017-07-01

    Full Text Available În prezentul studiu analizei sunt supuse temeiul real şi temeiul juridic ale răspunderii penale pentru faptele incriminate la art.241 CP RM. Sunt stabilite caracteristicile obiectului juridic şi ale obiectului imaterial în cazul infracţiunilor pre­văzute la art.241 CP RM. Se arată că noţiunea „activitate de întreprinzător”, utilizată în art.241 CP RM, are acelaşi înţeles ca şi noţiunea „activitate de întreprinzător” folosită în art.1 al Legii cu privire la antre­pre­no­riat şi întreprinderi. Se relevă forma şi conţinutul faptei prejudiciabile specificate la art.241 CP RM, prin prisma prevederilor de la lit.a-d art.125 CP RM. Se argumentează că calificarea desfăşurării activităţii de întreprinzător fără licenţă în baza art.241 CP RM (coroborat cu lit.b art.125 CP RM ar însemna nu altceva decât aplicarea prin analogie a legii penale, interzisă de alin.(2 art.3 CP RM. Sunt profilate particularităţile ce caracterizează consumarea infracţiunilor prevăzute la art.241 CP RM. Se stabileşte că scopul infracţiunilor prevăzute la art.241 CP RM este cel de asigurare a unei surse perma­nente de venituri. Sunt relevate ipotezele în care subiectul infracţiunilor prevăzute la art.241 CP RM are o calitate specială. Nu în ultimul rând, sunt elucidate criteriile de delimitare a infracţiunilor specificate la art.241 CP RM de infrac­ţiunile prevăzute la art.190, 2411, 244, 2441 şi altele din Codul penal.SOME THEORETICAL AND PRACTICAL CONSIDERATIONS WITH REGARD TO THE OFFENCE OF ILLEGAL PRACTICE OF ENTREPRENEURIAL ACTIVITY (art.241 OF THE PENAL CODEIn this study there are analyzed both the factual basis and the legal basis of the penal liability for the offences crimi­nalized in art.241 PCRM.There are also established the features of the legal object and the immaterial object of the offenses referred to at art.241 PCRM.It is argued that the concept of "entrepreneurial activity", applied in

  16. Wheat production and wheat rust management in Canada%加拿大小麦生产和锈病防治

    Institute of Scientific and Technical Information of China (English)

    Allen G. Xue; Dawn T. Chi; 张淑珍; 李卓夫; 徐鹏飞; 姜良宇; 范素杰; 王欣

    2012-01-01

    Wheat is Canada's largest crop with most of the production in the western Canadian Prairie Provinces of Manitoba, Saskatchewan and Alberta. There were approximately ten million hm2 seeded to wheat in Canada, including seven million hm2 of hexaploid spring wheat (Triticum aestivum L), two million hm2 of durum wheat (T. Turgkjum L ssp. Durum (Desf.) Husn.), and one million hm2 of winter wheat (T. Aestivum). Within hexaploid wheat there has been diversification into a number of market classes based on differentend-use quality criteria. The predominant spring bread wheat class has been the Canada Western Red Spring (CWRS) class. Historically, the disease of major concern in wheat was stem rust, caused by Pucdnia graminis f. Sp. Tritid. The first significant stem rust resistant cuttivar in Canada was Thatcher, grown extensively from 1939 until the early 1970s. Thatcher, however, was very susceptible to leaf rust, caused by Pucdnia triticina. Over the years, improved resistance to both stem and leaf rust was achieved with the release of cultivars with additional genes for resistance, primarily Sr2, Sr6, Sr7a, Sr9b, Lr13, Lr14a, Lr16, and Lr34. The genetic resistance has adequately controlled stem rust but leaf rust continues to cause significant losses, partially due to changes in the P. Triticina population which reduced the effectiveness of resistance genes such as Lr13 and Lr16. Stripe rust on wheat, caused by Pucdnia striiformis f. Sp. Tritid, was historically a problem under irrigation in southern Alberta, but since 2000 it has been found annually in the central Canadian prairies and southern Ontario. The genetic basis of resistance to stripe rust in most Canadian wheat cultivars has not been determined, although VTI8 provides partial resistance in many cultivars. In the future, other rust diseases such as wheat stripe rust, or highly virulent new pathotypes of current rust pathogens, such as P. Graminis f. Sp. Tritid race Ug-99, may pose new threats to cereal

