Radioactive air emissions notice of construction 241-ER-311 catch tank
International Nuclear Information System (INIS)
HILL, J.S.
1999-01-01
The following description, attachments and references are provided to the Washington State Department of Health (WDOH), Division of Radiation Protection, Air Emissions and Defense Waste Section as a notice of construction (NOC) in accordance with the Washington Administrative Code (WAC) 246-247, Radiation Protection - Air Emissions. The WAC 246-247-060, ''Applications, registration and licensing,'' states ''This section describes the information requirements for approval to construct, modify, and operate an emission unit. Any NOC requires the submittal of the information listed in Appendix A,'' Appendix A (WAC 246-247-110) lists the requirements that must be addressed. Additionally, the following description, attachments and references are provided to the U.S. Environmental Protection Agency (EPA) as an NOC, in accordance with Title 40, Code of Federal Regulations (CFR), Part 6 1, ''National Emission Standards for Hazardous Air Pollutants.'' The information required for submittal to the EPA is specified in 40 CFR 61.07. The potential emissions from this activity are estimated to provide less than 0.1 millirem/year total effective dose equivalent (TEDE) to the hypothetical offsite maximally exposed individual (MEI), and commencement is needed within a short time frame. Therefore, this application is also intended to provide notification of the anticipated date of initial startup in accordance with the requirement listed in 40 CFR 61.09(a)(l), and it is requested that approval of this application will also constitute EPA acceptance of this 40 CFR 61.09(a)(l) notification. Written notification of the actual date of initial startup, in accordance with the requirement listed in 40 CFR 61.09(a)(2) will be provided later
23 CFR 710.311 - Construction advertising.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction advertising. 710.311 Section 710.311...-WAY AND REAL ESTATE Project Development § 710.311 Construction advertising. The State must manage real... advertising for construction, the State shall develop ROW availability statements and certifications related...
Protective and Catching Safety Systems In Construction
Directory of Open Access Journals (Sweden)
Kuzhin Marat
2017-01-01
Full Text Available In the article is described application of protective and catching systems in construction. Classification of similar systems, their types and purpose are listed. Dangerous zones on construction site and events to for limiting their influence or protection from the factors. Protective and catching systems is one of the most effective technical equipment, applied in recent time. Protective fences and catching systems are important part in the problem solution. Protective fences protect workers from falling from height. Protective and catching systems allows avoid injuries by workers, also catch debris, fallen from constructing buildings. In regard with continuing development in technical and technological solutions, protective and catching systems require adaptation to a new requirements of construction industry and requirements of normative documents. Technical regulations in the appliance sphere of protective and catching systems requires actualization and aligning with modern normatives. Important role should be given to developing organizational and technological documentation for application of the systems. Scientific studying of technical parameters of fences and protective catching nets also has great interest.
241-SY Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.
2013-07-25
This report provides the results of an extent of condition construction history review for tanks 241-SY-101, 241-SY-102, and 241-SY-103. The construction history of the 241-SY tank farm has been reviewed to identify issues similar to those experienced during tank 241-AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank 241-AY-102 as the comparison benchmark. In the 241-SY tank farm, the third DST farm constructed, refractory quality and stress relief were improved, while similar tank and liner fabrication issues remained.
241-AY-101 Tank Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Gunter, Jason R.
2013-08-26
This report provides the results of an extent of condition construction history review for tank 241-AY-101. The construction history of tank 241-AY-101 has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In tank 241-AY-101, the second double-shell tank constructed, similar issues as those with tank 241-AY-102 construction reoccurred. The overall extent of similary and affect on tank 241-AY-101 integrity is described herein.
241-AW Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Gunter, Jason R.; Reeploeg, Gretchen E.
2013-11-19
This report provides the results of an extent of condition construction history review for the 241-AW tank farm. The construction history of the 241-AW tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AW tank farm, the fourth double-shell tank farm constructed, similar issues as those with tank 241-AY-102 construction occured. The overall extent of similary and affect on 241-AW tank farm integrity is described herein.
241-AZ Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.
2013-07-30
This report provides the results of an extent of condition construction history review for tanks 241-AZ-101 and 241-AZ-102. The construction history of the 241-AZ tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AZ tank farm, the second DST farm constructed, both refractory quality and tank and liner fabrication were improved.
International Nuclear Information System (INIS)
HILL, J.S.
2000-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61.07, for the installation and operation of one waste retrieval system in each of the following tanks; 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107. Pursuant to 40 CFR 61.09 (aXI), this application is also intended to provide anticipated initial start-up notification. It is requested that EPA approval of this application will also constitute EPA acceptance of the initial start-up notification. This NOC covers the installation and operation o f a waste retrieval system in tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107, and the 241-AN-A/-B Valve Pits. Generally, this includes removal of existing equipment, installation of new equipment, and construction of new ancillary equipment and buildings between now and the year2011. Tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107 will provide waste feed for immobilization into a low activity waste (LAW) product
46 CFR 169.311 - Fire protection.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Fire protection. 169.311 Section 169.311 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS Construction and Arrangement Hull Structure § 169.311 Fire protection. (a) The general construction of the vessel...
Energy Technology Data Exchange (ETDEWEB)
DEXTER, M.L.
1999-11-15
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year.
International Nuclear Information System (INIS)
DEXTER, M.L.
1999-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year
Operability test procedure [Tank] 241-SY-101 equipment removal system
International Nuclear Information System (INIS)
Mast, J.C.
1994-01-01
The 241-SY-101 equipment removal system (ERS) consists of components, equipment, instrumentation and procedures that will provide the means to disconnect, retrieve, contain, load and transport the Mitigation Pump Assembly (MPA) from waste Tank 241-SY-101 to the Central Waste Complex (CWC). The Operability Test Procedure (OTP) will test the interfaces between ERS components and will rehearse the procedure for MPA removal and transportation to the extent they can be mocked-up at the CTF (Cold Test Facility). At the conclusion of the OTP, the ERS components and equipment will be removed from the CTF, entered into the Component Based Recall System (CBRS), and stored until needed for actual MPA removal and transportation
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
International Nuclear Information System (INIS)
Hays, C.B.
1998-01-01
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
Energy Technology Data Exchange (ETDEWEB)
Hays, C.B.
1998-01-28
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Visual aids. 108.241 Section 108.241 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.241 Visual aids. (a) Each helicopter deck must— (1...
Energy Technology Data Exchange (ETDEWEB)
WYRWAS RB; DUNCAN JB
2008-11-20
This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.
Measuring the Digital Divide with PingER
Energy Technology Data Exchange (ETDEWEB)
Cottrell, L.
2003-10-01
We introduce the PingER project/toolkit and show its relevance to monitoring sites in developing countries. We then show results from PingER that illustrate the extent of the Digital Divide in terms of Internet performance between developed and developing regions, which developing regions are catching up, keeping up, or falling behind and the magnitude of the differences in performance between developed regions and developing regions.
Quantifying commercial catch and effort of monkfish Lophius ...
African Journals Online (AJOL)
Catch-per-unit-effort (cpue) data of vessels targeting monkfish and sole (the two ... analysed using two different methods to construct indices of abundance. ... in Namibia to all tail-weight classes is not appropriate for the current fishery and needs ... Keywords: catch per unit effort, Generalized Linear Model, Lophius vaillanti, ...
Improved MOX fuel calculations using new Pu-239, Am-241 and Pu-240 evaluations
International Nuclear Information System (INIS)
Noguere, G.; Bouland, O.; Bernard, D.; Leconte, P.; Blaise, P.; Peneliau, Y.; Vidal, J.F.; Saint Jean, C. de; Leal, L.; Schilleebeeckx, P.; Kopecky, S.; Lampoudis, C.
2013-01-01
Several studies based on the JEFF-3.1.1 nuclear data library show a systematic over-estimation of the critical keff for core configurations of MOX fuel assemblies. The present work investigates possible improvements of the C/E results by using new evaluations for Am-241, Pu-239 and Pu-240. The work reported in this paper demonstrates the performances of the new Am-241 evaluation based on capture and transmission data measured at the IRMM. For Pu-239, the new evaluation, established in the frame of the WPEC/SG-34, is able to explain a systematic discrepancy observed between different EOLE experiments. The combination of the Am-241 and Pu-239 evaluations demonstrates the necessity to improve the radiation width of the first resonance of Pu-240
Catch tanks inhibitor addition 200-East and 200-West Areas
International Nuclear Information System (INIS)
Palit, A.N.
1996-01-01
Reported is the study of 11 catch tanks in the 200-East Area and the 7 catch tanks in the 200-West Area listed as active. The location, capacity, material of construction, annual total accumulation, annual rain intrusion, waste transfer rate, and access for chemical injection in these tanks are documented. The present and future utilization and isolation plans for the catch tanks are established
241-AZ-101 pump removal trough analysis
International Nuclear Information System (INIS)
Coverdell, B.L.
1995-01-01
As part of the current Hanford mission of environmental cleanup, various long length equipment must be removed from highly radioactive waste tanks. The removal of equipment will utilize portions of the Equipment Removal System for Project W320 (ERS-W320), specifically the 50 ton hydraulic trailer system. Because the ERS-W320 system was designed to accommodate much heavier equipment it is adequate to support the dead weight of the trough, carriage and related equipment for 241AZ101 pump removal project. However, the ERS-W320 components when combined with the trough and its' related components must also be analyzed for overturning due to wind loads. Two troughs were designed, one for the 20 in. diameter carriage and one for the 36 in. diameter carriage. A proposed 52 in. trough was not designed and, therefore is not included in this document. In order to fit in the ERS-W320 strongback the troughs were design with the same widths. Structurally, the only difference between the two troughs is that more material was removed from the stiffener plates on the 36 in trough. The reduction in stiffener plate material reduces the allowable load. Therefore, only the 36 in. trough was analyzed
EPICS release 3.11 specific documentation -- EPICS release notes for 3.11
International Nuclear Information System (INIS)
1994-01-01
EPICS release 3.11 is now ready for user testing. A person who wants to set up a simplified application environment to boot an IOC and create databases using R3.11 should follow the directions in Appendix B, page 27, of the EPICS Source/Release Control Manual, Sept. 20, 1993. The R3.11 EPICS path at ANL/APS is /net/phebos/epics/R3.11 so the command to get the new release is /net/phebos/epics/R3.11/Unix/share/bin/getrel /net/phebos/epics/R3.11. An existing R3.8 short form report can be copied to this new directory and used to create a database. ANL/APS is currently testing an Application Developers Source/Release control system. It is not yet ready for general distribution. Attached are the EPICS R3.11 release notes
TANK 241-AN-102 MULTI-PROBE CORROSION MONITORING SYSTEM PROJECT LESSONS LEARNED
International Nuclear Information System (INIS)
TAYLOR T; HAGENSEN A; KIRCH NW
2008-01-01
During 2007 and 2008, a new Multi-Probe Corrosion Monitoring System (MPCMS) was designed and fabricated for use in double-shell tank 241-AN-102. The system was successfully installed in the tank on May 1, 2008. The 241-AN-102 MPCMS consists of one 'fixed' in-tank probe containing primary and secondary reference electrodes, tank material electrodes, Electrical Resistance (ER) sensors, and stressed and unstressed corrosion coupons. In addition to the fixed probe, the 241-AN-102 MPCMS also contains four standalone coupon racks, or 'removable' probes. Each rack contains stressed and unstressed coupons made of American Society of Testing and Materials A537 CL1 steel, heat-treated to closely match the chemical and mechanical characteristics of the 241-AN-102 tank wall. These coupon racks can be removed periodically to facilitate examination of the attached coupons for corrosion damage. Along the way to successful system deployment and operation, the system design, fabrication, and testing activities presented a number of challenges. This document discusses these challenges and lessons learned, which when applied to future efforts, should improve overall project efficiency
Allegheny County / City of Pittsburgh / Western PA Regional Data Center — This data set shows 311 service requests in the City of Pittsburgh. This data is collected using the request intake software used by the 311 Response Center in the...
42 CFR 57.311 - Cancellation of nursing student loans for disability or death.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Cancellation of nursing student loans for disability or death. 57.311 Section 57.311 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR CONSTRUCTION OF TEACHING FACILITIES, EDUCATIONAL IMPROVEMENTS, SCHOLARSHIPS AND STUDENT LOANS Nursing Student Loans §...
Chemical compatibility of tank wastes in tanks 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank 241-C-106 waste to tank 241-AY-102 utilizing supernatant from tank 241-AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
International Nuclear Information System (INIS)
Bauer, R.E.
1998-01-01
This test plan provides the directions to characterize the headspace gas concentrations and the headspace ventilation rate for double contained receiver tanks 241-A-244, 241-BX-244, 241-S-244, and 241-TX-244
Genome-wide association studies identify four ER negative-specific breast cancer risk loci
DEFF Research Database (Denmark)
Garcia-Closas, Montserrat; Couch, Fergus J; Lindstrom, Sara
2013-01-01
differences in genetic predisposition. To identify susceptibility loci specific to ER-negative disease, we combined in a meta-analysis 3 genome-wide association studies of 4,193 ER-negative breast cancer cases and 35,194 controls with a series of 40 follow-up studies (6,514 cases and 41,455 controls......), genotyped using a custom Illumina array, iCOGS, developed by the Collaborative Oncological Gene-environment Study (COGS). SNPs at four loci, 1q32.1 (MDM4, P = 2.1 × 10(-12) and LGR6, P = 1.4 × 10(-8)), 2p24.1 (P = 4.6 × 10(-8)) and 16q12.2 (FTO, P = 4.0 × 10(-8)), were associated with ER-negative but not ER...
National Oceanic and Atmospheric Administration, Department of Commerce — The Catch-In-Areas database integrates catch data from the Catch Accounting System (which has the spatial resolution of a NMFS Reporting Area) into a database that...
Small is beautiful: Marine small-scale fisheries catches from the South-West Maluku Regency
Hutubessy, BG; Mosse, JW; Hayward, P.
2017-10-01
The fisheries data supplied by fisheries agency have served as the primary tool for regional fisheries statistics. However, it is recognized these data are incomplete and often underestimate actual catches, particularly for small-scale fisheries. There is no widely accepted definition of small-scale fisheries or global data on number of small-scale fishers and their catches. This study reconstructed total marine catches from 1980 to 2015 for South-west Maluku (MBD) regency, by applying an established catch construction approach utilizing all available quantitative and qualitative data, combined with assumption-based estimations and interpolations. As newly established regency since 2009, there is lack of fisheries data available which is needed for fisheries management. Fishers’ knowledge is important information taken from to construct long-term fisheries data. Estimated total fish withdrawal from MBD waters was 86,849.66 tonnes during 1980 - 2015, dominated by pelagic fishes. Consistency of estimated total removal and total landings at MBD regency play important role in small-scale fisheries management and this method of visualizing the history of fishery from poor-data condition might be an optimistic effort.
Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
Garcia-Closas, Montserrat; Couch, Fergus J; Lindstrom, Sara; Michailidou, Kyriaki; Schmidt, Marjanka K; Brook, Mark N; Orr, Nick; Rhie, Suhn Kyong; Riboli, Elio; Feigelson, Heather S; Le Marchand, Loic; Buring, Julie E; Eccles, Diana; Miron, Penelope; Fasching, Peter A; Brauch, Hiltrud; Chang-Claude, Jenny; Carpenter, Jane; Godwin, Andrew K; Nevanlinna, Heli; Giles, Graham G; Cox, Angela; Hopper, John L; Bolla, Manjeet K; Wang, Qin; Dennis, Joe; Dicks, Ed; Howat, Will J; Schoof, Nils; Bojesen, Stig E; Lambrechts, Diether; Broeks, Annegien; Andrulis, Irene L; Guénel, Pascal; Burwinkel, Barbara; Sawyer, Elinor J; Hollestelle, Antoinette; Fletcher, Olivia; Winqvist, Robert; Brenner, Hermann; Mannermaa, Arto; Hamann, Ute; Meindl, Alfons; Lindblom, Annika; Zheng, Wei; Devillee, Peter; Goldberg, Mark S; Lubinski, Jan; Kristensen, Vessela; Swerdlow, Anthony; Anton-Culver, Hoda; Dörk, Thilo; Muir, Kenneth; Matsuo, Keitaro; Wu, Anna H; Radice, Paolo; Teo, Soo Hwang; Shu, Xiao-Ou; Blot, William; Kang, Daehee; Hartman, Mikael; Sangrajrang, Suleeporn; Shen, Chen-Yang; Southey, Melissa C; Park, Daniel J; Hammet, Fleur; Stone, Jennifer; Veer, Laura J Van't; Rutgers, Emiel J; Lophatananon, Artitaya; Stewart-Brown, Sarah; Siriwanarangsan, Pornthep; Peto, Julian; Schrauder, Michael G; Ekici, Arif B; Beckmann, Matthias W; Dos Santos Silva, Isabel; Johnson, Nichola; Warren, Helen; Tomlinson, Ian; Kerin, Michael J; Miller, Nicola; Marme, Federick; Schneeweiss, Andreas; Sohn, Christof; Truong, Therese; Laurent-Puig, Pierre; Kerbrat, Pierre; Nordestgaard, Børge G; Nielsen, Sune F; Flyger, Henrik; Milne, Roger L; Perez, Jose Ignacio Arias; Menéndez, Primitiva; Müller, Heiko; Arndt, Volker; Stegmaier, Christa; Lichtner, Peter; Lochmann, Magdalena; Justenhoven, Christina; Ko, Yon-Dschun; Muranen, Taru A; Aittomäki, Kristiina; Blomqvist, Carl; Greco, Dario; Heikkinen, Tuomas; Ito, Hidemi; Iwata, Hiroji; Yatabe, Yasushi; Antonenkova, Natalia N; Margolin, Sara; Kataja, Vesa; Kosma, Veli-Matti; Hartikainen, Jaana M; Balleine, Rosemary; Tseng, Chiu-Chen; Berg, David Van Den; Stram, Daniel O; Neven, Patrick; Dieudonné, Anne-Sophie; Leunen, Karin; Rudolph, Anja; Nickels, Stefan; Flesch-Janys, Dieter; Peterlongo, Paolo; Peissel, Bernard; Bernard, Loris; Olson, Janet E; Wang, Xianshu; Stevens, Kristen; Severi, Gianluca; Baglietto, Laura; McLean, Catriona; Coetzee, Gerhard A; Feng, Ye; Henderson, Brian E; Schumacher, Fredrick; Bogdanova, Natalia V; Labrèche, France; Dumont, Martine; Yip, Cheng Har; Taib, Nur Aishah Mohd; Cheng, Ching-Yu; Shrubsole, Martha; Long, Jirong; Pylkäs, Katri; Jukkola-Vuorinen, Arja; Kauppila, Saila; Knight, Julia A; Glendon, Gord; Mulligan, Anna Marie; Tollenaar, Robertus A E M; Seynaeve, Caroline M; Kriege, Mieke; Hooning, Maartje J; van den Ouweland, Ans M W; van Deurzen, Carolien H M; Lu, Wei; Gao, Yu-Tang; Cai, Hui; Balasubramanian, Sabapathy P; Cross, Simon S; Reed, Malcolm W R; Signorello, Lisa; Cai, Qiuyin; Shah, Mitul; Miao, Hui; Chan, Ching Wan; Chia, Kee Seng; Jakubowska, Anna; Jaworska, Katarzyna; Durda, Katarzyna; Hsiung, Chia-Ni; Wu, Pei-Ei; Yu, Jyh-Cherng; Ashworth, Alan; Jones, Michael; Tessier, Daniel C; González-Neira, Anna; Pita, Guillermo; Alonso, M Rosario; Vincent, Daniel; Bacot, Francois; Ambrosone, Christine B; Bandera, Elisa V; John, Esther M; Chen, Gary K; Hu, Jennifer J; Rodriguez-Gil, Jorge L; Bernstein, Leslie; Press, Michael F; Ziegler, Regina G; Millikan, Robert M; Deming-Halverson, Sandra L; Nyante, Sarah; Ingles, Sue A; Waisfisz, Quinten; Tsimiklis, Helen; Makalic, Enes; Schmidt, Daniel; Bui, Minh; Gibson, Lorna; Müller-Myhsok, Bertram; Schmutzler, Rita K; Hein, Rebecca; Dahmen, Norbert; Beckmann, Lars; Aaltonen, Kirsimari; Czene, Kamila; Irwanto, Astrid; Liu, Jianjun; Turnbull, Clare; Rahman, Nazneen; Meijers-Heijboer, Hanne; Uitterlinden, Andre G; Rivadeneira, Fernando; Olswold, Curtis; Slager, Susan; Pilarski, Robert; Ademuyiwa, Foluso; Konstantopoulou, Irene; Martin, Nicholas G; Montgomery, Grant W; Slamon, Dennis J; Rauh, Claudia; Lux, Michael P; Jud, Sebastian M; Bruning, Thomas; Weaver, Joellen; Sharma, Priyanka; Pathak, Harsh; Tapper, Will; Gerty, Sue; Durcan, Lorraine; Trichopoulos, Dimitrios; Tumino, Rosario; Peeters, Petra H; Kaaks, Rudolf; Campa, Daniele; Canzian, Federico; Weiderpass, Elisabete; Johansson, Mattias; Khaw, Kay-Tee; Travis, Ruth; Clavel-Chapelon, Françoise; Kolonel, Laurence N; Chen, Constance; Beck, Andy; Hankinson, Susan E; Berg, Christine D; Hoover, Robert N; Lissowska, Jolanta; Figueroa, Jonine D; Chasman, Daniel I; Gaudet, Mia M; Diver, W Ryan; Willett, Walter C; Hunter, David J; Simard, Jacques; Benitez, Javier; Dunning, Alison M; Sherman, Mark E; Chenevix-Trench, Georgia; Chanock, Stephen J; Hall, Per; Pharoah, Paul D P; Vachon, Celine; Easton, Douglas F; Haiman, Christopher A; Kraft, Peter
2013-04-01
Estrogen receptor (ER)-negative tumors represent 20-30% of all breast cancers, with a higher proportion occurring in younger women and women of African ancestry. The etiology and clinical behavior of ER-negative tumors are different from those of tumors expressing ER (ER positive), including differences in genetic predisposition. To identify susceptibility loci specific to ER-negative disease, we combined in a meta-analysis 3 genome-wide association studies of 4,193 ER-negative breast cancer cases and 35,194 controls with a series of 40 follow-up studies (6,514 cases and 41,455 controls), genotyped using a custom Illumina array, iCOGS, developed by the Collaborative Oncological Gene-environment Study (COGS). SNPs at four loci, 1q32.1 (MDM4, P = 2.1 × 10(-12) and LGR6, P = 1.4 × 10(-8)), 2p24.1 (P = 4.6 × 10(-8)) and 16q12.2 (FTO, P = 4.0 × 10(-8)), were associated with ER-negative but not ER-positive breast cancer (P > 0.05). These findings provide further evidence for distinct etiological pathways associated with invasive ER-positive and ER-negative breast cancers.
International Nuclear Information System (INIS)
RASMUSSEN, O.R.
2000-01-01
This report documents the preferred approach (retrieval strategy) to prepare and transfer waste from low-activity waste source tanks containing soluble solids (Tanks 241-AN-103, 241-AN-104, 241-AN-105 and 241-AW-101) to the vitrification plant. Several opportunities to further refine the selected retrieval strategy were identified; these were recommended for follow-on studies
14 CFR 67.311 - Cardiovascular.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Cardiovascular. 67.311 Section 67.311 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN MEDICAL STANDARDS AND CERTIFICATION Third-Class Airman Medical Certificate § 67.311 Cardiovascular. Cardiovascular...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1250.311 Section 1250.311 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE EGG RESEARCH AND PROMOTION Egg Research and Promotion Order Definitions § 1250.311 Research. Research means any type of research to...
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Homicide. 3.11 Section 3.11 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation General § 3.11 Homicide. Any person who has...
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Tuberculosis. 311.2 Section 311.2... CERTIFICATION DISPOSAL OF DISEASED OR OTHERWISE ADULTERATED CARCASSES AND PARTS § 311.2 Tuberculosis. The... pathogenesis of tuberculosis in swine, cattle, sheep, goats, and equines. (a) Carcasses condemned. The entire...
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Anemia. 311.34 Section 311.34 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION... CERTIFICATION DISPOSAL OF DISEASED OR OTHERWISE ADULTERATED CARCASSES AND PARTS § 311.34 Anemia. Carcasses of...
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Terrorism. 594.311 Section 594.311... ASSETS CONTROL, DEPARTMENT OF THE TREASURY GLOBAL TERRORISM SANCTIONS REGULATIONS General Definitions § 594.311 Terrorism. The term terrorism means an activity that: (a) Involves a violent act or an act...
2010-04-01
... services in the private sector. (o) Recipient includes all contractors, subcontractors at any tier, and... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Definitions. 311.105 Section 311.105 Foreign Relations PEACE CORPS NEW RESTRICTIONS ON LOBBYING General § 311.105 Definitions. For purposes of this part...
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Brucellosis. 311.15 Section 311.15... CERTIFICATION DISPOSAL OF DISEASED OR OTHERWISE ADULTERATED CARCASSES AND PARTS § 311.15 Brucellosis. Carcasses affected with localized lesions of brucellosis may be passed for human food after the affected parts are...
Hanford Double-Shell Tank Extent-of-Condition Construction Review
International Nuclear Information System (INIS)
Venetz, Theodore J.; Johnson, Jeremy M.; Gunter, Jason R.; Barnes, Travis J.; Washenfelder, Dennis J.; Boomer, Kayle D.
2013-01-01
During routine visual inspections of Hanford double-shell waste tank 241-AY-102 (AY-102), anomalies were identified on the annulus floor which resulted in further evaluations. Following a formal leak assessment in October 2012, Washington River Protection Solutions, LLC (WRPS) determined that the primary tank of AY-102 was leaking. The formal leak assessment, documented in RPP-ASMT-53793,Tank 241-AY-102 Leak Assessment Report, identified first-of-a-kind construction difficulties and trial-and-error repairs as major contributing factors to tank failure. To determine if improvements in double-shell tank (DST) construction occurred after construction of tank AY-102, a detailed review and evaluation of historical construction records were performed for the first three DST tank farms constructed, which included tanks 241-AY-101, 241-AZ-101, 241-AZ-102, 241-SY-101, 241-SY-102, and 241-SY-103. The review for these six tanks involved research and review of dozens of boxes of historical project documentation. These reviews form a basis to better understand the current condition of the three oldest Hanford DST farms. They provide a basis for changes to the current tank inspection program and also provide valuable insight into future tank use decisions. If new tanks are constructed in the future, these reviews provide valuable 'lessons-learned' information about expected difficulties as well as construction practices and techniques that are likely to be successful
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Arthritis. 311.7 Section 311.7 Animals... CERTIFICATION DISPOSAL OF DISEASED OR OTHERWISE ADULTERATED CARCASSES AND PARTS § 311.7 Arthritis. (a) Carcasses affected with arthritis which is localized and not associated with systemic change may be passed for human...
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Preemption. 311.3 Section 311.3 Commercial... STANDARDS FOR RECYCLED OIL § 311.3 Preemption. No law, regulation, or order of any State or political subdivision thereof may apply, or remain applicable, to any container of recycled oil, if such law, regulation...
Chemical compatibility of tank wastes in 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank C-106 waste to tank AY-102 utilizing supernatant from AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
Genome-wide association studies identify four ER negative–specific breast cancer risk loci
Garcia-Closas, Montserrat; Couch, Fergus J; Lindstrom, Sara; Michailidou, Kyriaki; Schmidt, Marjanka K; Brook, Mark N; orr, Nick; Rhie, Suhn Kyong; Riboli, Elio; Feigelson, Heather s; Le Marchand, Loic; Buring, Julie E; Eccles, Diana; Miron, Penelope; Fasching, Peter A; Brauch, Hiltrud; Chang-Claude, Jenny; Carpenter, Jane; Godwin, Andrew K; Nevanlinna, Heli; Giles, Graham G; Cox, Angela; Hopper, John L; Bolla, Manjeet K; Wang, Qin; Dennis, Joe; Dicks, Ed; Howat, Will J; Schoof, Nils; Bojesen, Stig E; Lambrechts, Diether; Broeks, Annegien; Andrulis, Irene L; Guénel, Pascal; Burwinkel, Barbara; Sawyer, Elinor J; Hollestelle, Antoinette; Fletcher, Olivia; Winqvist, Robert; Brenner, Hermann; Mannermaa, Arto; Hamann, Ute; Meindl, Alfons; Lindblom, Annika; Zheng, Wei; Devillee, Peter; Goldberg, Mark S; Lubinski, Jan; Kristensen, Vessela; Swerdlow, Anthony; Anton-Culver, Hoda; Dörk, Thilo; Muir, Kenneth; Matsuo, Keitaro; Wu, Anna H; Radice, Paolo; Teo, Soo Hwang; Shu, Xiao-Ou; Blot, William; Kang, Daehee; Hartman, Mikael; Sangrajrang, Suleeporn; Shen, Chen-Yang; Southey, Melissa C; Park, Daniel J; Hammet, Fleur; Stone, Jennifer; Veer, Laura J Van’t; Rutgers, Emiel J; Lophatananon, Artitaya; Stewart-Brown, Sarah; Siriwanarangsan, Pornthep; Peto, Julian; Schrauder, Michael G; Ekici, Arif B; Beckmann, Matthias W; Silva, Isabel dos Santos; Johnson, Nichola; Warren, Helen; Tomlinson, Ian; Kerin, Michael J; Miller, Nicola; Marme, Federick; Schneeweiss, Andreas; Sohn, Christof; Truong, Therese; Laurent-Puig, Pierre; Kerbrat, Pierre; Nordestgaard, Børge G; Nielsen, Sune F; Flyger, Henrik; Milne, Roger L; Perez, Jose Ignacio Arias; Menéndez, Primitiva; Müller, Heiko; Arndt, Volker; Stegmaier, Christa; Lichtner, Peter; Lochmann, Magdalena; Justenhoven, Christina; Ko, Yon-Dschun; Muranen, Taru A; Aittomäki, Kristiina; Blomqvist, Carl; Greco, Dario; Heikkinen, Tuomas; Ito, Hidemi; Iwata, Hiroji; Yatabe, Yasushi; Antonenkova, Natalia N; Margolin, Sara; Kataja, Vesa; Kosma, Veli-Matti; Hartikainen, Jaana M; Balleine, Rosemary; Tseng, Chiu-Chen; Van Den Berg, David; Stram, Daniel O; Neven, Patrick; Dieudonné, Anne-Sophie; Leunen, Karin; Rudolph, Anja; Nickels, Stefan; Flesch-Janys, Dieter; Peterlongo, Paolo; Peissel, Bernard; Bernard, Loris; Olson, Janet E; Wang, Xianshu; Stevens, Kristen; Severi, Gianluca; Baglietto, Laura; Mclean, Catriona; Coetzee, Gerhard A; Feng, Ye; Henderson, Brian E; Schumacher, Fredrick; Bogdanova, Natalia V; Labrèche, France; Dumont, Martine; Yip, Cheng Har; Taib, Nur Aishah Mohd; Cheng, Ching-Yu; Shrubsole, Martha; Long, Jirong; Pylkäs, Katri; Jukkola-Vuorinen, Arja; Kauppila, Saila; knight, Julia A; Glendon, Gord; Mulligan, Anna Marie; Tollenaar, Robertus A E M; Seynaeve, Caroline M; Kriege, Mieke; Hooning, Maartje J; Van den Ouweland, Ans M W; Van Deurzen, Carolien H M; Lu, Wei; Gao, Yu-Tang; Cai, Hui; Balasubramanian, Sabapathy P; Cross, Simon S; Reed, Malcolm W R; Signorello, Lisa; Cai, Qiuyin; Shah, Mitul; Miao, Hui; Chan, Ching Wan; Chia, Kee Seng; Jakubowska, Anna; Jaworska, Katarzyna; Durda, Katarzyna; Hsiung, Chia-Ni; Wu, Pei-Ei; Yu, Jyh-Cherng; Ashworth, Alan; Jones, Michael; Tessier, Daniel C; González-Neira, Anna; Pita, Guillermo; Alonso, M Rosario; Vincent, Daniel; Bacot, Francois; Ambrosone, Christine B; Bandera, Elisa V; John, Esther M; Chen, Gary K; Hu, Jennifer J; Rodriguez-gil, Jorge L; Bernstein, Leslie; Press, Michael F; Ziegler, Regina G; Millikan, Robert M; Deming-Halverson, Sandra L; Nyante, Sarah; Ingles, Sue A; Waisfisz, Quinten; Tsimiklis, Helen; Makalic, Enes; Schmidt, Daniel; Bui, Minh; Gibson, Lorna; Müller-Myhsok, Bertram; Schmutzler, Rita K; Hein, Rebecca; Dahmen, Norbert; Beckmann, Lars; Aaltonen, Kirsimari; Czene, Kamila; Irwanto, Astrid; Liu, Jianjun; Turnbull, Clare; Rahman, Nazneen; Meijers-Heijboer, Hanne; Uitterlinden, Andre G; Rivadeneira, Fernando; Olswold, Curtis; Slager, Susan; Pilarski, Robert; Ademuyiwa, Foluso; Konstantopoulou, Irene; Martin, Nicholas G; Montgomery, Grant W; Slamon, Dennis J; Rauh, Claudia; Lux, Michael P; Jud, Sebastian M; Bruning, Thomas; Weaver, Joellen; Sharma, Priyanka; Pathak, Harsh; Tapper, Will; Gerty, Sue; Durcan, Lorraine; Trichopoulos, Dimitrios; Tumino, Rosario; Peeters, Petra H; Kaaks, Rudolf; Campa, Daniele; Canzian, Federico; Weiderpass, Elisabete; Johansson, Mattias; Khaw, Kay-Tee; Travis, Ruth; Clavel-Chapelon, Françoise; Kolonel, Laurence N; Chen, Constance; Beck, Andy; Hankinson, Susan E; Berg, Christine D; Hoover, Robert N; Lissowska, Jolanta; Figueroa, Jonine D; Chasman, Daniel I; Gaudet, Mia M; Diver, W Ryan; Willett, Walter C; Hunter, David J; Simard, Jacques; Benitez, Javier; Dunning, Alison M; Sherman, Mark E; Chenevix-Trench, Georgia; Chanock, Stephen J; Hall, Per; Pharoah, Paul D P; Vachon, Celine; Easton, Douglas F; Haiman, Christopher A; Kraft, Peter
2013-01-01
Estrogen receptor (ER)-negative tumors represent 20–30% of all breast cancers, with a higher proportion occurring in younger women and women of African ancestry1. The etiology2 and clinical behavior3 of ER-negative tumors are different from those of tumors expressing ER (ER positive), including differences in genetic predisposition4. To identify susceptibility loci specific to ER-negative disease, we combined in a meta-analysis 3 genome-wide association studies of 4,193 ER-negative breast cancer cases and 35,194 controls with a series of 40 follow-up studies (6,514 cases and 41,455 controls), genotyped using a custom Illumina array, iCOGS, developed by the Collaborative Oncological Gene-environment Study (COGS). SNPs at four loci, 1q32.1 (MDM4, P = 2.1 × 10−12 and LGR6, P = 1.4 × 10−8), 2p24.1 (P = 4.6 × 10−8) and 16q12.2 (FTO, P = 4.0 × 10−8), were associated with ER-negative but not ER-positive breast cancer (P > 0.05). These findings provide further evidence for distinct etiological pathways associated with invasive ER-positive and ER-negative breast cancers. PMID:23535733
Crystal growth and scintillation properties of Er-doped Lu3Al5O12 single crystals
International Nuclear Information System (INIS)
Sugiyama, Makoto; Fujimoto, Yutaka; Yanagida, Takayuki; Totsuka, Daisuke; Kurosawa, Shunsuke; Futami, Yoshisuke; Yokota, Yuui; Chani, Valery; Yoshikawa, Akira
2012-01-01
Er-doped Lu 3 Al 5 O 12 (Er:LuAG) single crystalline scintillators with different Er concentrations of 0.1, 0.5, 1, and 3% were grown by the micro-pulling-down (μ-PD) method. The grown crystals were composed of single-phase material, as demonstrated by powder X-ray diffraction (XRD). The radioluminescence spectra measured under 241 Am α-ray excitation indicated host emission at approximately 350 nm and Er 3+ 4f-4f emissions. According to the pulse height spectra recorded under γ-ray irradiation, the 0.5% Er:LuAG exhibited the highest peak channel among the samples. The γ-ray excited decay time profiles were well fitted by the two-component exponential approximation (0.8 μs and 6-10 μs).
International Nuclear Information System (INIS)
ANDA, V.S.; EDGEMON, G.L.; HAGENSEN, A.R.; BOOMER, K.D.; CAROTHERS, K.G.
2009-01-01
In 2008, a new Multi-Probe Corrosion Monitoring System (MPCMS) was installed in double-shell tank 241-AN-102 on the U.S. Department of Energy's Hanford Site in Washington State. Developmental design work included laboratory testing in simulated tank 241-AN-102 waste to evaluate metal performance for installation on the MPCMS as secondary metal reference electrodes. The MPCMS design includes coupon arrays as well as a wired probe which facilitates measurement of tank potential as well as corrosion rate using electrical resistance (ER) sensors. This paper presents the MPCMS design, field data obtained following installation of the MPCMS in tank 241-AN-102, and a comparison between laboratory potential data obtained using simulated waste and tank potential data obtained following field installation
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Authority. 31.1 Section 31.1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY EXTENSIONS OF CREDIT TO INSIDERS AND TRANSACTIONS WITH AFFILIATES § 31.1 Authority. This part is issued by the Comptroller of the Currency pursuant to 12 U.S.C. 93a...
Energy Technology Data Exchange (ETDEWEB)
DUNCAN JB; HUBER HJ
2011-04-21
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
Hanford Single-Shell Tank Leak Causes and Locations - 241-BY and 241-TY Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2014-09-04
This document identifies 241-BY Tank Farm (BY Farm) and 241-TY Tank Farm (TY Farm) lead causes and locations for the 100 series leaking tanks (241-BY-103, 241-TY-103, 241-TY-104, 241-TY-105 and 241-TY-106) identified in RPP-RPT-43704, Hanford BY Farm Leak Assessments Report, and in RPP-RPT-42296, Hanford TY Farm Leak Assessments Report. This document satisfies the BY and TY Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Operational Test Report for the 241-AZ-101 Suspended Solids Profiler
International Nuclear Information System (INIS)
STENKAMP, D.M.
2000-01-01
This document comprises the Operational Test Report for the 241-AZ-101 Suspended Solids Profiler. This document presents the results of Operational Testing of the 241-AZ-101 Suspended Solids Profiler (SSP). Testing of the SSP was performed in accordance with OTP-260-005, ''SUSPENDED SOLIDS PROFILER OPERATIONAL TEST PROCEDURE''. The objective of the testing was to verify that all equipment and components functioned as designed, following construction completion and turnover to operations
9 CFR 381.311 - Recall procedure.
2010-01-01
... CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Canning and Canned Products § 381.311 Recall procedure... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Recall procedure. 381.311 Section 381.311 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY...
McCormick, Joshua L.; Quist, Michael C.; Schill, Daniel J.
2012-01-01
Roving–roving and roving–access creel surveys are the primary techniques used to obtain information on harvest of Chinook salmon Oncorhynchus tshawytscha in Idaho sport fisheries. Once interviews are conducted using roving–roving or roving–access survey designs, mean catch rate can be estimated with the ratio-of-means (ROM) estimator, the mean-of-ratios (MOR) estimator, or the MOR estimator with exclusion of short-duration (≤0.5 h) trips. Our objective was to examine the relative bias and precision of total catch estimates obtained from use of the two survey designs and three catch rate estimators for Idaho Chinook salmon fisheries. Information on angling populations was obtained by direct visual observation of portions of Chinook salmon fisheries in three Idaho river systems over an 18-d period. Based on data from the angling populations, Monte Carlo simulations were performed to evaluate the properties of the catch rate estimators and survey designs. Among the three estimators, the ROM estimator provided the most accurate and precise estimates of mean catch rate and total catch for both roving–roving and roving–access surveys. On average, the root mean square error of simulated total catch estimates was 1.42 times greater and relative bias was 160.13 times greater for roving–roving surveys than for roving–access surveys. Length-of-stay bias and nonstationary catch rates in roving–roving surveys both appeared to affect catch rate and total catch estimates. Our results suggest that use of the ROM estimator in combination with an estimate of angler effort provided the least biased and most precise estimates of total catch for both survey designs. However, roving–access surveys were more accurate than roving–roving surveys for Chinook salmon fisheries in Idaho.
National Oceanic and Atmospheric Administration, Department of Commerce — The Annual Catch Limit (ACL) dataset within the Species Information System (SIS) contains information and data related to management reference points and catch data.
31 CFR 593.311 - United States.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 593.311 Section 593.311 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... REGULATIONS General Definitions § 593.311 United States. The term United States means the United States, its...
5 CFR 551.311 - Subminimum wage.
2010-01-01
... FAIR LABOR STANDARDS ACT Minimum Wage Provisions Subminimum Wage § 551.311 Subminimum wage. An agency... minimum wage specified in section 6(a)(1) of the Act. [45 FR 85664, Dec. 30, 1980] ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Subminimum wage. 551.311 Section 551.311...
International Nuclear Information System (INIS)
Hays, C.B.
1996-01-01
The 241-A-101 tank, a 22.9 meter 3,785,400 liter capacity SST, was constructed from the fourth generation of tank designs, which were capable of holding boiling or self-concentrating waste. Construction features a reinforced concrete shell, dome, and base with a mild steel liner covering the bottom and sidewalls. The tank has a flat bottom with a usable waste depth of approximately 9.4 meters. The tank was put into service in 1956 to store plutonium-uranium extraction (PUREX) high-level waste and organic wash waste. The waste was allowed to self-concentrate up until 1968. Tank sluicing was performed in 1969 and again in 1976 to reduce the amount of strontium and cesium, the two isotopes found to be the main heat generating sources in the tank. In 1978, the tank was reassigned for saltcake storage. The tank was taken out of service in November 1980 and partially isolated in 1982. Salt well pumping is a method used to interim stabilize SSTS. Interim stabilization is commenced once all the liquid above the solids has been removed (primary stabilization). Interim stabilization removes the gravity drainable liquid and the interstitial liquid between the solids from the SST and transfers the liquid to a double-shell tank (DST) or to a staging double-contained receiver tank (DCRT), which is subsequently transferred to a DST. Pumping is accomplished at very low flow rates, 15.1 liters per minute or less. Normally, salt well pumping is performed without the need of an exhauster. However, recent safety evaluations concluded that a minimum exhaust flow rate of 7.1 cubic meters per minute would be required to enhance the safety of the tank. Therefore, active ventilation will be part of this process for the 241-A-101 tank. This document details the Nonradioactive Air Emissions Notice of Construction for the use of a portable exhauster on Tank 241-A-101 during salt well pumping and other routine activities
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Hog cholera. 311.3 Section 311.3... CERTIFICATION DISPOSAL OF DISEASED OR OTHERWISE ADULTERATED CARCASSES AND PARTS § 311.3 Hog cholera. (a) The carcasses of all hogs affected with hog cholera shall be condemned. (b) Inconclusive but suspicious symptoms...
DEFF Research Database (Denmark)
Figueroa, Jonine D; Garcia-Closas, Montserrat; Humphreys, Manjeet
2011-01-01
for tumors of lower grade (case-only P= 6.7 × 10(-3)) and lobular histology (case-only P= 0.01). SNPs at 14q24.1 were associated with risk for most tumor subtypes evaluated, including triple-negative breast cancers, which has not been described previously. Our results underscore the need for large pooling......A genome-wide association study (GWAS) identified single-nucleotide polymorphisms (SNPs) at 1p11.2 and 14q24.1 (RAD51L1) as breast cancer susceptibility loci. The initial GWAS suggested stronger effects for both loci for estrogen receptor (ER)-positive tumors. Using data from the Breast Cancer......10483813 (r(2)= 0.98) at 14q24.1 (RAD51L1), for up to 46 036 invasive breast cancer cases and 46 930 controls from 39 studies. Analyses by tumor characteristics focused on subjects reporting to be white women of European ancestry and were based on 25 458 cases, of which 87% had ER data. The SNP at 1p11...
Acceptance test procedure, 241-SY-101/241-C-106 shot loading system
International Nuclear Information System (INIS)
Ostrom, M.J.