  17. METODA ÎNVĂŢĂRII ÎN BAZĂ DE PROBLEMĂ – ELEMENT ESENŢIAL ÎN FORMAREA GÂNDIRII CRITICE A VIITORULUI SPECIALIST ÎN DOMENIUL SOCIOUMAN

    Directory of Open Access Journals (Sweden)

    Angela LISNIC

    2016-12-01

    Full Text Available Scopul acestei lucrări rezidă în justificarea susţinerii şi efectivităţii metodei de învăţare în bază de problemă pentru formarea gândirii critice ca o competenţă esenţială a unui viitor specialist în sfera ştiinţelor socioumane. Ce reprezintă studiul în bază de problemă? El exprimă un mod de gândire şi acţiuni practice în procesul de însuşire a materialului de studiu. În această privinţă, învăţătorul renunţă să prezinte cunoştinţa ca un „product” şi se focusează pe modelul „cunoaşterii în desfăşurare”. Studiul în bază de problemă permite învăţarea prin descoperirea noilor cunoştinţe în condiţiile procesului personal de gândire. Înlocuind lectura informativă cu studiul activ, învăţătorul se focusează pe felul de gândire al studentului, încadrându-l în soluţionarea problemelor. Ele au rolul de stimulare a studentului pentru căutarea căilor şi instrumentelor de rezolvare a acestora, devenind în acest fel o nouă metodă de obţinere a cunoştinţe­lor. În general, problema este o incertitudine ce necesită a fi soluţionată. Metoda de studiu în bază de problemă presu­pune soluţionarea unui impas (a unei situaţii incerte prin utilizarea cunoştinţelor studentului, derivate din acţiunile practice, perfecţionând astfel informaţia asimilată printr-o cale creativă. Această metodă permite să genereze cunoştinţe noi şi să descopere personalitatea viitorului specialist prin identificarea şi dezvoltarea abilităţilor lui.METHOD OF THE PROBLEM BASED LEARING – AN ESSENTIAL ELEMENT IN THE FORMATION OF THE CRITICAL THINKING OF A FUTURE SPECIALIST IN THE SOCIAL-HUMAN SPHEREResearch goal this paper is reasoning the sustainability and effectiveness of the problem-based learning in critical thinking formation as a basic competence for the future specialist in social- human sphere. What is problem – based learning? This is a thinking and practical

  18. Use of local pastoral species to increase fodder production of the saline rangelands in southern Tunisia

    Science.gov (United States)

    Tlili, Abderrazak; Tarhouni, Mohamed; Cardà, Artemi; Neffati, Mohamed

    2017-04-01

    Climate changes associated with multiple destructive human activities accelerate the degradation process of the natural rangelands around the world and especially the vulnerable areas such as the dryland ecosystems (Anaya-Romero et al., 2015; Eskandari et al., 2016; Muños Rojas et al., 2016; Vicente-Serrano et al., 2016). The vegetation cover and the biomass production of these ecosystems are decreasing and this is resulting in land degradation due to the soil erosion and changes in soil quality due to the abuse and misuse of the soil resources (Cerdà et al., 2016; Prosdocimi et al., 2016; Keesstra et al., 2016). To cope with such threats, it is necessary to develop some management techniques (restoration, plantation…) to enhance the biomass production and the carbon sequestration of the degraded rangelands (Muñoz-Rojas et al., 2016; Tarhouni et al., 2016). The valorization of saline water by planting pastoral halophyte species in salt-affected soils as well as the marginal areas are considered among the valuable tools to increase the rangeland production in dry areas. In this work, the ability of four plants (Atriplex halimus L. (Amaranthaceae), Atriplex mollis Desf. (Amaranthaceae), Lotus creticus L. (Fabaceae) and Cenchrus ciliaris L. (Poaceae)) to grow and to produce are tested under a field saline conditions (water and soil). Non-destructive method (Vegmeasure) is used to estimate the biomass production of these species. Chemical (crude protein, moisture and ash contents) and biochemical analyses (sugars, tannins and polyphenols contents) are also undertaken. Two years after plantation, the obtained results showed the ability of the four species to survive and to grow under high salinity degree. A strong positive correlation was obtained between the canopy cover and the dry biomass of the four studied species. Hence, the restoration of saline soils can be ensured by planting local halophytes. Acknowledgements. The research leading to these results has

  19. UTILIZAREA TEHNOLOGIILOR INFORMAŢIONALE ŞI COMUNICAŢIONALE LA ORELE DE ISTORIE

    Directory of Open Access Journals (Sweden)

    Natalia ŢURCANU

    2017-07-01

    Full Text Available Comunicarea face referire la integrarea mijloacelor, tehnologiilor informaţionale şi comunicaţionale (TIC în cadrul procesului de formare a competenţelor specifice la istorie, ca practică de succes în activitatea mea ca profesor de istorie şi educaţie civică. Drept argument pentru această preocupare este Recomandarea Consiliului Europei cu privire la pre­darea istoriei în secolul XXI, despre creşterea accesului tinerilor la tehnologiile informaţionale şi comuni­ca­ţionale atât la şcoală, cât şi în afara orelor de curs, despre necesitatea formării unui individ competitiv în societatea informaţională. În acest scop, pentru desfăşurarea orelor de istorie, profesorul dispune de mijloace TIC, cu ajutorul cărora realizează şi valorifică o bancă informţională ce conţine resurse didactice integrate în cadrul situaţiilor didactice şi ele­mentelor de conţinut disciplinar.S-a constatat, în urma unor evaluări şi sondaje, că utilizarea materialelor multimedia la ora de istorie a dus la obţine­rea unor câştiguri educaţionale: sunt consolidate abilităţile de cercetare şi capacităţile intelectuale, sporesc cunoştinţele şi abilităţile în utilizarea tehnologiei informaţiei, creşte interesul şi angajarea elevilor în procesul educaţional.Se menţionează existenţa unor limite ale posibilităţilor de utilizare TIC ce nu pot fi depăşite decât prin menţinerea unui rol important al profesorului în achiziţia, prelucrarea şi utilizarea informaţiilor, în acţiunea de formare a deprinde­rilor şi abilităţilor practice. De aceea, interesul acordat dezvoltării competenţei tehnologice depăşeşte etapa instruirii iniţiale în profesie şi se inserează pe parcursul întregii cariere didactice, necesitând o redefinire continuă a obiectivelor formării.THE INTEGRATION OF THE INFORMATIONAL AND COMMUNICATION TECHNOLOGIES DURING THE HISTORY LESSONSThe Communication that Natalia

  20. ASPECTE DIN ISTORIA CIRCULAŢIEI MONETARE ÎN GALAŢI ÎN SECOLUL AL XIX-LEA. MATERIALE DIN ARHIVELE MINISTERULUI DE EXTERNE AL FRANŢEI

    Directory of Open Access Journals (Sweden)