1994-01-01
This Acceptance Test Procedure is for the 241-SY-101/241-C-106 Shot Loading System. The procedure will test the components of the Shot Loading System and its capability of adequately loading shot into the annular space of the Container. The loaded shot will provide shielding as required for transporting and storage of a contaminated pump after removal from the tank. This test serves as verification that the SLS is acceptable for use in the pump removal operations for Tanks 241-SY-101, 241-C-106 and 241-AY-102. The pump removal operation for these three tanks will be performed by two different organizations with different equipment, but the Shot Loading System will be compatible between the two operations
International Nuclear Information System (INIS)
Duncan, J.B.; Huber, H.J.
2011-01-01
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
Crystal growth and scintillation properties of Er-doped Lu{sub 3}Al{sub 5}O{sub 12} single crystals
Energy Technology Data Exchange (ETDEWEB)
Sugiyama, Makoto, E-mail: makoto.sugiyama@imr.tohoku.ac.jp [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Fujimoto, Yutaka [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Yanagida, Takayuki [New Industry Creation Hatchery Center (NICHe), Tohoku University, 6-6-10 Aoba, Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Totsuka, Daisuke [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Nihon Kessho Kogaku Co. Ltd., 810-5 Nobe-cho Tatebayashi Gunma (Japan); Kurosawa, Shunsuke; Futami, Yoshisuke; Yokota, Yuui; Chani, Valery [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Yoshikawa, Akira [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); New Industry Creation Hatchery Center (NICHe), Tohoku University, 6-6-10 Aoba, Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan)
2012-02-01
Er-doped Lu{sub 3}Al{sub 5}O{sub 12} (Er:LuAG) single crystalline scintillators with different Er concentrations of 0.1, 0.5, 1, and 3% were grown by the micro-pulling-down ({mu}-PD) method. The grown crystals were composed of single-phase material, as demonstrated by powder X-ray diffraction (XRD). The radioluminescence spectra measured under {sup 241}Am {alpha}-ray excitation indicated host emission at approximately 350 nm and Er{sup 3+} 4f-4f emissions. According to the pulse height spectra recorded under {gamma}-ray irradiation, the 0.5% Er:LuAG exhibited the highest peak channel among the samples. The {gamma}-ray excited decay time profiles were well fitted by the two-component exponential approximation (0.8 {mu}s and 6-10 {mu}s).
Thermal modeling of tanks 241-AW-101 and 241-AN-104 with the TEMPEST code
International Nuclear Information System (INIS)
Antoniak, Z.I.; Recknagle, K.P.
1995-07-01
The TEMPEST code was exercised in a preliminary study of double-shell Tanks 241 -AW-101 and 241-AN-104 thermal behavior. The two-dimensional model used is derived from our earlier studies on heat transfer from Tank 241-SY-101. Several changes were made to the model to simulate the waste and conditions in 241-AW-101 and 241-AN-104. The nonconvective waste layer was assumed to be 254 cm (100 in.) thick for Tank 241-AW-101, and 381 cm (150 in.) in Tank 241-AN-104. The remaining waste was assumed, for each tank, to consist of a convective layer with a 7.6-cm (3-inch) crust on top. The waste heat loads for 241-AW-101 and 241-AN-104 were taken to be 10 kW (3.4E4 Btu/hr) and 12 kW (4.0E4 Btu/hr), respectively. Present model predictions of maximum and convecting waste temperatures are within 1.7 degrees C (3 degrees F) of those measured in Tanks 241-AW-101 and 241-AN-104. The difference between the predicted and measured temperature is comparable to the uncertainty of the measurement equipment. These models, therefore, are suitable for estimating the temperatures within the tanks in the event of changing air flows, waste levels, and/or waste configurations
Targeted sequencing of large genomic regions with CATCH-Seq.
Directory of Open Access Journals (Sweden)
Kenneth Day
Full Text Available Current target enrichment systems for large-scale next-generation sequencing typically require synthetic oligonucleotides used as capture reagents to isolate sequences of interest. The majority of target enrichment reagents are focused on gene coding regions or promoters en masse. Here we introduce development of a customizable targeted capture system using biotinylated RNA probe baits transcribed from sheared bacterial artificial chromosome clone templates that enables capture of large, contiguous blocks of the genome for sequencing applications. This clone adapted template capture hybridization sequencing (CATCH-Seq procedure can be used to capture both coding and non-coding regions of a gene, and resolve the boundaries of copy number variations within a genomic target site. Furthermore, libraries constructed with methylated adapters prior to solution hybridization also enable targeted bisulfite sequencing. We applied CATCH-Seq to diverse targets ranging in size from 125 kb to 3.5 Mb. Our approach provides a simple and cost effective alternative to other capture platforms because of template-based, enzymatic probe synthesis and the lack of oligonucleotide design costs. Given its similarity in procedure, CATCH-Seq can also be performed in parallel with commercial systems.
Energy Technology Data Exchange (ETDEWEB)
Jeanmaire, L; Michon, G
1962-07-01
The report gives all the results of iodine-131 measurements on 450 milk samples, on 27 animal thyroids, and on 311 human thyroids between November 1, 1961 and February 1, 1962. All these results and their interpretation show that the iodine concentrations, even if they have not attained a critical level have nevertheless come close to it, and that if the Soviet series of explosions had continued it would perhaps have been necessary to take sanitary precautions. The discussion concerns the determination of the moment when such steps should be taken. (authors) [French] Le rapport fournit l'ensemble des dosages d'iode 131 effectues sur 450 echantillons de lait, sur 27 thyroides animales et sur 311 thyroides humaines entre le 1er novembre 1961 et le 1er fevrier 1962. L'ensemble des resultats et leur interpretation montrent que les teneurs en iode, si elles n'ont pas atteint les niveaux critiques, s'en sont toutefois approchees et que si la serie des explosions sovietiques s'etait poursuivie, la situation aurait pu necessiter la mise en place de mesures sanitaires. La discussion porte sur la determination du moment ou de telles mesures doivent etre prises. (auteurs)
24 CFR 241.1005 - Definitions.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Insurance for Equity Loans and Acquisition Loans-Eligibility Requirements § 241.1005 Definitions. (a) All of the definitions of § 241.1 apply to equity and... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.1005 Section 241...
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations § 241.260 Definitions. All of the definitions contained in § 241.1 shall apply to this subpart. In addition, the term contract... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.260 Section 241...
40 CFR 311.2 - Definition of employee.
2010-07-01
... 40 Protection of Environment 27 2010-07-01 2010-07-01 false Definition of employee. 311.2 Section 311.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SUPERFUND, EMERGENCY PLANNING, AND COMMUNITY RIGHT-TO-KNOW PROGRAMS WORKER PROTECTION § 311.2 Definition of employee. Employee...
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Evidence. 726.311 Section 726.311 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969, AS AMENDED BLACK LUNG BENEFITS; REQUIREMENTS FOR COAL MINE OPERATOR'S INSURANCE Civil Money...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 120.311 Section 120.311 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Special Purpose Loans... which: (1) Is organized under federal or state law to operate in the interest of disabled individuals...
2010-04-01
... Internet or other electronic media. (b) Local funding sources. HUD recommends that approved agencies seek and secure funding from funding sources that may include local and state governments, private... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Funding. 214.311 Section 214.311...
49 CFR 238.311 - Single car test.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Single car test. 238.311 Section 238.311... Requirements for Tier I Passenger Equipment § 238.311 Single car test. (a) Except for self-propelled passenger cars, single car tests of all passenger cars and all unpowered vehicles used in passenger trains shall...
Hawaii DAR Fisherman Reporting System Data (Catch)
National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains the catch data from fishers who take marine life for commercial purposes and report their catch, effort, and sales on a commercial catch...
Zoellner, Jamie M; Porter, Kathleen J; Chen, Yvonnes; Hedrick, Valisa E; You, Wen; Hickman, Maja; Estabrooks, Paul A
2017-05-01
Guided by the theory of planned behaviour (TPB) and health literacy concepts, SIPsmartER is a six-month multicomponent intervention effective at improving SSB behaviours. Using SIPsmartER data, this study explores prediction of SSB behavioural intention (BI) and behaviour from TPB constructs using: (1) cross-sectional and prospective models and (2) 11 single-item assessments from interactive voice response (IVR) technology. Quasi-experimental design, including pre- and post-outcome data and repeated-measures process data of 155 intervention participants. Validated multi-item TPB measures, single-item TPB measures, and self-reported SSB behaviours. Hypothesised relationships were investigated using correlation and multiple regression models. TPB constructs explained 32% of the variance cross sectionally and 20% prospectively in BI; and explained 13-20% of variance cross sectionally and 6% prospectively. Single-item scale models were significant, yet explained less variance. All IVR models predicting BI (average 21%, range 6-38%) and behaviour (average 30%, range 6-55%) were significant. Findings are interpreted in the context of other cross-sectional, prospective and experimental TPB health and dietary studies. Findings advance experimental application of the TPB, including understanding constructs at outcome and process time points and applying theory in all intervention development, implementation and evaluation phases.
Zoellner, Jamie M.; Porter, Kathleen J.; Chen, Yvonnes; Hedrick, Valisa E.; You, Wen; Hickman, Maja; Estabrooks, Paul A.
2017-01-01
Objective Guided by the theory of planned behaviour (TPB) and health literacy concepts, SIPsmartER is a six-month multicomponent intervention effective at improving SSB behaviours. Using SIPsmartER data, this study explores prediction of SSB behavioural intention (BI) and behaviour from TPB constructs using: (1) cross-sectional and prospective models and (2) 11 single-item assessments from interactive voice response (IVR) technology. Design Quasi-experimental design, including pre- and post-outcome data and repeated-measures process data of 155 intervention participants. Main Outcome Measures Validated multi-item TPB measures, single-item TPB measures, and self-reported SSB behaviours. Hypothesised relationships were investigated using correlation and multiple regression models. Results TPB constructs explained 32% of the variance cross sectionally and 20% prospectively in BI; and explained 13–20% of variance cross sectionally and 6% prospectively. Single-item scale models were significant, yet explained less variance. All IVR models predicting BI (average 21%, range 6–38%) and behaviour (average 30%, range 6–55%) were significant. Conclusion Findings are interpreted in the context of other cross-sectional, prospective and experimental TPB health and dietary studies. Findings advance experimental application of the TPB, including understanding constructs at outcome and process time points and applying theory in all intervention development, implementation and evaluation phases. PMID:28165771
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1220.241 Section 1220.241 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Reports, Books, and Records § 1220.241 Reports... to report to the Board periodically such information as may be required by the regulations...
BIOGAS PRODUCTION FROM CATCH CROPS
DEFF Research Database (Denmark)
Molinuevo-Salces, Beatriz; Larsen, Søren U.; Ahring, Birgitte Kiær
2014-01-01
-substrate in manure-based biogas plants and the profit obtained from the sale of biogas barely compensates for the harvest costs. A new agricultural strategy to harvest catch crops together with the residual straw of the main crop was investigated to increase the biomass and thereby the methane yield per hectare......Catch crop cultivation combined with its use for biogas production would increase renewable energy production in the form of methane, without interfering with the production of food and fodder crops. The low biomass yield of catch crops is the main limiting factor for using these crops as co...... biomass. Leaving the straw on the field until harvest of the catch crop in the autumn could benefit biogas production due to the organic matter degradation of the straw taking place on the field during the autumn months. This new agricultural strategy may be a good alternative to achieve economically...
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects Without a HUD-Insured or HUD-Held Mortgage § 241.800 Definitions. All of the definitions contained in... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.800 Section 241...
40 CFR 63.311 - Reporting and recordkeeping requirements.
2010-07-01
... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Reporting and recordkeeping requirements. 63.311 Section 63.311 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... National Emission Standards for Coke Oven Batteries § 63.311 Reporting and recordkeeping requirements. (a...
International Nuclear Information System (INIS)
Mangeng, C.A.; Thayer, G.R.
1984-05-01
This report assesses the uses of 241 Am and the associated costs and supply. The study shows that 241 Am-fueled radioisotope thermoelectric generators in the range of 1 to 5 W electrical provide the most promising use of kilogram amounts of this isotope. For medical uses, where purity is essential, irradiation of 241 Am can produce 97% pure 238 Pu at $21,000/g. Using a pyro-metallurgical process, 241 Am could be recovered from molten salt extraction (MSE) residues at an estimated incremental cost of $83/g adjusted to reflect the disposal costs of waste products. This cost of recovery is less than the $300/g cost for disposal of the 241 Am contained in the MSE residues
Tank 241-AZ-101 and tank 241-AZ-102, airlift circulator operation vapor sampling and analysis plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of the tank 241-AZ-101 and 241-AZ-102 airlift circulators (ALCs). The purpose of the ALC operation is to support portions of the operational test procedure (OTP) for Project W-030 (OTP-W030-001) and to perform functional test in support of Project W-151. Project W-030 is the 241-A-702 ventilation upgrade project (241-AZ-702) and Project W-151 is the 241-AZ-101 Mixer Pump Test. The functional tests will check the operability of the tank 241-AZ-101 ALCs. Process Memo's No.2E98-082 and No.2E99-001 (LMHC 1999a, LMHC 1999b) direct the operation of the ALCs and the Industrial Hygiene monitoring respectively. A series of tests will be conducted in which the ALCs in tanks 241-AZ-101 and 241-AZ-102 will be operated at different air flow rates. Vapor samples will be obtained to determine constituents that may be present in the tank headspace during ALC operation at tanks 241-AZ-101 and 241-AZ-102 as the waste is disturbed. During the testing, vapor samples will be obtained from the headspace of tanks 241-AZ-101 and 241-AZ-102 via the unused port on the standard hydrogen monitoring system (SHMS). Results will be used to provide the waste feed delivery program with environmental air permitting data for tank waste disturbing activities. Because of radiological concerns, the samples will be filtered for particulates. It is recognized that this may remove some organic compounds
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH241 (Link to dictyBase) - - - Contig-U15835-1 SLH241E (Link... to Original site) - - - - - - SLH241E 371 Show SLH241 Library SL (Link to library) Clone ID SLH241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH241Q.Seq.d/ Representative seq. ID SLH24...1E (Link to Original site) Representative DNA sequence >SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH241Q.Seq.d/ GAAGT....Seq.d/ 638 0.0 VFE160 (VFE160Q) /CSM/VF/VFE1-C/VFE160Q.Seq.d/ 638 0.0 SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH24
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 24.1 Section 24.1 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.1 Introduction. (a) In 1970, the Secretary of the Interior...
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.241 Section 19.241 Banks and Banking..., and Debarment of Accountants From Performing Audit Services § 19.241 Scope. This subpart, which... their accounting firms from performing independent audit and attestation services required by section 36...
Structural analysis of the equipment removal system for tanks 241C106 and 241AY102
International Nuclear Information System (INIS)
Mackey, T.C.
1994-10-01
The calculations documented in this report show that the ERS major components are structurally qualified to complete the objective: install the removed equipment into a shipping container, transport and store the container at the Central Waste Complex (CWC). The analysis for the structural members of the ERS components considers live load with an impact factor of 125% and dead load. An allowable stress of 1/3 yield is used for all structural components carrying the load based on DOE-RL-92-36. Adherence to DOE-RL-92-36 is not a code requirement. However, due to the loads considered, this factor of safety is appropriate. The calculations meet the strength requirements of the American Institute for Steel Construction (AISC 1989) for all non-critical structural elements
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFK241 (Link to dictyBase) - - - Contig-U16322-1 AFK241Z (Link... to Original site) - - AFK241Z 753 - - - - Show AFK241 Library AF (Link to library) Clone ID AFK241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-B/AFK241Q.Seq.d/ Representative seq. ID AFK24...1Z (Link to Original site) Representative DNA sequence >AFK241 (AFK241Q) /CSM/AF/AFK2-B/AFK241Q.Seq.d/ XXXXX...llhfsmkilvpfkrkdqpqlvsklkqv lxinkalsqxhhi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFK2
30 CFR 75.311 - Main mine fan operation.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Main mine fan operation. 75.311 Section 75.311... MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Ventilation § 75.311 Main mine fan operation. (a) Main mine fans shall be continuously operated, except as otherwise approved in the ventilation plan, or when...
Bice, Matthew R; Brown, Stephen L; Parry, Thomas
2014-09-01
Coordinated Approach to Child Health (CATCH) is a school health program implemented in southern Illinois that focuses on physical activity and nutrition and consists of a classroom curriculum, physical education framework, and cafeteria guidelines. Though many schools agreed to implement CATCH, some schools implemented it better than others. This study examined implementation practices of classroom and physical education teachers and cafeteria supervisors. We surveyed 284 school employees at 36 elementary schools located in southern Illinois. Attention focused on organizational readiness, commitment to change, school leadership, implementation barriers, and innovation perceptions concerning degree of implementation of CATCH. Organizational readiness and implementation barriers were significant predictors of degree of implementation for school employees. Additionally, organizational readiness was reported a significant predictor of classroom teacher degree of implementation whereas leadership was a significant predictor of degree of implementation by physical education teachers. Data from this study can be used to enhance implementation of CATCH as well as other school health programs. This study provides educators evidence of why school employees have different implementation practices, evidence of what constructs influence degree of implementation most, and some explanation of school employee degree of implementation. © 2014 Society for Public Health Education.
On a low intensity 241 Am Compton spectrometer for measurement ...
Indian Academy of Sciences (India)
In this paper, a new design and construction of a low intensity (100 mCi) 241Am -ray Compton spectrometer is presented. The planar spectrometer is based on a small disc source with the shortest geometry. Measurement of the momentum density of polycrystalline Al is used to evaluate the performance of the new design.
International Nuclear Information System (INIS)
Lee, Ki-Man; Kim, Eun-Hee
2015-01-01
The Radiation Bioengineering Laboratory (RadBio Lab) at Seoul National University (SNU) has built an Am-241 alpha particle irradiator for study of cellular responses to radiation from radon daughters. The radon daughters of concern that cause internal exposure from inhalation of radon-contaminated air are Po-218, Po-214 and Po-210. In their alpha decay schemes, the yields of photon emissions are negligible. Unfortunately, Am-241, the source of alpha irradiator in RadBio Lab, emits photons at every alpha decay while transforming to Np-237 of long half-life. Employing Am-241 as the source simulating radon daughters, therefore, requires that photon emissions from Am-241 be specified in term of dose contribution. In this study, Monte Carlo calculations have been made to characterize dose contributions of Am-241 photon emissions. This study confirms that disturbance from Am-241 photon emissions of the cellular dose by Am-241 alpha emissions is negligible. Dose contamination fraction from photon emissions was 8.02 .. 10 -6 at 25 mm SSD at maximum. Also, note that LET in tissue-equivalent medium varies within about 20% for alpha particles at energies over 5 MeV
49 CFR 192.311 - Repair of plastic pipe.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Repair of plastic pipe. 192.311 Section 192.311... Lines and Mains § 192.311 Repair of plastic pipe. Each imperfection or damage that would impair the serviceability of plastic pipe must be repaired or removed. [Amdt. 192-93, 68 FR 53900, Sept. 15, 2003] ...
Completion Report for Model Evaluation Well ER-11-2: Corrective Action Unit 98: Frenchman Flat
Energy Technology Data Exchange (ETDEWEB)
NSTec Underground Test Area and Boreholes Programs and Operations
2013-01-22
Model Evaluation Well ER-11-2 was drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of Nevada Environmental Management Operations at the Nevada National Security Site (formerly known as the Nevada Test Site). The well was drilled in August 2012 as part of a model evaluation program in the Frenchman Flat area of Nye County, Nevada. The primary purpose of the well was to provide detailed geologic, hydrogeologic, chemical, and radionuclide data that can be used to test and build confidence in the applicability of the Frenchman Flat Corrective Action Unit flow and transport models for their intended purpose. In particular, this well was designed to provide data to evaluate the uncertainty in model forecasts of contaminant migration from the upgradient underground nuclear test PIN STRIPE, conducted in borehole U-11b in 1966. Well ER-11-2 will provide information that can be used to refine the Phase II Frenchman Flat hydrostratigraphic framework model if necessary, as well as to support future groundwater flow and transport modeling. The main 31.1-centimeter (cm) hole was drilled to a total depth of 399.6 meters (m). A completion casing string was not set in Well ER-11-2. However, a piezometer string was installed in the 31.1-cm open hole. The piezometer is composed of 7.3-cm stainless-steel tubing hung on 6.0-cm carbon-steel tubing via a crossover sub. The piezometer string was landed at 394.5 m, for monitoring the lower tuff confining unit. Data collected during and shortly after hole construction include composite drill cuttings samples collected every 3.0 m, various geophysical logs, water quality (including tritium and other test-related radionuclides) measurements, and water level measurements. The well penetrated 42.7 m of Quaternary and Tertiary alluvium and 356.9 m of Tertiary volcanic rock. The water-level measured in the piezometer string on September 25, 2012, was 353.8 m below ground surface. No
31 CFR 575.311 - Iraqi origin.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Iraqi origin. 575.311 Section 575.311 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF FOREIGN... Government of Iraq, or of a business entity located in Iraq. Services of Iraqi origin are not imported into...
31 CFR 592.311 - United States.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 592.311 Section 592... § 592.311 United States. The term United States, when used in the geographic sense, means the several States, the District of Columbia, and any commonwealth, territory, or possession of the United States. ...
AKRO/SF: Catch Accounting System (CAS)
National Oceanic and Atmospheric Administration, Department of Commerce — The Catch Accounting System (CAS) creates total catch estimates for the groundfish fisheries in the Bering Sea/Aleutian Islands and Gulf of Alaska. Each year, quotas...
31 CFR 537.311 - New investment.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false New investment. 537.311 Section 537....311 New investment. (a) The term new investment means any of the following activities if such activity... located in Burma, without regard to the form of the participation. (b) The term new investment shall not...
48 CFR 311.7000 - Defining electronic information technology requirements.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Defining electronic information technology requirements. 311.7000 Section 311.7000 Federal Acquisition Regulations System HEALTH... Accessibility Standards 311.7000 Defining electronic information technology requirements. HHS staff that define...
40 CFR 436.241 - Specialized definitions.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 436.241 Section 436.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Diatomite Subcategory § 436.241...
Energy Technology Data Exchange (ETDEWEB)
Dalton, J. C.; McDonald, B. J.; Barnes, V. [United Kingdom Atomic Energy Authority, Windscale Works, Sellafield (United Kingdom)
1965-10-15
The origin and characteristics of {sup 241}Pu are described, special emphasis being given to its consideration as a health hazard, and to the problem of its determination. A counting system is described which is at present under development at Windscale for the low-level quantitative assay of {sup 241}Pu in samples from a biological monitoring programme. The technique at its present stage of development is at least as sensitive as procedures previously reported, and represents an improvement in terms of simplicity, rapidity and economy. The procedure is intended primarily for use in urinanalysis to supplement information already obtained from autoradiographic analysis of {alpha}-active plutonium isotopes. The same source disc is used for {sup 241}Pu assay thereby economizing in preparative effort. The isotopes of plutonium are first separated from the sample of urine, or other biological material, in a state of high radiochemical purity using an anion exchange procedure. They are then electrodeposited on to a stainless-steel disc. A direct count of the {sup 241}Pu soft beta-ray spectrum (maximum energy 20 keV, half-life 13.3 years) is obtained in an anti-coincidence system consisting of a small-volume gas-flow proportional counter with a plastic phosphor scintillation anti-coincidence guard. The dimensions are such that all the plutonium {beta}-particles are absorbed within the proportional counter while the {alpha}-particles dissipate about half their energy within the plastic phosphor. The geometry for both radiations is almost 2{pi}. At its present stage of development the equipment will detect 3 pCi of {sup 241}Pu in a counting time of one hour. This represents the 24 h urinary excretion rate 3 months after the intake of about 5% of a maximum permissible body-burden (0.9 {mu}Ci). The discs are subsequently assayed for a'-active plutonium isotopes by exposure for one week to a nuclear track plate which is then examined visually using a microscope. (author
Attenuation studies near K-absorption edges using Compton scattered 241Am gamma rays
International Nuclear Information System (INIS)
Abdullah, K.K.; Ramachandran, N.; Karunakaran Nair, K.; Babu, B.R.S.; Joseph, Antony; Thomas, Rajive; Varier, K.M.
2008-01-01
We have carried out photon attenuation measurements at several energies in the range from 49.38 keV to 57.96 keV around the K-absorption edges of the rare earth elements Sm, Eu, Gd, Tb, Dy and Er using 59.54 keV gamma rays from 241 Am source after Compton scattering from an aluminium target. Pellets of oxides of the rare earth elements were chosen as mixture absorbers in these investigations. A narrow beam good geometry set-up was used for the attenuation measurements. The scattered gamma rays were detected by an HPGe detector. The results are consistent with theoretical values derived from the XCOM package. (author)
International Nuclear Information System (INIS)
Ingle, S.J.
1996-03-01
This document is a unit-specific contingency plan for the underground storage tanks at the Strontium Semiworks Facility and is intended to be used as a supplement to the Hanford Facility Contingency Plan. This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of WAC 173-303 for certain Resource Conservation and Recovery Act of 1976 (RCRA) waste management units. Radioactive material is contained in three underground storage tanks: 241-CX-70, 241-CX-71, and 241-CX-72. Tank 241-CX-70 has been emptied, except for residual quantities of waste, and has been classified as an elementary neutralization tank under the RCRA. Tanks 241-CX-71 and 241-CX-72 contain radioactive and Washington State-only dangerous waste material, but do not present a significant hazard to adjacent facilities, personnel, or the environment. Currently, dangerous waste management activities are not being applied at the tanks. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the Strontium Semiworks Facility
Catching a Cold When It's Warm
... Print this issue Catching a Cold When It’s Warm What’s the Deal with Summertime Sniffles? En español ... more unfair than catching a cold when it’s warm? How can cold symptoms arise when it’s not ...
Americium-241 in bile and feces
International Nuclear Information System (INIS)
LoSasso, T.; Cohen, N.; Wrenn, M.E.
1977-01-01
In order to investigate the relationship between the excretion of Am-241 in bile and in feces, two young adult female baboons underwent cholecystopexy surgery to facilitate gallbladder bile sampling by needle puncture through the abdominal wall. Am-241 was injected intravenously in citrate form at dose levels of 0.090 and 0.098 μCi/kg. It has been observed that concentrations of Am-241 in bile increase gradually at early times post injection, reach a peak at 3 to 5 weeks and then decrease slowly over a period of several months, similar to the pattern of Am-241 excretion in feces. At times greater than one week post Am-241 injection, there is a 1 : 1 correlation between the activity measured in bile and that which appears in the feces a few days later, indicating that Am-241 excreted in feces represents elimination primarily from liver and that significant reabsorption by the intestines does not occur as is true for other bile constituents. At earlier times, less than one week post injection, Am-241 appears in feces via other pathways in addition to the biliary route
Tank characterization report for single-shell Tank 241-B-110
International Nuclear Information System (INIS)
Amato, L.C.; De Lorenzo, D.S.; DiCenso, A.T.; Rutherford, J.H.; Stephens, R.H.; Heasler, P.G.; Brown, T.M.; Simpson, B.C.
1994-08-01
Single-shell Tank 241-B-110 is an underground storage tank containing radioactive waste. The tank was sampled at various times between August and November of 1989 and later in April of 1990. The analytical data gathered from these sampling efforts were used to generate this Tank Characterization Report. Tank 241-B-110, located in the 200 East Area B Tank Farm, was constructed in 1943 and 1944, and went into service in 1945 by receiving second cycle decontamination waste from the B and T Plants. During the service life of the tank, other wastes were added including B Plant flush waste, B Plant fission product waste, B Plant ion exchange waste, PUREX Plant coating waste, and waste from Tank 241-B-105. The tank currently contains 246,000 gallons of non-complexed waste, existing primarily as sludge. Approximately 22,000 gallons of drainable interstitial liquid and 1,000 gallons of supernate remain. The solid phase of the waste is heterogeneous, for the top layer and subsequent layers have significantly different chemical compositions and are visually distinct. A complete analysis of the top layer has not been done, and auger sampling of the top layer is recommended to fully characterize the waste in Tank 241-B-110. The tank is not classified as a Watch List tank; however, it is a Confirmed Leaker, having lost nearly 10,000 gallons of waste. The waste in Tank 241-B-110 is primarily precipitated salts, some of which are composed of radioactive isotopes. The most prevalent analytes include water, bismuth, iron, nitrate, nitrite, phosphate, silicon, sodium, and sulfate. The major radionuclide constituents are 137 Cs and 90 Sr
49 CFR 241.17 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 241.17 Section 241.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... OPERATIONS § 241.17 Preemptive effect. Under 49 U.S.C. 20106, the regulations in this part preempt any State...
10 CFR 600.241 - Financial reporting.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Financial reporting. 600.241 Section 600.241 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative....241 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this...
Catch shares slow the race to fish
Birkenbach, Anna M.; Kaczan, David J.; Smith, Martin D.
2017-04-01
In fisheries, the tragedy of the commons manifests as a competitive race to fish that compresses fishing seasons, resulting in ecological damage, economic waste, and occupational hazards. Catch shares are hypothesized to halt the race by securing each individual’s right to a portion of the total catch, but there is evidence for this from selected examples only. Here we systematically analyse natural experiments to test whether catch shares reduce racing in 39 US fisheries. We compare each fishery treated with catch shares to an individually matched control before and after the policy change. We estimate an average policy treatment effect in a pooled model and in a meta-analysis that combines separate estimates for each treatment-control pair. Consistent with the theory that market-based management ends the race to fish, we find strong evidence that catch shares extend fishing seasons. This evidence informs the current debate over expanding the use of market-based regulation to other fisheries.
12 CFR 335.241 - Unlisted trading.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Unlisted trading. 335.241 Section 335.241 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY SECURITIES OF NONMEMBER INSURED BANKS § 335.241 Unlisted trading. The provisions of the applicable and...
42 CFR 413.241 - Pharmacy arrangements.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Pharmacy arrangements. 413.241 Section 413.241... Disease (ESRD) Services and Organ Procurement Costs § 413.241 Pharmacy arrangements. Effective January 1, 2011, an ESRD facility that enters into an arrangement with a pharmacy to furnish renal dialysis...
FAM20A mutations can cause enamel-renal syndrome (ERS.
Directory of Open Access Journals (Sweden)
Shih-Kai Wang
Full Text Available Enamel-renal syndrome (ERS is an autosomal recessive disorder characterized by severe enamel hypoplasia, failed tooth eruption, intrapulpal calcifications, enlarged gingiva, and nephrocalcinosis. Recently, mutations in FAM20A were reported to cause amelogenesis imperfecta and gingival fibromatosis syndrome (AIGFS, which closely resembles ERS except for the renal calcifications. We characterized three families with AIGFS and identified, in each case, recessive FAM20A mutations: family 1 (c.992G>A; g.63853G>A; p.Gly331Asp, family 2 (c.720-2A>G; g.62232A>G; p.Gln241_Arg271del, and family 3 (c.406C>T; g.50213C>T; p.Arg136* and c.1432C>T; g.68284C>T; p.Arg478*. Significantly, a kidney ultrasound of the family 2 proband revealed nephrocalcinosis, revising the diagnosis from AIGFS to ERS. By characterizing teeth extracted from the family 3 proband, we demonstrated that FAM20A(-/- molars lacked true enamel, showed extensive crown and root resorption, hypercementosis, and partial replacement of resorbed mineral with bone or coalesced mineral spheres. Supported by the observation of severe ectopic calcifications in the kidneys of Fam20a null mice, we conclude that FAM20A, which has a kinase homology domain and localizes to the Golgi, is a putative Golgi kinase that plays a significant role in the regulation of biomineralization processes, and that mutations in FAM20A cause both AIGFS and ERS.
Catch statistics for belugas in West Greenland 1862 to 1999
Directory of Open Access Journals (Sweden)
MP Heide-Jørgensen
2002-07-01
Full Text Available Information and statistics including trade statistics on catches of white whales or belugas (Delphinapterus leucas in West Greenland since 1862 are presented. The period before 1952 was dominated by large catches south of 66o N that peaked with 1,380 reported kills in 1922. Catch levels in the past five decades are evaluated on the basis of official catch statistics, trade in mattak (whale skin, sampling of jaws and reports from local residents and other observers. Options are given for corrections of catch statistics based upon auxiliary statistics on trade of mattak, catches in previous decades for areas without reporting and on likely levels of loss rates in different hunting operations. The fractions of the reported catches that are caused by ice entrapments of whales are estimated. During 1954-1999 total reported catches ranged from 216 to 1,874 and they peaked around 1970. Correcting for underreporting and killed-but-lost whales increases the catch reports by 42% on average for 1954-1998. If the whales killed in ice entrapments are removed then the corrected catch estimate is on average 28% larger than the reported catches.
24 CFR 241.1235 - Cross default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross default. 241.1235 Section 241... Rights and Obligations § 241.1235 Cross default. In the event the borrower commits a default under a prior recorded insured mortgage and the holder thereof initiates a foreclosure proceeding, said default...
20 CFR 633.311 - Management information systems.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Management information systems. 633.311... AND SEASONAL FARMWORKER PROGRAMS Program Design and Administrative Procedures § 633.311 Management information systems. All grantees shall establish and maintain a program and financial management system which...
41 CFR 101-26.311 - Frustrated shipments.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Frustrated shipments. 101-26.311 Section 101-26.311 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND...
31 CFR 515.311 - Property; property interests.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Property; property interests. 515.311 Section 515.311 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE... way of limitation, money, checks, drafts, bullion, bank deposits, savings accounts, debts...
DEFF Research Database (Denmark)
Figueroa, Jonine D; Garcia-Closas, Montserrat; Humphreys, Manjeet
2011-01-01
A genome-wide association study (GWAS) identified single-nucleotide polymorphisms (SNPs) at 1p11.2 and 14q24.1 (RAD51L1) as breast cancer susceptibility loci. The initial GWAS suggested stronger effects for both loci for estrogen receptor (ER)-positive tumors. Using data from the Breast Cancer As...
Am-241 buildup in nematode organisms
International Nuclear Information System (INIS)
Martyushov, V.Z.; Tarasov, O.V.
1990-01-01
The process of Am-241 intake into earthworm organisms from chernozem leached in their presence in soil contaminated with this radionuclide is studied. The data on Am-241 buildup values during long-time radionuclide intake into earthworm organisms from soil are given. It s shown that Am-241 buildup in earthworm organisms do not exceed its concentration in soil for the whole observation period (as Am-241 presents in soil in state unavailable for animals). Intensive extraction of the radionuclide from the organisms is observed when earthworm contacts with soil are stopped
Thailand's Missing Marine Fisheries Catch (1950–2014
Directory of Open Access Journals (Sweden)
Brittany Derrick
2017-12-01
Full Text Available Overexploitation of marine resources has led to declining catches in many countries worldwide, and often also leads to fishing effort being exported to waters of neighboring countries or high seas areas. Thailand is currently under pressure to curb illegal fishing and human rights violations within its distant water fleets or face a European Union import ban. Simultaneously, Thailand is attempting to reduce fishing effort within its Exclusive Economic Zone (EEZ. Crucial to these endeavors is a comprehensive knowledge of total fisheries catches over time. A reconstruction of fisheries catches within Thailand's EEZ and by Thailand's fleet in neighboring countries' EEZs was undertaken for 1950–2014 to derive a comprehensive historical time series of total catches. This includes landings and discards that were not accounted for in official, reported statistics. Reconstructed Thai catches from within Thailand's EEZ increased from approximately 400,000 t·year−1 in 1950 to a peak of 2.6 million t·year−1 in 1987, before declining to around 1.7 million t·year−1 in 2014. Catches taken by Thai vessels outside their own EEZ increased from 52,000 t·year−1 in 1965 to a peak of 7.6 million t·year−1 in 1996, before declining to around 3.7 million t·year−1 by 2014. In total, reconstructed catches were estimated to be nearly three times larger than data reported by Thailand to the Food and Agriculture Organization of the United Nations (FAO. Reconstructed Thai distant-water fleet catches were almost seven times higher than the comparable non-domestic catch deemed reported for Thailand. Thai landings from recreational fishing were conservatively estimated for the first time, and while they contributed less than 1% of current catch, they can be expected to grow in volume and importance with increasing tourism. As Thailand takes measures to reduce fishing effort within its EEZs and increases monitoring and enforcement of illegal and foreign
Tank characterization report for double-shell tank 241-AP-105
International Nuclear Information System (INIS)
DeLorenzo, D.S.; Simpson, B.C.
1994-01-01
Double-Shell Tank 241-AP-105 is a radioactive waste tank most recently sampled in March of 1993. Sampling and characterization of the waste in Tank 241-AP-105 contributes toward the fulfillment of Milestone M-44-05 of the Hanford Federal Facility Agreement and Consent Order (Ecology, EPA, and DOE, 1993). Characterization is also needed tot evaluate the waste's fitness for safe processing through an evaporator as part of an overall waste volume reduction program. Tank 241-AP-105, located in the 200 East Area AP Tank Farm, was constructed and went into service in 1986 as a dilute waste receiver tank; Tank 241AP-1 05 was considered as a candidate tank for the Grout Treatment Facility. With the cancellation of the Grout Program, the final disposal of the waste in will be as high- and low-level glass fractions. The tank has an operational capacity of 1,140,000 gallons, and currently contains 821,000 gallons of double-shell slurry feed. The waste is heterogeneous, although distinct layers do not exist. Waste has been removed periodically for processing and concentration through the 242-A Evaporator. The tank is not classified as a Watch List tank and is considered to be sound. There are no Unreviewed Safety Questions associated with Tank 241-AP-105 at this time. The waste in Tank 241-AP-105 exists as an aqueous solution of metallic salts and radionuclides, with limited amounts of organic complexants. The most prevalent soluble analytes include aluminum, potassium, sodium, hydroxide, carbonate, nitrate, and nitrite. The calculated pH is greater than the Resource Conservation and Recovery Act established limit of 12.5 for corrosivity. In addition, cadmium, chromium, and lead concentrations were found at levels greater than their regulatory thresholds. The major radionuclide constituent is 137 Cs, while the few organic complexants present include glycolate and oxalate. Approximately 60% of the waste by weight is water
33 CFR 136.311 - Types of advertisement.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Types of advertisement. 136.311... PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT Designation of Source and Advertisement § 136.311 Types of advertisement. Advertisement required by the Director, NPFC, will normally include one or more of...
International Nuclear Information System (INIS)
Kamemoto, Takashi; Nishiyama, Tadao
1995-01-01
Since gravity, viscous force, surface tension and so on are related simultaneously to the inertia force of flow, in gas catching phenomena, it is often difficult to grasp exactly its similarity. At the time of designing actual equipment, careful model test is required, and the validity of the evaluation by model test for applying it to actual machines sometimes becomes a problem. In this research, for the purpose of elucidating the essential mechanism of the gas-catching phenomena by vortices, and obtaining the knowledge useful for the probability of the method of evaluating the limit of gas catching, the knowledge obtained so far on the similarity law and model testing method related to the air catching by vortices was put in order, and vortex structure and basic gas-catching process were observed by water flow visualizing experiment, thus the noteworthy flow characteristics for clarifying the essential mechanism of the phenomena were obtained. The main knowledges on the air catching by vortices obtained so far, the experiment of visualizing vortices using water flow and the experimental results are reported. (K.I.)
Vision Based Tracker for Dart-Catching Robot
Linderoth, Magnus; Robertsson, Anders; Åström, Karl; Johansson, Rolf
2009-01-01
This paper describes how high-speed computer vision can be used in a motion control application. The specific application investigated is a dart catching robot. Computer vision is used to detect a flying dart and a filtering algorithm predicts its future trajectory. This will give data to a robot controller allowing it to catch the dart. The performance of the implemented components indicates that the dart catching application can be made to work well. Conclusions are also made about what fea...
Yields of Selected Catch Crops in Dry Conditions
Directory of Open Access Journals (Sweden)
Martina Handlířová
2016-01-01
Full Text Available Catch crops mainly reduce soil erosion and leaching of nutrients as well as enrich the soil organic matter. The aim of this research is to evaluate the yields of catch crops of Sinapis alba, Phacelia tanacetifolia, Fagopyrum esculentum, Carthamus tinctorius and Secale cereale v. multicaule, and thus determine the possible applicability of catch crops in areas with high average annual temperature and low precipitation totals. The small-plot field experiment was performed on clay-loam gleyic fluvisol at the Field Experimental Station in Žabčice, Southern Moravia, Czech Republic, within the period of 2006-2014. The catch crops were set up after winter wheat in mid-August. The results have shown a statistically significant difference among different catch crops in yield of dry matter and even among years. The yield of catch crops is mainly dependent on a sufficient supply of water in the soil and the appropriate amount and distribution of rainfall over the growing season. Sinapis alba and Phacelia tanacetifolia regularly reached the highest yields. High yields were also achieved with Fagopyrum esculentum. Due to the method of crop rotation in the Czech Republic, with a predominance of Brassica napus var. napus, it is inappropriate to include Sinapis alba. It is the best to grow Phacelia tanacetifolia and even Fagopyrum esculentum, or a mixture thereof, depending on the use of catch crops.
Determination of 241Am in reindeer bone
International Nuclear Information System (INIS)
Tahtinen, P.; Hakanen, M.; Jaakkola, T.; Nikula, A.
1978-01-01
The purpose of this work was to develop a procedure to separate americium from other alpha active nuclides present in reindeer bone samples, especially 228 Th and its daughter nuclides. The 241 Am-spectrum of a reindeer bone sample analyzed using the proposed method is given. The α-spectrum was measured one week after electrodeposition. The absence of the alpha peak of 224 Ra, the daughter nuclide of 228 Th, indicates that no 228 Th was electrodeposited onto the platinum disc. Four reindeer bone samples were analyzed for 241 Am using the method developed. The 241 Am/ 239 240 Pu activity ratio in reindeer bone was 0.9 :- 0.4. These results indicate that compared to plutonium, americium is accumulated in reindeer bone more heavily than in liver. All 241 Am values presented are concentrations at the time of radioassay, and no correction has been made for the ingrowth of 241 Am formed by the decay of 241 Pu during stockpilling. However, all 241 Am determinations were made 1 to 3 yrs after sample collection, and thus the corrections due to the ingrowth can be considered slight. About 60% of plutonium body burden is located in liver and 20% in skeleton. The activity ratio 241 Am/ 239 240 Pu in these animals was about 0.2 and 1.0 in liver and skeleton, respectively. This indicates that about 60% of the 241 Am body burden is located in skeleton and about 30% in liver. It can be roughly estimated that the whole-body activity of 241 Am is thus about 40% of the 239 240 Pu body burden
Biosorption of americium-241 by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Liao Jiali
2003-01-01
As an important radioisotope in nuclear industry and other fields, americium-241 is one of the most serious contamination concerns duo to its high toxicity and long half-life. In this experiment, the biosorption of 241 Am from solution by Candida sp., and the effects of various experimental conditions on the adsorption were investigated. The preliminary results showed that the adsorption of 241 Am by Candida sp. was efficient. 241 Am could be removed by Candida sp. of 0.82 g/L (dry weight) from 241 Am solutions of 5.6-111 MBq/L (44.3-877.2 μg/L)(C 0 ), with maximum adsorption rate (R) of 98% and maximum adsorption capacities (W) of 63.5 MBq/g biomass (dry weight) (501.8 μg/g). The biosorption equilibrium was achieved within 4 hour and the optimum pH was pH = 2. No significant differences on 241 Am adsorption were observed at 10 C-45 C, or in solutions containing Au 3+ or Ag + , even 1500 times or 4500 times above the 241 Am concentration, respectively. The relationship between concentrations and adsorption capacities of 241 Am indicated the biosorption process should be described by a Langmuir adsorption isotherm. (orig.)
Synthesis of underreported small-scale fisheries catch in Pacific island waters
Zeller, D.; Harper, S.; Zylich, K.; Pauly, D.
2015-03-01
We synthesize fisheries catch reconstruction studies for 25 Pacific island countries, states and territories, which compare estimates of total domestic catches with officially reported catch data. We exclude data for the large-scale tuna fleets, which have largely foreign beneficial ownership, even when flying Pacific flags. However, we recognize the considerable financial contributions derived from foreign access or charter fees for Pacific host countries. The reconstructions for the 25 entities from 1950 to 2010 suggested that total domestic catches were 2.5 times the data reported to FAO. This discrepancy was largest in early periods (1950: 6.4 times), while for 2010, total catches were 1.7 times the reported data. There was a significant difference in trend between reported and reconstructed catches since 2000, with reconstructed catches declining strongly since their peak in 2000. Total catches increased from 110,000 t yr-1 in 1950 (of which 17,400 t were reported) to a peak of over 250,000 t yr-1 in 2000, before declining to around 200,000 t yr-1 by 2010. This decrease is driven by a declining artisanal (small-scale commercial) catch, which was not compensated for by increasing domestic industrial (large-scale commercial) catches. The artisanal fisheries appear to be declining from a peak of 97,000 t yr-1 in 1992 to less than 50,000 t yr-1 by 2010. However, total catches were dominated by subsistence (small-scale, non-commercial) fisheries, which accounted for 69 % of total catches, with the majority missing from the reported data. Artisanal catches accounted for 22 %, while truly domestic industrial fisheries accounted for only 6 % of total catches. The smallest component is the recreational (small-scale, non-commercial and largely for leisure) sector (2 %), which, although small in catch, is likely of economic importance in some areas due to its direct link to tourism income.
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
International Nuclear Information System (INIS)
BLACKER, S.M.
2000-01-01
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
Energy Technology Data Exchange (ETDEWEB)
BLACKER, S.M.
2000-04-13
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented.
InterCatch - a tool for fish stock assessment, status and methods
DEFF Research Database (Denmark)
Kjems-Nielsen, Henrik; Larsen, Lena Inger; Zarecki, Maria
2006-01-01
InterCatch is a web-based system for handling fish stock assessment data focusing on documenting characteristics of the catches. These national fish stock data are uploaded to InterCatch by national data submitters. After all data are uploaded the stock coordinators (working for the fish stock as...... assessment group) can then check and set up allocation schemes for unsampled catches. After applying the best allocation scheme to the unsampled catches, the catch data are aggregated as required and exported for analysis, e.g. XSA or ICA....
International Nuclear Information System (INIS)
Crawford, B.A.
1996-01-01
This test plan describes a sample separation method which will be used to obtain physical measurements and separated 241-C-106 solids and supernate fractions. In addition compatibility of tank 241-C-106 sludge with tank 241-AY-102 supernate will be determined
Biosorption of 241Am by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Hua Xinfeng
2003-01-01
The biosorption of radionuclide 241 Am from solutions by Candida sp., and the influences of experimental conditions on the adsorption were studied. The results showed that the adsorption equilibrium was achieved within 4h and the optimum pH=2. No significant differences on 241 Am biosorption were observed at 10-45 degree C, or challenged with Au 3+ or Ag + , even 1500 times or 4500 times over 241 Am, respectively. The adsorption rate could reach 97.8% by dry Candida sp. of 0.82 g/L in 241 Am solutions (pH=2) of 5.6-111 MBq/L (44.04-873.0 μg/L) (C 0 ), with maximum adsorption capacity (W) of 63.5 MBq/g (501.8 μg/g), implying that the removal of 241 Am by Candida sp. from solutions was feasible. The relationship between activities (C 0 ) and adsorption capacities (W) of 241 Am indicated that the biosorption process could be described by Langmuir adsorption isotherm
9 CFR 311.30 - Livestock suffocated and hogs scalded alive.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Livestock suffocated and hogs scalded alive. 311.30 Section 311.30 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT... PARTS § 311.30 Livestock suffocated and hogs scalded alive. All livestock which have been suffocated in...
Rab7a modulates ER stress and ER morphology.
Mateus, Duarte; Marini, Elettra Sara; Progida, Cinzia; Bakke, Oddmund
2018-05-01
The Endoplasmic Reticulum (ER) is a membranous organelle with diverse structural and functional domains. Peripheral ER includes interconnected tubules, and dense tubular arrays called "ER matrices" together with bona fide flat cisternae. Transitions between these states are regulated by membrane-associated proteins and cytosolic factors. Recently, the small GTPases Rab10 and Rab18 were reported to control ER shape by regulating ER dynamics and fusion. Here, we present evidence that another Rab protein, Rab7a, modulates the ER morphology by controlling the ER homeostasis and ER stress. Indeed, inhibition of Rab7a expression by siRNA or expression of the dominant negative mutant Rab7aT22 N, leads to enlargement of sheet-like ER structures and spreading towards the cell periphery. Notably, such alterations are ascribable neither to a direct modulation of the ER shaping proteins Reticulon-4b and CLIMP63, nor to interactions with Protrudin, a Rab7a-binding protein known to affect the ER organization. Conversely, depletion of Rab7a leads to basal ER stress, in turn causing ER membrane expansion. Both ER enlargement and basal ER stress are reverted in rescue experiments by Rab7a re-expression, as well as by the ER chemical chaperone tauroursodeoxycholic acid (TUDCA). Collectively, these findings reveal a new role of Rab7a in ER homeostasis, and indicate that genetic and pharmacological ER stress manipulation may restore ER morphology in Rab7a silenced cells. Copyright © 2018 Elsevier B.V. All rights reserved.
Biosorption of americium-241 by immobilized Rhizopus arrihizus
International Nuclear Information System (INIS)
Liao Jiali; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji
2004-01-01
Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove 241 Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting 241 Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb 241 Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of 241 Am was removed from 241 Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of 241 Am. At this time, the total adsorption of 241 Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed 241 Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO 3
Plant uptake and transport of 241Am
International Nuclear Information System (INIS)
Wallace, A.; Romney, E.M.; Mueller, R.T. Sr.; soufi, S.M.
1981-01-01
We conducted several experiments with 241 Am to obtain a more complete understanding of how this transuranium element is absorbed and transported in plants. In a plant species (Tamarix pentandra Pall.) that has salt glands in the leaves excreting NaCl and other ions, 241 Am was not pumped through these glands. Cyanide, which forms complexes with any metals, when applied to a calcareous soil, greatly increased the transport of 241 Am into stems and leaves of bush bean plants. Radioactive cyanide ( 14 C) was also transported to leaves and stems. When radish was grown in both calcareous and noncalcareous soils, 241 Am appeared to be fixed on the peel so firmly that it was resistant to removal by HNO 3 washing. The chelating agent DTPA induced increased transport of 241 Am to leaves and into the fleshy roots of the radish. Data for Golden Cross hybrid corn grown in solution culture showed at least seven times as much 241 Am transport to the xylem exudatields are corrected by recovery of added tracers
Wei, Dongbo; Zhang, Pingze; Liu, Yingchao; Chen, Xiaohu; Ding, Feng; Li, Fengkun
2018-02-01
The Zr coating and Zr-Er coating are grown on TC11 substrate by double-glow plasma surface metallurgy technique, followed by the wear tests at ambient temperature and 500 °C. The data of nanohardness and elastic modulus of the samples are collected by the nano-indentation test. The adhesion strength of coatings is investigated by means of the scratch test. The study of wear resistance is performed using a ball-on-disc wear test system by running against the Si3N4 ball and measured by scanning electron microscope (SEM) and X-ray diffraction (XRD). Experimental results indicate that the nanohardness of the Zr coating and Zr-Er coating are 5.94 GPa and 7.98 GPa, respectively, which are 1.79 times and 2.41 times greater than that of TC11 substrate. Zr coating and Zr-Er coating realize the metallurgical bonding with TC11 substrate with continuous and compact structure. Compared with the Zr coating and TC11, the Zr-Er coating presents the lowest specific wear rates, which are 1.689 × 10-6 mm3 Nm-1 and 1.851 × 10-6 mm3 Nm-1 at ambient temperature and 500 °C respectively, indicating the excellent and improved wear resistance of TC11.
22 CFR 311.205 - Professional and technical services.
2010-04-01
... and analysis directly applying any professional or technical discipline. For example, drafting of a... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Professional and technical services. 311.205... § 311.205 Professional and technical services. (a) The prohibition on the use of appropriated funds, in...
Selection of lamp reflector construction and fishing time of lift net
Directory of Open Access Journals (Sweden)
Gondo Puspito
2017-06-01
Full Text Available This study aimed to determine lift net’s lamp reflector construction which is able to give highest weight on catch and determine the best fishing time. Three lamp reflector constructions were made of cylinder shape for one construction and cone shape with opening angle α = 62° and 90° for two others. The dimension (øR × HR for each reflector are 30 × 37 (cm, 40 × 18 (cm and 40 × 39.62 (cm. Each lamp reflector was being operated by 1 lift net for 15 nights. Total fishing operations were twice per night within interval 07.00–12.00 PM and 00.00–05.00 AM. Results of the catch gave 2 schools of fish which were plankton feeders and predators. Plankton feeders included anchovy Stolephorus spp. 477 kg, mackerel (Rastrelliger spp. 1934 kg, and malayan half (Decapterus sp. 15.5 kg. Predators consisted of hairtail (Trichiurus sp. 982 kg, yellowstrip scad (Selaroides spp. 29 kg, and giant trevally (Caranx sp. 26.3 kg. The lift net which operated lamp reflector of α = 90° has the highest catch of 2,307.8 kg, while the lamp reflector of α = 62° has 1895 kg of catch. The one with cylinder shape has 1261 kg of catch.
9 CFR 311.29 - Unborn and stillborn animals.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Unborn and stillborn animals. 311.29 Section 311.29 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Unborn and stillborn animals. All unborn and stillborn animals shall be condemned and no hide or skin...
31 CFR 587.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 587.311... MONTENEGRO) MILOSEVIC SANCTIONS REGULATIONS General Definitions § 587.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity (including its foreign branches) that is engaged...
31 CFR 547.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 547.311... REGULATIONS General Definitions § 547.311 U.S. financial institution. The term U.S. financial institution... financial institutions that are located in the United States, but not such institutions' foreign branches...
31 CFR 544.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 544.311... SANCTIONS REGULATIONS General Definitions § 544.311 U.S. financial institution. The term U.S. financial... financial institutions that are located in the United States, but not such institutions' foreign branches...
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
International Nuclear Information System (INIS)
Girardot, Crystal L.; Harlow, Donald G.
2014-01-01
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L. [Washington River Protection Solutions (United States); Harlow, Donald G. [Washington River Protection Solutions (United States)
2014-01-08
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
50 CFR 660.311 - Open access fishery-definitions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Open access fishery-definitions. 660.311... Groundfish-Open Access Fisheries § 660.311 Open access fishery—definitions. General definitions for the... specific to the open access fishery covered in this subpart and are in addition to those specified at § 660...
14 CFR 125.311 - Flight crewmembers at controls.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight crewmembers at controls. 125.311... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight Operations § 125.311 Flight crewmembers at controls. (a) Except as provided in paragraph (b) of this section, each...
31 CFR 546.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 546.311... Definitions § 546.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices, and agencies of foreign financial institutions that are...
31 CFR 548.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 548.311... Definitions § 548.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity... foregoing. This term includes those branches, offices, and agencies of foreign financial institutions that...
31 CFR 542.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 542.311... Definitions § 542.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices and agencies of foreign financial institutions that are...
31 CFR 541.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 541.311... Definitions § 541.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices and agencies of foreign financial institutions that are...
31 CFR 588.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 588.311... General Definitions § 588.311 U.S. financial institution. The term U.S. financial institution means any U... financial institutions that are located in the United States, but not such institutions' foreign branches...
31 CFR 543.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 543.311... Definitions § 543.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices and agencies of foreign financial institutions that are...
Examination report: Remote video examination of air slots under the primary tank at 241-AN-107
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This report documents the results of remote video examination of air slots in the insulating concrete slab beneath the primary tank at 241-AN-107. Life Extension Equipment Engineering has selected tank 241-AN-107 for ultrasonic evaluation of tank wall, knuckle, and floor plates. Access to the primary tank floor plates is via the air slots which were formed into the insulating concrete slab during tank construction (reference drawings H-2-71105 and H-2-71160). Prior to deployment of the ultrasonic inspection equipment it is desirable to examine the air slots for obstructions and debris which could impede the ultrasonic equipment. The criteria, equipment description, deliverables, and responsibilities for examination of the air slots are described in HNF-1949, Rev. 0, ''Engineering Task Plan for Remote Video Examination of Air Slots Under the Primary Tank at 241-AN-107''
9 CFR 93.311 - Milk from quarantined horses.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Milk from quarantined horses. 93.311... FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Horses § 93.311 Milk from quarantined horses. Milk or cream from horses quarantined under the provisions of this part shall not be used by any person other...
Project W-314 241-AN-A valve pit upgrade acceptance for beneficial use
Energy Technology Data Exchange (ETDEWEB)
HAMMERS, J.S.
1999-07-21
This report identifies the responsibilities and requirements, applicable to the 241-AN-A Valve Pit Upgrades portion of Project W-314, for Acceptance for Beneficial Use in accordance with HNF-IP-0842, Vol IV, Sec 3.12. At project turnover, the end user accepts the affected Structures, Systems, and Components (SSCs) for beneficial use. This checklist is used to help the end user ensure that all documentation, training, and testing requirements are met prior to turnover. This checklist specifically identifies those items related to the upgrading of the 241-AN-A valve pit. The upgrades include: the installation of jumper/valve manifolds with position sensors, replacement pit leak detection systems, construction of replacement cover blocks, and electrical upgrades to support the instrumentation upgrades.
Project W-314 241-AN-A valve pit upgrade acceptance for beneficial use
International Nuclear Information System (INIS)
HAMMERS, J.S.
1999-01-01
This report identifies the responsibilities and requirements, applicable to the 241-AN-A Valve Pit Upgrades portion of Project W-314, for Acceptance for Beneficial Use in accordance with HNF-IP-0842, Vol IV, Sec 3.12. At project turnover, the end user accepts the affected Structures, Systems, and Components (SSCs) for beneficial use. This checklist is used to help the end user ensure that all documentation, training, and testing requirements are met prior to turnover. This checklist specifically identifies those items related to the upgrading of the 241-AN-A valve pit. The upgrades include: the installation of jumper/valve manifolds with position sensors, replacement pit leak detection systems, construction of replacement cover blocks, and electrical upgrades to support the instrumentation upgrades
38 CFR 3.311 - Claims based on exposure to ionizing radiation.
2010-07-01
... to ionizing radiation. 3.311 Section 3.311 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF... Evaluations; Service Connection § 3.311 Claims based on exposure to ionizing radiation. (a) Determinations of... to ionizing radiation in service, an assessment will be made as to the size and nature of the...
Tank characterization report for single-shell tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204
International Nuclear Information System (INIS)
Simpson, B.C.
1998-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, in addition to other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for the single-shell tank series consisting of 241-T-201, -T-202, -T-203, and -T-204. The objectives of this report are: (1) to use characterization data in response to technical issues associated with T-200 series tank waste and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. Appendix A contains historical information for 241-T-201 to T-204, including surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge-based computer program. Appendix B summarizes sampling events, sample data obtained before 1989, and the most current sampling results. Appendix C reports the statistical analysis and numerical manipulation of data used in issue resolution. Appendix D contains the evaluation to establish the best-basis for the inventory estimate and the statistical analysis performed for this evaluation. Appendix E is a bibliography that resulted from an in-depth literature search of all known information sources applicable to tanks 241-T-201, -T-202, -T-203, and -T-204. The reports listed in Appendix E are available in the Tank Characterization and Safety Resource Center
China-United States Productivity Catch-Up
DEFF Research Database (Denmark)
Deng, Paul Duo; Jefferson, Gary H.
China’s gap in industrial labor productivity with the United States has been steadily shrinking over recent decades. In this paper we examine the main sources of gap reduction and the potential for further catch-up. Using Chinese above-scale firm-level data during 1998-2007 period and BEA industry...... -level data in the US, we first document the respective rates of growth of labor productivity, gap reduction, and contributions to overall catch-up of China’s manufacturing sector during 1998-2007. We then aggregate the firm-level data to the 3-digit industry level to estimate a productivity gap...... reduction function and find that the key drivers for the productivity convergence are the initial technology gap, increased R&D spending, firm’s ownership restructuring, and industry level entry-exit ratio, a measure of competitive dynamism. A key finding is that the catch-up dynamic entails the break out...
Investigation of Tank 241-AN-101 Floating Solids
Energy Technology Data Exchange (ETDEWEB)
Kraft, Douglas P. [Washington River Protection Solutions, LLC, Richland, VA (United States); Meznarich, H. K. [Washington River Protection Solutions, LLC, Richland, VA (United States)
2017-10-30
Tank 241-AN-101 is the receiver tank for retrieval of several C-Farms waste tanks, including Tanks 241-C-102 and 241-C-111. Tank 241 C 111 received first-cycle decontamination waste from the bismuth phosphate process and Plutonium and Uranium Extraction cladding waste, as well as hydraulic fluid. Three grab samples, 1AN-16-01, 1AN-16-01A, and 1AN-16-01B, were collected at the surface of Tank 241-AN-101 on April 25, 2016, after Tank 241-C-111 retrieval was completed. Floating solids were observed in the three grab samples in the 11A hot cell after the samples were received at the 222-S Laboratory. Routine chemical analyses, solid phase characterization on the floating and settled solids, semivolatile organic analysis mainly on the aqueous phase for identification of degradation products of hydraulic fluids were performed. Investigation of the floating solids is reported.
International Nuclear Information System (INIS)
Rieck, C.A.
1996-02-01
This document provides a description of work for the design and construction of a waste retrieval system for Tank 241-SY-102. The description of work includes a working estimate and schedule, as well as a narrative description and sketches of the waste retrieval system. The working estimate and schedule are within the established baselines for the Tank 241-SY-102 retrieval system. The technical baseline is provided in Functional Design Criteria, WHC-SD-W211-FDC-001, Revision 2
50 CFR 31.1 - Determination of surplus wildlife populations.
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Determination of surplus wildlife populations. 31.1 Section 31.1 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR (CONTINUED) THE NATIONAL WILDLIFE REFUGE SYSTEM WILDLIFE SPECIES MANAGEMENT Surplus...
Mapping Lake Michigan Fish Catch Data
Wodd, Jacob; Doucette, Jarrod; Höök, Tomas O.
2014-01-01
The only Great Lake completely contained in the U.S., Lake Michigan offers an abundance of recreational fishing. This project takes 20 years’ worth of salmonid fish catch data, and uses GIS to organize and visually represent the data in a way that is meaningful and helpful to local fisherman and researchers. Species represented included Brown Trout, Lake Trout, Rainbow Trout, Chinook Salmon, and Coho Salmon. The species are organized by both decadal and yearly spans, as well as catch per t...
24 CFR 241.1245 - Insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.1245... Rights and Obligations § 241.1245 Insurance endorsement. (a) Endorsement. The Commissioner shall indicate his insurance of the equity loan or acquisition loan by endorsing the original credit instrument and...
Magnetic phase transitions in Er7Rh3 studied on single crystals
International Nuclear Information System (INIS)
Tsutaoka, Takanori; Obata, Keisuke; Cheyvuth, Seng; Koyama, Keiichi
2014-01-01
Highlights: • Magnetic and electrical properties of Er 7 Rh 3 were studied on single crystals. • The magnetic phase diagram along the c-axis was constructed. • The field-induced magnetic transitions in Er 7 Rh 3 can be explained by the magnetic structure with two magnetic propagation vectors. • The anomalies of electrical resistivity can also be described by the magnetic structure in Er 7 Rh 3 . - Abstract: Magnetic phase transitions in Er 7 Rh 3 with the Th 7 Fe 3 type hexagonal structure have been studied on single crystals by measuring magnetization, magnetic susceptibility and electrical resistivity. Er 7 Rh 3 possesses antiferromagnetic state below T N = 13 K. In the ordered state, the two successive magnetic transitions at T t1 = 6.2 K and T t2 = 4.5 K were observed. Several field-induced magnetic transitions were also observed along the a- and c-axes below T N ; magnetic field H – temperature T phase diagram along the c-axis was constructed. The field-induced magnetic transitions in Er 7 Rh 3 can be explained by the magnetic structure with two magnetic propagation vectors which were derived by the previous neutron diffraction studies. Electrical resistivity shows humps just below the magnetic transition temperatures, T N and T t1 due to the super-zone gap formation at the Fermi level; these anomalies can also be described by the magnetic structure changes in Er 7 Rh 3
Innovation, catch-up, and leadership in science-based industries
Isabel Almudi; Francisco Fatas-Villafranca; Luis R. Izquierdo
2012-01-01
In this article, we seek to shed new light on the sources of industrial leadership and catch-up in science-based industries. We propose an evolutionary model that incorporates scientists' training and migration, endogenous R&D decisions, and the possibility of funding capital accumulation through debt. The analysis of the model allows us to characterize a robust pattern of industrial catch-up. Likewise, the sensitivity analysis shows which parameters act as pro-catch-up factors or slow down t...
10 CFR 600.311 - Standards for financial management systems.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Standards for financial management systems. 600.311... Requirements § 600.311 Standards for financial management systems. (a) Recipients are encouraged to use existing financial management systems to the extent that the systems comply with Generally Accepted...
24 CFR 241.570 - Insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.570... § 241.570 Insurance endorsement. (a) Initial endorsement. The Commissioner shall indicate his/her insurance of the mortgage by endorsing the original credit instrument and identifying the section of the Act...
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.241-94 Section 86.241-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...
Analysis of lifting beam and redesigned lifting lugs for 241-AZ-01A decant pump
International Nuclear Information System (INIS)
Coverdell, B.L.
1994-01-01
This supporting document details calculations for the proper design of a lifting beam and redesigned lifting lugs for the 241AZO1A decant pump. This design is in accordance with Standard Architectural-Civil Design Criteria, Design Loads for Facilities (DOE-RL 1989) and is safety class three. The design and fabrication is in accordance with American Institute of Steel Construction, Manual of Steel Construction, (AISC, 1989) and the Hanford Hoisting and Rigging Manual (DOE-RL 1993)
Determination of plutonium-241 half-life by mass spectrometric measurement
International Nuclear Information System (INIS)
Hiyama, Takashi; Wada, Yukio; Onishi, Koichi
1982-01-01
Much data for Pu-241 half-life have been reported, but these values range from 13.8 years to 15.1 years depending on investigators. In order to define the half-life of Pu-241, the half-life was calculated by analyzing the mass spectrometry data obtained in the author's laboratory over the past six years on Plutonium Isotopic Standard Reference Materials prepared at the National Bureau of Standards (NBS). The sample used for this work consisted of SRM-947 and SRM-948 prepared at NBS. Before mass spectrometric analysis, the plutonium aliquot was separated from its Am-241 daughter by anion exchange chromatography, since Am-241 is not distinguished from Pu-241 in the mass spectrometer. 241 Pu/ 239 Pu and 241 Pu/ 240 Pu ratios were calculated from the values of mass spectrometric measurement. From the relation of log N to time, the half-life of Pu-241 was determined, based on the slope using a least squares fit. The half-life of Pu-241 was estimated to be 14.29+-0.15 years. (Yoshitake, I.)
Distribution and Excretion of Am-241 in Rats
International Nuclear Information System (INIS)
Alatas, Z; Nurhayati, S; Rahardjo, T
1996-01-01
Determination of the activity content of Am-241 administered oral y in several organs and tissues of white rats including the excretion had been carried out. The observation of Am-241 activity was carried out through surgery and for the excretion of the radionuclide by collecting urine and faces. The surgeries were conducted on the 0 (6 hours), 1, 2, 3, 4, 5, 15 and 30th day post administration of 2.965 kBq Am-241, whereas the urine and faces collections were done every other day for 30 days using metabolism cage. The result indicated that the distribution of Am-241 which found in all tested organs/tissues with various fraction is considered as the initial distribution of Am-241 in rats. The content of americium in gastrointestinal tract and lung is relatively high within the first week post contamination. And, americium activities in other organs/tissues are various with time. The excretion of Am-241 is higher via feces than that of urin, i.e up to 20% in 30 days
Tank 241-C-103 headspace flammability
International Nuclear Information System (INIS)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report
Tank 241-C-103 headspace flammability
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.
24 CFR 241.885 - Insurance benefits.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 241.885 Section... § 241.885 Insurance benefits. (a) Method of payment. Payment of claims shall be made in the following... acceptable assignment of the note and security instrument to the Commissioner, the insurance benefits shall...
Estimating historical eastern North Pacific blue whale catches using spatial calling patterns.
Directory of Open Access Journals (Sweden)
Cole C Monnahan
Full Text Available Blue whales (Balaenoptera musculus were exploited extensively around the world and remain endangered. In the North Pacific their population structure is unclear and current status unknown, with the exception of a well-studied eastern North Pacific (ENP population. Despite existing abundance estimates for the ENP population, it is difficult to estimate pre-exploitation abundance levels and gauge their recovery because historical catches of the ENP population are difficult to separate from catches of other populations in the North Pacific. We collated previously unreported Soviet catches and combined these with known catches to form the most current estimates of North Pacific blue whale catches. We split these conflated catches using recorded acoustic calls from throughout the North Pacific, the knowledge that the ENP population produces a different call than blue whales in the western North Pacific (WNP. The catches were split by estimating spatiotemporal occurrence of blue whales with generalized additive models fitted to acoustic call patterns, which predict the probability a catch belonged to the ENP population based on the proportion of calls of each population recorded by latitude, longitude, and month. When applied to the conflated historical catches, which totaled 9,773, we estimate that ENP blue whale catches totaled 3,411 (95% range 2,593 to 4,114 from 1905-1971, and amounted to 35% (95% range 27% to 42% of all catches in the North Pacific. Thus most catches in the North Pacific were for WNP blue whales, totaling 6,362 (95% range 5,659 to 7,180. The uncertainty in the acoustic data influence the results substantially more than uncertainty in catch locations and dates, but the results are fairly insensitive to the ecological assumptions made in the analysis. The results of this study provide information for future studies investigating the recovery of these populations and the impact of continuing and future sources of anthropogenic
Sorption of 241Am by Aspergillus niger spore and hyphae
International Nuclear Information System (INIS)
Yuanyou Yang; Ning Liu; Jiali Liao; Jiannan Jin; Shunzhong Luo; Taiming Zhang; Pengji Zhao
2004-01-01
Biosorption of 241 Am by a fungus A. niger, including the spore and hyphae, was investigated. The preliminary results showed that the adsorption of 241 Am by the microorganism was efficient. More than 96% of the total 241 Am could be removed from 241 Am solutions of 5.6-111 MBq/l (C 0 ) by spore and hyphae of A. niger, with adsorbed 241 Am metal (Q) of 7.2-142.4 MBq/g biomass, and 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 hour and the optimum pH range was pH 1-3. No obvious effects on 241 Am adsorption by the fungus were observed at 10-45 deg C, or in solutions containing Au 3+ or Ag + , even 2000 times above the 241 Am concentration. The 241 Am biosorption by the fungus obeys the Freundlich adsorption equation. There was no significant difference between the adsorption behavior of A. niger spore and hyphae. (author)
Biogas production from catch crops
DEFF Research Database (Denmark)
Molinuevo-Salces, Beatriz; Larsen, Søren U.; Ahring, Birgitte Kiær
2013-01-01
, being in the ranges of 1.4–3.0 t ha−1 and 0.3–1.7 t ha−1 for Holstebro and Aabenraa, respectively. Specific methane yields were in the range of 229–450 m3 t−1 of VS. Methane yields per hectare of up to 800 m3 ha−1 were obtained, making catch crops a promising source of feedstock for manure-based biogas......Manure-based biogas plants in Denmark are dependent on high yielding biomass feedstock in order to secure economically feasible operation. The aim of this study was to investigate the potential of ten different catch crop species or mixtures as feedstock for biogas production in co...
9 CFR 311.8 - Cattle carcasses affected with anasarca or generalized edema.
2010-01-01
... anasarca or generalized edema. 311.8 Section 311.8 Animals and Animal Products FOOD SAFETY AND INSPECTION... ADULTERATED CARCASSES AND PARTS § 311.8 Cattle carcasses affected with anasarca or generalized edema. (a... characterized by an extensive or well-marked generalized edema shall be condemned. (b) Carcasses of cattle...
24 CFR 241.805 - Insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premiums. 241.805 Section... Without a HUD-Insured or HUD-Held Mortgage Premiums § 241.805 Insurance premiums. (a) First premium. The... insurance premium equal to one percent of the original face amount of the note. (b) Second premium. The...
32 CFR 311.7 - OSD/JS Privacy Office Processes.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false OSD/JS Privacy Office Processes. 311.7 Section...) PRIVACY PROGRAM OFFICE OF THE SECRETARY OF DEFENSE AND JOINT STAFF PRIVACY PROGRAM § 311.7 OSD/JS Privacy Office Processes. The OSD/JS Privacy Office shall: (a) Exercise oversight and administrative control of...
Analysis of the 241SY101 pump removal trailer and the 241SY101 strongback
International Nuclear Information System (INIS)
Coverdell, B.L.
1995-09-01
The purpose of the calculations contained in the attached appendix is to determine the vibrational stability of the following combination (The Combination); shipping container, strongback and trailer. The vibrational stability of The Combination will be determined with the shipping container and strongback in the upright position. If the natural frequency of The Combination coincides with the input frequency and no damping is present, resonance will occur. The result of this is that the natural frequency of the Combination must be calculated as well as the input frequency. The input frequency in this case is caused by wind. Due to their geometrical complexity the upper and lower hydraulic clevises were analyzed for structural adequacy by using finite-element analysis (FEA). The FEA software COSMOS/M version 1.70 was used to model the upper and lower hydraulic clevis. All designs are in accordance with Standard Architectural-Civil Design Criteria, Design Loads for Facilities (DOE-RL 1989) and are safety class 3. The design and fabrication of each component is in accordance with American Institute of Steel Construction, Manual of Steel Construction, (AISC, 1989). The analyses contained in this document reflects the as-built condition of the 241SY101 hydraulic trailer
Catch-up growth or regression to the mean? Recovery from stunting revisited.
Cameron, Noël; Preece, Michael A; Cole, Tim J
2005-01-01
An important question for policy is the extent to which catch-up growth can ease the impact of early stunting. Martorell et al. (1992) showed that stunted Guatemalan infants remain stunted into adulthood, whereas Adair (1999) found appreciable catch-up growth in Filipino children from 2-12 years. Both groups defined catch-up as an inverse correlation between early height and subsequent growth, but Martorell based the correlation on height, whereas Adair used height z scores. The statistical phenomenon of regression to the mean is much like catch-up growth, an inverse correlation between initial height and later height gain. The objective of this study was to reexamine the relationship between stunting and later catch-up growth in the context of regression to the mean. The design was a theoretical analysis showing that catch-up growth is more evident based on height z scores than on height, validated using data on 495 stunted South African children seen at 2 and 5 years of age. The correlation between height at 2 and height change from 2 to 5 was small based on height (-0.11) but large and highly significant based on height z score (-0.58), providing strong evidence of catch-up growth. We argue that catch-up growth should be estimated using height z score not height and that catch-up is present only when the change in z score exceeds that predicted by regression to the mean. This leads to a compact definition of catch-up growth: if z1 and z2 are the initial and final (mean) height z scores, and r is the correlation between them, then catch-up growth for groups or individuals is given by (z2 - rz1). Copyright 2005 Wiley-Liss, Inc
Lee, Yoonje; Lee, Sang-Hyun; Kim, Changsun; Choi, Hyuk Joong
2018-05-01
In the treatment of patients with rib fractures (RFs), pain reduction is the most important consideration. Various studies have examined the effectiveness of treatments administered to RF patients, such as lidocaine patches, IV drugs, nerve blockers, and surgery. In this study, we evaluated the difference in the effectiveness in pain reduction between 2 groups of RF patients: 1 group who received a rib splint constructed in the ER (ER splint) and another group who received a Chrisofix Chest Orthosis (CCO) manufactured rib splint. A pilot study for a prospective randomized clinical trial was conducted to compare subjects using the CCO (Group A) with those using the ER splint (Group B) before and after the intervention. The primary outcome was difference in the level of pain based on the visual analogue scale (VAS) and the pulmonary function (PF) variables between before and after intervention in each group during forceful and resting respiration. A total of 24 subjects were enrolled in this study. The VAS results showed that the intervention was significantly effective in each group (before vs after: Group A resting: 8.50 ± 1.05 vs 4.17 ± 1.33, P pain, and no significant differences in pain level were observed between these 2 techniques.
Thermodynamic assessments of the Ag-Er and Er-Y systems
International Nuclear Information System (INIS)
Wang, S.L.; Wang, C.P.; Liu, X.J.; Tang, A.T.; Pan, F.S.; Ishida, K.
2010-01-01
The phase diagrams and thermodynamic properties in the Ag-Er and Er-Y binary systems have been assessed by using the CALPHAD (Calculation of Phase Diagrams) method on the basis of the experimental data including the thermodynamic properties and phase equilibria. The Gibbs free energies of the liquid, bcc, fcc, and hcp phases were described by the subregular solution model with the Redlich-Kister equation, and those of intermetallic compounds (Ag 2 Er and AgEr phases) were treated as stoichiometric compounds, and Ag 51 Er 14 phase was modeled by the sublattice model in the Ag-Er binary system. The thermodynamic parameters of the Ag-Er and Er-Y binary systems were obtained, and an agreement between the calculated results and experimental data was obtained for each binary system.
Effect of americium-241 on luminous bacteria. Role of peroxides
Energy Technology Data Exchange (ETDEWEB)
Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)
2011-04-15
The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.
Catch, effort and bycatch of longline fishery in central Peru
Directory of Open Access Journals (Sweden)
Liliana Ayala
2014-12-01
Full Text Available The aims of this study is to report some characteristics of fishing trips, effort, catches, fishing areas and bycatch through observations on board and logbooks. 85% of sets were in the first 574 Km of distance from the coast (309 nautical miles. Farthest set was located at 1320 Km (712 nautical miles. A total of 382000 hooks were used to catch Mahi mahi, in 224 sets and 29 fishing trips, 94.6% of catch was Mahi mahi, 2.7% blue shark (Prionace glauca y 1,3% mako shark (Isurus oxyrinchus. Also, 103790 hooks were used to catch sharks, in 109 sets y 12 trips, 81.9% of catch was blue sharks and 16.8% mako sharks. Catch per Unit of Effort (CPUE for Mahi mahi shows significative difference among seasons; with a peak from November to January. CPUE for shark shows significative difference among seasons, with peaks in September and October. The Green turtle Chelonia mydas agassizii was the most caugth species and two of three were juveniles. All Loggerhead turtles, Caretta caretta, caught were juveniles. A petrel is reported as bycatch and, probably, mammal bycatch is scarce. Considering the huge effort of this fishery, it is important to monitor it and establish management actions.
International Nuclear Information System (INIS)
Němec, M; Šulc, J; Indra, L; Fibrich, M; Jelínková, H
2015-01-01
Er:YAG crystal was investigated as the gain medium in a diode (1452 nm) pumped tunable laser. The tunability was reached in an eye-safe region by an intracavity birefringent filter. The four tuning bands were obtained peaking at wavelengths 1616, 1632, 1645, and 1656 nm. The broadest continuous tunability was 6 nm wide peaking at 1616 nm. The laser was operating in a pulsed regime (10 ms pulse length, 10 Hz repetition rate). The maximum mean output power was 26.5 mW at 1645 nm. The constructed system demonstrated the tunability of a resonantly diode-pumped Er:YAG laser which could be useful in the development of compact diode-pumped lasers for spectroscopic applications. (paper)
TEST OF THE CATCH-UP HYPOTHESIS IN AFRICAN AGRICULTURAL GROWTH RATES
Directory of Open Access Journals (Sweden)
Kalu Ukpai IFEGWU
2015-11-01
Full Text Available The paper tested the catch-up hypothesis in agricultural growth rates of twenty-six African countries. Panel data used was drawn from the Food and Agricultural Organization Statistics (FAOSTAT of the United Nations. The Data Envelopment Analysis Method for measuring productivity was used to estimate productivity growth rates. The cross-section framework consisting of sigma-convergence and beta-convergence was employed to test the catching up process. Catching up is said to exist if the value of beta is negative and significant. Since catching up does not necessarily imply narrowing of national productivity inequalities, sigma-convergence which measures inequality, was estimated for the same variables. The results showed evidence of the catch-up process, but failed to find a narrowing of productivity inequalities among countries.
International Nuclear Information System (INIS)
King, C.M.; Bryan, S.A.
1999-01-01
This report summarizes progress in evaluating thermal and radiolytic flammable gas generation in actual Hanford single-shell tank wastes. The work described was conducted at Pacific Northwest National Laboratory (PNNL) for the Flammable Gas Safety Project, whose purpose is to develop information to support DE and S Hanford (DESH) and Project Management Hanford Contract (PHMC) subcontractors in their efforts to ensure the safe interim storage of wastes at the Hanford Site. This work is related to gas generation studies performed by Numatec Hanford Corporation (formerly Westinghouse Hanford Company). This report describes the results of laboratory tests of gas generation from actual convective layer wastes from Tank 241-U-103 under thermal and radiolytic conditions. Accurate measurements of gas generation rates from highly radioactive tank wastes are needed to assess the potential for producing and storing flammable gases within the tanks. The gas generation capacity of the waste in Tank 241-U-103 is a high priority for the Flammable Gas Safety Program due to its potential for accumulating gases above the flammability limit (Johnson et al, 1997). The objective of this work was to establish the composition of gaseous degradation products formed in actual tank wastes by thermal and radiolytic processes as a function of temperature. The gas generation tests on Tank 241-U-103 samples focused first on the effect of temperature on the composition and rate of gas generation Generation rates of nitrogen, nitrous oxide, methane, and hydrogen increased with temperature, and the composition of the product gas mixture varied with temperature
Tank characterization report for double-shell tank 241-AN-102
International Nuclear Information System (INIS)
Jo, J.
1996-01-01
This characterization report summarizes the available information on the historical uses, current status, and sampling and analysis results of waste stored in double-shell underground storage tank 241- AN-102. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-09 (Ecology et al. 1996). Tank 241-AN-102 is one of seven double-shell tanks located in the AN Tank Farm in the Hanford Site 200 East Area. The tank was hydrotested in 1981, and when the water was removed, a 6-inch heel was left. Tank 241-AN-102 began receiving waste from tank 241-SY-102 beginning in 1982. The tank was nearly emptied in the third quarter of 1983, leaving only 125 kL (33 kgal) of waste. Between the fourth quarter of 1983 and the first quarter of 1984, tank 241-AN-102 received waste from tanks 241-AY-102, 241-SY-102, 241-AW-105, and 241- AN-101. The tank was nearly emptied in the second quarter of 1984, leaving a heel of 129 kL (34 kgal). During the second and third quarters of 1984, the tank was filled with concentrated complexant waste from tank 241-AW-101. Since that time, only minor amounts of Plutonium-Uranium Extraction (PUREX) Plant miscellaneous waste and water have been received; there have been no waste transfer to or from the tank since 1992. Therefore, the waste currently in the tank is considered to be concentrated complexant waste. Tank 241-AN-102 is sound and is not included on any of the Watch Lists
Signature of ocean warming in global fisheries catch.
Cheung, William W L; Watson, Reg; Pauly, Daniel
2013-05-16
Marine fishes and invertebrates respond to ocean warming through distribution shifts, generally to higher latitudes and deeper waters. Consequently, fisheries should be affected by 'tropicalization' of catch (increasing dominance of warm-water species). However, a signature of such climate-change effects on global fisheries catch has so far not been detected. Here we report such an index, the mean temperature of the catch (MTC), that is calculated from the average inferred temperature preference of exploited species weighted by their annual catch. Our results show that, after accounting for the effects of fishing and large-scale oceanographic variability, global MTC increased at a rate of 0.19 degrees Celsius per decade between 1970 and 2006, and non-tropical MTC increased at a rate of 0.23 degrees Celsius per decade. In tropical areas, MTC increased initially because of the reduction in the proportion of subtropical species catches, but subsequently stabilized as scope for further tropicalization of communities became limited. Changes in MTC in 52 large marine ecosystems, covering the majority of the world's coastal and shelf areas, are significantly and positively related to regional changes in sea surface temperature. This study shows that ocean warming has already affected global fisheries in the past four decades, highlighting the immediate need to develop adaptation plans to minimize the effect of such warming on the economy and food security of coastal communities, particularly in tropical regions.
Process Control Plan for Tank 241-SY-101 Surface Level Rise Remediation
International Nuclear Information System (INIS)
ESTEY, S.D.
1999-01-01
designed and built waste transfer and dilution system. This Process Control Plan (PCP) deals with the operation of the system, To facilitate design, construction, and operation, this transfer system conveys waste from tank to tank via a transfer line composed of an overground, encased flexible hose. An existing waste transfer pump, known alternately as the new generation transfer pump (NGTP) or pump P-350, is installed in 241-SY-101 to accomplish the transfer. Instrumentation and control features are kept as simple as possible to facilitate the mitigation activity, yet comply with the necessary safety constraints. The design incorporates a pressurized, heated water supply to provide a high degree of operational flexibility and reliability by limiting the concentration of waste slurries in transfer. The transfer system water supply also provides the water for dilution of the waste in tank 241-SY-101. Various connections are provided to supply dilution water addition devices from the dedicated transfer system water supply
Permitting plan for project W-320 tank 241-C-106 waste retrieval sluicing system (WRSS)
International Nuclear Information System (INIS)
Symons, G.A.
1997-01-01
This document describes the permitting plan for Project W-320, Tank 241-C-106 Waste Retrieval Sluicing System (WRSS). A comprehensive review of environmental regulations have indicated that several environmental reviews [e.g. National Environmental Policy Act (NEPA), State Environmental Policy Act (SEPA)], permits, and approvals are required prior to construction or operation of the facility. The environmental reviews, permits and approvals, as well the regulatory authority, potentially applicable to the Tank 241-C-106 WRSS include the following: for NEPA - U.S. Department of Energy-Headquarters: Action Description Memorandum, Environmental Assessment, Categorical Exclusion, and Environmental Impact Statement; and for SEPA - State of Washington Department of Ecology (Ecology) Determination of Nonsignificance, Mitigated Determination of Nonsignificance, Determination of Significance, and SEPA Environmental Checklist
24 CFR 241.1070 - Agreed interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.1070...-Eligibility Requirements § 241.1070 Agreed interest rate. The equity or acquisition loan shall bear interest at the rate agreed upon by the borrower and the lender. ...
14 CFR 417.311 - Flight safety crew roles and qualifications.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Flight safety crew roles and qualifications. 417.311 Section 417.311 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION... vehicles in flight under the influence of aerodynamic forces; and (x) The application of flight termination...
Software configuration management plan, 241-AY and 241-AZ tank farm MICON automation system
International Nuclear Information System (INIS)
Hill, L.F.
1997-01-01
This document establishes a Computer Software Configuration Management Plan (CSCM) for controlling software for the MICON Distributed Control System (DCS) located at the 241-AY and 241-AZ Aging Waste Tank Farm facilities in the 200 East Area. The MICON DCS software controls and monitors the instrumentation and equipment associated with plant systems and processes. A CSCM identifies and defines the configuration items in a system (section 3.1), controls the release and change of these items throughout the system life cycle (section 3.2), records and reports the status of configuration items and change requests (section 3.3), and verifies the completeness and correctness of the items (section 3.4). All software development before initial release, or before software is baselined, is considered developmental. This plan does not apply to developmental software. This plan applies to software that has been baselined and released. The MICON software will monitor and control the related instrumentation and equipment of the 241-AY and 241-AZ Tank Farm ventilation systems. Eventually, this software may also assume the monitoring and control of the tank sludge washing equipment and other systems as they are brought on line. This plan applies to the System Cognizant Manager and MICON Cognizant Engineer (who is also referred to herein as the system administrator) responsible for the software/hardware and administration of the MICON system. This document also applies to any other organizations within Tank Farms which are currently active on the system including system cognizant engineers, nuclear operators, technicians, and control room supervisors
Effect of gavaged chemical form of 241Am on its retention in mice
International Nuclear Information System (INIS)
Hisamatsu, S.; Takizawa, Y.