    Elena ARCUŞ-JANTOVAN

    2015-11-01

    Full Text Available Amplasarea geografică a Galaţiului a jucat un rol foarte important în realizarea şi dezvoltarea legăturilor economice nu doar la nivel naţional, ci şi internaţional. Din acest considerent, încă din secolul al XVIII-lea prin Galaţi avea să se realizeze o mare parte din comerţul de la Dunărea de Jos. După semnarea tratatului de la Adrianopol comerţul cunoaşte o mai mare dezvoltare, mai evidentă din 1837, când Galaţiul este declarat port liber. Respectiv, analizând cum se desfă-şura comerţul în acest oraş, în care se aduceau mărfuri din multe părţi ale lumii, se poate observa foarte clar şi tipurile de monede care erau utilizate în comerţ, luând în considerare instabilitatea monetară care se menţinea în secolul al XIX-lea până în 1867, când are loc reforma monetară şi leul devine monedă naţională. Prin Galaţi operaţiile comerciale se efectuau foarte intens în secolul al XVIII-lea. Călătorii străini (Anthoine Antoine-Ignace de Saint-Joseph, W.Chzanovski etc. oferă o seamă de informaţii importante în acest sens. Piastrul şi paraua serveau ca monede de calcul. În arhiva diplomatică a Ministerului Afacerilor Externe din Paris se păstrează fonduri ce conţin corespondenţa comercială cu oraşul Galaţi, din care putem desprinde ce tipuri de monede erau utilizate în exprimarea valorii mărfurilor, fiindcă preţul era exprimat atât în unităţi franceze, cât şi străine. Astfel, când se reglementau preţurile, acestea erau exprimate în piaştri, florini, franci, livre etc. Ceea ce denotă, pe de o parte, complexitatea şi caracterul constant al legăturilor comerciale, iar, pe de altă parte, greutăţile întâmpinate de locuitori la procurarea mărfurilor în urma tuturor schimbărilor din circulaţia mone-tară, căci în aşa circumstanţe speculaţiile erau uşor de realizat. Deci, analizând circulaţia monetară din Galaţi, se poate de înţeles care era situaţia generală a

  1. IMPLICAŢIILE JURIDICO-PENALE ALE ADOPTĂRII LEGII NR.133/2016 ŞI A LEGII NR.134/2016

    Directory of Open Access Journals (Sweden)

    Sergiu BRÎNZA

    2017-01-01

    Full Text Available Obiectul investigaţiei de faţă îl constituie implicaţiile juridico-penale ale adoptării Legii nr.133/2016 şi a Legii nr.134/2016. Se stabileşte că obiectul juridic special al infracţiunii prevăzute la alin.(3 art.3301 CP RM îl constituie relaţiile sociale cu privire la buna desfăşurare a activităţii de serviciu în sfera publică, care implică inviolabilitatea se­cre­tului informaţiilor din declaraţiile de avere şi interese personale. Se arată că obiectul imaterial al infracţiunii prevă­zute la alin.(3 art.3301 CP RM îl reprezintă informaţiile din declaraţiile de avere şi interese personale, informaţii deve­nite cunoscute în procesul îndeplinirii atribuţiilor de serviciu sau al exercitării controlului. Se argumentează că victimă a acestei infracţiuni este persoana care are una dintre următoarele calităţi speciale: 1 subiect al declarării (inclusiv subiect al declarării, care este ofiţer de informaţii şi securitate sau ofiţer de investigaţii din cadrul unei subdiviziuni cu misiuni speciale a Ministerului Afacerilor Interne, a Ministerului Apărării, a Autorităţii Naţionale Anticorupţie, a Serviciului de Informaţii şi Securitate, a Serviciului de Protecţie şi Pază de Stat, a Departamentului instituţiilor penitenciare al Mini­ste­rului Justiţiei ori a Serviciului Vamal; 2 membru al familiei subiectului declarării; 3 concubin/concubină al/a subiectului declarării. Sunt analizate modalităţile normative alternative ale acţiunii prejudiciabile specificate la alin.(3 art.3301 CP RM: 1 divulgare; 2 publicare. Se arată că subiectul infracţiunii specificate la alin.(3 art.3301 CP RM trebuie să aibă una dintre următoarele calităţi speciale: 1 persoană responsabilă de colectarea declaraţiilor de avere şi interese personale, desemnată de conducătorul uneia dintre organizaţiile publice în care activează persoanele care, în confor­mi­tate cu Legea nr.133/2016, au obliga