1987-01-01
The retention of 241 Am in mice 48 h after administration by gavage is reported here. The 241 Am was given to mice in the form of either 241 Am nitrate or 241 Am citrate. The 241 Am was also injected into rats in the same form. The homogenized livers of those rats were subsequently administered by gavage to another group of mice. The retention of 241 Am citrate was 1.5 X 10(-2)% of the original dose and was the highest among the compounds examined. The retention of biologically incorporated 241 Am into the liver as 241 Am nitrate and as 241 Am citrate was 2.4 X 10(-3) and 2.6 X 10(-3)%, respectively, and was similar to the retention of 241 Am nitrate, which was 2.8 X 10(-3)%. The ratio of the retention in the carcass to that in the liver for the 241 Am citrate was lower than that of the 241 Am nitrate and the biologically incorporated 241 Am. This difference indicates that the distribution of 241 Am in the animal body depends on the chemical form administered. The retention of liver-incorporated 241 Am as citrate after autolysis of the liver is similar to that of fresh liver-incorporated 241 Am citrate
Landmann, Alessandra; Farrugia, Daniel J; Zhu, Li; Diego, Emilia J; Johnson, Ronald R; Soran, Atilla; Dabbs, David J; Clark, Beth Z; Puhalla, Shannon L; Jankowitz, Rachel C; Brufsky, Adam M; Ahrendt, Gretchen M; McAuliffe, Priscilla F; Bhargava, Rohit
2018-05-08
Pathologic complete response (pCR) rate after neoadjuvant chemotherapy was compared between 141 estrogen receptor (ER)-negative (43%), 41 low ER+ (13%), 47 moderate ER+ (14%), and 98 high ER+ (30%) tumors. Human epidermal growth factor receptor 2-positive cases, cases without semiquantitative ER score, and patients treated with neoadjuvant endocrine therapy alone were excluded. The pCR rate of low ER+ tumors was similar to the pCR rate of ER- tumors (37% and 26% for low ER and ER- respectively, P = .1722) but significantly different from the pCR rate of moderately ER+ (11%, P = .0049) and high ER+ tumors (4%, P < .0001). Patients with pCR had an excellent prognosis regardless of the ER status. In patients with residual disease (no pCR), the recurrence and death rate were higher in ER- and low ER+ cases compared with moderate and high ER+ cases. Low ER+ breast cancers are biologically similar to ER- tumors. Semiquantitative ER H-score is an important determinant of response to neoadjuvant chemotherapy.
International Nuclear Information System (INIS)
Harris, J.P.; Julyk, L.J.; Marlow, R.S.; Moore, C.J.; Day, J.P.; Dyrness, A.D.; Jagadish, P.; Shulman, J.S.
1993-10-01
The buried single-shell waste tank 241-C-106, located at the US Department of Energy's Hanford Site, has been a repository for various liquid radioactive waste materials since its construction in 1943. A first step toward waste tank remediation is demonstrating that remediation activities can be performed safely. Determination of the current structural capacity of this high-heat tank is an important element in this assessment. A structural finite-element model of tank 241-C-106 has been developed to assess the tank's structural integrity with respect to in situ conditions and additional remediation surface loads. To predict structural integrity realistically, the model appropriately addresses two complex issues: (1) surrounding soil-tank interaction associated with thermal expansion cycling and surcharge load distribution and (2) concrete-property degradation and creep resulting from exposure to high temperatures generated by the waste. This paper describes the development of the 241-C-106 structural model, analysis methodology, and tank-specific structural acceptance criteria
24 CFR 241.890 - Characteristics of debentures.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Characteristics of debentures. 241... Insurance § 241.890 Characteristics of debentures. Debentures issued in settlement of insurance claims under this subpart shall have the same characteristics and the same requirements for registration and...
Single-Shell Tank (SST) Retrieval Project Plan for Tank 241-C-104 Retrieval
International Nuclear Information System (INIS)
DEFIGH PRICE, C.
2000-01-01
In support of the SST Interim Closure Project, Project W-523 ''Tank 241-C-104 Waste Retrieval System'' will provide systems for retrieval and transfer of radioactive waste from tank 241-C-104 (C-104) to the DST staging tank 241-AY-101 (AY-101). At the conclusion of Project W-523, a retrieval system will have been designed and tested to meet the requirements for Acceptance of Beneficial Use and been turned over to operations. Completion of construction and operations of the C-104 retrieval system will meet the recently proposed near-term Tri-Party Agreement milestone, M-45-03F (Proposed Tri-Party Agreement change request M-45-00-01A, August, 30 2000) for demonstrating limits of retrieval technologies on sludge and hard heels in SSTs, reduce near-term storage risks associated with aging SSTs, and provide feed for the tank waste treatment plant. This Project Plan documents the methodology for managing Project W-523; formalizes responsibilities; identifies key interfaces required to complete the retrieval action; establishes the technical, cost, and schedule baselines; and identifies project organizational requirements pertaining to the engineering process such as environmental, safety, quality assurance, change control, design verification, testing, and operational turnover
9 CFR 3.11 - Cleaning, sanitization, housekeeping, and pest control.
2010-01-01
..., and pest control. 3.11 Section 3.11 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION..., sanitization, housekeeping, and pest control. (a) Cleaning of primary enclosures. Excreta and food waste must... contained in the primary enclosures, and to reduce disease hazards, insects, pests and odors. When steam or...
Vertical distribution of 241Pu in the southern Baltic Sea sediments
International Nuclear Information System (INIS)
Strumińska-Parulska, Dagmara I.
2014-01-01
Highlights: • The unique study on 241 Pu in sediments from the southern Baltic Sea was presented. • 241 Pu was determined using alpha spectrometry by indirect method. • The biggest amount of 241 Pu existed in the surface layers of all analyzed sediments. • The highest 241 Pu amount comes from the Chernobyl accident. - Abstract: The vertical distribution of plutonium 241 Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, 241 Pu/ 239+240 Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of 241 Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of 241 Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident
Storage of catch crops to produce biogas
DEFF Research Database (Denmark)
Molinuevo-Salces, Beatriz; Ahring, Birgitte Kiær; Uellendahl, Hinrich
2014-01-01
. On the contrary, the poor quality of IR silage, due to its high TS content, made it inappropriate as feedstock for biogas production. A TS content of 25-35% is preferable, to obtain a proper fermentation avoid leachate run-off and growth of Clostridium sp. or mold formation. Avoiding soil particles in the bales......Catch crop biomass is a promising co-substrate for manure-based biogas plants in Denmark since the cultivation of catch crops is mandatory to retain nutrients in the soil, contributing to protect the aquatic environment. In general, the growth period for catch crops is from harvest of the previous...... crop in July-August to the end of the growing season and harvest in late October. Hence, for use of the biomass in biogas production there is a need for storage of the biomass. Storage as silage would guarantee the availability of the feedstock for biogas production during the whole year. A proper...
Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples
International Nuclear Information System (INIS)
Doll, Stephanie R.; Bolling, Stacie D.
2016-01-01
Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, ''Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.'' The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.
Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples
Energy Technology Data Exchange (ETDEWEB)
Doll, Stephanie R. [Washington River Protection Solutions, Richland, WA (United States); Bolling, Stacie D. [Washington River Protection Solutions, Richland, WA (United States)
2016-07-14
Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, “Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.” The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.
LPS Catch and Effort Estimation
National Oceanic and Atmospheric Administration, Department of Commerce — Data collected from the LPS dockside (LPIS) and the LPS telephone (LPTS) surveys are combined to produce estimates of total recreational catch, landings, and fishing...
24 CFR 241.1030 - Mortgage insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 241... Loans-Eligibility Requirements § 241.1030 Mortgage insurance premiums. The lender, upon endorsement of the note, shall pay the Commissioner a first mortgage insurance premium equal to 0.5 percent of the...
Assessment of selenium mineralization and availability from catch crops
DEFF Research Database (Denmark)
Stavridou, Eleftheria; Thorup-Kristensen, Kristian; Young, S.D.
2011-01-01
Selenium (Se) release from four plant species (Indian mustard, fodder radish, Italian ryegrass and hairy vetch) was measured under controlled leaching conditions and in a pot incubation experiment as part of a study of the potential for using these plant species as Se catch crops. Catch crops may...
Effect of fishing effort on catch rate and catchability of largemouth bass in small impoundments
Wegener, M. G.; Schramm, Harold; Neal, J. W.; Gerard, P.D.
2018-01-01
Largemouth bass Micropterus salmoides (Lacepède) catch rates decline with sustained fishing effort, even without harvest. It is unclear why declines in catch rate occur, and little research has been directed at how to improve catch rate. Learning has been proposed as a reason for declining catch rate, but has never been tested on largemouth bass. If catch rate declines because fish learn to avoid lures, periods of no fishing could be a management tool for increasing catch rate. In this study, six small impoundments with established fish populations were fished for two May to October fishing seasons to evaluate the effect of fishing effort on catch rate. Closed seasons were implemented to test whether a 2‐month period of no fishing improved catch rates and to determine whether conditioning from factors other than being captured reduced catch rate. Mixed‐model analysis indicated catch rate and catchability declined throughout the fishing season. Catch rate and catchability increased after a 2‐month closure but soon declined to the lowest levels of the fishing season. These changes in catch rate and catchability support the conclusion of learned angler avoidance, but sustained catchability of fish not previously caught does not support that associative or social learning affected catchability.
24 CFR 241.830 - Definition of default.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 241.830... § 241.830 Definition of default. (a) If the borrower fails to make any payments due under or provided to...
Contractile fibers and catch bond clusters : a biological force sensor?
Novikova, E.A.; Storm, C.
2013-01-01
Catch bonds are cellular receptor-ligand pairs whose lifetime, counterintuitively, increases with increasing load. Although their existence was initially pure theoretical speculation, recent years have seen several experimental demonstrations of catch-bond behavior in biologically relevant and
22 CFR Appendix A to Part 311 - Certification Regarding Lobbying
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Certification Regarding Lobbying A Appendix A to Part 311 Foreign Relations PEACE CORPS NEW RESTRICTIONS ON LOBBYING Pt. 311, App. A Appendix A to Part...,” in accordance with its instructions. (3) The undersigned shall require that the language of this...
2010-01-01
... that derives its lift from a captive lighter-than-air gas; (2) A hot air balloon is a balloon that... STANDARDS: MANNED FREE BALLOONS General § 31.1 Applicability. (a) This part prescribes airworthiness standards for the issue of type certificates and changes to those certificates, for manned free balloons. (b...
2010-04-01
... FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS IMPLANTATION OR INJECTABLE DOSAGE FORM NEW ANIMAL DRUGS § 522.311 Cefovecin. (a.... A second subcutaneous injection of 3.6 mg/lb (8 mg/kg) may be administered if response to therapy is...
24 CFR 241.840 - Date of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Date of default. 241.840 Section... § 241.840 Date of default. In computing loan insurance benefits, the date of default shall be considered... of the lender's acceleration of the debt because of the borrower's default under the first...
Catch bonding in the forced dissociation of a polymer endpoint
Vrusch, Cyril; Storm, Cornelis
2018-04-01
Applying a force to certain supramolecular bonds may initially stabilize them, manifested by a lower dissociation rate. We show that this behavior, known as catch bonding and by now broadly reported in numerous biophysics bonds, is generically expected when either or both the trapping potential and the force applied to the bond possess some degree of nonlinearity. We enumerate possible scenarios and for each identify the possibility and, if applicable, the criterion for catch bonding to occur. The effect is robustly predicted by Kramers theory and Mean First Passage Time theory and confirmed in direct molecular dynamics simulation. Among the catch scenarios, one plays out essentially any time the force on the bond originates in a polymeric object, implying that some degree of catch bond behavior is to be expected in many settings relevant to polymer network mechanics or optical tweezer experiments.
Comparison of catching efficiency of two Indonesian traditional traps, Ayunan and Tamba
Directory of Open Access Journals (Sweden)
Ahmadi
2014-08-01
Full Text Available The catching efficiency of traditional traps: Ayunan and Tamba were tested in Sungai Batang River, South Kalimantan of Indonesia. Trials consisted of 320-trap hauls/type using 1-day submersion time of 24 hr. The baited traps sampling accounted for 82 specimens assigned to 5 species of 5 families. There was a large variability in number of catch between prawns and fish species collected (T=2.318, P<0.05. The prawns catch was represented by only the species Macrobrachium rossenbergii with total of 53 and 1,015 g weight. The prawns weight of Tamba was significantly higher than that of Ayunan (T=3.453, P<0.01.The fish catch composed of Mystus gulio 79%, Osteochilus hasselti 10%, Hypostomus plecostomus 7%, and Macrognathus aculeatus 3%, with total weight ranged from 35 to 560 g. A clear difference was found in catching efficiency. Comparative fishing trials showed that Tamba collected specimens were 1.8 times higher than Ayunan (T=2.223, P<0.05. Catch per unit effort for Tamba ranged from 58.13 to 80.00, and for Ayunan ranged from 5.31 to 7.19. The gear modifications and various treatments (e.g. bait odor, light are necessary to be taken to increase their relative catching efficiency.
The technique of QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe) is only 7 years old, yet it is revolutionizing the manner in which multiresidue, multiclass pesticide analysis (and perhaps beyond) is performed. Columnist Ron Majors sits down with inventors Steve Lehotay and Michelangelo An...
241-AY/AZ waste storage tanks: Supplemental gravity load analysis. Volume 1
International Nuclear Information System (INIS)
Baliga, R.
1994-01-01
An analysis of the 241SY tanks performed by ADVENT(1994b) to resolve dome overload issues indicated that the tank can sustain the dome loads resulting from additional soil overburden depth, increased soil density, and increased concentrated load. Similar issues exist for the 241AY/AZ tanks and therefore, an interim analysis of the 241AY/AZ tanks is presented herein. The scope of this effort is to review and compare all design drawings pertaining to the 241AY and 241AZ tanks with those pertaining to the 241SY tanks; to modify the axisymmetric model of the 241SY tanks to represent the 241AY/AZ tanks; and to evaluate the effect of additional dome load on the 241AY/AZ tanks by performing a structural analysis for gravity loads (dead load + live load). ADVENTS's additional scope of work is to perform a qualitative evaluation of the 241AY/AZ tanks for seismic and thermal loadings (Vollert 1982 and Blume 1971). This qualitative evaluation does not include any detailed finite element analysis of the tanks. The following design-based gravity loading conditions are used in this interim analysis of the 241AY/AZ tanks to determine a baseline for the tank stresses or section loads
42 CFR 422.311 - RADV audit dispute and appeal processes.
2010-10-01
... Organizations § 422.311 RADV audit dispute and appeal processes. (a) Risk adjustment data validation (RADV) audits. In accordance with § 422.2 and § 422.310(e), CMS annually conducts RADV audits to ensure risk... 42 Public Health 3 2010-10-01 2010-10-01 false RADV audit dispute and appeal processes. 422.311...
24 CFR 241.560 - Agreed interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.560... § 241.560 Agreed interest rate. (a) The mortgage shall bear interest at the rate agreed upon by the lender and the borrower. (b) Interest shall be payable in monthly installments on the principal amount of...
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1998-01-01
An Unreviewed Safety Question (Wagoner, 1997) was declared based on lack of adequate authorization basis for Tank 241-Z-361 in the 200W Area at Hanford. This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of over twenty years ago. Records of transfers into the tank, past characterization efforts, and speculation were used to estimate the current condition of Tank 241-Z-361 and its contents. Information about the overall waste system as related to the settling tank was included to help in understanding the numbering system and process relationships. The Plutonium Finishing Plant was built in 1948 and began processing plutonium in mid-1949. The Incinerator (232-Z) operated from December 1961 until May 1973. The Plutonium Reclamation Facility (PRF, 236-Z) began operation in May 1964. The Waste Treatment Facility (242-Z) operated from August 1964 until August 1976. Waste from some processes went through transfer lines to 241-Z sump tanks. High salt and organic waste under normal operation were sent to Z-9 or Z-18 cribs. Water from the retention basin may have also passed through this tank. The transfer lines to 241-Z were numbered D-4 to D-6. The 241-Z sump tanks were numbered D-4 through D-8. The D-4, 5, and 8 drains went to the D-6 sump tank. When D-6 tank was full it was transferred to D-7 tank. Prior to transfer to cribs, the D-7 tank contents was sampled. If the plutonium content was analyzed to be more than 10 g per batch, the material was (generally) reprocessed. Below the discard limit, caustic was added and the material was sent to the cribs via the 241-Z-361 settling tank where solids settled out and the liquid overflowed by gravity to the cribs. Waste liquids that passed through the 241-Z-361 settling tank flowed from PFP to ground in
Assessment of catches in shore angling competitions from the ...
African Journals Online (AJOL)
By mass, most of the catch was made up of R. annulatus (24 %), D. c. chrysonota (19 %), Carcharius taurus (16 %) and A. japonicus (13 %). These species constituted the most important species during each year of the study period. Mean annual catch per unit effort (CPUE) by number and mass has decreased slightly over ...
Impact of catch shares on diversification of fishers' income and risk.
Holland, Daniel S; Speir, Cameron; Agar, Juan; Crosson, Scott; DePiper, Geret; Kasperski, Stephen; Kitts, Andrew W; Perruso, Larry
2017-08-29
Many fishers diversify their income by participating in multiple fisheries, which has been shown to significantly reduce year-to-year variation in income. The ability of fishers to diversify has become increasingly constrained in the last few decades, and catch share programs could further reduce diversification as a result of consolidation. This could increase income variation and thus financial risk. However, catch shares can also offer fishers opportunities to enter or increase participation in catch share fisheries by purchasing or leasing quota. Thus, the net effect on diversification is uncertain. We tested whether diversification and variation in fishing revenues changed after implementation of catch shares for 6,782 vessels in 13 US fisheries that account for 20% of US landings revenue. For each of these fisheries, we tested whether diversification levels, trends, and variation in fishing revenues changed after implementation of catch shares, both for fishers that remained in the catch share fishery and for those that exited but remained active in other fisheries. We found that diversification for both groups was nearly always reduced. However, in most cases, we found no significant change in interannual variation of revenues, and, where changes were significant, variation decreased nearly as often as it increased.
Speciation and bioavailability of Americium-241 in the fresh water environment
International Nuclear Information System (INIS)
Bierkens, J.
1986-01-01
Due to its anthropogenic origin, the transuranic americium 241 confronts physiologists with the intriguing question, which mechanisms are involved in the incorporation or elimination of such artificial elements in biological cycles. The investigations on the speciation and bioavailability of 241 Am in the freshwater environment aim to establish a relation between the behavior of 241 Am in freshwater ecosystems and its availability for biota. In the limnic environment, most often characterized by a high organic load and a low conductivity, the effect of complexation of 241 Am with humic acids and competition with trivalent cations such as A1 and Fe, were proven to be significant on the speciation of 241 Am. Based on the registration of the 241 Am uptake by a large number of freshwater organisms, the crayfish Astacus leptodactylus Eschscholtz was chosen to study the whole-body uptake of 241 Am, its corresponding organ distribution and its retention in the animal. The share of external fixation and ingestion in the global uptake, and the effect of speciation on it, were studied more carefully. Other aspects in this physiological part were: the kinetics of 241 Am in the hemolymph and the hepatopancreas, and its subcellular distribution in the digestive gland. Finally, by comparing the physiology of 241 Am with some other metals ( 240 Pu, 64 Cu, 198 Au) with analogous or contradictional properties, we tried to find out whether the behavior of 241 Am in organisms can be explained from its chemical characteristics
Tank characterization data report: Tank 241-C-112
Energy Technology Data Exchange (ETDEWEB)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable.
Tank characterization data report: Tank 241-C-112
International Nuclear Information System (INIS)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable
24 CFR 241.850 - Notice of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of default. 241.850 Section... § 241.850 Notice of default. (a) If the default is not cured within the 30 day grace period, as defined... such default. (b) The lender shall give notice in writing to the Commissioner of the failure of the...
Influence of anglers' specializations on catch, harvest, and bycatch of targeted taxa
Pope, Kevin L.; Chizinski, Christopher J.; Wiley, Christopher L.; Martin, Dustin R.
2016-01-01
Fishery managers often use catch per unit effort (CPUE) of a given taxon derived from a group of anglers, those that sought said taxon, to evaluate fishery objectives because managers assume CPUE for this group of anglers is most sensitive to changes in fish taxon density. Further, likelihood of harvest may differ for sought and non-sought taxa if taxon sought is a defining characteristic of anglers’ attitude toward harvest. We predicted that taxon-specific catch across parties and reservoirs would be influenced by targeted taxon after controlling for number of anglers in a party and time spent fishing (combine to quantify fishing effort of party); we also predicted similar trends for taxon-specific harvest. We used creel-survey data collected from anglers that varied in taxon targeted, from generalists (targeting “anything” [no primary target taxa, but rather targeting all fishes]) to target specialists (e.g., anglers targeting largemouth bass Micropterus salmoides) in 19 Nebraska reservoirs during 2009–2011 to test our predictions. Taxon-specific catch and harvest were, in general, positively related to fishing effort. More importantly, we observed differences of catch and harvest among anglers grouped by taxon targeted for each of the eight taxa assessed. Anglers targeting a specific taxon had the greatest catch for that taxon and anglers targeting anything typically had the second highest catch for that taxon. In addition, anglers tended to catch more of closely related taxa and of taxa commonly targeted with similar fishing techniques. We encourage managers to consider taxon-specific objectives of target and non-target catch and harvest.
8 CFR 241.3 - Detention of aliens during removal period.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Detention of aliens during removal period. 241.3 Section 241.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.3 Detention of...
International Nuclear Information System (INIS)
Vukanac, I.; Novkovic, D.; Djurasevic, M.; Obradovic, Z.; Kandi, A.
2006-01-01
The surface air samples collected in the first half of May 1986 at Vinca- Belgrade site were prepared and measured at the end of the 1991 and beginning of the 1992. year. Activity concentrations of the 137 Cs immediately after the Chernobyl accident were determined by means of gamma spectrometry, while the air activity concentration of 238 Pu and 239,240 Pu were determined by alpha spectrometry, after the plutonium radiochemical separation. The 236 Pu was used as a tracer. The same samples were remeasured after 13 years, during the 2004. The surface air activity concentrations of 241 Pu were estimated by a 241 Am in-growth method. The built up activities of 236 Pu progenies were determined from the recorded spectra and also calculated using the Bateman equations. The 241 Am activity in the remeasured samples, obtained by complex spectral analysis was confirmed by gamma spectrometry. The 241 Pu activity concentration in measured air samples ranged from 240 μBq/m3 to 7800 μBq/m3. The average activity concentration ratio 241 Pu/ 239,240 Pu originated from Chernobyl accident was approximately 100. (authors)
Hvis en kartoffel er forkert, hvad er en Mars-bar så?
DEFF Research Database (Denmark)
Lichtenstein, Mia Beck; Thomsen, Freja; Hinze, Cecilie
2016-01-01
Danske unge er de slankeste af 41 europæiske unge, men de føler sig ofte tykke og går på slankekur. Hvad er årsagen, og hvorfor er det et problem?......Danske unge er de slankeste af 41 europæiske unge, men de føler sig ofte tykke og går på slankekur. Hvad er årsagen, og hvorfor er det et problem?...
Iron chelators ICL670 and 311 inhibit HIV-1 transcription
International Nuclear Information System (INIS)
Debebe, Zufan; Ammosova, Tatyana; Jerebtsova, Marina; Kurantsin-Mills, Joseph; Niu, Xiaomei; Charles, Sharroya; Richardson, Des R.; Ray, Patricio E.; Gordeuk, Victor R.; Nekhai, Sergei
2007-01-01
HIV-1 replication is induced by an excess of iron and iron chelation by desferrioxamine (DFO) inhibits viral replication by reducing proliferation of infected cells. Treatment of cells with DFO and 2-hydroxy-1-naphthylaldehyde isonicotinoyl hydrazone (311) inhibit expression of proteins that regulate cell-cycle progression, including cycle-dependent kinase 2 (CDK2). Our recent studies showed that CDK2 participates in HIV-1 transcription and viral replication suggesting that inhibition of CDK2 by iron chelators might also affect HIV-1 transcription. Here we evaluated the effect of a clinically approved orally effective iron chelator, 4-[3,5-bis-(hydroxyphenyl)-1,2,4-triazol-1-yl]-benzoic acid (ICL670) and 311 on HIV-1 transcription. Both ICL670 and 311 inhibited Tat-induced HIV-1 transcription in CEM-T cells, 293T and HeLa cells. Neither ICL670 nor 311 induced cytotoxicity at concentrations that inhibited HIV-1 transcription. The chelators decreased cellular activity of CDK2 and reduced HIV-1 Tat phosphorylation by CDK2. Neither ICL670A or 311 decreased CDK9 protein level but significantly reduced association of CDK9 with cyclin T1 and reduced phosphorylation of Ser-2 residues of RNA polymerase II C-terminal domain. In conclusion, our findings add to the evidence that iron chelators can inhibit HIV-1 transcription by deregulating CDK2 and CDK9. Further consideration should be given to the development of iron chelators for future anti-retroviral therapeutics
7 CFR 1210.311 - Programs and projects.
2010-01-01
... PROMOTION PLAN Watermelon Research and Promotion Plan Definitions § 1210.311 Programs and projects. Programs and projects mean those research, development, advertising, or promotion programs or projects...
Modelling and forecasting monthly swordfish catches in the Eastern Mediterranean
Directory of Open Access Journals (Sweden)
Konstantinos I. Stergiou
2003-04-01
Full Text Available In this study, we used the X-11 census technique for modelling and forecasting the monthly swordfish (Xiphias gladius catches in the Greek Seas during 1982-1996 and 1997 respectively, using catches reported by the National Statistical Service of Greece (NSSG. Forecasts built with X-11 were also compared with those derived from ARIMA andWinter’s exponential smoothing (WES models. The X-11 method captured the features of the study series and outperformed the other two methods, in terms of both fitting and forecasting performance, for all the accuracy measures used. Thus, with the exception of October, November and December 1997, when the corresponding absolute percentage error(APE values were very high (as high as 178.6% because of the low level of the catches, monthly catches during the remaining months of 1997 were predicted accurately, with a mean APE of 12.5%. In contrast, the mean APE values of the other two methods for the same months were higher (ARIMA: 14.6%; WES: 16.6%. The overall good performance of X-11 andthe fact that it provides an insight into the various components (i.e. the seasonal, trend-cycle and irregular components of the time series of interest justify its use in fisheries research. The basic features of the swordfish catches revealed by the application of the X-11 method, the effect of the length of the forecasting horizon on forecasting accuracy and the accuracy of the catches reported by NSSG are also discussed.
9 CFR 318.311 - Recall procedure.
2010-01-01
....311 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION ENTRY INTO OFFICIAL ESTABLISHMENTS; REINSPECTION AND PREPARATION OF PRODUCTS Canning and Canned...
No evidence for association of dopamine D2 receptor variant (Ser311/Cys311) with major psychosis
Energy Technology Data Exchange (ETDEWEB)
Sasaki, Tsukasa; Macciardi, F.M.; Badri, F. [Clarke Institute of Psychiatry, Ontario (Canada)] [and others
1996-07-26
We investigated a variant of the dopamine D2 receptor gene (Ser311/Cys311 substitution) in Caucasian patients with schizophrenia (n = 273), delusional disorder (n = 62), bipolar I affective disorder (n = 63), and controls (n = 255). No evidence for association between the receptor variant and any of the diseases was found, even when patients with younger age-of-onset (<25 years) were compared with controls. Futhermore, in a subgroup of schizophrenia patients whom we assessed for negative symptoms, those with the Cys allele did not differ from the remainder of the group. Also, the bipolar affective disorder patients with psychotic features did not show evidence for association with the receptor variant. Thus, our results do not provide evidence for an association between this D2 receptor variant and schizophrenia, or delusional disorder, or bipolar affective disorder. 11 refs., 1 tab.
Hanford Single Shell Tank Leak Causes and Locations - 241-TX Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, C. L.; Harlow, D> G.
2014-07-22
This document identifies 241-TX Tank Farm (TX Farm) leak causes and locations for the 100 series leaking tanks (241-TX-107 and 241-TX-114) identified in RPP-RPT-50870, Rev. 0, Hanford 241-TX Farm Leak Inventory Assessment Report. This document satisfies the TX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102
International Nuclear Information System (INIS)
Shultz, M.V.
1999-01-01
Tank 241-SY-101 waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from Tank 241-SY-101 to Tank 241-SY-102. The results of the hazards evaluation were compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. Revision 1 of this document deletes hazardous conditions no longer applicable to the current waste transfer design and incorporates hazardous conditions related to the use of an above ground pump pit and overground transfer line. This document is not part of the AB and is not a vehicle for requesting authorization of the activity; it is only intended to provide information about the hazardous conditions associated with this activity. The AB Control Decision process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis
31 CFR 595.311 - Specially designated terrorist.
2010-07-01
...) OFFICE OF FOREIGN ASSETS CONTROL, DEPARTMENT OF THE TREASURY TERRORISM SANCTIONS REGULATIONS General Definitions § 595.311 Specially designated terrorist. (a) The term specially designated terrorist means: (1...
50 CFR 679.93 - Amendment 80 Program recordkeeping, permits, monitoring, and catch accounting.
2010-10-01
...) Catch accounting—(1) Amendment 80 species—(i) Amendment 80 cooperative. All Amendment 80 species caught..., permits, monitoring, and catch accounting. 679.93 Section 679.93 Wildlife and Fisheries FISHERY... recordkeeping, permits, monitoring, and catch accounting. (a) Recordkeeping and reporting. See § 679.5(s). (b...
17 CFR 3.11 - Registration of floor brokers and floor traders.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Registration of floor brokers and floor traders. 3.11 Section 3.11 Commodity and Securities Exchanges COMMODITY FUTURES TRADING... a contract market or registered as a derivatives transaction execution facility by the Commission...
Tsunashima, Ryo; Naoi, Yasuto; Shimazu, Kenzo; Kagara, Naofumi; Shimoda, Masashi; Tanei, Tomonori; Miyake, Tomohiro; Kim, Seung Jin; Noguchi, Shinzaburo
2018-05-04
Prediction models for late (> 5 years) recurrence in ER-positive breast cancer need to be developed for the accurate selection of patients for extended hormonal therapy. We attempted to develop such a prediction model focusing on the differences in gene expression between breast cancers with early and late recurrence. For the training set, 779 ER-positive breast cancers treated with tamoxifen alone for 5 years were selected from the databases (GSE6532, GSE12093, GSE17705, and GSE26971). For the validation set, 221 ER-positive breast cancers treated with adjuvant hormonal therapy for 5 years with or without chemotherapy at our hospital were included. Gene expression was assayed by DNA microarray analysis (Affymetrix U133 plus 2.0). With the 42 genes differentially expressed in early and late recurrence breast cancers in the training set, a prediction model (42GC) for late recurrence was constructed. The patients classified by 42GC into the late recurrence-like group showed a significantly (P = 0.006) higher late recurrence rate as expected but a significantly (P = 1.62 × E-13) lower rate for early recurrence than non-late recurrence-like group. These observations were confirmed for the validation set, i.e., P = 0.020 for late recurrence and P = 5.70 × E-5 for early recurrence. We developed a unique prediction model (42GC) for late recurrence by focusing on the biological differences between breast cancers with early and late recurrence. Interestingly, patients in the late recurrence-like group by 42GC were at low risk for early recurrence.
ER-to-plasma membrane tethering proteins regulate cell signaling and ER morphology.
Manford, Andrew G; Stefan, Christopher J; Yuan, Helen L; Macgurn, Jason A; Emr, Scott D
2012-12-11
Endoplasmic reticulum-plasma membrane (ER-PM) junctions are conserved structures defined as regions of the ER that tightly associate with the plasma membrane. However, little is known about the mechanisms that tether these organelles together and why such connections are maintained. Using a quantitative proteomic approach, we identified three families of ER-PM tethering proteins in yeast: Ist2 (related to mammalian TMEM16 ion channels), the tricalbins (Tcb1/2/3, orthologs of the extended synaptotagmins), and Scs2 and Scs22 (vesicle-associated membrane protein-associated proteins). Loss of all six tethering proteins results in the separation of the ER from the PM and the accumulation of cytoplasmic ER. Importantly, we find that phosphoinositide signaling is misregulated at the PM, and the unfolded protein response is constitutively activated in the ER in cells lacking ER-PM tether proteins. These results reveal critical roles for ER-PM contacts in cell signaling, organelle morphology, and ER function. Copyright © 2012 Elsevier Inc. All rights reserved.
Isothermal section of the Er-Fe-Al ternary system at 800 oC
International Nuclear Information System (INIS)
Jemmali, M.; Walha, S.; Pasturel, M.; Tougait, O.; Ben Hassen, R.; Noel, H.
2010-01-01
Physico-chemical analysis techniques, including X-ray diffraction and Scanning Electron Microscope-Energy Dispersive X-ray Spectroscopy, were employed to construct the isothermal section of the Er-Fe-Al system at 800 o C. At this temperature, the phase diagram is characterized by the formation of five intermediate phases, ErFe 12-x Al x with 5 ≤ x ≤ 8 (ThMn 12 -type), ErFe 1+x Al 1-x with -0.2 ≤ x ≤ 0.75 (MgZn 2 -type), ErFe 3-x Al x with 0.5 2 Al-type), Er 2 Fe 17-x Al x with 4.74 ≤ x ≤ 5.7 (TbCu 7 -type) and Er 2 Fe 17-x Al x with 5.7 2 Zn 17 -type), seven extensions of binaries into the ternary system; ErFe x Al 3-x with x 3 Cu-type), ErFe x Al 2-x with x ≤ 0.68 (MgCu 2 -type), Er 2 Fe x Al 1-x with x ≤ 0.25 (Co 2 Si-type), ErFe 2-x Al x with x ≤ 0.5 (MgCu 2 -type), ErFe 3-x Al x with x ≤ 0.5 (Be 3 Nb-type), Er 6 Fe 23-x Al x with x ≤ 8 (Th 6 Mn 23 -type), and Er 2 Fe 17-x Al x with x ≤ 4.75 (Th 2 Ni 17 -type) and one intermetallic compound; the ErFe 2 Al 10 (YbFe 2 Al 10 -type).
49 CFR 374.311 - Service responsibility.
2010-10-01
... REGULATIONS Adequacy of Intercity Motor Common Carrier Passenger Service § 374.311 Service responsibility. (a..., any passenger inconvenience it causes by disrupting travel plans. (d) Seating and reservations. A carrier shall provide sufficient buses to meet passengers' normal travel demands, including ordinary...
Placental transfer and distribution of 241Am in the rat
International Nuclear Information System (INIS)
Hisamatsu, S.; Takizawa, Y.
1983-01-01
The placental transfer and distribution of 241 Am in the feto-placental system were studied in pregnant rats. Rats were injected intravenously with 241 Am citrate at 15 or 18 days of gestation. Groups injected at 15 days of gestation were sacrificed 2, 24, 48, or 120 hr after injection, and the group injected at 18 days was sacrificed 24 hr after. The radioactivities of 241 Am in fetus, fetal membrane, and placenta were determined, and its distribution in the feto-placental system was investigated by high-speed autoradiography using a silver-activated zinc sulfide-coated membrane as an intensifying screen. The deposition of 241 Am in feto-placenta units increased with the number of days of gestation. Results of autoradiography revealed that major deposition sites of 241 Am in the fetus are the skeleton and liver. Heavy deposition of 241 Am in the yolksac splanchnopleure and its existence in the exocoelom strongly suggest that the yolk sac placenta plays an important role in the placental transfer of this nuclide
Determination of 241Pu by low level β-proportional counting
International Nuclear Information System (INIS)
Rosner, G.; Hoetzl, H.; Winkler, R.
1992-01-01
A chemical separation procedure is described which allows the direct determination of low 241 Pu activities in environmental samples with a windowless gas-flow proportional counter. While current separation schemes based on anion exchange yield counting sources of sufficient purity for subsequent α-spectrometry, for β-counting of 241 Pu additional purification steps are required. A combination of anion exchange from 9 mol/1 HCl, LaF 3 precipitation and TTA extraction was found to be suitable even for analysis of long-range Chernobyl fallout samples which contained interfering radionuclides with β-activities at least 3 to 4 orders of magnitude higher than usually encountered. No difference is detectable between the results of the present, direct procedure and the results of the conventional indirect method based on the build-up of 241 Am. Average 241 Pu/ 239+241 Pu ratios in air and deposition samples taken at Neuherberg near Munich were 70±6 with the present procedure and 66±9 from 241 Am build-up. (author) 29 refs.; 3 tabs
International Nuclear Information System (INIS)
Guilmette, R.A.; Cohen, N.; Wrenn, M.E.
1975-01-01
Experiments were performed to study the metabolism and distribution of intravenously administered 241 Am in the adult and juvenile baboon; in addition, decorporation therapy using Na 3 -CaDTPA was performed on selected baboons to assess the efficacy of this drug in removing systemic burdens of 241 Am from this primate species. Determination of the kinetics of 241 Am was accomplished principally by in vivo methodologies and by radiochemical analysis of 241 Am activity of biological material. The use of Na 3 -CaDTPA as a therapeutic agent for the removal of 241 Am from the body proved to be an effective form of treatment in the case of early administration. (U.S.)
Social Cultural Data - Social Impacts of Catch Shares in the West Coast Groundfish Fishery
National Oceanic and Atmospheric Administration, Department of Commerce — Catch shares are one method of catch allocation utilized by fisheries managers in the United States West Coast groundfish fishery. Catch share management results in...
Hanford Tanks 241-AY-102 and 241-BX-101: Sludge Composition and Contaminant Release Data
International Nuclear Information System (INIS)
Krupka, Kenneth M.; Deutsch, William J.; Lindberg, Michael J.; Cantrell, Kirk J.; Hess, Nancy J.; Schaef, Herbert T.; Arey, Bruce W.
2004-01-01
This report describes the results of testing sludge samples from Hanford tanks 241-AY-102 (AY-102) and 241-BX-101 (BX-101). These tests were conducted to characterize the sludge and assess the water leachability of contaminants from the solids. This work is being conducted to support the tank closure risk assessments being performed by CH2M HILL Hanford Group, Inc. for the U.S. Department of Energy. This is the first report of testing of BX-101 sludge and the second report of testing of AY-102. Lindberg and Deutsch (2003) described the first phase of testing on AY-102 material
Deepening Thermocline Displaces Salmon Catch On The Oregon Coast
Harrison, C. S.; Lawson, P.
2015-12-01
Establishing a linkage between fish stock distributions and physical oceanography at a fine scale provides insights into the dynamic nature of near-shore ocean habitats. Characterization of habitat preferences adds to our understanding of the ecosystem, and may improve forecasts of distribution for harvest management. The Project CROOS (Collaborative Research on Oregon Ocean Salmon) Chinook salmon catch data set represents an unprecedented high-resolution record of catch location and depth, with associated in-situ temperature measurements and stock identification derived from genetic data. Here we connect this data set with physical ocean observations to gain understanding of how circulation affects salmon catch distributions. The CROOS observations were combined with remote and in situ observations of temperature, as well as a data assimilative regional ocean model that incorporates satellite and HF radar data. Across the CROOS data set, catch is primarily located within the upwelling front over the seamounts and reef structures associated with Heceta and Stonewall Banks along the shelf break. In late September of 2014 the anomalously warm "blob" began to arrive on the Oregon coast coincident with a strong downwelling event. At this time the thermocline deepened from 20 to 40 m, associated with a deepening of salmon catch depth. A cold "bulb" of water over Heceta Bank may have provided a thermal refuge for salmon during the initial onshore movement of the anomalously warm water. These observations suggest that a warming ocean, and regional warming events in particular, will have large effects on fish distributions at local and regional scales, in turn impacting fisheries.
33 CFR 127.311 - Motor vehicles.
2010-07-01
...) WATERFRONT FACILITIES WATERFRONT FACILITIES HANDLING LIQUEFIED NATURAL GAS AND LIQUEFIED HAZARDOUS GAS Waterfront Facilities Handling Liquefied Natural Gas Operations § 127.311 Motor vehicles. (a) The operator... storage tank or loading flange. (b) During transfer operations, no person may— (1) Stop or park a motor...
5 CFR 838.241 - Cost-of-living adjustments.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Cost-of-living adjustments. 838.241... Affecting Employee Annuities Procedures for Computing the Amount Payable § 838.241 Cost-of-living... provide for cost-of-living adjustments on the former spouse's payment from employee annuity, the cost-of...
A Global Analysis of the Relationship between Farmed Seaweed Production and Herbivorous Fish Catch.
Directory of Open Access Journals (Sweden)
E James Hehre
Full Text Available Globally, farmed seaweed production is expanding rapidly in shallow marine habitats. While seaweed farming provides vital income to millions of artisanal farmers, it can negatively impact shallow coral reef and seagrass habitats. However, seaweed farming may also potentially provide food subsidies for herbivorous reef fish such as the Siganidae, a valuable target family, resulting in increased catch. Comparisons of reef fish landings across the central Philippines revealed that the catch of siganids was positively correlated to farmed seaweed production whilst negatively correlated to total reef fish catch over the same period of time. We tested the generality of this pattern by analysing seaweed production, siganid catch, and reef fish catch for six major seaweed-producing countries in the tropics. We hypothesized that increased seaweed production would correspond with increased catch of siganids but not other reef fish species. Analysis of the global data showed a positive correlation between farmed seaweeds and siganids in Southeast Asia (Indonesia, Malaysia, and the Philippines but not Africa (Tanzania and Zanzibar, or the Western Pacific (Fiji. In Southeast Asia, siganid catch increased disproportionately faster with seaweed production than did reef fish catch. Low continuity, sporadic production and smaller volumes of seaweed farming may explain the differences.
A Global Analysis of the Relationship between Farmed Seaweed Production and Herbivorous Fish Catch.
Hehre, E James; Meeuwig, Jessica J
2016-01-01
Globally, farmed seaweed production is expanding rapidly in shallow marine habitats. While seaweed farming provides vital income to millions of artisanal farmers, it can negatively impact shallow coral reef and seagrass habitats. However, seaweed farming may also potentially provide food subsidies for herbivorous reef fish such as the Siganidae, a valuable target family, resulting in increased catch. Comparisons of reef fish landings across the central Philippines revealed that the catch of siganids was positively correlated to farmed seaweed production whilst negatively correlated to total reef fish catch over the same period of time. We tested the generality of this pattern by analysing seaweed production, siganid catch, and reef fish catch for six major seaweed-producing countries in the tropics. We hypothesized that increased seaweed production would correspond with increased catch of siganids but not other reef fish species. Analysis of the global data showed a positive correlation between farmed seaweeds and siganids in Southeast Asia (Indonesia, Malaysia, and the Philippines) but not Africa (Tanzania and Zanzibar), or the Western Pacific (Fiji). In Southeast Asia, siganid catch increased disproportionately faster with seaweed production than did reef fish catch. Low continuity, sporadic production and smaller volumes of seaweed farming may explain the differences.
International Nuclear Information System (INIS)
Eberlein, Susan J.; Sydnor, Harold A.; Parker, Danny L.; Glaser, Danney R.
2013-01-01
Unplanned releases of radioactive and hazardous wastes have occurred at the 241-SX Tank Farm on the U.S. Department of Energy Hanford Site in southeast Washington State. Interim and long-term mitigation efforts are currently under evaluation for 241-SX Tank Farm. Two contiguous interim surface barriers have been designed for deployment at 241-SX Tank Farm to reduce future moisture infiltration; however, construction of the surface barriers has been deferred to allow testing of alternative technologies for soil moisture reduction and possibly contaminant source term reduction. Previous tests performed by other organizations at the Hanford Site have demonstrated that: vadose zone desiccation using large diameter (greater than 4 inch) boreholes is feasible; under certain circumstances, mobile contaminants may be removed in addition to water vapor; and small diameter (approximately 2 inch) boreholes (such as those placed by the direct push hydraulic hammer) can be used to perform vapor extractions. Evaluation of the previous work combined with laboratory test results have led to the design of a field proof-of-principle test to remove water and possibly mobile contaminants at greater depths, using small boreholes placed with the direct push unit
Energy Technology Data Exchange (ETDEWEB)
Eberlein, Susan J.; Sydnor, Harold A.; Parker, Danny L.; Glaser, Danney R. [Washington River Protection Solutions, P.O. Box 850, Richland, WA, 99352 (United States)
2013-07-01
Unplanned releases of radioactive and hazardous wastes have occurred at the 241-SX Tank Farm on the U.S. Department of Energy Hanford Site in southeast Washington State. Interim and long-term mitigation efforts are currently under evaluation for 241-SX Tank Farm. Two contiguous interim surface barriers have been designed for deployment at 241-SX Tank Farm to reduce future moisture infiltration; however, construction of the surface barriers has been deferred to allow testing of alternative technologies for soil moisture reduction and possibly contaminant source term reduction. Previous tests performed by other organizations at the Hanford Site have demonstrated that: vadose zone desiccation using large diameter (greater than 4 inch) boreholes is feasible; under certain circumstances, mobile contaminants may be removed in addition to water vapor; and small diameter (approximately 2 inch) boreholes (such as those placed by the direct push hydraulic hammer) can be used to perform vapor extractions. Evaluation of the previous work combined with laboratory test results have led to the design of a field proof-of-principle test to remove water and possibly mobile contaminants at greater depths, using small boreholes placed with the direct push unit. (authors)
Multilevel resonance parameters of 241Pu
International Nuclear Information System (INIS)
Weston, L.W.; Todd, J.H.
1978-01-01
The data previously reported by the authors on the neutron fission and capture cross sections of 241 Pu were simultaneously fit with the Adler formalism to obtain multilevel resonance parameters. The neutron energy range of the fit was 0.01 to 100 eV. The 241 Pu cross sections in the resonance region of neutron energies are complex, and the Adler parameters present an efficient method of representing these cross sections, which are important for plutonium-fueled reactors. The parameters represent the data to an accuracy within the quoted experimental errors. 5 figures, 2 tables
Timely Healthcare Checkup Catches Melanoma Early
... please turn Javascript on. Feature: Skin Cancer Timely Healthcare Checkup Catches Melanoma Early Past Issues / Summer 2013 ... left the Congress and starting working as a healthcare consultant, when I finally decided to have a ...
Biosorption of radionuclide Americium-241 by A. niger spore and hyphae
International Nuclear Information System (INIS)
Yang Yuanyou; Liu Ning; Jin Jiannan; Hua Xinfeng; Zhang Taiming; Luo Shunzhong; Sun Qiling
2002-01-01
The biosorption of radionuclide 241 Am from solution was studied by a. niger spore and hyphae, and the effects of the operational conditions on the treatment were investigated. The results showed the treatment by A. niger spore and hyphae were very efficient. An average of 96% of the total 241 Am was removed from 241 Am solutions of 5.6-111 MBq/L (C 0 ), with adsorption capacities (W) of 7.2-142.4 MBq/g biomass, 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 h and the optimum pH value ranged 3-0.1 mol/L HNO 3 and 3-2 for spore and hyphae of A. niger, respectively. No significant effects on 241 Am biosorption were observed at 15 degree C-45 degree C, or challenged with containing Au 3+ or Ag + , even 2000 times above 241 Am amount. the index relationship between concentrations and adsorption capacities of 241 Am indicated that the 241 Am biosorption by A. niger spore and hyphae obey to Freundlich adsorption equation. The adsorption behavior of A. niger spore and hyphae were basically coincident
49 CFR 385.311 - What will the safety audit consist of?
2010-10-01
... SAFETY FITNESS PROCEDURES New Entrant Safety Assurance Program § 385.311 What will the safety audit consist of? The safety audit will consist of a review of the new entrant's safety management systems and a... 49 Transportation 5 2010-10-01 2010-10-01 false What will the safety audit consist of? 385.311...
Few data but many fish: marine small-scale fisheries catches for ...
African Journals Online (AJOL)
... substantially under-reported national data puts authorities under serious risk of over-licensing fishing access and mismanaging marine ecosystems and national food security. Keywords: catch rates, catch reconstructions, food security, Malthusian overfishing, small-scale fisheries, sub-Saharan Africa, subsistence fisheries
40 CFR 51.241 - Nonattainment areas for carbon monoxide and ozone.
2010-07-01
... Intergovernmental Consultation Agency Designation § 51.241 Nonattainment areas for carbon monoxide and ozone. (a... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Nonattainment areas for carbon monoxide and ozone. 51.241 Section 51.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
Catching up with the Keynesians
Ljungqvist, L.; Uhlig, H.F.H.V.S.
1996-01-01
This paper examines the role for tax policies in productivity-shock driven economies with \\catching-up-with-the-Joneses" utility functions.The optimal tax policy is shown to a ect the economy countercyclically via procyclical taxes, i.e., \\cooling down" the economy with higher taxes when it is
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Solicitation provision and contract clause on liability insurance under cost-reimbursement contracts. 328.311 Section 328.311 Federal... Insurance 328.311 Solicitation provision and contract clause on liability insurance under cost-reimbursement...
Comparative study on the human landing catch and light trap ...
African Journals Online (AJOL)
As part of a longitudinal study on the epidemiology of filariasis, this study was carried out to test a hypothesis that three light traps catch about the same number of mosquitoes as a team of two Human Landing Catch collectors. The comparison was done to analyze possible differences between the two techniques in the ...
International Nuclear Information System (INIS)
Budak, G.; Polat, R.
2004-01-01
The X-ray absorption jump factor and jump ratio of Gd, Dy, Ho and Er were measured with a Si(Li) detector by attenuation, with Gd, Dy, Ho and Er foil, a Compton peak produced by the scattering of the 59.5 keV Am-241 Gamma rays. Al was chosen as secondary exciter. The experimental absorption jump factors and jump ratios are compared with the theoretical estimates of WinXcom (Radiat. Phys. Chem. 60 (2001) 23), McMaster (Compilation of X-ray cross sections UCRL-50174, 1969; Sec. II. Rev. I), Broll (X-ray Spectrom 15 (1986) 271), Hubbel and Seltzer (NISTIR (1995) 5632) and Budak (Radiat. Meas. accepted for publication). The present results constitute the first measurement for this combination of energy and elements, and good agreement is obtained between experiment and theory
Tank 241-T-201, core 192 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-08-07
This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report.
Tank 241-T-204, core 188 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-07-24
TANK 241-T-204, CORE 188, ANALYTICAL RESULTS FOR THE FINAL REPORT. This document is the final laboratory report for Tank 241 -T-204. Push mode core segments were removed from Riser 3 between March 27, 1997, and April 11, 1997. Segments were received and extruded at 222-8 Laboratory. Analyses were performed in accordance with Tank 241-T-204 Push Mode Core Sampling and analysis Plan (TRAP) (Winkleman, 1997), Letter of instruction for Core Sample Analysis of Tanks 241-T-201, 241- T-202, 241-T-203, and 241-T-204 (LAY) (Bell, 1997), and Safety Screening Data Qual@ Objective (DO) ODukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DC) analyses exceeded the notification limits stated in DO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group and are not considered in this report.
Tank 241-T-201, core 192 analytical results for the final report
International Nuclear Information System (INIS)
Nuzum, J.L.
1997-01-01
This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report
9 CFR 311.39 - Biological residues.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Biological residues. 311.39 Section... Biological residues. Carcasses, organs, or other parts of carcasses of livestock shall be condemned if it is determined that they are adulterated because of the presence of any biological residues. ...
Completion Report for Well ER-EC-1
International Nuclear Information System (INIS)
Townsend, M.J.
2000-01-01
Well ER-EC-1 was drilled for the U.S. Department of Energy, Nevada Operations Office in support of the Nevada Environmental Restoration Project at the Nevada Test Site, Nye County, Nevada. This well was drilled in the spring of 1999 as part of the U.S. Department of Energy's hydrogeologic investigation well program in the Western Pahute Mesa - Oasis Valley region just west of the Test Site. A 44.5-centimeter surface hole was drilled and cased off to the depth 675.1 meters below the surface. The hole diameter was then decreased to 31.1 centimeters for drilling to a total depth of 1,524.0 meters. A preliminary composite, static, water level was measured at the depth of approximately 566.3 meters prior to installation of the completion string. One completion string with three isolated, slotted intervals was installed in the well. Detailed lithologic descriptions with preliminary stratigraphic assignments are included in the report. These are based on composite drill cuttings collected every 3 meters and 31 sidewall samples taken at various depths below 680 meters, supplemented by geophysical log data. Detailed chemical and mineralogical studies of rock samples are in progress. The well penetrated Tertiary-age lava and tuff of the Timber Mountain Group, the Paintbrush Group, the Calico Hills Formation, the Crater Flat Group, and the Volcanics of Quartz Mountain. The preliminary geologic interpretation of data from Well ER-EC-1 indicates the presence of a structural trough or bench filled with a thick section of post-Rainier Mesa lava. These data also suggest that this site is located on a buried structural ridge that may separate the Silent Canyon and Timber Mountain caldera complexes
8 CFR 241.9 - Notice to transportation line of alien's removal.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's removal. 241.9 Section 241.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.9...
8 CFR 241.10 - Special care and attention of removable aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Special care and attention of removable aliens. 241.10 Section 241.10 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.10...
Decorporation of 241Am in beagles by DTPA
International Nuclear Information System (INIS)
Lloyd, R.D.; McFarland, S.S.; Taylor, G.N.; Williams, J.L.; Mays, C.W.
1975-01-01
Chelation treatments using daily subcutaneous injections of ZnNa 3 -DTPA were begun 2 wk after the intravenous administration of 0.3 μCi/kg 241 Am citrate to six female beagles averaging 505 days of age. Retention of americium in the liver and in non-liver tissue (mainly skeleton) was followed serially in the living dogs by a combination of total-body and partial-body counting. During the first 13 mo of DTPA therapy, the removal of 241 Am from two dogs given one DTPA injection each day of 0.027 or 0.034 mmole/kg was similar to the fraction removed from two other dogs given a similar total of 0.035 or 0.037 mmole/kg/day in five fractionated injections each day. Increasing the daily amount of DTPA to 0.36 and 5.0 mmole/kg/day in the two remaining dogs only slightly increased the removal of 241 Am. At the beginning of chelation therapy, all six dogs averaged 43 percent of the injected 241 Am in the liver and 46 percent in nonliver tissue. 241 Am retention in liver at 2 mo of therapy was about 2 percent of pretreatment liver retention, decreased to roughly 1 percent of pretreatment retention by 5 mo of DTPA administration, and was undetectable at 13 months. Nonliver retention at 2 mo was 53 percent of pretreatment retention in nonliver tissue, at 5 mo averaged about 40 percent, and had decreased to 27 percent of pretreatment values by 13 mo of chelation therapy. In contrast, for beagles of our colony not treated with DTPA, 241 Am in the liver and in nonliver tissue exhibited a biological half-time in the order of 10 yr. (U.S.)
Catch of the Day, Tomorrow, and the Future
Brown, J.
2017-12-01
There are many fishermen and women in Pensacola, Florida, specifically at the Plaza De Luna Circle at the end of Palafox street. What are these fisherpeople hoping to catch? Do they want to eat their harvest or just catch for sport? Surveying the locals will help answer these questions and more. These answers will turn into data that will be shared and discussed with the Florida Fish and Wildlife Conservation Commission in hopes that it will give them ideas on how to manage our natural resources while best serving the interests our community.
Trends in marine fish catches at Pattani Fishery Port (1999-2003
Directory of Open Access Journals (Sweden)
Wanchamai Karntanut
2006-07-01
Full Text Available This study aims to develop statistical models for forecasting the quantity of the various types of marine fish landed at Pattani Fishery Port, allowing for trend and seasonality, using official data during 1999-2003. The data comprise daily and monthly totals by weight for eight types of fish (mackerel, other food fish, squid, scads, trash fish, shrimp, lobster and crab. The statistical methods are one-way analysis of variance, multiple linear regression and time series forecasting using trend and seasonal models. It is found that mackerel, other food fish and squid catches tend to decrease, whereas the catches of scads tend to increase, and trash fish catches have no detectable trend up or down. Shrimp and lobster tend to decrease exponentially, and the trend of crab catch is constant. This study raises questions about the ecological and economic sustainability of the current fisheries policy in Thailand.
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-08-05
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-07-29
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
Seasonal abundance, distribution, and catch per unit effort using gill ...
African Journals Online (AJOL)
Catch per unit effort was obtained for the fish of the Sundays .... Methods. Catch per unit effort (numbers and weight/net) of fish in the estuary was obtained from 55 .... Table 1 CPUE (number and mass) of fish caught monthly using gill-net over 12·h periods with 55 nettings at .... The abundance of some other species may.
8 CFR 241.15 - Countries to which aliens may be removed.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Countries to which aliens may be removed. 241.15 Section 241.15 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.15 Countries to...
Completion Report for Well Cluster ER-6-1
Energy Technology Data Exchange (ETDEWEB)
Bechtel Nevada
2004-10-01
Well Cluster ER-6-1 was constructed for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Restoration Division at the Nevada Test Site, Nye County, Nevada. This work was initiated as part of the Groundwater Characterization Project, now known as the Underground Test Area Project. The well cluster is located in southeastern Yucca Flat. Detailed lithologic descriptions with stratigraphic assignments for Well Cluster ER-6-1 are included in this report. These are based on composite drill cuttings collected every 3 meters and conventional core samples taken below 639 meters, supplemented by geophysical log data. Detailed petrographic, chemical, and mineralogical studies of rock samples were conducted on 11 samples to resolve complex interrelationships between several of the Tertiary tuff units. Additionally, paleontological analyses by the U.S. Geological Survey confirmed the stratigraphic assignments below 539 meters within the Paleozoic sedimentary section. All three wells in the Well ER-6-1 cluster were drilled within the Quaternary and Tertiary alluvium section, the Tertiary volcanic section, and into the Paleozoic sedimentary section.
Directory of Open Access Journals (Sweden)
Fathur Rochman
2016-12-01
Full Text Available Discharge of by catch is a significant problem in world fishery. Every commercial fishery such as tuna longline has a suite of bycatch species, escolar fish (LEC. LEC as by catch product has received a little attention because of its lower economic value and given its importance as a secondary market. With time, however, market can become establish for this presently undesirable species. Acknowledging that today’s by catch might become tomorrow’s target fish. The aims of this study areto provide information on biological aspect and catch per unit of effort (CPUE spatial distribution of escolar (Lepidocybium flavobrunneum as by catch in Indonesian longline fishery operating in the Eastern Indian Ocean. Total escolar samples of 1,815 were taken from scientific observer data from 2011-2013. The study area of escolar was between 0.897-33.175°S and 85.366– 138.733°E of Eastern Indian Ocean. Results show that the escolar length (cmFL is distributed from 27-178 cmFL (median=83 cmFL, mode=85 cmFL, mean=83.95 cmFL and n= 1.812 and dominated by the size of 85 cmFL. The length weight relationship was determined to be W=0.0002FL2.2926(W in kg, FL in cm. In terms of CPUEs distribution, the lower CPUEs(1.0001 to 7.382 generally occurred in Western Australian, precisely on grid between 10-35°S and 85-110°E. These grids would be a potential for fishing LEC with the best time to catch in June to August.
Thirty years of monitoring traditional fish trap catches at Kosi Bay ...
African Journals Online (AJOL)
... mark and recapture studies, suggest a very high, and possibly unsustainable, catch rate that requires management intervention to return them back to historical and sustainable levels. Keywords: catch monitoring, estuarine, fisheries, fish marking, fish traps, iSimangaliso, overfishing, South-East Africa, World Heritage Site
Phenotype abnormality: 311 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 311 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u816i increased efficiency during process... named seed dormancy process ... increased efficiency ... seed dormancy process ...
239Pu(n, 2n) and 241Pu(n, 2n) surrogate cross section measurements using NeutronSTARS
Energy Technology Data Exchange (ETDEWEB)
Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Alan, B. S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Akindele, O. A. [Univ. of California, Berkeley, CA (United States); Casperson, R. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hughes, R. O. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Koglin, J. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Tamashiro, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Oregon State Univ., Corvallis, OR (United States); Kolos, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Norman, E. B. [Univ. of California, Berkeley, CA (United States); Saastamoinen, A. [Univ. of California, Los Angeles, CA (United States); Padilla, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Univ. of California, Los Angeles, CA (United States); Fisher, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-12-08
The goal of this project was to develop a new approach to measuring (n,2n) reactions for isotopes of interest. We set out to measure the 239Pu(n,2n) and 241Pu(n,2n) cross sections by directly detecting the 2n neutrons that are emitted. With the goal of improving the 239Pu(n,2n) cross section and to measure the 241Pu(n,2n) cross section for the first time. To that end, we have constructed a new neutron-charged-particle detector array called NeutronSTARS. It has been described extensively in Casperson et al. [1] and in Akindele et al. [2]. We have used this new neutron-charged-particle array to measure the 241Pu and 239Pu fission neutron multiplicity as a function of equivalent incident-neutron energy from 100 keV to 20 MeV. We have made a preliminary determination of the 239Pu(n,2n) and 241Pu(n,2n) cross sections from the surrogate 240Pu(α,α’2n) and 242Pu(α,α’2n) reactions respectively. The experimental approach, detector array, data analysis, and results to date are summarized in the following sections.
Rapid shifts in catch composition in the artisanal Red Sea reef fisheries of Eritrea
Tsehaye, I.W.; Machiels, M.A.M.; Nagelkerke, L.A.J.
2007-01-01
Shifts in catch composition were registered in the Eritrean artisanal fisheries, which were launched into a renewed development after the end of the independence war in 1991. Our analysis of catch and effort data showed that total fishing effort as well as total annual catch increased more than
DEFF Research Database (Denmark)
Jørgensen, Ole A; Chrysafi, Anna
A simple Schaefer model was tested on the Greenland halibut stock offshore in NAFO SA 0 and 1. The minimum data required for this model is a catch time series and a measure of the resilience of the species. Other input parameters that had to be guessed were the carrying capacity, the biomass...
Investigation of the touch sensitivity of ER fluid based tactile display
Liu, Yanju; Davidson, Rob; Taylor, Paul
2005-05-01
A tactile display is programmable device whose controlled surface is intended to be investigated by human touch. It has a great number of potential applications in the field of virtual reality and elsewhere. In this research, a 5x5 touch sensitive tactile display array including electrorheological (ER) fluid has been developed and investigated. Experimental results show that the sensed surface information could be controlled effectively by adjusting the voltage activation pattern imposed on the tactels. In the meantime, it is possible to sense the touching force normal to the display"s surface by monitoring the change of current passing through the ER fluid. These encouraging results are helpful for constructing a new type of tactile display based on ER fluid which can act as both sensor and actuator at the same time.
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
International Nuclear Information System (INIS)
Conner, J.C.
1996-01-01
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
Energy Technology Data Exchange (ETDEWEB)
Conner, J.C.
1996-01-25
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices.
Efficacy of Electrocuting Devices to Catch Tsetse Flies (Glossinidae and Other Diptera.
Directory of Open Access Journals (Sweden)
Glyn A Vale
2015-10-01
Full Text Available The behaviour of insect vectors has an important bearing on the epidemiology of the diseases they transmit, and on the opportunities for vector control. Two sorts of electrocuting device have been particularly useful for studying the behaviour of tsetse flies (Glossina spp, the vectors of the trypanosomes that cause sleeping sickness in humans and nagana in livestock. Such devices consist of grids on netting (E-net to catch tsetse in flight, or on cloth (E-cloth to catch alighting flies. Catches are most meaningful when the devices catch as many as possible of the flies potentially available to them, and when the proportion caught is known. There have been conflicting indications for the catching efficiency, depending on whether the assessments were made by the naked eye or assisted by video recordings.Using grids of 0.5m2 in Zimbabwe, we developed catch methods of studying the efficiency of E-nets and E-cloth for tsetse, using improved transformers to supply the grids with electrical pulses of ~40kV. At energies per pulse of 35-215mJ, the efficiency was enhanced by reducing the pulse interval from 3200 to 1ms. Efficiency was low at 35mJ per pulse, but there seemed no benefit of increasing the energy beyond 70mJ. Catches at E-nets declined when the fine netting normally used became either coarser or much finer, and increased when the grid frame was moved from 2.5cm to 27.5cm from the grid. Data for muscoids and tabanids were roughly comparable to those for tsetse.The catch method of studying efficiency is useful for supplementing and extending video methods. Specifications are suggested for E-nets and E-cloth that are ~95% efficient and suitable for estimating the absolute numbers of available flies. Grids that are less efficient, but more economical, are recommended for studies of relative numbers available to various baits.
NanoByg - a survey of nanoinnovation in Danish construction. Executive summary, dansk
DEFF Research Database (Denmark)
Andersen, Maj Munch; Molin, Måns J.
Denne tekst er et Executive summary af Risø rapporten, ''NanoByg - A survey of nanoinnovation in Danish construction''. (Risø-R-1602 (EN), 72 p.)......Denne tekst er et Executive summary af Risø rapporten, ''NanoByg - A survey of nanoinnovation in Danish construction''. (Risø-R-1602 (EN), 72 p.)...
31 CFR 29.311 - Credit only for service performed on or before June 30, 1997.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Credit only for service performed on or before June 30, 1997. 29.311 Section 29.311 Money and Finance: Treasury Office of the Secretary of... Benefits General Principles for Determining Service Credit to Calculate Federal Benefit Payments § 29.311...
International Nuclear Information System (INIS)
Ammerich, M.; Frot, P.; Gambini, D.; Gauron, C.; Moureaux, P.; Herbelet, G.; Lahaye, T.; Le Guen, B.; Pihet, P.; Rannou, A.; Vidal, E.
2012-12-01
This sheet presents the characteristics of Americium-241, its origin, and its radio-physical and biological properties. It briefly describes its use in nuclear medicine. It indicates its dosimetric parameters for external exposure, cutaneous contamination, and internal exposure due to acute contamination or to chronic contamination. It indicates and comments the various exposure control techniques: ambient dose rate measurement, surface contamination measurement, atmosphere contamination. It addresses the means of protection: premise design, protection against external exposure and against internal exposure. It describes how areas are delimited and controlled within the premises: regulatory areas, controls to be performed. It addresses the personnel classification, training and medical survey. It addresses the issue of wastes and effluents. It briefly recalls the administrative procedures related to the authorization and declaration of possession and use of sealed and unsealed sources. It indicates regulatory aspects related to the road transport of Americium-241, describes what is to be done in case of incident or accident (for the different types of contamination or exposure)
National low-level waste management program radionuclide report series, Volume 14: Americium-241
International Nuclear Information System (INIS)
Winberg, M.R.; Garcia, R.S.
1995-09-01
This report, Volume 14 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of americium-241 ( 241 Am). This report also includes discussions about waste types and forms in which 241 Am can be found and 241 Am behavior in the environment and in the human body
Characterization of the ER-Targeted Low Affinity Ca2+ Probe D4ER
Directory of Open Access Journals (Sweden)
Elisa Greotti
2016-09-01
Full Text Available Calcium ion (Ca2+ is a ubiquitous intracellular messenger and changes in its concentration impact on nearly every aspect of cell life. Endoplasmic reticulum (ER represents the major intracellular Ca2+ store and the free Ca2+ concentration ([Ca2+] within its lumen ([Ca2+]ER can reach levels higher than 1 mM. Several genetically-encoded ER-targeted Ca2+ sensors have been developed over the last years. However, most of them are non-ratiometric and, thus, their signal is difficult to calibrate in live cells and is affected by shifts in the focal plane and artifactual movements of the sample. On the other hand, existing ratiometric Ca2+ probes are plagued by different drawbacks, such as a double dissociation constant (Kd for Ca2+, low dynamic range, and an affinity for the cation that is too high for the levels of [Ca2+] in the ER lumen. Here, we report the characterization of a recently generated ER-targeted, Förster resonance energy transfer (FRET-based, Cameleon probe, named D4ER, characterized by suitable Ca2+ affinity and dynamic range for monitoring [Ca2+] variations within the ER. As an example, resting [Ca2+]ER have been evaluated in a known paradigm of altered ER Ca2+ homeostasis, i.e., in cells expressing a mutated form of the familial Alzheimer’s Disease-linked protein Presenilin 2 (PS2. The lower Ca2+ affinity of the D4ER probe, compared to that of the previously generated D1ER, allowed the detection of a conspicuous, more clear-cut, reduction in ER Ca2+ content in cells expressing mutated PS2, compared to controls.
Markov chain model for demersal fish catch analysis in Indonesia
Firdaniza; Gusriani, N.
2018-03-01
As an archipelagic country, Indonesia has considerable potential fishery resources. One of the fish resources that has high economic value is demersal fish. Demersal fish is a fish with a habitat in the muddy seabed. Demersal fish scattered throughout the Indonesian seas. Demersal fish production in each Indonesia’s Fisheries Management Area (FMA) varies each year. In this paper we have discussed the Markov chain model for demersal fish yield analysis throughout all Indonesia’s Fisheries Management Area. Data of demersal fish catch in every FMA in 2005-2014 was obtained from Directorate of Capture Fisheries. From this data a transition probability matrix is determined by the number of transitions from the catch that lie below the median or above the median. The Markov chain model of demersal fish catch data was an ergodic Markov chain model, so that the limiting probability of the Markov chain model can be determined. The predictive value of demersal fishing yields was obtained by calculating the combination of limiting probability with average catch results below the median and above the median. The results showed that for 2018 and long-term demersal fishing results in most of FMA were below the median value.
A simple statistical method for catch comparison studies
DEFF Research Database (Denmark)
Holst, René; Revill, Andrew
2009-01-01
For analysing catch comparison data, we propose a simple method based on Generalised Linear Mixed Models (GLMM) and use polynomial approximations to fit the proportions caught in the test codend. The method provides comparisons of fish catch at length by the two gears through a continuous curve...... with a realistic confidence band. We demonstrate the versatility of this method, on field data obtained from the first known testing in European waters of the Rhode Island (USA) 'Eliminator' trawl. These data are interesting as they include a range of species with different selective patterns. Crown Copyright (C...
Shielding of a neutron irradiator with {sup 241}Am-Be source
Energy Technology Data Exchange (ETDEWEB)
Oliveira, K.A.M. de; Crispim, V.R.; Silva, A.X., E-mail: koliveira@con.ufrj.b, E-mail: verginia@con.ufrj.b, E-mail: ademir@con.ufrj.b [Universidade Federal do Rio de Janeiro (PEN/COPPE/UFRJ), RJ (Brazil). Coordenacao dos Programas de Pos-Graduacao de Engenharia. Programa de Engenharia Nuclear; Fonseca, E.S., E-mail: evaldo@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)
2011-07-01
The equivalent dose rates at 1.0 cm from the outer surface of the shielding of a neutron irradiation system that uses {sup 241}Am-Be source with activity of 185 GBq (5 Ci) were determined. A theoretical-experimental approach including case studies, through computer simulations with MCNP code was employed to calculate the best shielding thickness. Following the construction of the neutron irradiator, dose measurements were conducted in order to validate data obtained from simulation. The neutron irradiator shielding was designed in such a way to allow transport of the neutron radiography system for in loco inspections ensuring workers' radiologic safety. (author)
Hankin-Wei, Abigail; Rein, David B.; Hernandez-Romieu, Alfonso; Kennedy, Mallory J.; Bulkow, Lisa; Rosenberg, Eli; Trigg, Monica; Nelson, Noele P.
2017-01-01
Background Since 2006, the US Centers for Disease Control and Prevention has recommended hepatitis A (HepA) vaccination routinely for children aged 12–23 months to prevent hepatitis A virus (HAV) infection. However, a substantial proportion of US children are unvaccinated and susceptible to infection. We present results of economic modeling to assess whether a one-time catch-up HepA vaccination recommendation would be cost-effective. Methods We developed a Markov model of HAV infection that followed a single cohort from birth through death (birth to age 95 years). The model compared the health and economic outcomes from catch-up vaccination interventions for children at target ages from two through 17 years vs. outcomes resulting from maintaining the current recommendation of routine vaccination at age one year with no catch-up intervention. Results Over the lifetime of the cohort, catch-up vaccination would reduce the total number of infections relative to the baseline by 741 while increasing doses of vaccine by 556,989. Catch-up vaccination would increase net costs by $10.2 million, or $2.38 per person. The incremental cost of HepA vaccine catch-up intervention at age 10 years, the midpoint of the ages modeled, was $452,239 per QALY gained. Across age-cohorts, the cost-effectiveness of catch-up vaccination is most favorable at age 12 years, resulting in an Incremental Cost-Effectiveness Ratio of $189,000 per QALY gained. Conclusions Given the low baseline of HAV disease incidence achieved by current vaccination recommendations, our economic model suggests that a catch-up vaccination recommendation would be less cost-effective than many other vaccine interventions, and that HepA catch-up vaccination would become cost effective at a threshold of $50,000 per QALY only when incidence of HAV rises about 5.0 cases per 100,000 population. PMID:27317459
Americium-241 in surface soil associated with the Hanford site and vicinity
International Nuclear Information System (INIS)
Price, K.R.; Gilbert, R.O.; Gano, K.A.
1981-05-01
Various kinds of surface soil samples were collected and analyzed for Americium-241 ( 241 Am) to examine the feasibility of improving soil sample data for the Hanford Surface Environmental Surveillance Program. Results do not indicate that a major improvement would occur if procedures were changed from the current practices. Conclusions from this study are somewhat tempered by the very low levels of 241 Am ( 241 Am in soil crust (0 to 1.0 cm deep) was greater than the corresponding subsurface layer (1.0 to 2.5 cm deep), and the average concentration of 241 Am in some onsite samples collected near the PUREX facility was greater than comparable samples collected 60 km upwind at an offsite location
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available LEGMHDVYYGTQLP 180 ... Query: 252 GHEVKKGRLPHNLLPLQSGVGNVANAVMAGLEDGPFDNLTAYTEVLQDGMLHLLRKGKXX 311 ... G...HEVKKGRLPHNLLPLQSGVGNVANAVMAGLEDGPFDNLTAYTEVLQDGMLHLLRKGK ... Sbjct: 241 GHEVKKGRLPHNLLPLQSGVGNVANAVMAGLEDGPFD
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM
7 CFR 900.311 - Submittals or requests.
2010-01-01
... Conduct of Referenda To Determine Producer Approval of Milk Marketing Orders To Be Made Effective Pursuant to Agricultural Marketing Agreement Act of 1937, as Amended § 900.311 Submittals or requests... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing...
Simulation Gaming in Construction: ER, The Equipment Replacement Game.
Nassar, Khaled
2002-01-01
The Equipment Replacement simulation game can be used to explain the different effects of various equipment buy/sell strategies on the economic performance of construction companies. The probabilistic aspect of demand in the construction market is incorporated. The game is implemented using Excel and Visual Basic for Applications. (Author/SK)
Surrogate 239Pu(n, fxn) and 241Pu(n, fxn) average fission-neutron-multiplicity measurements
Energy Technology Data Exchange (ETDEWEB)
Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Alan, B. S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Akindele, O. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Casperson, R. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hughes, R. O. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Fisher, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-09-26
We have constructed a new neutron-charged-particle detector array called NeutronSTARS. It has been described extensively in LLNL-TR-703909 [1] and Akindele et al [2]. We have used this new neutron-charged-particle array to measure the 241Pu and 239Pu fissionneutron multiplicity as a function of equivalent incident-neutron energy from 100 keV to 20 MeV. The experimental approach, detector array, data analysis, and results are summarized in the following sections.
Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102
International Nuclear Information System (INIS)
SHULTZ, M.V.
1999-01-01
Tank 241-SY-101 (SY-101) waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from SY-101 to 241-SY-102 (SY-102). The results of the hazards evaluation will be compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. This document is not intended to authorize the activity or determine the adequacy of controls; it is only intended to provide information about the hazardous conditions associated with this activity. The Unreviewed Safety Question (USQ) process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis
DEFF Research Database (Denmark)
Steenbuch, Johannes Aakjær
2011-01-01
Der er ikke længere nogen højere sandhed i livet end den, flertallet bestemmer sig for – og dermed ingen del af livet, der ikke er politisk. Højre- og venstrefløjen er i bund og grund enige - enige om, at det er politikernes opgave at forære os det gode liv. Dermed bliver demokratiet totalitært. ...
Structural analysis of the equipment removal system for tank 241SY101
International Nuclear Information System (INIS)
Mackey, T.C.
1995-01-01
The calculations documented in this report show that the ERS major components are structurally qualified to complete the objective, i.e., to install the removed equipment into a shipping container and transport and store the container at the Central Waste Complex (CWC). The analysis for the structural members of the ERS components considers live load with an impact factor of 125 % added to dead load. An allowable stress of one-third yield is used for all structural components carrying the load based on DOE-RL-92-36. Adherence to DOE-RL-92-36 is not a code requirement. However, the loads considered make this factor of safety appropriate. The calculations meet the strength requirements of the American Institute for Steel Construction (ASIC 1989) for all non-critical structural elements
Tank 241-T-203, core 190 analytical results for the final report
International Nuclear Information System (INIS)
Steen, F.H.
1997-01-01
This document is the analytical laboratory report for tank 241-T-203 push mode core segments collected on April 17, 1997 and April 18, 1997. The segments were subsainpled and analyzed in accordance with the Tank 241-T-203 Push Mode Core Sampling andanalysis Plan (TSAP) (Schreiber, 1997a), the Safety Screening Data Quality Objective (DQO)(Dukelow, et al., 1995) and Leffer oflnstructionfor Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI)(Hall, 1997). The analytical results are included in the data summary report (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Schreiber, 1997a). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems (TWRS) Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997b) and not considered in this report
Uptake of americium-241 by algae and bacteria
Energy Technology Data Exchange (ETDEWEB)
Geisy, J P; Paine, D
1978-01-01
Algae and bacteria are important factors in the transport and mobilization of elements in the biosphere. These factors may be involved in trophic biomagnification, resulting in a potential human hazard or environmental degradation. Although americium, one of the most toxic elements known, is not required for plant growth, it may be concentrated by algae and bacteria. Therefore, the availability of americium-241 to algae and bacteria was studied to determine their role in the ultimate fate of this element released into the environment. Both algae and bacteria concentrated americium-241 to a high degree, making them important parts of the biomagnification process. The ability to concentrate americium-241 makes algae and bacteria potentially significant factors in cycling this element in the water column. (4 graphs, numerous references, 3 tables)
Alpha spectrum analysis of 241Am in the urine
International Nuclear Information System (INIS)
Qiu Yongmei; Yang Yong
2006-10-01
With 241 Am as indicator, americium in the urine was concentrated by the method of codeposition, then it was purified by the method of anion exchange, at last, the americium was electroplated. 241 Am in the urine was analysed by six channel low level alpha measuring instrument and Alpha Spectrometer. The results show that the recovering ratio is beyond 60% under the condition that the indicator added to the urine is at the level of mBq. So, 241 Am in the urine can be quantitatively analysed by this method, uncertainty of the result is under 40%, detection limit of the instrument is under 10 -4 Bq. (authors)
Hanford Single-Shell Tank Leak Causes and Locations - 241-C Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2013-07-30
This document identifies 241-C Tank Farm (C Farm) leak causes and locations for the 100 series leaking tanks (241-C-101 and 241-C-105) identified in RPP-RPT-33418, Rev. 2, Hanford C-Farm Leak Inventory Assessments Report. This document satisfies the C Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Hanford Single-Shell Tank Leak Causes and Locations - 241-A Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2013-09-10
This document identifies 241-A Tank Farm (A Farm) leak causes and locations for the 100 series leaking tanks (241-A-104 and 241-A-105) identified in RPP-ENV-37956, Hanford A and AX Farm Leak Assessment Report. This document satisfies the A Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
20 CFR 404.241 - 1977 simplified old-start method.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false 1977 simplified old-start method. 404.241... DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Old-Start Method of Computing Primary Insurance Amounts § 404.241 1977 simplified old-start method. (a) Who is qualified. To qualify for the old...
ORF Alignment: NC_004461 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AIVKGYFADQLQQYFLSHGVSSAIIDLGGNVLTIGRQPETLE 180 ... Query: 254 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSV...LMTSKMQKY 311 ... ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY Sbjct: 241 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 298
EMNE Catch-up Strategies in the Wind Turbine Industry
DEFF Research Database (Denmark)
Awate, Snehal; Larsen, Marcus M.; Mudambi, Ram
2012-01-01
EMNEs' focus on output capabilities need not facilitate innovation catch-up. We compare the knowledge bases of an industry-leading AMNE and a fast-follower EMNE using patent data, buttressed by qualitative information. The AMNE's knowledge base is deeper and composed of more distinct technology groups......Emerging economy multinationals (EMNEs) are catching up with advanced economy MNEs (AMNEs) even in emerging, high technology industries, where their knowledge-based disadvantages are most severe. We explain this phenomenon by distinguishing between output and innovation capabilities. Successful...
Energy Technology Data Exchange (ETDEWEB)
Glover, A G; Fingerhut, M P; Dorling, D V
1988-10-01
Research was conducted to develop an ultrasonic inspection design for the nondestructive evaluation of pipeline girth welds made by the mechanized gas metal arc (GMA) welding process for onshore and offshore pipeline construction. This report describes the work carried out to evaluate the performance to the pitch-catch technique with respect to its ability to examine the body region of mechanized GMA welds in 19.5 mm thick material. Evaluation of the pitch-catch technique was carried out on simulated and real weld defects. Results show that an inspection design method and criteria can be specified for the detection of lack of sidewall fusion defects in the body region of mechanized GMA welds. The criteria specified a pitch-catch technique using a 2.25 MHz 45{degrees} transmitter and a 2.25 MHz 55{degrees} receiver probe. A single pair of these transducers can inspect wall thickness from 9.7 mm to 23.0 mm. The pitch-catch technique evaluated on 19.5 mm wall thickness materials demonstrated that the detection goal of projected depth with a signal-to-noise ratio of greater than 12dB could be met, and that no problems occurred with false indications or missed defects. High sensitivities to small defects in the body region were obtained using a single pair of pitch-catch probes that inspected the body region as a single plane. 4 refs., 14 figs., 6 tabs.
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1997-01-01
This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of 20 plus years ago. Records of transfers into the tank, past characterization efforts, and speculation will be used to estimate the current condition of Tank 241-Z-361 and its contents
Riser configuration, Tank 241-A-105, light duty utility arm
International Nuclear Information System (INIS)
Boucher, T.D.
1994-01-01
The light-duty utility arm (LDUA) is a seven-joint stainless steel robotic arm with a payload capacity of 75 lb. The robotic arm is deployed vertically with a maximum vertical reach of 63 ft. and a maximum horizontal reach of 13.5 ft. The functional requirements of the LDUA system are mapping and characterization of waste in Hanford single-shell tanks (SST) before and during waste retrieval. The LDUA system consists of a mobile deployment system (MDS), a vertical positioning mast (VPM), a tank riser interface confinement (TRIC), the LDUA, and a controller subsystem or support trailer. Currently, the system is in design and is subject to change; however, the LDUA or robotic arm will be deployed through a 12-in. riser above the tank dome. Field trips were performed to gather specifics for future deployment of the LDUA in Tank 241-A-105. The purpose of this report is to support two previous reports for the investigation of SSTs for deployment of the LDUA system. The first report identified the availability of risers while the second report identified the availability of Tanks 241-A-105, 241-A-S-109, 241-A-T-101, and 241-A-T-109 for deployment of the LDUA system. The second report also identified those 4- and 12-in. risers that could be used for deployment of the LDUA and camera system. This report addresses accessibility to the 241-A Tank Farm and the usability of the Tank 241-A-105 risers. The following information for assisting in the design and deployment of the LDUA will be discussed in this report: radiation survey; flange identification; high resolution video; computer simulated model; and field survey
Pet, J.S.; Densen, van W.L.T.; Machiels, M.A.M.; Sukkel, M.; Setyohady, D.; Tumuljadi, A.
1997-01-01
Temporal and spatial patterns in the fishery for Sardinella spp. around East Java, Indonesia, were studied in an attempt to develop an efficient catch and effort sampling strategy for this highly variable fishery. The inter-annual and monthly variation in catch, effort and catch per unit of effort
Indian Academy of Sciences (India)
WHEN SCIENCE CATCHES THE EYE · Slide 2 · Slide 3 · Slide 4 · Concept Overview · Slide 6 · Slide 7 · Slide 8 · Accommodation: Biomechanics · Accommodative IOL: Crystalens · Slide 11 · Enhanced Single Optic Designs · A Dual Optic Accommodating IOL · Slide 14 · A-IOL Implantation being done by Dr. Virender ...
Passing and Catching in Rugby.
Namudu, Mike M.
This booklet contains the fundamentals for rugby at the primary school level. It deals primarily with passing and catching the ball. It contains instructions on (1) holding the ball for passing, (2) passing the ball to the left--standing, (3) passing the ball to the left--running, (4) making a switch pass, (5) the scrum half's normal pass, (6) the…
Vertical distribution of (241)Pu in the southern Baltic Sea sediments.
Strumińska-Parulska, Dagmara I
2014-12-15
The vertical distribution of plutonium (241)Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, (241)Pu/(239+240)Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of (241)Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of (241)Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident. Copyright © 2014 Elsevier Ltd. All rights reserved.
12 CFR 3.11 - Standards for determination of appropriate individual minimum capital ratios.
2010-01-01
.../or affiliate(s); (d) The bank's liquidity, capital, risk asset and other ratios compared to the... individual minimum capital ratios. 3.11 Section 3.11 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY MINIMUM CAPITAL RATIOS; ISSUANCE OF DIRECTIVES Establishment of Minimum Capital...
DEFF Research Database (Denmark)
Mehlsen, Camilla
2006-01-01
Urolige elever, cyklister - der giver fuck-finger, aggressive demonstranter. Samtiden er på vej ind i en æra domineret af vrede, siger rektor Lars-Henrik Schmidt, der er aktuel med bogen 'Om vreden'. Udgivelsesdato: Juni......Urolige elever, cyklister - der giver fuck-finger, aggressive demonstranter. Samtiden er på vej ind i en æra domineret af vrede, siger rektor Lars-Henrik Schmidt, der er aktuel med bogen 'Om vreden'. Udgivelsesdato: Juni...
Comparison of effectiveness of four chelating agents in removing incorporated sup 241 Am
Energy Technology Data Exchange (ETDEWEB)
Mingyue, Lun; Yumin, Wang; Zhikang, Wei [Ministry of Nuclear Industry, Taiyuan, SX (China). Inst. of Radiation Protection; and others
1988-02-01
The effectiveness of four chelating agents (Ca-DTPA, Zn-DTPA, quinamic acid and H-73-10) in removing incorporated {sup 241}Am was studied on 200 rats. The results show that Ca-DTPA and Zn-DTPA are more effective than the others. They decreased the {sup 241}Am contents in the rat liver and skeleton down to only about 5 and 10 per cent of the control values, respectively. Quinamic acid has the same effectiveness in reducing the {sup 241}Am contents in the rat skeleton and liver as that of DTPA, but it leads to the cumulation of {sup 241}Am in the kidney, i. e., the {sup 241}Am content in the kidney is even higher than that in control rats. Although H-73-10 can remove {sup 241}Am from the rat organs, it is much less effective than DTPA.
Recovery of Americium-241 from lightning rod by the method of chemical treatment
International Nuclear Information System (INIS)
Cruz, W.H.
2013-01-01
About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ( 241 Am), fewer and Radium 226 ( 226 Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241 Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241 Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241 Am technique was used electrodeposition. (author)
Influence of tow duration on catch performance of trawl survey in the Mediterranean Sea.
Directory of Open Access Journals (Sweden)
Antonello Sala
Full Text Available The aim of this study was to assess the effect of tow duration on catch per unit of swept area (CPUE, trawl catch performance, and the proportion of the species caught in a trawl survey. Longer tows are expected to have a greater probability of catching species. An average of 26 species were caught in the first 30 minutes, whereas only about one additional species was caught in the next 30 minutes in longer tows. The shorter tows involved a decrement in catch weight for 11 of the 12 target species sampled, demonstrating that tow duration did affect catch per unit of swept area CPUE. The shorter tows were associated with a significant reduction of the overall CPUE in terms of weight of the main target species and of the total catch (circa 60%. The same strong reduction of around 70% was found in particular for European hake (Merluccius merluccius and surmullet (Mullus spp and 50% for Nephrops (Nephrops norvegicus. The shorter tows were less efficient in catching large-sized hake, surmullet, Nephrops, Atlantic horse mackerel (Trachurus trachurus, and poor cod (Trisopterus minutus, even though the difference was significant only for Nephrops. Regardless of the p-value statistic, these findings suggest that the continuity of survey time series would be severely impaired by changing tow duration. Further work is required to explore a way to reduce tow duration without reducing CPUE.
50 CFR 679.84 - Rockfish Program recordkeeping, permits, monitoring, and catch accounting.
2010-10-01
..., monitoring, and catch accounting. 679.84 Section 679.84 Wildlife and Fisheries FISHERY CONSERVATION AND..., permits, monitoring, and catch accounting. (a) Recordkeeping and reporting. See § 679.5(r). (b) Permits... cooperative or rockfish limited access fishery. The requirements under paragraphs (c)(1) through (9) of this...
Operational test report for the 241-A-701 air compressor upgrade
Energy Technology Data Exchange (ETDEWEB)
Meeuwsen, W.E.
1997-06-30
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-@-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in @-C-SD-@-DB-016, 241-A-702 Ventilation System Accumulator Design Basis.
International Nuclear Information System (INIS)
Biermans, Geert; Horemans, Nele; Vanhoudt, Nathalie; Vandenhove, Hildegarde; Saenen, Eline; Van Hees, May; Wannijn, Jean; Vangronsveld, Jaco; Cuypers, Ann
2015-01-01
Human activity has led to an increasing amount of radionuclides in the environment and subsequently to an increased risk of exposure of the biosphere to ionising radiation. Due to their high linear energy transfer, α-emitters form a threat to biota when absorbed or integrated in living tissue. Among these, 241 Am is of major concern due to high affinity for organic matter and high specific activity. This study examines the dose-dependent biological effects of α-radiation delivered by 241 Am at the morphological, physiological and molecular level in 14-day old seedlings of Arabidopsis thaliana after hydroponic exposure for 4 or 7 days. Our results show that 241 Am has high transfer to the roots but low translocation to the shoots. In the roots, we observed a transcriptional response of reactive oxygen species scavenging and DNA repair pathways. At the physiological and morphological level this resulted in a response which evolved from redox balance control and stable biomass at low dose rates to growth reduction, reduced transfer and redox balance decline at higher dose rates. This situation was also reflected in the shoots where, despite the absence of a transcriptional response, the control of photosynthesis performance and redox balance declined with increasing dose rate. The data further suggest that the effects in both organs were initiated in the roots, where the highest dose rates occurred, ultimately affecting photosynthesis performance and carbon assimilation. Though further detailed study of nutrient balance and 241 Am localisation is necessary, it is clear that radionuclide uptake and distribution is a major parameter in the global exposure effects on plant performance and health. - Highlights: • Arabidopsis thaliana was exposed hydroponically to a range of 241 Am concentrations. • Effects at molecular, morphological and physiological level were observed. • Effects were dependent on both dose rate and 241 Am distribution.
The effect of catch crop species on selenium availability for succeeding crops
DEFF Research Database (Denmark)
Stavridou, Eleftheria; Young, Scott D.; Thorup-Kristensen, Kristian
2012-01-01
2007–10 investigated the ability of catch crops (Italian ryegrass, fodder radish and hairy vetch) under different fertiliser regimes to reduce soil Se content in the autumn and to increase its availability in spring to the succeeding crop. Results and Conclusions The catch crops (Italian ryegrass...... and fodder radish) increased water-extractable Se content in the 0.25–0.75msoil layer in only one of the experiments. Selenium uptake by the catch crops varied between 65 and 3263 mg ha−1, depending on species, year and fertilisation treatment; this corresponded to 0.1–3.0% of the water-extractable soil Se......Background and Aims Selenium (Se) is an essential nutrient for humans and animals. In order to ensure an optimal concentration of Se in crops, Se fertilisers are applied. Catch crops may be an alternative way to increase Se concentrations in vegetables. Methods Three experiments in Denmark between...
Hunting the Shadow, Catching the Light
DEFF Research Database (Denmark)
Toft, Anne Elisabeth; Nielsen, Torben
2009-01-01
From 28 October to 6 November 2009 twenty-one 3rd year students in interior design from Central Academy of Fine Arts (CAFA), School of Architecture, Beijing participated in the workshop Hunting the Shadow - Catching the Light. The workshop was conceived and led by the Danish architects Torben Nie...
48 CFR 52.241-1 - Electric Service Territory Compliance Representation.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Electric Service Territory Compliance Representation. 52.241-1 Section 52.241-1 Federal Acquisition Regulations System FEDERAL... utility franchises or service territories established pursuant to State statute, State regulation, or...
24 CFR 3285.311 - Required perimeter supports.
2010-04-01
... HOUSING AND URBAN DEVELOPMENT MODEL MANUFACTURED HOME INSTALLATION STANDARDS Foundations § 3285.311... sides of side wall exterior doors (such as entry, patio, and sliding glass doors) and any other side wall openings of 48 inches or greater in width, and under load-bearing porch posts, factory installed...
49 CFR 214.311 - Responsibility of employers.
2010-10-01
... Responsibility of employers. (a) Each employer is responsible for the understanding and compliance by its employees with its rules and the requirements of this part. (b) Each employer shall guarantee each employee... 49 Transportation 4 2010-10-01 2010-10-01 false Responsibility of employers. 214.311 Section 214...
Reading for national development: Catching them young ...
African Journals Online (AJOL)
Reading for national development: Catching them young. ... It also discussed the impact of illiteracy and inefficient use of reading skills in an era of world's advanced technology. Some agencies that ... AJOL African Journals Online. HOW TO ...
{sup 241}Pu concentrations in water, plankton and fish from the southern Baltic Sea
Energy Technology Data Exchange (ETDEWEB)
Struminska-Parulska, D.I.; Skwarzec, B. [Gdansk, Univ. (Poland). Facuty of Chemistry
2013-08-01
The aim of the work was to determine {sup 241}Pu activities in different components (water, plankton and fish) of the southern Baltic Sea ecosystem. Measurement of {sup 241}Pu in the samples was done indirectly by determining the increment in {sup 241}Am from the decay of the {beta}-emitting {sup 241}Pu in samples collected 10-15 years after the Chernobyl accident. Enhanced levels of {sup 241}Pu were observed in all analyzed Baltic samples. The highest {sup 241}Pu concentrations in fish were found in Perciformes: benthic round goby (0.863 {+-} 0.066 mBq/g ww) and pelagic perch (0.666 {+-} 0.001 mBq/g ww). Plutonium is also non-uniformly distributed in the organs and tissues of the analyzed fish; especially pelagic herring and cod as well as benthic flounder. Most of {sup 241}Pu in flounder, herring and cod is located in soft tissues, especially digestive organs (stomach, intestine, liver). The annual individual effective doses calculated on the basis of {sup 241}Pu concentrations in fish indicated that the impact of the consumption of {sup 241}Pu containing Baltic fish on the annual effective dose for a statistical inhabitant of Poland was very small. (orig.)
Catch-Up Growth Occurs after Diarrhea in Early Childhood123
Richard, Stephanie A.; Black, Robert E.; Gilman, Robert H.; Guerrant, Richard L.; Kang, Gagandeep; Lanata, Claudio F.; Mølbak, Kåre; Rasmussen, Zeba A.; Sack, R. Bradley; Valentiner-Branth, Palle; Checkley, William
2014-01-01
Diarrhea and linear growth faltering continue to burden low-income countries and are among the most important contributors to poor health during early childhood. Diarrhea is thought to adversely affect linear growth, but catch-up growth can occur if no additional insults are experienced. We sought to characterize catch-up growth in relation to diarrhea burden in a multisite dataset of 1007 children. Using longitudinal anthropometry and diarrheal surveillance data from 7 cohort studies in 4 countries, we examined the relation between diarrhea prevalence and growth in 3- to 6-mo periods using linear mixed-effect models. Growth during each period was calculated as a function of age using linear splines. We incorporated the longitudinal prevalence of diarrhea in both current and previous periods into the model. Diarrhea during the current period was associated with slower linear and ponderal growth. Faster (catch-up) growth in length was observed in children with no diarrhea in age groups immediately after an age group in which diarrhea was experienced [age group >6–12 mo: 0.03 mm/mo for each percentage diarrhea prevalence in the previous period (95% CI: 0.007, 0.06) relative to 11.3 mm/mo mean growth rate; age group >12–18 mo: 0.04 mm/mo (95% CI: 0.02, 0.06) relative to 8.9 mm/mo mean growth rate; age group >18–24 mo: 0.04 mm/mo (95% CI: 0.003, 0.09) relative to 7.9 mm/mo mean growth rate]. The associations were stronger in boys than in girls when separate models were run. Similar results were observed when weight was the outcome variable. When diarrheal episodes are followed by diarrhea-free periods in the first 2 y of life, catch-up growth is observed that may allow children to regain their original trajectories. The finding of a greater effect of diarrhea on linear growth in boys than in girls was unexpected and requires additional study. Diarrhea burdens are high throughout the first 2 y of life in these study sites, therefore reducing the likelihood of
COPII-Dependent ER Export: A Critical Component of Insulin Biogenesis and β-Cell ER Homeostasis.
Fang, Jingye; Liu, Ming; Zhang, Xuebao; Sakamoto, Takeshi; Taatjes, Douglas J; Jena, Bhanu P; Sun, Fei; Woods, James; Bryson, Tim; Kowluru, Anjaneyulu; Zhang, Kezhong; Chen, Xuequn
2015-08-01
Pancreatic β-cells possess a highly active protein synthetic and export machinery in the endoplasmic reticulum (ER) to accommodate the massive production of proinsulin. ER homeostasis is vital for β-cell functions and is maintained by the delicate balance between protein synthesis, folding, export, and degradation. Disruption of ER homeostasis by diabetes-causing factors leads to β-cell death. Among the 4 components to maintain ER homeostasis in β-cells, the role of ER export in insulin biogenesis is the least understood. To address this knowledge gap, the present study investigated the molecular mechanism of proinsulin ER export in MIN6 cells and primary islets. Two inhibitory mutants of the secretion-associated RAS-related protein (Sar)1 small GTPase, known to specifically block coat protein complex II (COPII)-dependent ER export, were overexpressed in β-cells using recombinant adenoviruses. Results from this approach, as well as small interfering RNA-mediated Sar1 knockdown, demonstrated that defective Sar1 function blocked proinsulin ER export and abolished its conversion to mature insulin in MIN6 cells, isolated mouse, and human islets. It is further revealed, using an in vitro vesicle formation assay, that proinsulin was packaged into COPII vesicles in a GTP- and Sar1-dependent manner. Blockage of COPII-dependent ER exit by Sar1 mutants strongly induced ER morphology change, ER stress response, and β-cell apoptosis. These responses were mediated by the PKR (double-stranded RNA-dependent kinase)-like ER kinase (PERK)/eukaryotic translation initiation factor 2α (p-eIF2α) and inositol-requiring protein 1 (IRE1)/x-box binding protein 1 (Xbp1) pathways but not via activating transcription factor 6 (ATF6). Collectively, results from the study demonstrate that COPII-dependent ER export plays a vital role in insulin biogenesis, ER homeostasis, and β-cell survival.
Operational test report for the 241-A-701 air compressor upgrade
International Nuclear Information System (INIS)
Meeuwsen, W.E.
1997-01-01
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-at sign-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in at sign-C-SD-at sign-DB-016, 241-A-702 Ventilation System Accumulator Design Basis
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
International Nuclear Information System (INIS)
Himes, D.A.
1998-01-01
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
Energy Technology Data Exchange (ETDEWEB)
Himes, D.A.
1998-08-11
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
18 CFR 701.311 - Accounting for disclosures.
2010-04-01
... ORGANIZATION Protection of Privacy § 701.311 Accounting for disclosures. (a) Maintenance of an accounting. (1...) the name and address of the person or agency to whom the disclosure was made. (3) Accountings prepared... longer, after the disclosure for which the accounting is made. (b) Access to accounting. (1) Except for...
Type B Investigation Report for 241-SY-101 Pump Start and 241-C-106 Pit Cleanout
Energy Technology Data Exchange (ETDEWEB)
Ewalt, J.R.
1993-09-01
In accordance with the direction of the Department of Energy (DOE) Manager, Richland Operations Office, a Type ``B`` investigation in accordance with the DOE Order 5484.1, Environmental Protection, Safety and Health Protection Information Reporting Requirements, has been conducted. The scope of the investigation included two events: The ``Inadvertent Mixer Pump Operation at 241-SY-101`` (RL-WHC-TANK FARM-1993-069); ``Inadequate Work Control Results in Personnel Skin Contamination at 241-C-106, Pit B`` (RL-WHC-TANK FARM-1993-071) events. Additionally, at the request of the President of the WHC, a broader investigation into Waste Tank Farm ``safety practices`` and ``Conduct of Operations`` was also conducted. The review was focused on (1) WHC organizations performing operations, maintenance, and radiological safety tasks; and (2) KEH organizations performing major maintenance tasks.
Maintenance of the classroom health education curricula: results from the CATCH-ON study.
Johnson, Carolyn C; Li, Donglin; Galati, Todd; Pedersen, Sheryl; Smyth, Mary; Parcel, Guy S
2003-08-01
Maintenance of the interactive Child and Adolescent Trial for Cardiovascular Health (CATCH) third- to fifth-grade curricula was studied in the 56 original intervention schools and 20 of the original control schools 5 years postintervention in four regions of the United States. Target grade teachers completed a self-administered survey that included questions regarding use of the CATCH materials, training in CATCH or other health education, barriers and perceived support for health education, and amount of health education currently taught. Percentage of teachers who continued to teach CATCH in the classroom was low; however, percentages were significantly higher in former intervention compared with control schools, even though control schools received training and materials following the main field trial. The results of this study can provide useful information for future development of classroom health promotion materials with a higher level of sustainability.
Variation in angler distribution and catch rates of stocked rainbow trout in a small reservoir
Harmon, Brian S.; Martin, Dustin R.; Chizinski, Christopher J.; Pope, Kevin L.
2018-01-01
We investigated the spatial and temporal relationship of catch rates and angler party location for two days following a publicly announced put-and-take stocking of rainbow trout (Oncorhynchus mykiss). Catch rates declined with time since stocking and distance from stocking. We hypothesized that opportunity for high catch rates would cause anglers to fish near the stocking location and disperse with time, however distance between angler parties and stocking was highly variable at any given time. Spatially explicit differences in catch rates can affect fishing quality. Further research could investigate the variation between angler distribution and fish distribution within a waterbody.
Effects of material growth technique and Mg doping on Er3+ photoluminescence in Er-implanted GaN
International Nuclear Information System (INIS)
Kim, S.; Henry, R. L.; Wickenden, A. E.; Koleske, D. D.; Rhee, S. J.; White, J. O.; Myoung, J. M.; Kim, K.; Li, X.; Coleman, J. J.
2001-01-01
Photoluminescence (PL) and photoluminescence excitation (PLE) spectroscopies have been carried out at 6 K on the ∼1540 nm 4 I 13/2 - 4 I 15/2 emissions of Er 3+ in Er-implanted and annealed GaN. These studies revealed the existence of multiple Er 3+ centers and associated PL spectra in Er-implanted GaN films grown by metalorganic chemical vapor deposition, hydride vapor phase epitaxy, and molecular beam epitaxy. The results demonstrate that the multiple Er 3+ PL centers and below-gap defect-related absorption bands by which they are selectively excited are universal features of Er-implanted GaN grown by different techniques. It is suggested that implantation-induced defects common to all the GaN samples are responsible for the Er site distortions that give rise to the distinctive, selectively excited Er 3+ PL spectra. The investigations of selectively excited Er 3+ PL and PLE spectra have also been extended to Er-implanted samples of Mg-doped GaN grown by various techniques. In each of these samples, the so-called violet-pumped Er 3+ PL band and its associated broad violet PLE band are significantly enhanced relative to the PL and PLE of the other selectively excited Er 3+ PL centers. More importantly, the violet-pumped Er 3+ PL spectrum dominates the above-gap excited Er 3+ PL spectrum of Er-implanted Mg-doped GaN, whereas it was unobservable under above-gap excitation in Er-implanted undoped GaN. These results confirm the hypothesis that appropriate codopants can increase the efficiency of trap-mediated above-gap excitation of Er 3+ emission in Er-implanted GaN. [copyright] 2001 American Institute of Physics
8 CFR 241.21 - Stay of deportation of excluded alien.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Stay of deportation of excluded alien. 241.21 Section 241.21 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for Hearings Commenced...
Estimation of cross talk between lungs and liver for 241Am using phoswich detector
International Nuclear Information System (INIS)
Mishra, Lokpati; Nadar, Minal Y.; Singh, I.S.; Sawant, P.D.
2018-01-01
241 Am is used as a tracer for in-vivo assessment of plutonium (Pu) in the lungs. Internal contamination of 241 Am is estimated by measuring its 59.5 keV photons then activity of Pu is estimated by applying Pu/ 241 Am ratio obtained from radiochemical analysis of fecal/workplace sample. According to ICRP systemic bio-kinetic model, for Type M compounds of 241 Am after 100 days post inhalation intake, 241 Am activity in liver exceeds 241 Am activity present in the lungs and goes on increasing even up to about ten years. In this work, cross talk (CT) between lungs and liver viz. CT (liver to lungs) and CT (lungs to liver) for the actinide monitoring system for 241 Am using realistic thorax Lawrence Livermore National Laboratory (LLNL) phantom were estimated. Also CT has been estimated using voxel phantom by carrying out Monte Carlo simulations in FLUKA code. This study will help in reporting the actual activity present in the individual organ (lungs, liver)
DEFF Research Database (Denmark)
Hoffmeyer, Jesper
2013-01-01
Nu ved vi, at der er mange slags DNA i vores krop, og at samarbejdet mellem de organismer, som bærer alt dette DNA, er essentielt for vores overlevelse" … "Kroppen er en slags økosystem, hvor alle slags samarbejde hen ad vejen bliver afprøvet"...
Directory of Open Access Journals (Sweden)
A. F. Kiosov
2014-01-01
Full Text Available The term catch-up growth is now widely used in neonatology and pediatrics to describe the growth of preterm infants. Catch-up growth — is a compensatory strengthening of the body's growth after a period of slow growth. The lower the gestational age of the premature baby, the more intense catch-up growth in the future.Catch-up growth is considered an important criterion for evaluating nursing preterm infants. Formation of catch-up growth is seen as a favorable outcome. Evaluation of catch-up growth is carried out with the use of percentiles and standard deviations (Z-score. Catch-up growth has a positive effect on neurological outcome. Catch-up growth achieved if the growth rates are between 5 and 10 percentile. The values of growth are satisfactory if they are located at the 10th percentile and above. Catch-up growth is achieved with a standard deviation greater than minus 2 (Z-score. The optimal parameters are considered indicators located within two standard deviations of the mean.Estimation of the growth should be carried out optimally weekly. Growth curves help to determine when the catch-up growth begins. After discharge from the hospital catch-up growth continues. Catch-up growth occurs within the first year of life. The critical period for catch-up growth are considered the first 6 months. Subsequently, the growth rate decreases. The growth is not sufficient, if the values are below the 3 percentile. About 50% of the causes impaired growth is due to the shortage of supply. Premature babies can have problems with food and after discharge from the hospital. The very rapid growth may lead to the development of metabolic syndrome in later life. Low birth weight is associated with increased risk of hypertension, stroke, and diabetes. Compensatory growth often occurs with excessive deposition of fat. In assessing the growth necessary to accommodate the growth of muscle mass and fat mass. Maintaining optimal growth rate is important for the
Effects of Organic Acids and Sylvite on Phytoextraction of 241Am Contaminated Soil.
Wang, Ping; Du, Liang; Tan, Zhaoyi; Su, Rongbo; Li, Taowen
2017-03-01
Contamination of soil with Americium ( 241 Am) at nuclear sites in China poses a serious problem. We screened six plants, from five families, for their 241 Am-enrichment potential. Europium (Eu), which is morphologically and chemically similar to the highly toxic 241 Am, was used in its place. Moreover, the effects of sylvite, citric acid (CA), malic acid (MA), and humic acid (HA) on the absorption of 241 Am by the plants, and its transport within them, were evaluated along with their effect on plant biomass and 241 Am extraction volume. Barley and cabbage showed relatively stronger Eu accumulation capacities. Citric acid promoted the absorption of 241 Am by barley roots and its transport within the plants. The effects of sylvite were not obvious and those of HA were the weakest in case of sunflower; HA, however, maximally increased the biomass of the plants. Our results could provide the basis for future radionuclide phytoremediation of contaminated soils.
Ethical Concern in Joseph Heller’s Catch-22
Institute of Scientific and Technical Information of China (English)
XIAN Yu-jing
2015-01-01
In Catch-22, Joseph Heller shows his ethical concern behind absurdity, which is manifested from his attitude toward individualism and utilitarianism, religious belief, sexual promiscuity, interpersonal relationship, etc.
Plutonium-241 processing: from impure oxide to high purity metal target disks
International Nuclear Information System (INIS)
Conner, W.V.; Baaso, D.L.
1975-01-01
The preparation of three plutonium-241 metal target disks, using a precision casting technique, is described. The disks were 0.625 inch in diameter and 0.125, 0.025, and 0.010 inch thick. All three disks were prepared simultaneously in a single casting. The variation in thickness of each disk was within +-1 percent of the disk's average thickness. The plutonium-241 was highly pure, and the finished disks contained a total of only 297 parts per million of detectable impurities. Purification of the plutonium oxide ( 241 PuO 2 ) and the conversion of the purified 241 PuO 2 to metal are also described. (U.S.)
5 CFR 2610.311 - Payment of award.
2010-01-01
... THE EQUAL ACCESS TO JUSTICE ACT Procedures for Considering Applications § 2610.311 Payment of award..., Suite 500, 1201 New York Avenue NW., Washington, DC 20005-3917. The Office will pay the amount awarded to the applicant within 60 days, unless judicial review of the award or of the underlying decision of...
27 CFR 24.311 - Taxpaid wine record.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Taxpaid wine record. 24..., DEPARTMENT OF THE TREASURY LIQUORS WINE Records and Reports § 24.311 Taxpaid wine record. A proprietor who has taxpaid United States or foreign wine on taxpaid wine premises or on taxpaid wine bottling house...
Contingency plan for deployment of the void fraction instrument in Tank 241-AY-102
International Nuclear Information System (INIS)
CONNER, J.M.
1999-01-01
High-heat producing sludge from tank 241-C-106 will be sluiced and transferred to tank 241-AY-102 beginning in October 1998. Safety analyses have postulated that after retrieval, the waste in 241-AY-102 may generate and retain unsafe levels of flammable gases (Noorani 1998, Pasamebmetoglu etal. 1997). Unsafe levels of retained gas are not expected, but cannot be ruled out because of the large uncertainty in the gas generation and retention rates. The Tank Waste Remediation System Basis for Interim Operation (Noorani 1998) identifies the need for a contingency plan to add void fraction monitoring to tank 241-AY-102 within 2 weeks of the identification of flammable gas buildup that would warrant monitoring. The Tank 241-C-106 Waste Retrieval Sluicing System Process Control Plan (Carothers et al. 1998) committed to providing a contingency plan for deployment of the void fraction instrument (VFI) in tank 241-AY-102. The VFI determines the local void fraction of the waste by compressing a waste sample captured in a gas-tight test chamber. The sample chamber is mounted on the end of a 76-cm (2.5-ft) arm that can be rotated from vertical to horizontal when the instrument is deployed. Once in the waste, the arm can be positioned horizontally and rotated to sample in different areas below the riser. The VFI is deployed using a crane. The VFI has been deployed previously in 241-AW, 241-AN, and 241-SY tank farms, most recently in tank 241-SY-101 in June and July 1998. An additional test in tank 241-SY-101 is planned in September 1998. Operating instructions for the VFI are included in the Void Fraction Instrument Operation and Maintenance Manual (Pearce 1994)
Test report - 241-AN-274 Caustic Pump Control Building
International Nuclear Information System (INIS)
Paintner, G.P.
1995-05-01
This Acceptance Test Report documents the test results of test procedure WHC-SD-WM-ATP-135 'Acceptance Test Procedure for the 241-AN- 274 Caustic Pump Control Building.' The objective of the test was to verify that the 241-AN-274 Caustic Pump Control Building functions properly based on design specifications per applicable H-2-85573 drawings and associated ECN's. The objective of the test was met
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Solicitation provision and contract clause on liability insurance under cost-reimbursement contracts. 528.311 Section 528.311 Federal...-reimbursement contracts. ...
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Solicitation provision and contract clause on liability insurance under cost-reimbursement contracts. 28.311 Section 28.311 Federal...-reimbursement contracts. ...
Environmental DNA from seawater samples correlate with trawl catches of Subarctic, deepwater fishes
DEFF Research Database (Denmark)
Thomsen, Philip Francis; Møller, Peter Rask; Sigsgaard, Eva Egelyng
2016-01-01
such as bottom trawling, and on official reporting of global catches, which can be unreliable. Thus, there is need for alternative and non-invasive techniques for qualitative and quantitative oceanic fish surveys. Here we report environmental DNA (eDNA) metabarcoding of seawater samples from continental slope...... depths in Southwest Greenland. We collected seawater samples at depths of 188-918 m and compared seawater eDNA to catch data from trawling. We used Illumina sequencing of PCR products to demonstrate that eDNA reads show equivalence to fishing catch data obtained from trawling. Twenty-six families were...... found with both trawling and eDNA, while three families were found only with eDNA and two families were found only with trawling. Key commercial fish species for Greenland were the most abundant species in both eDNA reads and biomass catch, and interpolation of eDNA abundances between sampling sites...
SAFETY ANALYSIS APPROACH TO TANK 241-SY-101 REMEDIATION ACTIVITIES
International Nuclear Information System (INIS)
RYAN, G.W.
2000-01-01
An Unreviewed Safety Question was declared related to the unexplained waste surface level growth in high-level radioactive waste storage Tank 241-SY-101 at the Hanford Site in Richland, Washington. Because the waste surface level in Tank 241-SY-101 was growing in a manner inconsistent with previous behavior, the following issues of concern were recognized: (1) The continually rising surface level had the potential to reach physical encumbrances or limits within the tank (e.g., instrumentation, cameras, established Authorization Basis limits, and the double containment boundary) and the potential to significantly change the consequences of previously analyzed accidents (e.g., flammable gas deflagrations). (2) The presence of new hazards because of significant quantities of flammable gas retained in the crust (e.g., crust collapse gas-release events). (3) The potential to inhibit information gathering related to the existing hazards in the tank (e.g., unable to determine surface level to assess the potential for large gas releases). In response to this situation, a Contractor Project Team, which included Department of Energy representation, was formed to constructively address the issue. The team was responsible for developing and evaluating remediation options and executing the chosen option for remediating the surface level rise issue for Tank 241-SY-101. From an Authorization Basis perspective, the following important aspects will be discussed in this paper: (1) The integrated nature of the Project Team. The team consisted of all the organizations necessary to ensure that the time available to remediate Tank 241-SY-101 was effectively used. Most notable is the connectivity of the Nuclear Safety and Licensing organization with the Engineering, Design, and Operations organizations. (2) The ability of the safety analysis support to adjust to and address evolving Project Team goals and dynamic tank conditions. (3) Due to the urgency to mitigate this developing issue
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Solicitation provision and contract clause on liability insurance under cost-reimbursement contracts. 1428.311 Section 1428.311... under cost-reimbursement contracts. ...
Globalization, nation-state and catching up
Directory of Open Access Journals (Sweden)
Luiz Carlos Bresser-Pereira
2008-12-01
Full Text Available Globalization and nation-states are not in contradiction, since globalization is the present stage of capitalist development, and the nation-state is the territorial political unit that organizes the space and population in the capitalist system. Since the 1980s, Global Capitalism constitutes the economic system characterized by the opening of all national markets and a fierce competition between nation-states. Developing countries tend to catch up, while rich countries try to neutralize such competitive effort, using globalism as an ideology, and conventional orthodoxy as a strategy. Middle-income countries that are catching up in the realm of globalization are the ones that count with a national development strategy. This is broadly the case of the dynamic Asian countries. In contrast, Latin American countries have no longer their own strategy, and grow less. To add data to the argument, the author conducts an econometric test comparing these two groups of countries, and three variables: the rate of investment, the current account deficit or surplus that would indicate or not a competitive exchange rate, and public deficit.
Electronic catch recordings for scientific and commercial use
DEFF Research Database (Denmark)
Gundersen, Agnes C.; Dyb, Jan Erik; Fossen, Inge
For assessment and management of marine fish resources, representative data of statistically good quality describing the actual catch are lacking for many fisheries. Even for the most studied fisheries in the North Atlantic, the uncertainty regarding what is actually caught has implications...... for management. Fish stock assessments and sound advice in most cases rely on representative samples of catches. Distant and high sea fisheries often suffer from poor sampling due to sampling personal logistics. Consequently, stock assessment and management of marine fish resources exploited by those fisheries...... on the fishery, thereby meeting the challenges of obtaining representative fishery data, that is continuous and complete and willprovide sufficient data for fish stock assessments and, hence, subsequent fisheries management of species found in distant waters....
System Description for Tank 241-AZ-101 Waste Retrieval Data Acquisition System
International Nuclear Information System (INIS)
ROMERO, S.G.
2000-01-01
The proposed activity provides the description of the Data Acquisition System for Tank 241-AZ-101. This description is documented in HNF-5572, Tank 241-AZ-101 Waste Retrieval Data Acquisition System (DAS). This activity supports the planned mixer pump tests for Tank 241-AZ-101. Tank 241-AZ-101 has been selected for the first full-scale demonstration of a mixer pump system. The tank currently holds over 960,000 gallons of neutralized current acid waste, including approximately 12.7 inches of settling solids (sludge) at the bottom of the tank. As described in Addendum 4 of the FSAR (LMHC 2000a), two 300 HP mixer pumps with associated measurement and monitoring equipment have been installed in Tank 241-AZ-101. The purpose of the Tank 241-AZ-101 retrieval system Data Acquisition System (DAS) is to provide monitoring and data acquisition of key parameters in order to confirm the effectiveness of the mixer pumps utilized for suspending solids in the tank. The suspension of solids in Tank 241-AZ-101 is necessary for pretreatment of the neutralized current acid waste and eventual disposal as glass via the Hanford Waste Vitrification Plant. HNF-5572 provides a basic description of the Tank 241-AZ-101 retrieval system DAS, including the field instrumentation and application software. The DAS is provided to fulfill requirements for data collection and monitoring. This document is not an operations procedure or is it intended to describe the mixing operation. This USQ screening provides evaluation of HNF-5572 (Revision 1) including the changes as documented on ECN 654001. The changes include (1) add information on historical trending and data backup, (2) modify DAS I/O list in Appendix E to reflect actual conditions in the field, and (3) delete IP address in Appendix F per Lockheed Martin Services, Inc. request
Energy Technology Data Exchange (ETDEWEB)
RIECK, C.A.
1999-02-25
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.
International Nuclear Information System (INIS)
RIECK, C.A.
1999-01-01
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Solicitation provision and contract clause on liability insurance under cost-reimbursement contracts. 1828.311 Section 1828.311... insurance under cost-reimbursement contracts. ...
Catching up with the Future of Physics
2008-01-01
With most of the high-energy physics world on tenterhooks waiting for the startup of the Large Hadron Collider in Switzerland later this year, it's a good time to catch up (if you haven't already) on what all the excitement is about.
International Nuclear Information System (INIS)
Park, Je Woong; Yang, In Young; Im, Kwang Hee; Hsu, David K.; Jung, Jong An
2012-01-01
The importance of carbon fiber reinforced plastics (CFRP) has been generally recognized, and CFRP composite laminates have become widely used. Thus, a nondestructive technique would be very useful for evaluating CF/epoxy composite laminates. A pitch catch UT signal is more sensitive than is a normal incidence backwall echo of a longitudinal wave in composites. The depth of the sampling volume where the pitch catch UT signal came from is relatively shallow, but the depth can be increased by increasing the separation distance of the transmitting and receiving probes. Moreover, a method is utilized to determine the porosity content of a composite lay up by processing micrograph images of the laminate. The porosity content of a composite structure is critical to the overall strength and performance of the structure. The image processing method developed utilizes software to process micrograph images of the test sample. The results from the image processing method are compared with existing data. Beam profile is characterized in unidirectional CFRP using pitch catch Rayleigh probes. The one sided and two sided pitch catch techniques are utilized to produce C scan images with the aid of an automatic scanner. The pitch catch ultrasonic signal corresponds with the simulated results of unidirectional CFRP composites
Experimental verification for standard analysis procedure of 241Am in food
International Nuclear Information System (INIS)
Liu Qingfen; Zhu Hongda; Liu Shutian; Pan Jingshun; Yang Dating
2005-01-01
Objective: The briefly experimental verification for 'determination of 241 Am in food' has been described. Methods: The overall recovery, the MDL of method and decontamination experiment has been done by standard analysis procedure. Results: The overall recovery is 76.26 ± 4.1%. The MDL is 3.4 x 10 -5 Bq/g ash, decontamination factor is higher than 10 3 for Po, 10 2 for U, Th, Pu and 60 for 237 Np. Conclusion: The results showed that the overall recovery is quite high and reliable, the MDL of method is able to meet examining 241 Am limited values in foods. the obtained decontamination factors of recommended procedure can meet analysis of 241 Am in food examination. Venifying results of the procedure are satisfied by using 243 Am spike and 241 Am standard reference material. (authors)
Pitch-catch only ultrasonic fluid densitometer
Greenwood, M.S.; Harris, R.V.
1999-03-23
The present invention is an ultrasonic fluid densitometer that uses a material wedge and pitch-catch only ultrasonic transducers for transmitting and receiving ultrasonic signals internally reflected within the material wedge. Density of a fluid is determined by immersing the wedge into the fluid and measuring reflection of ultrasound at the wedge-fluid interface. 6 figs.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitation provision and contract clause on liability insurance under cost-reimbursement contracts. 228.311 Section 228.311 Federal... liability insurance under cost-reimbursement contracts. ...
Using 311 Data as a Proxy For Weather Impacts
Zou, X.
2017-12-01
According to the World Bank, two-thirds of the global population will lives in urban areas by 2050. The impacts of major weather events have sometimes led to huge economic losses in urban areas and impacts are projected to increase as cities grow. Using remote sensing to study weather in urban areas is challenge because urban areas are small relative to the resolutions of many satellite products. In addition, most human activity is indoors and underground, which neither satellites nor other remote sensing instruments can measure. As a substitute for these instruments, there are datasets that can potentially provide information about the local impacts of the weather. Many cities use the U.S. Federal Communications Commision code for non-emergencies (311) as a hotline for residents to report municipal issues. For example, New York City's 311 dataset contains over a 100 million reports, many of which are potentially related to the impacts of weather events. To isolate the impacts, we aggregate over space and time to reduce the noise in the data and normalize the data to account for uneven distributions of people and complaints. We then compare the potentially weather related 311 reports with global monthly summaries of weather observations from the Global Historical Climatology Network (GHCN) to analyze the impact of weather events as reported by the residents of NYC.
Rocklin, Delphine; Levrel, Harold; Drogou, Mickaël; Herfaut, Johanna; Veron, Gérard
2014-01-01
Fisheries statistics are known to be underestimated, since they are mainly based on information about commercial fisheries. However, various types of fishing activities exist and evaluating them is necessary for implementing effective management plans. This paper assesses the characteristics and catches of the French European sea bass recreational fishery along the Atlantic coasts, through the combination of large-scale telephone surveys and fishing diaries study. Our results demonstrated that half of the total catches (mainly small fish) were released at sea and that the mean length of a kept sea bass was 46.6 cm. We highlighted different patterns of fishing methods and type of gear used. Catches from boats were greater than from the shore, both in abundance and biomass, considering mean values per fishing trip as well as CPUE. Spearfishers caught the highest biomass of sea bass per fishing trip, but the fishing rod with lure was the most effective type of gear in terms of CPUE. Longlines had the highest CPUE value in abundance but not in biomass: they caught numerous but small sea bass. Handlines were less effective, catching few sea bass in both abundance and biomass. We estimated that the annual total recreational sea bass catches was 3,173 tonnes of which 2,345 tonnes were kept. Since the annual commercial catches landings were evaluated at 5,160 tonnes, recreational landings represent 30% of the total fishing catches on the Atlantic coasts of France. Using fishers' self-reports was a valuable way to obtain new information on data-poor fisheries. Our results underline the importance of evaluating recreational fishing as a part of the total amount of fisheries catches. More studies are critically needed to assess overall fish resources caught in order to develop effective fishery management tools.
Directory of Open Access Journals (Sweden)
Delphine Rocklin
Full Text Available Fisheries statistics are known to be underestimated, since they are mainly based on information about commercial fisheries. However, various types of fishing activities exist and evaluating them is necessary for implementing effective management plans. This paper assesses the characteristics and catches of the French European sea bass recreational fishery along the Atlantic coasts, through the combination of large-scale telephone surveys and fishing diaries study. Our results demonstrated that half of the total catches (mainly small fish were released at sea and that the mean length of a kept sea bass was 46.6 cm. We highlighted different patterns of fishing methods and type of gear used. Catches from boats were greater than from the shore, both in abundance and biomass, considering mean values per fishing trip as well as CPUE. Spearfishers caught the highest biomass of sea bass per fishing trip, but the fishing rod with lure was the most effective type of gear in terms of CPUE. Longlines had the highest CPUE value in abundance but not in biomass: they caught numerous but small sea bass. Handlines were less effective, catching few sea bass in both abundance and biomass. We estimated that the annual total recreational sea bass catches was 3,173 tonnes of which 2,345 tonnes were kept. Since the annual commercial catches landings were evaluated at 5,160 tonnes, recreational landings represent 30% of the total fishing catches on the Atlantic coasts of France. Using fishers' self-reports was a valuable way to obtain new information on data-poor fisheries. Our results underline the importance of evaluating recreational fishing as a part of the total amount of fisheries catches. More studies are critically needed to assess overall fish resources caught in order to develop effective fishery management tools.
Brasil (1955-2005: 25 anos de catching up, 25 anos de falling behind
Directory of Open Access Journals (Sweden)
Marcelo Arend
2012-03-01
Full Text Available Brazil (1955-2005: 25 years of catching-up, 25 years of falling behind. The present paper discusses the Brazilian industrial development under a neo-schumpeterian perspective in the period after 1955. The hypothesis is that, in the last 50 years, Brazil spent the first 25 years catching up and, next, the following 25 years falling behind. The 1955-1980 period, by means of international funding, allowed catching up with the paradigm in maturation within the fourth technological revolution. However, in this period, it was determined the main debilitating elements for the country's entrance in the new techno-economical paradigm of the fifth technological revolution which emerged in the middle of the 70s. It is in the strategy to internationalize the economy, granting the mutinational companies the key-sectors of the national economy dynamics during the catching up period, the main element of dependence in the journey that conditions the current performance, responsible for technology subordination and keeps the Brazilian economy with low dynamism.
7 CFR 1951.241 - Special provision for interest rate change.
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Special provision for interest rate change. 1951.241... Community and Direct Business Programs Loans and Grants § 1951.241 Special provision for interest rate... interest rate charged by FmHA or its successor agency under Public Law 103-354 to water and waste disposal...
Catching Comet's Particles in the Earth's Atmosphere by Using Balloons
Potashko, Oleksandr; Viso, Michel
The project is intended to catch cometary particles in the atmosphere by using balloons. The investigation is based upon knowledge that the Earth crosses the comet’s tails during the year. One can catch these particles at different altitudes in the atmosphere. So, we will be able to gradually advance in the ability to launch balloons from low to high altitudes and try to catch particles from different comet tails. The maximum altitude that we have to reach is 40 km. Both methods - distance observation and cometary samples from mission Stardust testify to the presence of organic components in comet’s particles. It would be useful to know more details about this organic matter for astrobiology; besides, the factor poses danger to the Earth. Moreover, it is important to prove that it is possible to get fundamental scientific results at low cost. In the last 5 years launching balloons has become popular and this movement looks like hackers’ one - as most of them occur without launch permission to airspace. The popularity of ballooning is connected with low cost of balloon, GPS unit, video recording unit. If you use iPhone, you have a light solution with GPS, video, picture and control function in one unit. The price of balloon itself begins from $50; it depends on maximum altitude, payload weight and material. Many university teams realized balloon launching and reached even stratosphere at an altitude of 33 km. But most of them take only video and picture. Meanwhile, it is possible to carry out scientific experiments by ballooning, for example to collect comet particles. There is rich experience at the moment of the use of mineral, chemical and isotopic analysis techniques and data of the comet’s dust after successful landing of StarDust capsule with samples in 2006. Besides, we may use absolutely perfect material to catch particles in the atmosphere, which was used by cosmic missions such as Stardust and Japanese Hayabusa. As to balloon launches, we could use
30 CFR 241.76 - Can MMS reduce my penalty once it is assessed?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Can MMS reduce my penalty once it is assessed? 241.76 Section 241.76 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... Provisions § 241.76 Can MMS reduce my penalty once it is assessed? Under 30 U.S.C. 1719(g), the Director or...
International Nuclear Information System (INIS)
Estey, S.D.
1997-01-01
This calculation note analyzes headspace concentrations of hydrogen dependent upon assumed ventilation flow rates provided for tanks 241-C-106 and 241-AY-102. The analyses are based on measured or estimated steady state hydrogen release rates. Tank 241-C-106 is analyzed prior to sluicing; tank 241-AY-102 is analyzed both prior to and after completion of sluicing. Specific analyses, using both best estimated and bounding hydrogen generation rates, include the minimum primary ventilation flow rates required in the tanks to ensure that the steady state hydrogen concentration in the respective tank headspace does not exceed 25% and 100% of the LFL. The headspace hydrogen concentration as a function of time as well as the time required to reach 25% and 100% of LFL upon complete loss of active ventilation, starting from the steady state hydrogen concentration based on a 200 CFM minimum flow rate in tank 241-C-106 and a 100 CFM minimum flow rate in tank241-AY-102. The headspace hydrogen concentration as a function of thee following partial loss of active ventilation (i.e., step changes to l60, l20, 80, and 40 CFM ventilation flow rates) in tank 241-C-106, staffing from a 200 CFM flow rate and the corresponding steady state hydrogen concentration based on the 200 CFM flow rate. The headspace hydrogen concentration as a function of the following partial loss of active ventilation i.e., step changes to 80, 60, 40, and 20 CFM ventilation flow rates) in tank 241-AY-102, starting from a 100 CFM flow rate and the corresponding steady state hydrogen concentration based on the 100 CFM flow rate
Tank characterization report for single-shell tank 241-T-104
International Nuclear Information System (INIS)
DiCenso, A.T.; Simpson, B.C.
1994-01-01
In August 1992, Single-Shell Tank 241-T-104 was sampled to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code (Ecology, 1991). This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also addresses expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background tank information. The purpose of this report is to describe and characterize the waste in Single-Shall Tank 241-T-104 (hereafter, Tank 241-T-104) based on information given from various sources. This report summarizes the available information regarding the waste in Tank 241-T-104, and using the historical information to place the analytical data in context, arranges this information in a useful format for making management and technical decisions concerning this waste tank. In addition, conclusions and recommendations are given based on safety issues and further characterization needs
Tank characterization report for double-shell Tank 241-AP-107
International Nuclear Information System (INIS)
DeLorenzo, D.S.; Simpson, B.C.
1994-01-01
The purpose of this tank characterization report is to describe and characterize the waste in Double-Shell Tank 241-AP-107 based on information gathered from various sources. This report summarizes the available information regarding the waste in Tank 241-AP-107, and arranges it in a useful format for making management and technical decisions concerning this particular waste tank. In addition, conclusion and recommendations based on safety and further characterization needs are given. Specific objectives reached by the sampling and characterization of the waste in Tank 241-AP-107 are: Contribute toward the fulfillment of the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-44-05 concerning the characterization of Hanford Site high-level radioactive waste tanks; Complete safety screening of the contents of Tank 241-AP-107 to meet the characterization requirements of the Defense Nuclear Facilities Safety board (DNFSB) Recommendation 93-5; and Provide tank waste characterization to the Tank Waste Remediation System (TWRS) Program Elements in accordance with the TWRS Tank Waste Analysis Plan
DEFF Research Database (Denmark)
Bech, Henning; Necef, Mehmet Ümit
Igennem de seneste årtier er det blevet almindeligt at tale om, at der er en udbredt racisme i Danmark. Påstande om danskernes racisme, fremmedhad og diskrimination optræder dagligt i offentligheden og i medierne, og der henvises ofte til, hvad ’forskerne’ og de ’videnskabelige undersøgelser’ siger...... om emnet. Der kan da næppe heller være tvivl om, at der forekommer racistiske holdninger hos nogle danskere. Men er problemet så stort, som det gøres til i den offentlige debat? Bogen ønsker at afklare, hvorvidt der er videnskabelig dokumentation for påstandene om danskernes racisme. Den går i dybden...... med en række forskeres og eksperters udtalelser på området og præsenterer en grundig analyse af deres fremstilling af dansk racisme i forhold til emner som kultur, seksualitet, kriminalitet og arbejdsmarked....
Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis)
International Nuclear Information System (INIS)
Bolsunovsky, A.; Zotina, T.; Bondareva, L.
2005-01-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241 Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241 Am is accumulated by Elodea biomass: the activity concentration of 241 Am can reach 3280 ± 240 Bq/g, with the concentration factor for 241 Am 16 600 ± 2200 l/kg. Results of chemical fractionation have proved that in the course of 241 Am accumulation by Elodea biomass, 241 Am tightly bound to biomass increases from 11% to 27% of the total 241 Am in the biomass. Release of 241 Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241 Am activity and the rate of 241 Am release into the water environment reached 23 Bq/day
Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis).
Bolsunovsky, A; Zotina, T; Bondareva, L
2005-01-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241Am is accumulated by Elodea biomass: the activity concentration of 241Am can reach 3280+/-240 Bq/g, with the concentration factor for 241Am 16 600+/-2200l/kg. Results of chemical fractionation have proved that in the course of 241Am accumulation by Elodea biomass, 241Am tightly bound to biomass increases from 11% to 27% of the total 241Am in the biomass. Release of 241Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241Am activity and the rate of 241Am release into the water environment reached 23 Bq/day.
Competing probabilistic models for catch-effort relationships in wildlife censuses
Energy Technology Data Exchange (ETDEWEB)
Skalski, J.R.; Robson, D.S.; Matsuzaki, C.L.
1983-01-01
Two probabilistic models are presented for describing the chance that an animal is captured during a wildlife census, as a function of trapping effort. The models in turn are used to propose relationships between sampling intensity and catch-per-unit-effort (C.P.U.E.) that were field tested on small mammal populations. Capture data suggests a model of diminshing C.P.U.E. with increasing levels of trapping intensity. The catch-effort model is used to illustrate optimization procedures in the design of mark-recapture experiments for censusing wild populations. 14 references, 2 tables.
Pu241 cross-sections below 1 keV
International Nuclear Information System (INIS)
Doherty, G.
1966-12-01
Early in 1965 a new data file (DFN 40) for Pu241 covering the energy range 10 - 4 eV to 15 MeV was prepared for the UKAEA Nuclear Data Library. The data above 1 keV are described by Douglas (AWRE 0-101/64) and the data below 1 keV are set out in this report. During the past year a number of additional measurements have been reported for Pu241 and a brief summary of these measurements and their implications for the data on the file are given. (author)
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi, E-mail: rpadua@ipen.b, E-mail: sksakata@ipen.b, E-mail: jblima@ipen.b, E-mail: mbmarumo@ipen.b, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-10-26
This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137
Determination of plutonium 241 in solutions of nuclear wastes
International Nuclear Information System (INIS)
Raymond, A.; Bilcot, J.B.; Poletiko, C.
1990-09-01
Determination of plutonium 241 in nuclear wastes is important because of long period and high energy of some daughter products. In this report are presented two quantitative analysis methods using both scintillation techniques: A complete method, in any case, by selective extraction of plutonium on an anionic resin allowing simultaneous determination of Pu 241 and the sum of other plutonium isotopes; a simplified method when alpha activity is higher than beta/gamma activity by liquid extraction with TTA. These methods are applied for analysis of 4 waste types: cement encapsulated wastes, bitumen encapsulated wastes, incineration ashes, leaching of encapsulated incineration ashes. In these 4 examples, Pu 241 activity is equal or higher than the sum of alpha plutonium isotope activity. Separation efficiency, measured from Pu 239 or with Pu 236 as tracer, is between 90 and 99% [fr
Project W-314 specific test and evaluation plan for 241-AN-A valve pit
International Nuclear Information System (INIS)
Hays, W.H.
1997-01-01
The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-A Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a ''lower tier'' document based on the W-314 Test and Evaluation Plan (TEP) This STEP encompasses all testing activities required to demonstrate compliance to the project design criteria as it relates to the modifications of the AN-A valve pit. The Project Design Specifications (PDS) identify the specific testing activities required for the Project. Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities), Factory Acceptance Tests (FATs), installation tests and inspections, Construction Acceptance Tests (CATs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). It should be noted that POTPs are not required for testing of the modifications to the 241-AN-A Valve Pit. The STEP will be utilized in conjunction with the TEP for verification and validation
Tank 241-C-106 in-tank imaging system operational test report
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of operational testing of the 241-C-106 In-Tank Video Camera Imaging System. This imaging system was installed as a component of Project W-320 to monitor sluicing and waste retrieval activities in Tank 241-C-106
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Solicitation provision and contract clause on liability insurance under cost-reimbursement contracts. 3028.311 Section 3028.311... contract clause on liability insurance under cost-reimbursement contracts. ...
From bonito to anchovy: a reconstruction of Turkey’s marine fisheries catches (1950-2010
Directory of Open Access Journals (Sweden)
A. ULMAN
2013-06-01
Full Text Available Turkey’s marine fisheries catches were estimated for the 1950-2010 time period using a reconstruction approach, which estimated all fisheries removals, including unreported landings, recreational landings and discards. We added these estimates to the ‘official’ data, as reported in TURKSTAT, which are also available from the United Nation’s Food and Agriculture Organization (FAO. The total reconstructed catch for the 1950-2010 time period (inclusive of the reported data is approximately 32 million t, or 74% more than the 18.4 million t of reported data. This added approximately 13.6 million t to the reported data, consisting of 6.9 million t of unreported landings, 2.6 million t of discards, 2.4 million t of recreational catches, and 1.7 million t of subsistence catches. In 2010, total reported marine landings for Turkey were 445,680 t and the total reconstructed catch was 763,760 t, or 73% more than the reported data. The main unreported taxon by tonnage was European anchovy (Engraulis encrasicolus due to its sheer high proportion of catch. The major reasons for underreporting include a general distrust fishers have towards the taxing system combined with inefficient fisheries monitoring and surveillance capabilities. Accounting for all fisheries components is crucial in understanding the development of fisheries resources, improving management, and reducing threats to the domestic food security of Turkey.
International Nuclear Information System (INIS)
Yamaguchi, Hiroshi; Zhang, Xin-Rong; Niu, Xiao-Dong
2010-01-01
The damping characteristics and flow behaviors of ER fluids inside a piston–cylinder viscous damper subjected to external electric fields are studied based on experiment, theoretical analysis and numerical simulation. The viscous damper is a closed system with an inner piston and an outer cylinder, which is designed and constructed in our laboratory. In the experiment, the test ER fluid is enclosed in the gap of a piston–cylinder system. To examine the damping characteristics of the test ER fluid, a piston sine vibration experiment is performed with accompanying theoretical analyses. In addition, in order to investigate the ER flow behaviors inside the damper, a numerical simulation is carried out. The present study discloses the damping characteristics and the fluid mechanism of the ER fluid in the piston–cylinder damper with an applied external electric field
Ivasauskas, Tomas J.; Xiong, Wilson N.; Engman, Augustin C.; Fischer, Jesse R.; Kwak, Thomas J.; Rundle, Kirk R.
2017-01-01
Urban fisheries provide unique angling opportunities for people from traditionally underrepresented demographics. Lake Raleigh is a 38-ha impoundment located on the North Carolina State University campus in Raleigh. Like many urban fisheries, little is known about angler use and satisfaction or how angling catch rate is related to fish availability in Lake Raleigh. We characterized the recreational fishery and fish assemblage with concurrent creel and boat electrofishing surveys over the course of one year. In total, 245 anglers were interviewed on 68 survey days. On average, anglers spent 1.7 h fishing per trip and caught 0.385 fish h –1. A large proportion of anglers (43.9%) targeted multiple species, whereas 36.5% targeted largemouth bass (Micropterus salmoides), 10.0% targeted panfish (i.e., sunfishes [Lepomis spp.] and crappies [Pomoxis spp.]), and 9.6% targeted catfish (Ameiurus spp. and Ictalurus spp.). Most anglers (69.4%) were satisfied with their experience, and overall satisfaction was unrelated to catch rate. Pulsed-DC boat electrofishing was conducted on 25 dates, and 617 fish were sampled. Angler catch rate was unrelated to electrofishing catch rate, implying that anglers' catch rate was independent of fish density or availability. Our results demonstrate that even minimally managed urban fisheries can provide high angler satisfaction, with limited dedication of management resources. Relationships Among Catch, Angler Satisfaction, and Fish Assemblage Characteristics of an Urban Small Impoundment Fishery (PDF Download Available). Available from: https://www.researchgate.net/publication/316636550_Relationships_Among_Catch_Angler_Satisfaction_and_Fish_Assemblage_Characteristics_of_an_Urban_Small_Impoundment_Fishery [accessed Aug 11, 2017].
Direct Imaging of ER Calcium with Targeted-Esterase Induced Dye Loading (TED)
Samtleben, Samira; Jaepel, Juliane; Fecher, Caroline; Andreska, Thomas; Rehberg, Markus; Blum, Robert
2013-01-01
Visualization of calcium dynamics is important to understand the role of calcium in cell physiology. To examine calcium dynamics, synthetic fluorescent Ca2+ indictors have become popular. Here we demonstrate TED (= targeted-esterase induced dye loading), a method to improve the release of Ca2+ indicator dyes in the ER lumen of different cell types. To date, TED was used in cell lines, glial cells, and neurons in vitro. TED bases on efficient, recombinant targeting of a high carboxylesterase activity to the ER lumen using vector-constructs that express Carboxylesterases (CES). The latest TED vectors contain a core element of CES2 fused to a red fluorescent protein, thus enabling simultaneous two-color imaging. The dynamics of free calcium in the ER are imaged in one color, while the corresponding ER structure appears in red. At the beginning of the procedure, cells are transduced with a lentivirus. Subsequently, the infected cells are seeded on coverslips to finally enable live cell imaging. Then, living cells are incubated with the acetoxymethyl ester (AM-ester) form of low-affinity Ca2+ indicators, for instance Fluo5N-AM, Mag-Fluo4-AM, or Mag-Fura2-AM. The esterase activity in the ER cleaves off hydrophobic side chains from the AM form of the Ca2+ indicator and a hydrophilic fluorescent dye/Ca2+ complex is formed and trapped in the ER lumen. After dye loading, the cells are analyzed at an inverted confocal laser scanning microscope. Cells are continuously perfused with Ringer-like solutions and the ER calcium dynamics are directly visualized by time-lapse imaging. Calcium release from the ER is identified by a decrease in fluorescence intensity in regions of interest, whereas the refilling of the ER calcium store produces an increase in fluorescence intensity. Finally, the change in fluorescent intensity over time is determined by calculation of ΔF/F0. PMID:23685703
Direct imaging of ER calcium with targeted-esterase induced dye loading (TED).
Samtleben, Samira; Jaepel, Juliane; Fecher, Caroline; Andreska, Thomas; Rehberg, Markus; Blum, Robert
2013-05-07
Visualization of calcium dynamics is important to understand the role of calcium in cell physiology. To examine calcium dynamics, synthetic fluorescent Ca(2+) indictors have become popular. Here we demonstrate TED (= targeted-esterase induced dye loading), a method to improve the release of Ca(2+) indicator dyes in the ER lumen of different cell types. To date, TED was used in cell lines, glial cells, and neurons in vitro. TED bases on efficient, recombinant targeting of a high carboxylesterase activity to the ER lumen using vector-constructs that express Carboxylesterases (CES). The latest TED vectors contain a core element of CES2 fused to a red fluorescent protein, thus enabling simultaneous two-color imaging. The dynamics of free calcium in the ER are imaged in one color, while the corresponding ER structure appears in red. At the beginning of the procedure, cells are transduced with a lentivirus. Subsequently, the infected cells are seeded on coverslips to finally enable live cell imaging. Then, living cells are incubated with the acetoxymethyl ester (AM-ester) form of low-affinity Ca(2+) indicators, for instance Fluo5N-AM, Mag-Fluo4-AM, or Mag-Fura2-AM. The esterase activity in the ER cleaves off hydrophobic side chains from the AM form of the Ca(2+) indicator and a hydrophilic fluorescent dye/Ca(2+) complex is formed and trapped in the ER lumen. After dye loading, the cells are analyzed at an inverted confocal laser scanning microscope. Cells are continuously perfused with Ringer-like solutions and the ER calcium dynamics are directly visualized by time-lapse imaging. Calcium release from the ER is identified by a decrease in fluorescence intensity in regions of interest, whereas the refilling of the ER calcium store produces an increase in fluorescence intensity. Finally, the change in fluorescent intensity over time is determined by calculation of ΔF/F0.
THE APPLICATION OF SURVEY IN ER WANG TEMPLE RESTITUTING
Directory of Open Access Journals (Sweden)
W. Shuai
2013-07-01
Full Text Available Er Wang Temple, in World Heritage Site "Dujiang Weirs and Qingchengshan Mountai", was severely destroyed in Wenchuan earthquake of May 2008. There are several problems at different level in every building, such as structural distortion, foundation displacement, wall fracture, roof damage, etc. The stage was completely collapsed in the earthquake. Tableland the stage situated had a huge crack and slope collapse. This article is for the stage renovation. The survey of damage in earthquake is the basis of Er Wang Temple restituting. Survey including field survey after the earthquake and the measurement and investigation for the remained construction member of the main wood structure. For field survey, the basis of pillars which had not have significantly affects in earthquake could be seem as the reference points for measurement. The investigation of remained main wood construction member, especially the size of the key structures and site and manufacture method of the joints, is the important basis for recovery stage. Our team did our utmost to restore the original appearance of stage in design, materials and craft by various tools, which include measured drawings in different times, old images collection, fine measuring by 3D laser scan, measurement of leftover pieces, logical inference.
Tank 241-C-106 waste retrieval sluicing system process control plan
Energy Technology Data Exchange (ETDEWEB)
Carothers, K.G.
1998-07-25
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity.
Tank 241-C-106 waste retrieval sluicing system process control plan
International Nuclear Information System (INIS)
Carothers, K.G.
1998-01-01
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity
Behavior of 241Am in fast reactor systems - a safeguards perspective
International Nuclear Information System (INIS)
Beddingfield, David H.; Lafleur, Adrienne M.
2009-01-01
Advanced fuel-cycle developments around the world currently under development are exploring the possibility of disposing of 241 Am from spent fuel recycle processes by burning this material in fast reactors. For safeguards practitioners, this approach could potentially complicate both fresh- and spent-fuel safeguards measurements. The increased (α,n) production in oxide fuels from the 241 Am increases the uncertainty in coincidence assay of Pu in MOX assemblies and will require additional information to make use of totals-based neutron assay of these assemblies. We have studied the behavior of 241 Am-bearing MOX fuel in the fast reactor system and the effect on neutron and gamma-ray source-terms for safeguards measurements. In this paper, we will present the results of simulations of the behavior of 241 Am in a fast breeder reactor system. Because of the increased use of MOX fuel in thermal reactors and advances in fuel-cycle designs aimed at americium disposal in fast reactors, we have undertaken a brief study of the behavior of americium in these systems to better understand the safeguards impacts of these new approaches. In this paper we will examine the behavior of 241 Am in a variety of nuclear systems to provide insight into the safeguards implications of proposed Am disposition schemes.
Genetic Evidence Highlights Potential Impacts of By-Catch to Cetaceans
Mendez, Martin; Rosenbaum, Howard C.; Wells, Randall S.; Stamper, Andrew; Bordino, Pablo
2010-01-01
Incidental entanglement in fishing gear is arguably the most serious threat to many populations of small cetaceans, judging by the alarming number of captured animals. However, other aspects of this threat, such as the potential capture of mother-offspring pairs or reproductive pairs, could be equally or even more significant but have rarely been evaluated. Using a combination of demographic and genetic data we provide evidence that i) Franciscana dolphin pairs that are potentially reproductive and mother-offspring pairs form temporal bonds, and ii) are entangled simultaneously. Our results highlight potential demographic and genetic impacts of by-catch to cetacean populations: the joint entanglement of mother-offspring or reproductive pairs, compared to random individuals, might exacerbate the demographic consequences of by-catch, and the loss of groups of relatives means that significant components of genetic diversity could be lost together. Given the social nature of many odontocetes (toothed cetaceans), we suggest that these potential impacts could be rather general to the group and therefore by-catch could be more detrimental than previously considered. PMID:21179542
Den sproglige leg er super fly
DEFF Research Database (Denmark)
Just, Sine Nørholm
2013-01-01
Man kan rappe om alt. I hvert fald hvis man er Marvelous Mosell. I spændingsfeltet mellem fiktion og virkelighed skaber Mosell sin persona i et forjættende 80' er-univers der på en og samme tid er vildt overdrevet og helt autentisk.......Man kan rappe om alt. I hvert fald hvis man er Marvelous Mosell. I spændingsfeltet mellem fiktion og virkelighed skaber Mosell sin persona i et forjættende 80' er-univers der på en og samme tid er vildt overdrevet og helt autentisk....
Cao, Pengfei; Renna, Luciana; Stefano, Giovanni; Brandizzi, Federica
2016-12-05
The endoplasmic reticulum (ER) is an essential organelle that spreads throughout the cytoplasm as one interconnected network of narrow tubules and dilated cisternae that enclose a single lumen. The ER network undergoes extensive remodeling, which critically depends on membrane-cytoskeleton interactions [1]. In plants, the ER is also highly mobile, and its streaming contributes significantly to the movement of other organelles [2, 3]. The remodeling and motility of the plant ER rely mainly on actin [4] and to a minor extent on microtubules [5]. Although a three-way interaction between the ER, cytosolic myosin-XI, and F-actin mediates the plant ER streaming [6], the mechanisms underlying stable interaction of the ER membrane with actin are unknown. Early electron microscopy studies suggested a direct attachment of the plant ER with actin filaments [7, 8], but it is plausible that yet-unknown proteins facilitate anchoring of the ER membrane with the cytoskeleton. We demonstrate here that SYP73, a member of the plant Syp7 subgroup of SNARE proteins [9] containing actin-binding domains, is a novel ER membrane-associated actin-binding protein. We show that overexpression of SYP73 causes a striking rearrangement of the ER over actin and that, similar to mutations of myosin-XI [4, 10, 11], loss of SYP73 reduces ER streaming and affects overall ER network morphology and plant growth. We propose a model for plant ER remodeling whereby the dynamic rearrangement and streaming of the ER network depend on the propelling action of myosin-XI over actin coupled with a SYP73-mediated bridging, which dynamically anchors the ER membrane with actin filaments. Copyright © 2016 Elsevier Ltd. All rights reserved.
Saska, Pavel; van der Werf, Wopke; Hemerik, Lia; Luff, Martin L; Hatten, Timothy D; Honek, Alois; Pocock, Michael
2013-02-01
Carabids and other epigeal arthropods make important contributions to biodiversity, food webs and biocontrol of invertebrate pests and weeds. Pitfall trapping is widely used for sampling carabid populations, but this technique yields biased estimates of abundance ('activity-density') because individual activity - which is affected by climatic factors - affects the rate of catch. To date, the impact of temperature on pitfall catches, while suspected to be large, has not been quantified, and no method is available to account for it. This lack of knowledge and the unavailability of a method for bias correction affect the confidence that can be placed on results of ecological field studies based on pitfall data.Here, we develop a simple model for the effect of temperature, assuming a constant proportional change in the rate of catch per °C change in temperature, r , consistent with an exponential Q 10 response to temperature. We fit this model to 38 time series of pitfall catches and accompanying temperature records from the literature, using first differences and other detrending methods to account for seasonality. We use meta-analysis to assess consistency of the estimated parameter r among studies.The mean rate of increase in total catch across data sets was 0·0863 ± 0·0058 per °C of maximum temperature and 0·0497 ± 0·0107 per °C of minimum temperature. Multiple regression analyses of 19 data sets showed that temperature is the key climatic variable affecting total catch. Relationships between temperature and catch were also identified at species level. Correction for temperature bias had substantial effects on seasonal trends of carabid catches. Synthesis and Applications . The effect of temperature on pitfall catches is shown here to be substantial and worthy of consideration when interpreting results of pitfall trapping. The exponential model can be used both for effect estimation and for bias correction of observed data. Correcting for temperature
2010-01-01
... meet to apply for a sport pilot certificate? 61.311 Section 61.311 Aeronautics and Space FEDERAL... INSTRUCTORS, AND GROUND INSTRUCTORS Sport Pilots § 61.311 What flight proficiency requirements must I meet to apply for a sport pilot certificate? Except as specified in § 61.329, to apply for a sport pilot...
Tracing possible drivers of synchronously fluctuating species catches in individual logbook data
Czech Academy of Sciences Publication Activity Database
Jankovský, Martin; Boukal S., David; Pivnička, K.; Kubečka, Jan
2011-01-01
Roč. 18, č. 4 (2011), s. 297-306 ISSN 0969-997X R&D Projects: GA MŠk 7F10070 Grant - others:NFM(CZ) A/CZ0046/2/0029 Institutional research plan: CEZ:AV0Z60170517; CEZ:AV0Z50070508 Keywords : angler preferences * catch statistics * reservoirs * catch per unit effort * time series correlations Subject RIV: GL - Fishing Impact factor: 1.294, year: 2011
Social dilemmas, time preferences and technology adoption in a commons problem
Joosten, Reinoud A.M.G.
Agents interacting on a body of water choose between technologies to catch fish. One is harmless to the resource, as it allows full recovery; the other yields high immediate catches, but low(er) future catches. Strategic interaction in one 'objective'resource game may induce several 'subjective'
8 CFR 241.24 - Notice to transportation line of alien's exclusion.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's exclusion. 241.24 Section 241.24 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for Hearings...
Potentiostatic electro-deposition of 241Am using room temperature ionic liquids
International Nuclear Information System (INIS)
Sankhe, R.H.; Mirashi, N.N.; Arijit Sengupta; Murali, M.S.
2015-01-01
An attempt was made for the potentiostatic electrodeposition of 241 Am using six different room temperature ionic liquids (RTILs). Effect of electrodeposition time on the % of electrodeposition of 241 Am, pH change of the solution and the temperature change of the systems were investigated. It was observed that for water immiscible RTILs, the least viscous RTIL gave the best yield (when mixed with iso-propanol), while for water miscible RTILs, reverse trend was observed (when mixed with water). Out of all water immiscible RTILs under consideration for the present case, the octyl-methyl-pyrrolidinium bis(trifluoromethylsulfonyl)imide (C 8 mpyNTf 2 ) in isopropanol was found to yield almost quantitative (99.6 %) electrodeposition of 241 Am within 45 min whereas the most effective system was found to be C 8 mimBr with ∼90 % of 241 Am deposited on the electrode for water miscible RTILs. To the best of our knowledge, this is the first approach ever been reported in the literature. (author)
Tank 241-A-105 evaporation estimate, 1970 through 1978
International Nuclear Information System (INIS)
Allen, G.K.
1991-09-01
Tank 241-A-105 was subjected to a severe steam explosion in January 1965 that caused the metal liner on the bottom to bulge upward approximately 8 feet above its concrete foundation. Shortly after this event, radiation was detected in drywells around the tank and it was declared a leaker. Sluicing operations to remove material from the tank began in August 1968 and continued through August 1970. After sluicing was completed, a significant amount of heat generating material still remained in the tank. To keep tank temperatures below operating limits, the water level in the tank was maintained at an approximate depth of 1.5 feet. This practice was continued until January 1979 when it was believed that the contents had decayed sufficiently to discontinue the water addition and put the tank on a portable exhauster system. Recent concern has focused on what portion of this cooling water added to Tank 241-A-105 actually evaporated and how much leaked into the soil during the nine year time period. This report presents the results of a study that estimates the amount of water evaporated from Tank 241-A-105 between 1970 and 1979. The problem was completed in two parts. The first part involved development of a three dimensional heat transfer model which was used to establish the tank heat load. The results of this model were validated against thermocouple data from Tank 241-A-105. The heat removed from the tank by the ventilation air was then used as input to a second computer code, which calculated the water evaporation. Based upon these two models, the amount of water evaporated from Tank 241-A-105, between 1970 and 1979, was between 378,000 and 410,000 gallons. 9 refs., 17 figs., 7 tabs
Reconstructed Marine Fisheries Catches at a Remote Island Group: Pitcairn Islands (1950–2014
Directory of Open Access Journals (Sweden)
Amy R. Coghlan
2017-09-01
Full Text Available The remote Pitcairn Island Group in the South Pacific was designated one of the world's largest marine reserves in 2016, encompassing some of the few remaining near-pristine areas within EEZ boundaries. Pitcairn's domestic fisheries are small-scale, and consist mainly of subsistence (non-commercial and limited artisanal (commercial catches. There is no locally-based industrial (large-scale commercial fishery and the level of foreign industrial activity in recent times has been minimal, due in part to the low biomass of commercially valuable species, along with economic constraints of the EEZ's geographic isolation. Using a catch reconstruction method we estimated the total domestic marine catches for the Pitcairn Islands from 1950 to 2014. We show that overall the Pitcairn Islands' small-scale fisheries catches were almost 2.5 times higher than the data reported by the Food and Agriculture Organization (FAO of the United Nations on behalf of the Pitcairn Islands, however, this primarily reflects discrepancies prior to the 1980s. Overall, catches for the subsistence and artisanal sectors started with around 12 t·year−1 in 1950, but declined to 4 t·year−1 by 2014. Domestic reconstructed subsistence catch levels were entirely driven by changes in the human population on the island, with reconstructed artisanal catches only occurring in recent years (2000 onwards. Industrial fishing is entirely executed by foreign vessels, this catch is considerably variable throughout the years and ceases entirely in 2006. The implementation of one of the world's largest marine reserves surrounding the offshore waters of Pitcairn Island has been specifically designed not to affect the rates of subsistence and artisanal fishing conducted by the resident population. Although there is no industrial fishing in the Pitcairn EEZ at present, climate change is predicted to influence the routes of migrating commercially-targeted species, potentially altering fishing
Site of Er ions in silica layers codoped with Si nanoclusters and Er
International Nuclear Information System (INIS)
Pellegrino, P.; Garrido, B.; Arbiol, J.; Garcia, C.; Lebour, Y.; Morante, J.R.
2006-01-01
Silica layers implanted with Si and Er ions to various doses and annealed at 950 deg. C have been investigated by means of energy-filtered transmission electron microscopy (EFTEM) and high annular angle dark field (HAADF). EFTEM analysis reveals Si nanoclusters (Si-nc) with an average size around 3 nm for high Si content (15 at. %) whereas no clusters can be imaged for the lowest Si excess (5 at. %). Raman scattering supports that amorphous Si precipitates are present in all the samples. Moreover, the filtered images show that Er ions appear preferentially located outside the Si-nc. HAADF analysis confirms that the Er atoms form agglomerations of 5-10 nm size when the Er concentration exceeds 1x10 20 cm -3 . This observation correlates well with the reduction of the Er population excitable by Si nanoclusters, in the best case corresponding to 10% of the total. A suitable tuning of the annealing drastically reduces this deleterious effect
Waste behavior analysis for tank 241-SY-103
International Nuclear Information System (INIS)
Wilkins, N.E.
1994-01-01
Tank 241-SY-103 is on the Flammable Gas Watch List. The waste in this tank behaves similarly to that in tank 241-Sy-101. Both show slurry growth and periodic surface level drops. However, the surface level drops are much smaller than those in tank 101-SY. A standard hydrogen monitoring system (SHMS) was recently installed in tank 103-SY, and waste auger samples were recently taken. This document covers the characterization results to date for the auger samples, and the behavior of the tank waste during both steady state periods and gas release events
Catch history of ringed seals (Phoca hispida in Canada
Directory of Open Access Journals (Sweden)
Randall R Reeves
1998-06-01
Full Text Available The ringed seal (Phoca hispida has always been a staple in the diet and household economy of Inuit in Canada. The present paper was prepared at the request of the NAMMCO Scientific Committee to support their assessment of ringed seal stocks in the North Atlantic Basin and adjacent arctic and subarctic waters. Specifically, our objective was to evaluate recent and current levels of use of ringed seals by Canadian Inuit. Annual removals probably were highest (possibly greater than 100,000 in the 1960s and 1970s, a period when sealskin prices were particularly strong. Catches declined substantially in the 1980s following a collapse in sealskin prices, presumably related to the European trade ban on skins from newborn harp and hooded seals (Phoca groenlandica and Cystophora cristata, respectively. Recent catch levels throughout Canada (1980s and early 1990s are believed to be in the order of 50,000 to 65,000 ringed seals, with a total average annual kill (including hunting loss in the high tens of thousands. No reliable system is in place to monitor catches of ringed seals, so any estimate must be derived from a heterogeneous array of sources.
Safety evaluation for the interim stabilization of Tank 241-C-103
Energy Technology Data Exchange (ETDEWEB)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed.
Safety evaluation for the interim stabilization of Tank 241-C-103
International Nuclear Information System (INIS)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed
Tank 241-AP-104 Grab Sampling and Analysis Plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AP-104. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AP-104 required to provide sample material to the Waste Treatment Contractor. Grab samples will be obtained from riser 001 to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives and ICD-23. The 222-S Laboratory will receive samples; composite the samples; perform chemical analyses on composite samples; and provide samples to the Waste Treatment Contractor and the Process Chemistry Laboratory. The Process Chemistry Laboratory at the 222-S Laboratory Complex will perform process tests to evaluate the behavior of the 241-AP-104 waste undergoing the retrieval and treatment scenarios defined in the applicable DQOs. The Waste Treatment Contractor will perform process verification and waste form qualification tests. Requirements for analyses of samples originating in the L and H DQO process tests will be documented in the corresponding test plan (Person 2000) and are not within the scope of this SAP. This report provides the general methodology and procedures to be used in the preparation, retrieval, transport, analysis, and reporting of results from grab samples retrieved from tank 241-AP-104
Directory of Open Access Journals (Sweden)
G. A. Sobral
2015-01-01
Full Text Available Fluorescence intensity ratio (FIR technique, based on the thermal coupling of H11/22 and S3/24 energy levels of erbium ions, was used to study the optical heating behavior of rare earth doped yttrium oxide nanophosphors (Y2O3:Er3+, Y2O3:Er3+-Eu3+, Y2O3:Er3+-Tb3+, and Y2O3:Er3+-Eu3+-Tb3+ synthesized via PVA-assisted sol-gel route. The samples were optically heated by an 800 nm CW diode laser, while the upconverted green emissions were used to measure their temperatures in real time. The experimental results indicate that the studied nanoparticles are promising candidates to applications such as photothermal treatments and hyperthermia.
DEFF Research Database (Denmark)
van der Meijden, Peter Alexander
2008-01-01
"Fluxus-øer" er en introduktion til Fluxus med udgangspunkt i den tyske galleri-ejer René Blocks samling, som udstillingen "Food for Thought" i Sukkerfabrikken i Stege (Møn) præsenterede et udvalg af. Artiklen beskriver Fluxus som et heterotopi som beskrevet af Michel Foucault i "Of Other Spaces"...
Sampling, testing and modeling particle size distribution in urban catch basins.
Garofalo, G; Carbone, M; Piro, P
2014-01-01
The study analyzed the particle size distribution of particulate matter (PM) retained in two catch basins located, respectively, near a parking lot and a traffic intersection with common high levels of traffic activity. Also, the treatment performance of a filter medium was evaluated by laboratory testing. The experimental treatment results and the field data were then used as inputs to a numerical model which described on a qualitative basis the hydrological response of the two catchments draining into each catch basin, respectively, and the quality of treatment provided by the filter during the measured rainfall. The results show that PM concentrations were on average around 300 mg/L (parking lot site) and 400 mg/L (road site) for the 10 rainfall-runoff events observed. PM with a particle diameter of model showed that a catch basin with a filter unit can remove 30 to 40% of the PM load depending on the storm characteristics.
Shaheen, Alaa
2018-05-05
The unfolded protein response (UPR) is an adaptive cellular response that aims to relieve endoplasmic reticulum (ER) stress via several mechanisms, including inhibition of protein synthesis and enhancement of protein folding and degradation. There is a controversy over the effect of the UPR on ER protein export. While some investigators suggested that ER export is inhibited during ER stress, others suggested the opposite. In this article, their conflicting studies are analyzed and compared in attempt to solve this controversy. The UPR appears indeed to enhance ER export, possibly via multiple mechanisms. However, another factor, which is the integrity of the folding machinery/environment inside ER, determines whether ER export will appear increased or decreased during experimentation. Also, different methods of stress induction appear to have different effects on ER export. Thus, improvement of ER export may represent a new mechanism by which the UPR alleviates ER stress. This may help researchers to understand how the UPR works inside cells and how to manipulate it to alter cell fate during stress, either to promote cell survival or death. This may open up new approaches for the treatment of ER stress-related diseases.
Social dilemmas, time preferences and technology adoption in a commons problem
Joosten, Reinoud A.M.G.
2014-01-01
Agents interacting on a body of water choose between technologies to catch fish. One is harmless to the resource, as it allows full recovery; the other yields high immediate catches, but low(er) future catches. Strategic interaction in one ‘objective’ resource game may induce several ‘subjective’
Construction research needs in Europe
DEFF Research Database (Denmark)
1991-01-01
fælles europæisk forsknings- og udviklingsstrategi for byggesektoren har det europæiske netværk af byggeforskningsinstitutter, ENBRI, sammenfattet de nationale forskningstemaer samt analyseret perspektiver og behov. Dette materiale er anvendt som diskussionsoplæg ved symposiet Construction research needs...
Environmental impact of a teratogenic actinide: a case study of americium-241
Energy Technology Data Exchange (ETDEWEB)
Wang, J.; Yang, J.Y.
1985-10-16
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs.
Environmental impact of a teratogenic actinide: a case study of americium-241
International Nuclear Information System (INIS)
Wang, J.; Yang, J.Y.
1985-01-01
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs
Measurement of contamination by 241Am
International Nuclear Information System (INIS)
Hemmingsen, L.B.S.
1991-08-01
In relation to the fact that four employees at the Danish Isotope Center who had regularly cleaned the smoke detectors used for control measurements were found to be contaminated with 241 Am, the aim was to investigate the suitability of the Phoswich detector system for measurement of contamination of humans by 241 Am. It was also wished to compare this measuring method with other selected ones. The measurement results are presented in detail. It was found that measurements taken on the cranium with the Phoswich detectors were more suitable for measurement of contamination by 241 Am than the use of a Ge detector on the liver, - because of the first-named method's greater degree of measuring efficiency, (0.013 cps/Bq compared with 0.0001 cps/Bq in the case of Ge detector measurement) and lower minimum detectable activity in relation to that activity that was measured on A1 (one of the employees). It was found that Phoswich-detector measurement and measuring of urine samples supplemented each other in a satisfactory way. The Phoswich detector enables a quick measurement of the degree of seriousness of the contamination of a person and a relatively accurate determination of the calculated intake of contamination which has a size of at least twice the annual limit of intake size. Measurements of urine samples enable smaller amounts of contamination to be revealed, but this takes ca. 32 weeks and is less accurate than Phoswich measurement especially if a long time has elapsed after the intake. (AB) (34 refs.)
9 CFR 319.311 - Chow mein vegetables with meat, and chop suey vegetables with meat.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Chow mein vegetables with meat, and chop suey vegetables with meat. 319.311 Section 319.311 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY...
Tank 241-S-102, Core 232 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
STEEN, F.H.
1998-11-04
This document is the analytical laboratory report for tank 241-S-102 push mode core segments collected between March 5, 1998 and April 2, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-S-102 Retained Gas Sampler System Sampling and Analysis Plan (TSAP) (McCain, 1998), Letter of Instruction for Compatibility Analysis of Samples from Tank 241-S-102 (LOI) (Thompson, 1998) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Mulkey and Miller, 1998). The analytical results are included in the data summary table (Table 1).
49 CFR 234.241 - Protection of insulated wire; splice in underground wire.
2010-10-01
... underground wire. 234.241 Section 234.241 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY... of insulated wire; splice in underground wire. Insulated wire shall be protected from mechanical...
DEFF Research Database (Denmark)
Schilling, Benedicte; Jacobsen, Claus Haugaard; Nielsen, Jan
2010-01-01
Kontrol, kontrakt og kontekst er supervisionens tre k'er. Men hvad er supervision i det hele taget for en størrelse, der spillerså central en rolle for den psykologfaglige profession?......Kontrol, kontrakt og kontekst er supervisionens tre k'er. Men hvad er supervision i det hele taget for en størrelse, der spillerså central en rolle for den psykologfaglige profession?...
Evaluating potential sources of variation in Chironomidae catch rates on sticky traps
Smith, Joshua T.; Muehlbauer, Jeffrey D.; Kennedy, Theodore A.
2016-01-01
Sticky traps are a convenient tool for assessing adult aquatic insect population dynamics, but there are many practical questions about how trap sampling artefacts may affect observed results. Utilising study sites on the Colorado River and two smaller streams in northern Arizona, USA, we evaluated whether catch rates and sex ratios of Chironomidae, a ubiquitous aquatic insect, were affected by spraying traps with insecticide, placing traps at different heights above ground, and placing traps at different locations within a terrestrial habitat patch. We also evaluated temporal variation in Chironomidae counts monthly over a 9-month growing season. We found no significant variation in catch rates or sex ratios between traps treated versus untreated with insecticide, nor between traps placed at the upstream or downstream end of a terrestrial habitat patch. Traps placed near ground level did have significantly higher catch rates than traps placed at 1.5 m, although sex ratios were similar across heights. Chironomidae abundance and sex ratios also varied from month-to-month and seemed to be related to climatic conditions. Our results inform future sticky trap studies by demonstrating that trap height, but not insecticide treatment or precise trap placement within a habitat patch, is an important source of variation influencing catch rates.
Coronavirus infection, ER stress and Apoptosis
Directory of Open Access Journals (Sweden)
TO SING eFUNG
2014-06-01
Full Text Available The replication of coronavirus, a family of important animal and human pathogens, is closely associated with the cellular membrane compartments, especially the endoplasmic reticulum (ER. Coronavirus infection of cultured cells was previously shown to cause ER stress and induce the unfolded protein response (UPR, a process that aims to restore the ER homeostasis by global translation shutdown and increasing the ER folding capacity. However under prolonged ER stress, UPR can also induce apoptotic cell death. Accumulating evidence from recent studies has shown that induction of ER stress and UPR may constitute a major aspect of coronavirus-host interaction. Activation of the three branches of UPR modulates a wide variety of signaling pathways, such as mitogen-activated protein (MAP kinases activation, autophagy, apoptosis and innate immune response. ER stress and UPR activation may therefore contribute significantly to the viral replication and pathogenesis during coronavirus infection. In this review, we summarize current knowledge on coronavirus-induced ER stress and UPR activation, with emphasis on their cross-talking to apoptotic signaling.
Test plan for tank 241-AN-104 dilution studies
International Nuclear Information System (INIS)
Herting, D.L.
1998-01-01
Tank 241-AN-104 (104-AN) has been identified as the one of the first tanks to be retrieved for low level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount and type of dilution required for safe retrieval and transfer of feed and to re-dissolve major soluble sodium salts while not precipitating out other salts. The proposed laboratory tests are described in this document. Tank 241-AN-104 is on the Hydrogen Watch List
The effect of dilution on the gas retention behavior of Tank 241-SY- 103 waste
International Nuclear Information System (INIS)
Bredt, P.R.; Tingey, S.M.
1996-01-01
Twenty-five of the 177 underground waste storage tanks on the Hanford Site have been placed on the Flammable Gas watch list. These 25 tanks, containing high-level waste generated during plutonium and uranium processing, have been identified as potentially capable of accumulating flammable gases above the lower flammability limit (Babad et al. 1991). In the case of Tanks 241-SY-101 and 241-SY-103, it has been proposed that diluting the tank waste may mitigate this hazard (Hudson et al. 1995; Stewart et al. 1994). The effect of dilution on the ability of waste from Tank 241-SY-103 to accumulate gas was studied at Pacific Northwest National Laboratory. A similar study has been completed for waste from Tank 241-SY-101 (Bredt et al. 1995). Because of the additional waste-storage volume available in Tank 241-SY-103 and because the waste is assumed to be similar to that currently in Tank 241-SY-101, Tank 241-SY-103 became the target for a demonstration of passive mitigation through in-tank dilution. In 1994, plans for the in-tank dilution demonstration were deferred pending a decision on whether to pursue dilution as a mitigation strategy. However, because Tank 241-SY-103 is an early retrieval target, determination of how waste properties vary with dilution will still be required
Recovery of americium-241 from aged plutonium metal
International Nuclear Information System (INIS)
Gray, L.W.; Burney, G.A.; Reilly, T.A.; Wilson, T.W.; McKibben, J.M.
1980-12-01
About 5 kg of ingrown 241 Am was recovered from 850 kg of aged plutonium using a process developed specifically for Savannah River Plant application. The aged plutonium metal was first dissolved in sulfamic acid. Sodium nitrite was added to oxidize the plutonium to Pu(IV) and the residual sulfamate ion was oxidized to nitrogen gas and sulfate. The plutonium and americium were separated by one cycle of solvent extraction. The recovered products were subsequently purified by cation exchange chromatography, precipitated as oxalates, and calcined to the oxides. Plutonium processng was routine. Before cation exchange purification, the aqueous americium solution from solvent extraction was concentrated and stripped of nitric acid. More than 98% of the 241 Am was then recovered from the cation exchange column where it was effectively decontaminated from all major impurities except nickel and chromium. This partially purified product solution was concentrated further by evaporation and then denitrated by reaction with formic acid. Individual batches of americium oxalate were then precipitated, filtered, washed, and calcined. About 98.5% of the americium was recovered. The final product purity averaged 98% 241 AmO 2 ; residual impurities were primarily lead and nickel
Uptake of americium-241 by algae and bacteria
Energy Technology Data Exchange (ETDEWEB)
Giesy, Jr, J P; Paine, D [Savannah River Ecology Lab., Aiken, S.C. (USA)
1978-01-01
The uptake of americium by three algae, Scenedesmus obliguus, Selenastrum capricomutum and Chlorella pyrenosdosa and a bacterium Aeromonas hydrophila was studied. Live and fixed cells of each algal species and live bacterial cells were used. It is shown that algae and bacteria concentrate americium 241 to a high degree which makes them important links in the biomagnification phenomenon which may ultimately lead to a human hazard and be potentially important in recycling Am /sup 241/ in the water column and mobilization from sediments. Chemical fixation of algal cells caused increased uptake which indicated that uptake is by passive diffusion and probably due to chemical alteration of surface binding sites.
International Nuclear Information System (INIS)
Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G.
2004-01-01
Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including 241 Am). 241 Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of 241 Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of 241 Am from the biomass. The content of 241 Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of 241 Am in the plants were in inverse proportion to their biomass. We obtained new data on release of 241 Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial 241 Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of 241 Am and retain americium for long periods of time in biomass. (author)
Accumulation and release of {sup 241}Am by a macrophyte of the Yenisei River (Elodea canadensis)
Energy Technology Data Exchange (ETDEWEB)
Bolsunovsky, A. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)]. E-mail: radecol@ibp.ru; Zotina, T. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation); Bondareva, L. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)
2005-07-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of {sup 241}Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that {sup 241}Am is accumulated by Elodea biomass: the activity concentration of {sup 241}Am can reach 3280 {+-} 240 Bq/g, with the concentration factor for {sup 241}Am 16 600 {+-} 2200 l/kg. Results of chemical fractionation have proved that in the course of {sup 241}Am accumulation by Elodea biomass, {sup 241}Am tightly bound to biomass increases from 11% to 27% of the total {sup 241}Am in the biomass. Release of {sup 241}Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial {sup 241}Am activity and the rate of {sup 241}Am release into the water environment reached 23 Bq/day.
DEFF Research Database (Denmark)
Christensen, Steen; van Thi, Dang
2008-01-01
that might reflect seasonality in shrimp recruitment was found, making this resource potentially suitable for a fishery management system based on closed seasons. Further, the data indicate that the major part of the catches are comprised of low value species belonging to the genera Parapenaeopsis; whereas......Based on catch and effort data analyses covering the period 1996-2002, time series of catch rates in the trawl fisheries in the South China Sea along the coasts of Bac Lieu and Ca Mau in South East Vietnam were estimated. The indicators include catch rates for total shrimp catch, five major shrimp...... the most valuable species, i.e. the Penaeus and Metapenaeus catch groups have been significantly depleted during the period investigated. Based on the experiences from the present analysis, recommendations are presented with regard to adjustments of the enumerator data collection programme to fulfil...
DEFF Research Database (Denmark)
Poulfelt, Flemming
2015-01-01
HR: Er der behov for nytænkning i HR-land? Artikler i Harvard Business Review - bakket op af en dansk undersøgelse - konkluderer, at HR stadig mangler gennemslagskraft i virksomhederne. Er HR ude i tovene? ... For i undersøgelsen "Ny Dansk Ledelse" (maj 2015), som er baseret på danske lederes...
Characterization of strong (241)Am sources.
Vesterlund, Anna; Chernikova, Dina; Cartemo, Petty; Axell, Kåre; Nordlund, Anders; Skarnemark, Gunnar; Ekberg, Christian; Ramebäck, Henrik
2015-05-01
Gamma ray spectra of strong (241)Am sources may reveal information about the source composition as there may be other radioactive nuclides such as progeny and radioactive impurities present. In this work the possibility to use gamma spectrometry to identify inherent signatures in (241)Am sources in order to differentiate sources from each other, is investigated. The studied signatures are age, i.e. time passed since last chemical separation, and presence of impurities. The spectra of some sources show a number of Doppler broadened peaks in the spectrum which indicate the presence of nuclear reactions on light elements within the sources. The results show that the investigated sources can be differentiated between by age and/or presence of impurities. These spectral features would be useful information in a national nuclear forensics library (NNFL) in cases when the visual information on the source, e.g. the source number, is unavailable. Copyright © 2015 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Pedersern, Birger
2010-01-01
Forskningen i fødevarer har fået et potent redskab i hånden. Metabolomics er vejen frem, mener professor Søren Balling Engelsen fra Københavns Universitet......Forskningen i fødevarer har fået et potent redskab i hånden. Metabolomics er vejen frem, mener professor Søren Balling Engelsen fra Københavns Universitet...
DEFF Research Database (Denmark)
Helms, Niels Henrik
2008-01-01
Brugerdreven innovation er blevet svaret på mange af de udfordringer, som vores moderne samfund står overfor.Det er skrevet ind i såvel regeringsgrundlaget som i de forskellige tiltag, som skal ruste Danmark i forhold til globaliseringen. Vi har ifølge argumentationen her enrække særlige forudsæt....... Udgivelsesdato: marts 2008...
DEFF Research Database (Denmark)
Jensen, J. P.; Søndergaard, M.; Jeppesen, E.
styrke det fagli-ge grundlag for de mil-jøpolitiske prioriteringer og beslut-ninger. En væsentlig del af denne opgave er overvågning af miljø og natur. Det er derfor et naturligt led i Danmarks Miljø-undersø-gelsers opgave at forestå den landsdækkende rapportering af overvågnings-program-met inden...
Tank characterization report for single-shell tank 241-S-104
International Nuclear Information System (INIS)
DiCenso, A.T.; Simpson, B.C.
1994-01-01
In July and August 1992, Single-Shell Tank 241-S-104 was sampled as part of the overall characterization effort directed by the Hanford Federal Facility Agreement and Consent Order. Sampling was also performed to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code. This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also presents expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background historical and surveillance tank information. Finally, this report makes recommendations and conclusions regarding operational safety. The purpose of this report is to describe the characteristics the waste in Single-Shell Tank 241-S-104 (hereafter, Tank 241-S-104) based on information obtained from a variety of sources. This report summarizes the available information regarding the chemical and physical properties of the waste in Tank 241-S-104, and using the historical information to place the analytical data in context, arranges this information in a format useful for making management and technical decisions concerning waste tank safety and disposal issues. In addition, conclusions and recommendations are presented based on safety issues and further characterization needs
Tank 241-AP-104 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-11-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Double-Shell Tank (DST) 241-AP-104
The Effect of Intellectual Property Standards on the Catch-Up Process Of Emerging Market Economies
DEFF Research Database (Denmark)
Darendeli, Izzet; Brandl, Kristin Martina; Hamilton, III, Robert D.
2014-01-01
The catch-up process of emerging market economies is dependent on multiple factors, such as local governmental regulations but also global industry developments. We investigate how intellectual property (IP) protection standards affect this catch-up process. The alignment of these standards...
Test plan for Tank 241-AW-101 solubility screening tests
International Nuclear Information System (INIS)
Person, J.C.
1998-01-01
Tank 241-AW-101 (101-AW) has been identified as one of the early tanks to be for retrieved for low level waste pretreatment and immobilization and retrieval of the tank waste may require dilution. This test is to determine the effects of dilution on the mass of solids and their composition. This test plan gives test instructions, example data sheets, a waste compatibility review, and a waste stream fact sheet. This test Plan is similar to tests on tanks 241-AN-102 (Person 1998a) and 241-AN-107 (Person 1998 b). The 101-AW tests will be done with composites of liquid and solids from grab samples that were taken in 1998 (Benar 1998). Future revisions of the Tank Sampling and Analysis Plan (Benar 1998) may change the details of the work performed under this test plan
IMPACT OF CLIMATE ANOMALY ON CATCH COMPOSITION OF NERITIC TUNA IN SUNDA STRAIT
Directory of Open Access Journals (Sweden)
Khairul Amri
2013-12-01
Full Text Available Tongkol komo/kawakawa (Euthynnus affinis and tenggiri (Scomberomerus guttatus are commonly caught by mini purseiners operated in Sunda Straits and landed in Labuan, West Java. This species inhabits coastal water and has preference staying in relatively warm water. Oceanography parameters commonly influencing the distribution of Euthynnus affinis are temperature, current, and salinity. The oceanography of Sunda Strait is influenced by water masses coming from the north that mainly originated from the Java Sea and water masses from the south mainly originated from Indian Ocean. The internal oceanography of Sunda Strait is also influenced by upwelling and monsoon as regional climate anomaly (ENSO and Indian Ocean Dipole Mode. This paper describes the influence of Dipole Mode (positive and negative event and ENSO (El- Nino/La-Nina to the catch dynamics of neritic tuna particularly in Sunda Straits waters. The results shown that regional climate anomaly influenced neritic tuna catch and its composition. The catches Euthynnus affinis in phase negative dipole mode or La-Nina were higher and dominated the catch composition of pelagic fishes of Sunda Strait. Similar situation also is showen by Scomberomorus commerson.
Acceptance Test Report for the 241-AN-107 Enraf Advanced Technology Gauges
International Nuclear Information System (INIS)
Dowell, J.L.; Enderlin, V.R.
1995-06-01
This Acceptance Test Report covers the results of the execution of the Acceptance Test Procedure for the 241-AN-107 Enraf Advanced Technology Gauges. The test verified the proper operation of the gauges to measure waste density and level in the 241-AN-107 tank
DEFF Research Database (Denmark)
Andersson, Lasse
2014-01-01
afhængig af Frank Underwood fra serien House of Cards på den fremadstormende TV-streamingstjenesten Netflix. Jeg har opdaget et nyt internetbaseret datingforhold. Et surrealt, fedt miks af det kyniske og joviale personificeret i karakteren Frank Underwood, som er helt igennem ubehagelig, men fantastisk...... spillet af Kevin Spacey. Og tak til Spacey der for en tid har forladt teateret ’The Old Vic’ i London for at begejstre mig. Der er generelt to årsager til mine FRANKofile tilbøjeligheder. For det første er Netflix’s remake af den tyve år gamle BBC serie House of Cards efter min menig et stykke tv...... anden grund, til at jeg er blevet Frankofil, er, at jeg ikke skal sidde og vente på næste søndag efter søndag efter søndag for at få lov at se næste afsnit. Netflix lagde alle tretten timer af sæson 2 ud på nettet. Jeg afgør selv, hvornår jeg skal have mere Frank! Men på trods af mit narkomanlignende...
Associated risk factors for chronic kidney disease of unknown etiologies in 241 patients.
Xing, Xuexue; Lu, Jing; Wang, Zheng
2015-04-01
Apart from the well-known etiologies, there are still a high proportion of patients with chronic kidney disease of unknown etiology (CKDu), which has rarely been reported on. In this study, we explored the potential associated risk factors for CKDu and identified those that occur in childhood. 700 patients with CKD we were selected randomly from 4 hospitals in Chengdu and 241 were screened for CKDu. The following clinical information was analyzed: demographic data, life style, personal and family history, nephrotoxic drugs, exposure to poison, allergies, and recurrent respiratory infections in childhood. Among 700 CKD patients, 34.43% (241/700) were CKDu. Of the 241 patients, there were 67.63% (163/241) with at least 1 associated risk factor and 56.44% (92/163) with more than 1. Patients with a personal history of an associated risk factor represented the largest proportion (31.95%, 77/241), while 28.63% (69/241) of the CKDu patients had risk factors appearing in childhood. Logistic regression analysis supported the results. The study demonstrated that most so-called CKDu patients do have an identifiable etiology, and that several associated risk factors contribute to it. Of all the risk factors, age >60 years, nephrotoxic drugs, exposure to poison, and alcohol consumption were the independent significant factors for CKDu. Furthermore, many risk factors that caused kidney injury started in childhood.
Operability test procedure for 241-U compressed air system and heat pump
International Nuclear Information System (INIS)
Freeman, R.D.
1994-01-01
The 241-U-701 compressed air system supplies instrument quality compressed air to Tank Farm 241-U. The supply piping to the 241-U Tank Farm is not included in the modification. Modifications to the 241-U-701 compressed air system include installation of a 15 HP Reciprocating Air Compressor, Ingersoll-Rand Model 10T3NLM-E15; an air dryer, Hankinson, Model DH-45; and miscellaneous system equipment and piping (valves, filters, etc.) to meet the design. A newly installed heat pump allows the compressor to operate within an enclosed relatively dust free atmosphere and keeps the compressor room within a standard acceptable temperature range, which makes possible efficient compressor operation, reduces maintenance, and maximizes compressor operating life. This document is an Operability Test Procedure (OTP) which will further verify (in addition to the Acceptance Test Procedure) that the 241-U-701 compressed air system and heat pump operate within their intended design parameters. The activities defined in this OTP will be performed to ensure the performance of the new compressed air system will be adequate, reliable and efficient. Completion of this OTP and sign off of the OTP Acceptance of Test Results is necessary for turnover of the compressed air system from Engineering to Operations
Catch history and status of the harbour seal (Phoca vitulina in Greenland
Directory of Open Access Journals (Sweden)
Aqqalu Rosving-Asvid
2010-09-01
Full Text Available The number of harbour seals (Phoca vitulina in West Greenland declined rapidly after the 1950s and the seals have now abandoned their traditional haulout locations along the Greenland west coast. However, in recent years, a previously undetected group of about 60-100 harbour seals has been observed approximately 80 km upstream in a large river, and some traditional hauloutlocations are still in use near the south-eastern tip of Greenland. A small number of harbour seals is caught annually far from any of these locations, indicating that other groups might live unnoticed. Catch statistics provide the best evidence of the presence and locations of these remnant harbour seals. Therefore efforts were made to validate the recent catch statistics and to describe the catch history for the past 60 years. The catch statistics were also used to estimate plausibleranges of past and present numbers of harbour seals based on the assumption that hunting has caused the observed decline. The total number of harbour seals in Greenland according to these estimates was about 3,000 in 1950 and fewer than 1,000 in 2007. The number of harbour seals caught in the southernmost part of Greenland has, unlike in the rest of Greenland, increased significantly in some of the recent years. This change seems to be related to changes in the amount of drift ice. Drift ice reduces the frequency of contact between hunters and harbour seals in South Greenland and above normal quantities of drift ice from the mid 1960s to the mid 1980s probably allowed these seals to increase in numbers. Record low inflow of drift ice in some of the recent years, however, has resulted in record high catches, which likely have reduced the seals again. The remaining harbour seals in Greenland are few and without protection these sealsare potentially in danger of extinction.
Catch-up operation on old pesticides: an integration
Canton JH; Linders JBHJ; Luttik R; Mensink BJWG; Panman E; Plassche EJ van de; Sparenburg PM; Tuinstra J
1991-01-01
The "catch-up operation on old pesticides" project has resulted in a summary and RIVM conclusion of the environmental aspects of 152 pesticides which were already marketed in the Netherlands before 1975. The RIVM conclusion was subsequently rewritten to form an environmental synopsis. The
Catch-up operation on old pesticides: an integration
Canton JH; Linders JBHJ; Luttik R; Mensink BJWG; Panman E; van de Plassche EJ; Sparenburg PM; Tuinstra J
1991-01-01
The "catch-up operation on old pesticides" project has resulted in a summary and RIVM conclusion of the environmental aspects of 152 pesticides which were already marketed in the Netherlands before 1975. The RIVM conclusion was subsequently rewritten to form an environmental synopsis. The present
Acceptance test report for the Tank 241-C-106 in-tank imaging system
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of Acceptance Testing of the 241-C-106 in-tank video camera imaging system. The purpose of this imaging system is to monitor the Project W-320 sluicing of Tank 241-C-106. The objective of acceptance testing of the 241-C-106 video camera system was to verify that all equipment and components function in accordance with procurement specification requirements and original equipment manufacturer's (OEM) specifications. This document reports the results of the testing
DEFF Research Database (Denmark)
Gundelach, Peter; Nørregård-Nielsen, Esther C.
2002-01-01
Hvornår er man ung, og hvornår er man voksen? Er der forskelle i befolkningens værdier i forhold til arbejde og politik, når det undersøges ud fra henholdsvis et alders- eller generationsperspektiv? Baseret på data fra den danske del af den internationale værdiundersøgelse vises at der er så store...
Alves, João Guilherme; Vasconcelos, Sarita Amorim; de Almeida, Tais Sá; Lages, Raquel; Just, Eduardo
2015-01-01
A rapid catch-up growth in very low birth weight has been associated both with a higher height growth and a higher risk to metabolic disturbances, including insulin resistance and its consequences. Abdominal fat distribution in early postnatal life may play a role in these outcomes and can help in addressing this neonatal dilemma. This study aimed to compare abdominal fat distribution among very low birth weight (VLBW) children with and without rapid catch-up growth. A cohort study followed 86 VLBW (children born in Brazil, during the first 3 years of life. Rapid catch-up growth was considered as an increased in length >2 Z score during the first year of life. Abdominal subcutaneous and preperitoneal fat thickness was determined by ultrasound. χ²-Test and Student's t-test were used to compare the groups. A total of 79 VLBW children completed the study, of whom 22 (27.8%) showed rapid catch-up growth. Abdominal subcutaneous and preperitoneal fat thickness showed no differences among children with or without rapid catch-up growth at 3.3 mm vs. 3.8 mm, respectively (p=0.79) and 4.0 mm vs. 4.0 mm (p=0.55), respectively. VLBW children with rapid catch-up growth were also taller. Rapid catch-up growth during the first year of life in VLBW children does not seem to change abdominal fat distribution until the third year of life.
Directory of Open Access Journals (Sweden)
Siti Aminah
2017-02-01
Full Text Available Tujuan dari Penelitian ini adalah untuk mengetahui (1 deskripsi lalat tangkap Lalangit yang biasa digunakan, (2 jumlah hasil tangkapan (catch yang diperoleh dari perbedaan beberapa merk nilon yang digunakan, (3 merk nilon yang terbaik sebagai bahan material lalangit (horizontal gillnet. Metode penelitian yang digunakan adalah Rancangan Acak Kelompok (RAK dengan 6 perlakuan yaitu 6 jenis merk nilon yang berbeda. Dari hasil penelitian diperoleh jumlah hasil tangkapan yang paling banyak pada Lalangit yang menggunakan nilon merk damyl memperoleh jumlah hasil tangkapan sebanyak 50 ekor dengan berat total 1.728 gram,karena dari segi konstruksi atau bahan materialnya lembut yang menyebabkan hasil tangkapan tidak mudah meloloskan diri dari jaring karena ke elastisitasan dan warna biru dari nilon dapat menyerupai kondisi perairan sehingga ikan mudah tertipu keadaan daerah perairan tersebut dan didapatkan hasil tangkapan yang optimal. The purpose of this research is to know (1 the description of the commonly used lalangit, (2 the amount of the catch (catch are obtained from the difference in some brands of nylon that is used, (3 brands of nylon materials as the best lalangit (horizontal gillnet. The research method used was Random Design Group (RAK with 6 treatments IE 6 types of different brands of nylon. Of research results obtained the most number of catches a lot on Lalangit using the brand damyl earn 50 catches the tail with a total weight of 1.728 gram, because in terms of construction or its material soft materials that cause the catch is not easy to escape from nets due to elastisitasan and the blue color of nylon can resemble aquatic conditions so that the gullible fish State of the waters and the obtained results the optimal catch.
Energy Technology Data Exchange (ETDEWEB)
Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)
2004-07-01
Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including {sup 241}Am). {sup 241}Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of {sup 241}Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of {sup 241}Am from the biomass. The content of {sup 241}Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of {sup 241}Am in the plants were in inverse proportion to their biomass. We obtained new data on release of {sup 241}Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial {sup 241}Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of {sup 241}Am and retain americium for long periods of time in biomass. (author)
DEFF Research Database (Denmark)
Jensen, J. P.; Søndergaard, M.; Jeppesen, E.
små cladoceer og hjuldyr, og især er maksimumsforekom-sterne af calanoide vandlopper og de små og store cladoceer og daf-nier gået tilbage. Den gennemsnitlige biomasse af dafnier er derimod øget især p.g.a. stigning i de 25 % af søerne med størst forekomster. Dyreplanktons græsning Betragtet under et...
Syamsuddin, Mega; Sunarto; Yuliadi, Lintang
2018-02-01
The remotely derived oceanographic variables included sea surface temperature (SST), chlorophyll-a (Chl-a) and Eastern Little Tuna (Euthynnus affinis) catches are used as a combined dataset to understand the seasonal variation of oceanographic variables and Eastern Little Tuna catches in the north Indramayu waters, Java Sea. The fish catches and remotely sensed data were analysed for the 5 years datasets from 2010-2014. This study has shown the effect of monsoon inducing oceanographic condition in the study area. Seasonal change features were dominant for all the selected oceanographic parameters of SST and Chl-a, and also Eastern Little Tuna catches, respectively. The Eastern Little Tuna catch rates have the peak season from September to December (700 to 1000) ton that corresponded with the value of SST ranging from 29 °C to 30 °C following the decreasing of Chl-a concentrations in September to November (0.4 to 0.5) mg m-3. The monsoonal system plays a great role in determining the variability of oceanographic conditions and catch in the north Indramayu waters, Java Sea. The catches seemed higher during the northwest monsoon than in the southeast monsoon for all year observations except in 2010. The wavelet spectrum analysis results confirmed that Eastern Little Tuna catches had seasonal and inter-annual variations during 2012-2014. The SST had seasonal variations during 2010-2014. The Chl-a also showed seasonal variations during 2010-2011 and interannual variations during 2011-2014. Our results would benefit the fishermen and policy makers to have better management for sustainable catch in the study area.
Mean temperature of the catch (MTC in the Greek Seas based on landings and survey data
Directory of Open Access Journals (Sweden)
Athanassios C. Tsikliras
2015-04-01
Full Text Available The mean temperature of the catch (MTC, which is the average inferred temperature preference of the exploited species weighted by their annual catch, is an index that has been used for evaluating the effect of sea warming on marine ecosystems. In the present work, we examined the effect of sea surface temperature on the catch composition of the Greek Seas using the MTC applied on the official catch statistics (landings for the period 1970-2010 (Aegean and Ionian Seas and on experimental bottom trawl survey data for 1997-2014 (southern Aegean Sea. The MTC of the landings for the study period increased from 11.8 οC to 16.2 οC in the Aegean Sea and from 10.0 οC to 14.7 οC in the Ionian Sea. Overall, the rate of MTC increase was 1.01 οC per decade for the Aegean and 1.17 οC per decade for the Ionian Sea and was positively related to sea surface temperature anomalies in both areas. For the survey data, the increase of the MTC of the bottom trawl catch in the southern Aegean Sea was lower (0.51 οC per decade but referred to a shorter time frame and included only demersal species. The change in MTC of official and survey catches indicates that the relative catch proportions of species preferring warmer waters and those preferring colder waters have changed in favour of the former and that this change is linked to sea surface temperature increase, both internally (through the Atlantic Multidecadal Oscillation or externally (warming trend driven.
Dawson, K. W.; Meskhidze, N.; Burton, S. P.; Johnson, M. S.; Kacenelenbogen, M. S.; Hostetler, C. A.; Hu, Y.
2017-11-01
Current remote sensing methods can identify aerosol types within an atmospheric column, presenting an opportunity to incrementally bridge the gap between remote sensing and models. Here a new algorithm was designed for Creating Aerosol Types from CHemistry (CATCH). CATCH-derived aerosol types—dusty mix, maritime, urban, smoke, and fresh smoke—are based on first-generation airborne High Spectral Resolution Lidar (HSRL-1) retrievals during the Ship-Aircraft Bio-Optical Research (SABOR) campaign, July/August 2014. CATCH is designed to derive aerosol types from model output of chemical composition. CATCH-derived aerosol types are determined by multivariate clustering of model-calculated variables that have been trained using retrievals of aerosol types from HSRL-1. CATCH-derived aerosol types (with the exception of smoke) compare well with HSRL-1 retrievals during SABOR with an average difference in aerosol optical depth (AOD) methods. In the future, spaceborne HSRL-1 and CATCH can be used to gain insight into chemical composition of aerosol types, reducing uncertainties in estimates of aerosol radiative forcing.
The role of the AR/ER ratio in ER-positive breast cancer patients.
Rangel, Nelson; Rondon-Lagos, Milena; Annaratone, Laura; Osella-Abate, Simona; Metovic, Jasna; Mano, Maria Piera; Bertero, Luca; Cassoni, Paola; Sapino, Anna; Castellano, Isabella
2018-03-01
The significance of androgen receptor (AR) in breast cancer (BC) management is not fully defined, and it is still ambiguous how the level of AR expression influences oestrogen receptor-positive (ER+) tumours. The aim of the present study was to analyse the prognostic impact of AR/ER ratio, evaluated by immunohistochemistry (IHC), correlating this value with clinical, pathological and molecular characteristics. We retrospectively selected a cohort of 402 ER+BC patients. On each tumour, IHC analyses for AR, ER, PgR, HER2 and Ki67 were performed and AR+ cases were used to calculate the AR/ER value. A cut-off of ≥2 was selected using receiver-operating characteristic (ROC) curve analyses. RNA from 19 cases with AR/ER≥2 was extracted and used for Prosigna-PAM50 assays. Tumours with AR/ER≥2 (6%) showed more frequent metastatic lymph nodes, larger size, higher histological grade and lower PgR levels than cases with AR/ERAR/ER≥2 had worse disease-free interval (DFI) and disease-specific survival (DSS) (hazard ratios (HR) = 4.96 for DFI and HR = 8.69 for DSS, both P ≤ 0.004). According to the Prosigna-PAM50 assay, 63% (12/19) of these cases resulted in intermediate or high risk of recurrence categories. Additionally, although all samples were positive for ER assessed by IHC, the molecular test assigned 47.4% (9/19) of BCs to intrinsic non-luminal subtypes. In conclusion, the AR/ER ratio ≥2 identifies a subgroup of patients with aggressive biological features and may represent an additional independent marker of worse BC prognosis. Moreover, the Prosigna-PAM50 results indicate that a significant number of cases with AR/ER≥2 could be non-luminal tumours. © 2018 Society for Endocrinology.
International Nuclear Information System (INIS)
Bondareva, L.; Vlasova, I.; Mogilnaya, O.; Bolsunovsky, A.; Kalmykov, S.
2010-01-01
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide 241 Am among different components of the plant. The total amount of 241 Am added to the experimental system was 1850 ± 31 Bq/L. The total amount of 241 Am accumulated by the plants was 182 Bq per sample, or 758,333 ± 385 Bq/kg dry mass. It has been found that the major portion of 241 Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of 241 Am within different components of the submerged plant E. canadensis was not uniform. 241 Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
Bondareva, L; Vlasova, I; Mogilnaya, O; Bolsunovsky, A; Kalmykov, S
2010-01-01
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide (241)Am among different components of the plant. The total amount of (241)Am added to the experimental system was 1850+/-31 Bq/L. The total amount of (241)Am accumulated by the plants was 182 Bq per sample, or 758,333+/-385 Bq/kg dry mass. It has been found that the major portion of (241)Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of (241)Am within different components of the submerged plant E. canadensis was not uniform. (241)Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
West, Diana C.; Pan, Deng; Tonsing-Carter, Eva Y.; Hernandez, Kyle M.; Pierce, Charles F.; Styke, Sarah C.; Bowie, Kathleen R.; Garcia, Tzintzuni I.; Kocherginsky, Masha; Conzen, Suzanne D.
2016-01-01
In estrogen receptor (ER)-negative breast cancer (BC), high tumor glucocorticoid receptor (GR) expression has been associated with a relatively poor outcome. In contrast, using a meta-analysis of several genomic datasets, here we find that tumor GR mRNA expression is associated with improved ER+ relapse-free survival (RFS) (independently of progesterone receptor (PR) expression). To understand the mechanism by which GR expression is associated with a better ER+ BC outcome, the global effect of GR-mediated transcriptional activation in ER+ BC cells was studied. Analysis of GR chromatin immunoprecipitation followed by high-throughput sequencing (ChIP-seq) in ER+/GR+ MCF-7 cells revealed that upon co-activation of GR and ER, GR chromatin association became enriched at proximal promoter regions. Furthermore, following ER activation, increased GR chromatin association was observed at ER, FOXO, and AP1 response elements. In addition, ER associated with GR response elements, suggesting that ER and GR interact in a complex. Co-activation of GR and ER resulted in increased expression (relative to ER activation alone) of transcripts that encode proteins promoting cellular differentiation (e.g. KDM4B, VDR) and inhibiting the Wnt-signaling pathway (IGFBP4). Finally, expression of these individual pro-differentiation genes was associated with significantly improved RFS in ER+ BC patients. Together, these data suggest that the co-expression and subsequent activity of tumor cell GR and ER contribute to the less aggressive natural history of early-stage BC by coordinating the altered expression of genes favoring differentiation. Implications The interaction between estrogen and glucocorticoid receptor activity highlights the importance of context-dependent nuclear receptor function in cancer. PMID:27141101
Hanford Single-Shell Tank Leak Causes and Locations - 241-B Farm
International Nuclear Information System (INIS)
Girardot, Crystal L.; Harlow, Donald G.
2013-01-01
This document identifies 241-B Tank Farm (B Farm) leak cause and locations for the 100 series leaking tank (241-B-107) identified in RPP-RPT-49089, Hanford B-Farm Leak Inventory Assessments Report. This document satisfies the B Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F
Li, Xiao-Yan; Dong, Shi-Kui; Liu, Shi-Liang; Peng, Ming-Chun; Li, Jin-Peng; Zhao, Qing-He; Zhang, Zhao-Ling
2012-08-01
Taking the surrounding areas of Xiaowan Reservoir in the middle reach of Lancangjiang River as study area, and based on the vegetation investigation at three sites including electricity transmission area (site 1), electricity-transfer substation and roadsides to the substation (site 2), and emigration area (site 3) in 1997 (before dam construction), another investigation was conducted on the vegetation composition, plant coverage, and dominant species at the same sites in 2010 (after dam construction), aimed to evaluate the ecological risk of the dam construction for the terrestrial plant species in middle reach of Lancangjiang River. There was an obvious difference in the summed dominance ratio of dominant species at the three sites before and after the dam construction. According the types of species (dominant and non-dominant species) and the changes of plant dominance, the ecological risk (ER) for the plant species was categorized into 0 to IV, i.e., no or extremely low ecological risk (0), low ecological risk (I), medium ecological risk (II), high ecological risk (III), and extremely high ecological risk (IV). As affected by the dam construction, the majority of the species were at ER III, and a few species were at ER IV. The percentage of the plant species at ER III and ER IV at site 3 was higher than that at sites 1 and 2. The decrease or loss of native plants and the increase of alien or invasive plants were the major ecological risks caused by the dam construction. Effective protection strategies should be adopted to mitigate the ecological risk of the dam construction for the terrestrial plants at species level.
Endoplasmic Reticulum (ER Stress and Endocrine Disorders
Directory of Open Access Journals (Sweden)
Daisuke Ariyasu
2017-02-01
Full Text Available The endoplasmic reticulum (ER is the organelle where secretory and membrane proteins are synthesized and folded. Unfolded proteins that are retained within the ER can cause ER stress. Eukaryotic cells have a defense system called the “unfolded protein response” (UPR, which protects cells from ER stress. Cells undergo apoptosis when ER stress exceeds the capacity of the UPR, which has been revealed to cause human diseases. Although neurodegenerative diseases are well-known ER stress-related diseases, it has been discovered that endocrine diseases are also related to ER stress. In this review, we focus on ER stress-related human endocrine disorders. In addition to diabetes mellitus, which is well characterized, several relatively rare genetic disorders such as familial neurohypophyseal diabetes insipidus (FNDI, Wolfram syndrome, and isolated growth hormone deficiency type II (IGHD2 are discussed in this article.
Endoplasmic Reticulum (ER) Stress and Endocrine Disorders
Ariyasu, Daisuke; Yoshida, Hiderou; Hasegawa, Yukihiro
2017-01-01
The endoplasmic reticulum (ER) is the organelle where secretory and membrane proteins are synthesized and folded. Unfolded proteins that are retained within the ER can cause ER stress. Eukaryotic cells have a defense system called the “unfolded protein response” (UPR), which protects cells from ER stress. Cells undergo apoptosis when ER stress exceeds the capacity of the UPR, which has been revealed to cause human diseases. Although neurodegenerative diseases are well-known ER stress-related diseases, it has been discovered that endocrine diseases are also related to ER stress. In this review, we focus on ER stress-related human endocrine disorders. In addition to diabetes mellitus, which is well characterized, several relatively rare genetic disorders such as familial neurohypophyseal diabetes insipidus (FNDI), Wolfram syndrome, and isolated growth hormone deficiency type II (IGHD2) are discussed in this article. PMID:28208663
Energy Technology Data Exchange (ETDEWEB)
None
2013-03-05
Well ER-EC-14 was drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Management Operations Underground Test Area (UGTA) Activity at the Nevada National Security Site (NNSS; formerly Nevada Test Site), Nye County, Nevada. The well was drilled in September and October 2012, as part of the Central and Western Pahute Mesa Corrective Action Unit Phase II drilling program. The primary purpose of the well was to provide detailed hydrogeologic information for the Fortymile Canyon composite hydrostratigraphic unit in the Timber Mountain moat area, within the Timber Mountain caldera complex, that will help address uncertainties within the Pahute Mesa–Oasis Valley hydrostratigraphic framework model. The main 55.9-centimeter (cm) hole was drilled to a total depth of 325.5 meters (m) and cased with 40.6-cm casing to 308.1 m. The hole diameter was then decreased to 37.5 cm, and drilling continued to a total depth of 724.8 m. The completion casing string, set to the depth of 690.9 m, consists of 16.8-cm stainless-steel casing hanging from 19.4-cm carbon-steel casing. The stainless-steel casing has two slotted intervals open to the Rainier Mesa Tuff. Two piezometer strings were installed in Well ER-EC-14. Both piezometer strings, each with one slotted interval, consist of 6.0-cm carbon-steel tubing at the surface, then cross over to 7.3-cm stainless-steel tubing just above the water table. The shallow piezometer string was landed at 507.8 m, and the deep piezometer string was landed at 688.6 m. Both piezometer strings are set to monitor groundwater within moderately to densely welded Rainier Mesa Tuff. Data collected during and shortly after hole construction include composite drill cuttings samples collected every 3.0 m, various geophysical logs, water quality (including tritium and other radionuclides) measurements, and water level measurements. The well penetrated 15.2 m of alluvium and
Using variance structure to quantify responses to perturbation in fish catches
Vidal, Tiffany E.; Irwin, Brian J.; Wagner, Tyler; Rudstam, Lars G.; Jackson, James R.; Bence, James R.
2017-01-01
We present a case study evaluation of gill-net catches of Walleye Sander vitreus to assess potential effects of large-scale changes in Oneida Lake, New York, including the disruption of trophic interactions by double-crested cormorants Phalacrocorax auritus and invasive dreissenid mussels. We used the empirical long-term gill-net time series and a negative binomial linear mixed model to partition the variability in catches into spatial and coherent temporal variance components, hypothesizing that variance partitioning can help quantify spatiotemporal variability and determine whether variance structure differs before and after large-scale perturbations. We found that the mean catch and the total variability of catches decreased following perturbation but that not all sampling locations responded in a consistent manner. There was also evidence of some spatial homogenization concurrent with a restructuring of the relative productivity of individual sites. Specifically, offshore sites generally became more productive following the estimated break point in the gill-net time series. These results provide support for the idea that variance structure is responsive to large-scale perturbations; therefore, variance components have potential utility as statistical indicators of response to a changing environment more broadly. The modeling approach described herein is flexible and would be transferable to other systems and metrics. For example, variance partitioning could be used to examine responses to alternative management regimes, to compare variability across physiographic regions, and to describe differences among climate zones. Understanding how individual variance components respond to perturbation may yield finer-scale insights into ecological shifts than focusing on patterns in the mean responses or total variability alone.
241-SY-101 DACS instrument problem screen (SCR 448) acceptance test procedure
International Nuclear Information System (INIS)
ERMI, A.M.
1999-01-01
The operability of the 241-SY-101 Data Acquisition and Control System (DACS) to provide proper control and monitoring of the mitigation mixer pump and instrumentation installed in the 241-SY-101 underground storage tank utilizing the [INSTPROB] screen will be systematically evaluated by the performance of this procedure
Akiyama, Y.; Heyde, K.; Arima, A.; Yoshinaga, N.
1986-05-01
Extending the interacting boson model by incorporating besides s and d, also the g-boson, we can describe the population of positive parity states of 168Er in the 166Er(t,P) 168Er reaction rather well. In particular, the excitation of I,Kπi = 4,3 +1; 2,2 +2; 0,0 +3 and 0,0 +4 states is much improved over the sd-IBM approach.
Can an observer really catch up with light?
International Nuclear Information System (INIS)
Tian, Guihua; Zheng, Zhao
2003-01-01
Given a null geodesic γ 0 (λ) with a point r in (p, q) conjugate to p along γ 0 (λ), up to the second variation, there will be a variation of γ 0 (λ) which will give a timelike curve from p to q. This is the well-known theory proved in the famous book (Hawking S W and Ellis G F R 1973 The Large Scale Structure of Space-Time (Cambridge: Cambridge University Press)). In this paper, we prove that the timelike curves coming from the above-mentioned second variation have a proper acceleration approaching infinity as the timelike curves approach the null geodesic. This means no observer infinitesimally near the light can begin at the same point with it and finally catch up with it. Only when separated from the light path finitely, can the observer begin at the same point with it and really catch up with it
Safety catching device for pipes in missile shielding cylinders of nuclear power plants
International Nuclear Information System (INIS)
Hering, S.; Doll, B.
1976-01-01
The safety catching device consists of a steel wire passed in U-shape around the pipe to be caught and supported by two anchor ties embedded in the concrete of the missile shielding cylinder. This flexible catching device is to cause the energy released in case of a pipe rupture to be absorbed and no dangerous bending shesses to be transferred to the walls of the missile shielding cylinder. (UWI) [de
DEFF Research Database (Denmark)
Rennison, Betina Wolfgang
2017-01-01
Ledere skal i dag selv skabe deres eget rum til ledelse, men hvad er med til at sætte det, hvilke betingelser og udfordringer er der, og hvordan kan lederne skabe sig selv i et hav af forventninger? Dette katalog inviterer til refleksion herom....
Status of tank 241-SY-101 data analyses
International Nuclear Information System (INIS)
Anantatmula, R.P.
1992-09-01
The Waste Tank Flammable Gas Stabilization Program was established in 1990 to provide for resolution of a major safety issue identified for 23 of the high-level waste tanks at the Hanford Site. The safety issue involves the production, accumulation, and periodic release from these tanks of flammable gases in concentrations exceeding the lower flammability limits. This document deals primarily with tank 241-SY-101 from the SY Tank Farm. The flammable gas condition has existed for this tank since the tank was first filled in the time period from 1977 to 1980. During a general review of waste tank chemical stability in 1988--1989, this situation was re-examined and, in March 1990, the condition was declared to be an unreviewed safety question. Tank 241-SY-101 was placed under special operating restrictions, and a program of investigation was begun to evaluate the condition and determine appropriate courses of action. This report summarizes the data that have become available on tank 241-SY-101 since it was declared as an unreviewed safety question and updates the information reported in an earlier document (WHC-EP-0517). The report provides a technical basis for use in the evaluation of safety risks of the tank and subsequent resolution of the unreviewed safety question
Effect of Er3+ Concentration on Upconversion in Hexagonal-Phase NaYF4:Er3+ Nanocrystals
International Nuclear Information System (INIS)
Luo, X J; Yuminami, R; Sakurai, T; Akimoto, K
2013-01-01
A facile synthesis method was developed to produce hexagonal-phase of NaYF 4 nanocrystals (NCs) doped with Er 3+ in different concentration, which showed upconversion (UC) emission from infrared to visible spectral region. This proposed method is simple and less toxic compared with generally used method so far. It was found that up-conversion emission spectra of NaYF 4 :Er 3+ NCs, excited at 1550 nm, included four peaks at about 980 nm, 800 nm, 660 nm and 540 nm. The effect of Er 3+ concentration on UC in β-phase NaYF 4 :Er 3+ NCs were discussed based on the excitation power dependence. The optimum Er 3+ concentration for 2-step and 3-step UC was found to be around 10∼30%.
Nielsen, Jon Magne
2006-01-01
Denne oppgaven ser på bruken av elektronisk ID i statlige etater i Norge i dag. Det ses spesielt på om bruken av tekologien PKI er en god løsning på etatenes behov på dette området. Som utgangspunkt for analysen er det sett spesielt på to statlige etater. Disse etatenes behov og bruk av elektronisk ID generelt og PKI spesielt blir undersøkt. Det er videre gjort rede for hvilke lover, forskrifter og andre førende dokumenter som danner de formelle rammebetingelsene for etaters bruk av PKI. ...
In-vivo counting of 241Am in human lungs and tracheobronchial lymph nodes
International Nuclear Information System (INIS)
Northcutt, A.R.; Binney, S.E.; Palmer, H.E.
1988-01-01
A study was conducted of a human male who had inhaled a mixture of 241 Am and Pu. To distinguish 241 Am deposited in the subject's lungs from translocated activity deposited in the tracheobronchial lymph nodes (TBLN), two intrinsic Ge detectors were collimated with 0.3-cm Pb sheeting. A tissue-equivalent phantom containing either 22.9 kBq (620 nCi) of 241 Am in the lungs or a 81.4 kBq (2200 nCi) 241 Am point source in the TBLN was measured. Calibration curves observed from lateral differential scans on the phantom were compared to data obtained by the same detection system for a human male with a measured lung deposition of 89 Bq (2.4 nCi) of 241 Am. Comparison of the human data to the calibration curves indicated the activity was restricted primarily to the lungs. The calibration curves demonstrate that this method is useful in determining the distribution of inhaled radioactivity between the lungs and TBLN. The measured activity from the male subject generally supported the ICRP Publication 30 model translocation prediction for class Y compounds
Final results of double-shell tank 241-AZ-101 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AZ-101. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AZ-101 primary tank wall and welds. The inspection found one reportable indication of thinning and no reportable pitting, corrosion, or cracking
DEFF Research Database (Denmark)
Rydén, Pernille; Ringberg, Torsten; Wilke, Ricky
En forskningsrapport fra CBS om danske lederes opfattelse af sociale medier i detail- og servicebranchen. Rapporten er udarbejdet i regi af Service Platform.......En forskningsrapport fra CBS om danske lederes opfattelse af sociale medier i detail- og servicebranchen. Rapporten er udarbejdet i regi af Service Platform....
Energy Technology Data Exchange (ETDEWEB)
Pereira, Tatiane Rocha
2009-07-01
In this work the mechanisms involved in the sorption of {sup 241}Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m{sup -2} and 4 kg m{sup -2}) were artificially contaminated by radioactive solution water, which contained {sup 241}Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of {sup 241}Am in radish's roots was measured. The main results show that {sup 241}Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for {sup 241}Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
Wang, Xin; Shi, Qi; Xu, Kun; Gao, Chen; Chen, Cao; Li, Xiao-Li; Wang, Gui-Rong; Tian, Chan; Han, Jun; Dong, Xiao-Ping
2011-01-01
Background Genetic prion diseases are linked to point and inserted mutations in the prion protein (PrP) gene that are presumed to favor conversion of the cellular isoform of PrP (PrPC) to the pathogenic one (PrPSc). The pathogenic mechanisms and the subcellular sites of the conversion are not completely understood. Here we introduce several PRNP gene mutations (such as, PrP-KDEL, PrP-3AV, PrP-A117V, PrP-G114V, PrP-P102L and PrP-E200K) into the cultured cells in order to explore the pathogenic mechanism of familial prion disease. Methodology/Principal Findings To address the roles of aberrant retention of PrP in endoplasmic reticulum (ER), the recombinant plasmids expressing full-length human PrP tailed with an ER signal peptide at the COOH-terminal (PrP-KDEL) and PrP with three amino acids exchange in transmembrane region (PrP-3AV) were constructed. In the preparations of transient transfections, 18-kD COOH-terminal proteolytic resistant fragments (Ctm-PrP) were detected in the cells expressing PrP-KDEL and PrP-3AV. Analyses of the cell viabilities in the presences of tunicamycin and brefeldin A revealed that expressions of PrP-KDEL and PrP-3AV sensitized the transfected cells to ER stress stimuli. Western blots and RT-PCR identified the clear alternations of ER stress associated events in the cells expressing PrP-KDEL and PrP-3AV that induced ER mediated apoptosis by CHOP and capase-12 apoptosis pathway. Moreover, several familial CJD related PrP mutants were transiently introduced into the cultured cells. Only the mutants within the transmembrane region (G114V and A117V) induced the formation of Ctm-PrP and caused the ER stress, while the mutants outside the transmembrane region (P102L and E200K) failed. Conclusions/Significance The data indicate that the retention of PrP in ER through formation of Ctm-PrP results in ER stress and cell apoptosis. The cytopathic activities caused by different familial CJD associated PrP mutants may vary, among them the mutants
Directory of Open Access Journals (Sweden)
Xin Wang
Full Text Available BACKGROUND: Genetic prion diseases are linked to point and inserted mutations in the prion protein (PrP gene that are presumed to favor conversion of the cellular isoform of PrP (PrP(C to the pathogenic one (PrP(Sc. The pathogenic mechanisms and the subcellular sites of the conversion are not completely understood. Here we introduce several PRNP gene mutations (such as, PrP-KDEL, PrP-3AV, PrP-A117V, PrP-G114V, PrP-P102L and PrP-E200K into the cultured cells in order to explore the pathogenic mechanism of familial prion disease. METHODOLOGY/PRINCIPAL FINDINGS: To address the roles of aberrant retention of PrP in endoplasmic reticulum (ER, the recombinant plasmids expressing full-length human PrP tailed with an ER signal peptide at the COOH-terminal (PrP-KDEL and PrP with three amino acids exchange in transmembrane region (PrP-3AV were constructed. In the preparations of transient transfections, 18-kD COOH-terminal proteolytic resistant fragments (Ctm-PrP were detected in the cells expressing PrP-KDEL and PrP-3AV. Analyses of the cell viabilities in the presences of tunicamycin and brefeldin A revealed that expressions of PrP-KDEL and PrP-3AV sensitized the transfected cells to ER stress stimuli. Western blots and RT-PCR identified the clear alternations of ER stress associated events in the cells expressing PrP-KDEL and PrP-3AV that induced ER mediated apoptosis by CHOP and caspase-12 apoptosis pathway. Moreover, several familial CJD related PrP mutants were transiently introduced into the cultured cells. Only the mutants within the transmembrane region (G114V and A117V induced the formation of Ctm-PrP and caused the ER stress, while the mutants outside the transmembrane region (P102L and E200K failed. CONCLUSIONS/SIGNIFICANCE: The data indicate that the retention of PrP in ER through formation of Ctm-PrP results in ER stress and cell apoptosis. The cytopathic activities caused by different familial CJD associated PrP mutants may vary, among them
Trade-Based Estimation of Bluefin Tuna Catches in the Eastern Atlantic and Mediterranean, 2005–2011
Gagern, Antonius; van den Bergh, Jeroen; Sumaila, Ussif Rashid
2013-01-01
The Eastern Atlantic and Mediterranean stock of Bluefin tuna Thunnus thynnus (BFTE) has long been considered overfished and at risk of collapse. Although ICCAT quotas for this stock have decreased considerably over the past years, uncertainty exists about the degree of catch beyond this quota. The extent of such catch is an important piece of information in stock assessment models as well as being an indicator of the effectiveness of fisheries management. We present a model using Bluefin tuna trade data to infer actual catches. Basing our calculations on 25 countries involved in BFTE trade, we estimate that between 2005 and 2011, allowable quotas were exceeded by 44 percent. This gap between catch and quotas has slightly increased over past years, leading to estimated excess catches of 57 percent for the period between 2008 and 2011. To improve assessments, preparation and design of BFTE management, we suggest that the estimated total removals reported in this paper be included in stock assessment models for BFTE. An implication of our findings is that ICCAT member states should take stronger measures to monitor and enforce compliance with quotas. PMID:23922870
Analysis and characterization of double shell tank 241-AP-108
International Nuclear Information System (INIS)
Miller, G.L.
1994-01-01
This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank