WorldWideScience

Sample records for coloredge cg222w nec

  1. Niger - NECS

    Data.gov (United States)

    Millennium Challenge Corporation — This impact evaluation uses random assignment at the village level to estimate impacts of the NECS and IMAGINE projects on enrollment, attendance, learning and other...

  2. Necrotizing enterocolitis (NEC: what’s going on

    Directory of Open Access Journals (Sweden)

    Mario De Curtis

    2013-06-01

    Full Text Available Necrotizing enterocolitis (NEC is among the most common and devastating diseases in neonates and, despite the significant advances in neonatal care and clinical and basic science investigations, its etiology remains incompletely understood, specific treatment strategies are lacking, and morbidity and mortality from this disease remain high. Recent improvements in the pathophysiology of NEC may have therapeutic consequences. Toll-like receptors and intestinal microflora play an increasing role in the pathogenesis of NEC. Pharmacologic inhibition of TLR signaling, the use of novel nutritional strategies, and microflora modulation may represent novel promising approaches to the prevention and treatment of NEC. This review focuses on current and future therapeutic perspectives, starting from the recent acquisitions in the pathogenic mechanisms of NEC. Proceedings of the 9th International Workshop on Neonatology · Cagliari (Italy · October 23rd-26th, 2013 · Learned lessons, changing practice and cutting-edge research

  3. PENERAPAN ASAS PACTA TERTIIS NEC NOCENT NEC PROSUNT BERKAITAN DENGAN STATUS HUKUM DAERAH DASAR LAUT SAMUDERA DALAM (SEA BED

    Directory of Open Access Journals (Sweden)

    Aryuni Yuliatiningsih

    2010-01-01

    Full Text Available International ocean seabed area out of national jurisdiction recognized as a common heritage of mankind. Its regulations under International authority based on UNCLOS 1982. UNCLOS 1982 didn’t universal acceptance because there are several states unwilling consent to be bound by a treaty. In the law of treaty there is pacta tertiis nec nocent nec prosunt principle, means a treaty does not either obligations or rights for a third State without its consent. Nevertheless, rules in a treaty becoming binding upon on third states through international custom and there is a principle has character erga omnes Key Words: pacta tertiis nec nocent nec prosunt principle, legal status, ocean seabed, erga omnes

  4. SimNEC : research platform for studying human functioning in NCW

    NARCIS (Netherlands)

    Veen, H.A.H.C. van; Graaf, B. de; Essens, P.

    2006-01-01

    SimNEC is TNOÆs grand scheme for experimentally studying human factors issues related to NEC/NCW. The research platform SimNEC consists of multidisciplinary expert teams, long-term research programmes, and a local network of state-of-the-art simulator modules. SimNEC does not focus on technology,

  5. NEC-2020 emission reduction scenarios

    DEFF Research Database (Denmark)

    Slentø, Erik; Nielsen, Ole-Kenneth; Hoffmann, Leif

    The upcoming NEC-2020 EU directive sets up emission ceilings for NOX, SO2, NH3, NMVOC and PM in order to meet the environmental exposure targets of the Thematic Strategy. This report contains an assessment of intermediary emission reduction scenarios for Denmark, computed by the GAINS model 2007,......, which serves as the basis for the pending negotiations in EU. The assessment is brought up to date by including a brief evaluation of the new reduction scenarios published in 2008, founding the European Commission NEC-2020 directive proposal....

  6. Differential disease resistance response in the barley necrotic mutant nec1

    Directory of Open Access Journals (Sweden)

    Kunga Laura

    2011-04-01

    Full Text Available Abstract Background Although ion fluxes are considered to be an integral part of signal transduction during responses to pathogens, only a few ion channels are known to participate in the plant response to infection. CNGC4 is a disease resistance-related cyclic nucleotide-gated ion channel. Arabidopsis thaliana CNGC4 mutants hlm1 and dnd2 display an impaired hypersensitive response (HR, retarded growth, a constitutively active salicylic acid (SA-mediated pathogenesis-related response and elevated resistance against bacterial pathogens. Barley CNGC4 shares 67% aa identity with AtCNGC4. The barley mutant nec1 comprising of a frame-shift mutation of CNGC4 displays a necrotic phenotype and constitutively over-expresses PR-1, yet it is not known what effect the nec1 mutation has on barley resistance against different types of pathogens. Results nec1 mutant accumulated high amount of SA and hydrogen peroxide compared to parental cv. Parkland. Experiments investigating nec1 disease resistance demonstrated positive effect of nec1 mutation on non-host resistance against Pseudomonas syringae pv. tomato (Pst at high inoculum density, whereas at normal Pst inoculum concentration nec1 resistance did not differ from wt. In contrast to augmented P. syringae resistance, penetration resistance against biotrophic fungus Blumeria graminis f. sp. hordei (Bgh, the causal agent of powdery mildew, was not altered in nec1. The nec1 mutant significantly over-expressed race non-specific Bgh resistance-related genes BI-1 and MLO. Induction of BI-1 and MLO suggested putative involvement of nec1 in race non-specific Bgh resistance, therefore the effect of nec1on mlo-5-mediated Bgh resistance was assessed. The nec1/mlo-5 double mutant was as resistant to Bgh as Nec1/mlo-5 plants, suggesting that nec1 did not impair mlo-5 race non-specific Bgh resistance. Conclusions Together, the results suggest that nec1 mutation alters activation of systemic acquired resistance

  7. An animal model of necrotizing enterocolitis (NEC) in preterm rabbits.

    Science.gov (United States)

    Bozeman, Andrew P; Dassinger, Melvin S; Birusingh, Rhea J; Burford, Jeffrey M; Smith, Samuel D

    2013-04-01

    Creation of an animal model of necrotizing enterocolitis (NEC) allowing adjustment of severity and potential recoverability is needed to study effectiveness of prevention and treatment strategies. This study describes a novel model in preterm rabbits capable of adjusting severity of NEC-like histologic changes. Rabbit pups (n = 151) were delivered by cesarean section 2 days preterm. In the treatment groups, tissue adhesive was applied to anal openings to simulate the poor intestinal function and dysmotility of preterm neonates. Pups were placed into five groups: 3INT (3 day intermittent block), 4INT (4 day intermittent block), 3COM (3 day complete block), 4COM (4 day complete block), based on differences in type of anal blockage and day of life sacrificed. The fifth group, 4CON, was comprised of a control arm (n = 28) without anal block, with sacrifice of subjects on day 4. All pups were gavage fed with formula contaminated with Enterobacter cloacae, ranitidine, and indomethacin. Following sacrifice, the intestines were harvested for pathologic evidence of NEC. A blinded pathologist graded histologic changes consistent with NEC using a grading scale 0-4 with 4 being most severe. Fifty-seven pups (57/123) (46%) in the research arm survived to sacrifice, compared to 26/28 (93%) in the control arm of the investigation, p < 0.0001. The incidence and severity of NEC-like damage increased with the duration and completeness of the anal blockage. 44/57 (77%) of survivors revealed various degrees of NEC-like damage to large and small bowel, and 3/26 (12%) exhibited early NEC-like mucosal injury in the research and control arms, respectively. This animal model produces NEC-like pathologic changes in both small and large intestine in preterm rabbits. Because incidence and severity of damage increases with duration and completeness of intestinal dysmotility, this allows future effectiveness studies for nonsurgical treatment and prevention of NEC.

  8. Quantifying the Benefits of NEC

    National Research Council Canada - National Science Library

    Court, Georgia; Sharp, Lynda C

    2005-01-01

    ...). The white paper notes that NEC, through enabling "the ability to respond more quickly and precisely, will act as a force multiplier enabling our forces to achieve the desired effect through a smaller...

  9. NEC violation in mimetic cosmology revisited

    Directory of Open Access Journals (Sweden)

    Anna Ijjas

    2016-09-01

    Full Text Available In the context of Einstein gravity, if the null energy condition (NEC is satisfied, the energy density in expanding space–times always decreases while in contracting space–times the energy density grows and the universe eventually collapses into a singularity. In particular, no non-singular bounce is possible. It is, though, an open question if this energy condition can be violated in a controlled way, i.e., without introducing pathologies, such as unstable negative-energy states or an imaginary speed of sound. In this letter, we will re-examine the claim that the recently proposed mimetic scenario can violate the NEC without pathologies. We show that mimetic cosmology is prone to gradient instabilities even in cases when the NEC is satisfied (except for trivial examples. Most interestingly, the source of the instability is always the Einstein–Hilbert term in the action. The matter stress-energy component does not contribute spatial gradient terms but instead makes the problematic curvature modes dynamical. We also show that mimetic cosmology can be understood as a singular limit of known, well-behaved theories involving higher-derivative kinetic terms and discuss ways of removing the instability.

  10. NEC3 - Managing change - 16380

    International Nuclear Information System (INIS)

    Wilsoncroft, Charles

    2009-01-01

    The Office of Government Commerce (OGC) has endorsed the use of NEC for all public sector contracts. The reason being is that it stimulates effective project management and enables the parties to manage risk and change more efficiently, which in turn serves to mitigate the cost and time effects of any risk event should it arise under the contract. In essence it facilitates a more collaborative working culture between the parties. The NEC3 contract is gaining in popularity and has been adopted for use in the decommissioning of nuclear power stations and the London Olympics, it also recently received support in the Tenth Special Report on Construction Matters by the House of Commons. It has strict time limits for the notification of compensation events as set out in the core clause 61.3 whereby the Contractor's contract administration team needs to notify the project manager within an eight week period of becoming aware of the event. The contract also provides for an early warning procedure whereby the Contractor and the project manager will cooperate and pro-actively discuss how issues can be overcome in a collaborative manner. This NEC3 contract requires both the Contractor and the Employer to act positively and is welcomed as a possible solution to the entrenched disputes which have regularly occurred on major energy projects and if properly administered will hopefully result in an earlier and less fraught final account settlement process for both parties. (authors)

  11. Secure Service Oriented Architectures (SOA) Supporting NEC [Architecture orientée service (SOA) gérant la NEC

    NARCIS (Netherlands)

    Meiler, P.P.; Schmeing, M.

    2009-01-01

    Combined scenario ; Data management ; Data processing ; Demonstrator ; Information systems ; Integrated systems ; Interoperability ; Joint scenario ; Network Enabled Capability (NEC) ; Operational effectiveness ; Operations research ; Scenarios ; Secure communication ; Service Oriented Architecture

  12. Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP

  13. Transcription factor CgMTF-1 regulates CgZnT1 and CgMT expression in Pacific oyster (Crassostrea gigas) under zinc stress

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Jie; Zhang, Linlin [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China); Li, Li, E-mail: lili@qdio.ac.cn [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China); Li, Chunyan; Wang, Ting [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Zhang, Guofan, E-mail: gfzhang@qdio.ac.cn [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China)

    2015-08-15

    Highlights: • CgMTF-1 and CgZnT1 were first identified in oysters. • CgMTF-1 localized in cell nucleus under unstressed conditions. • CgMTF-1 proteins could bind with the typical MRE motif. • CgMTF-1 activated CgZnT1, CgMT1 and CgMT4 promoters and regulated their expressions under zinc exposure. - Abstract: Oysters accumulate zinc at high tissue concentrations, and the metal response element (MRE)-binding transcription factor (MTF) functions as the cellular zinc sensor that coordinates the expression of genes involved in zinc efflux and storage, as well as those that protect against metal toxicity. In this study, we cloned MTF-1 in oysters and examined its regulation mechanism for its classic target genes, including MTs and ZnT1 under zinc exposure conditions. We cloned CgMTF-1 and determined the subcellular locations of its protein product in HEK293 cells. CgMTF-1 has a 2826 bp open reading frame that encodes a predicted polypeptide with 707 amino acid residues, showing six well-conserved zinc finger domains that are required for metal binding. In HEK293 cell lines, CgMTF-1 primarily localizes in the cell nucleus under unstressed conditions and nuclear translocation was not critical for the activation of this gene. We searched for CgMTF-1-regulated genes in oysters using RNA interference. Decreased expression levels of CgMT1, CgMT4, and CgZnT1 were observed after CgMTF-1 interference (>70% inhibition) under zinc exposure, indicating the critical role of CgMTF-1 in the regulation of these genes. We searched for a direct regulation mechanism involving CgMTF-1 for CgMT1, CgMT4, and CgZnT1 in vitro. EMSA experiments indicated that CgMTF-1 can bind with the MREs found in the CgZnT1, CgMT1 and CgMT4 promoter regions. Additionally, luciferase reporter gene experiments indicated that CgMTF-1 could activate the CgMT1, CgMT4, and CgZnT1 promoters. Overall, our results suggest that CgMTF-1 directly coordinates the regulation of CgMTs and CgZnT1 expression and plays

  14. Transcription factor CgMTF-1 regulates CgZnT1 and CgMT expression in Pacific oyster (Crassostrea gigas) under zinc stress

    International Nuclear Information System (INIS)

    Meng, Jie; Zhang, Linlin; Li, Li; Li, Chunyan; Wang, Ting; Zhang, Guofan

    2015-01-01

    Highlights: • CgMTF-1 and CgZnT1 were first identified in oysters. • CgMTF-1 localized in cell nucleus under unstressed conditions. • CgMTF-1 proteins could bind with the typical MRE motif. • CgMTF-1 activated CgZnT1, CgMT1 and CgMT4 promoters and regulated their expressions under zinc exposure. - Abstract: Oysters accumulate zinc at high tissue concentrations, and the metal response element (MRE)-binding transcription factor (MTF) functions as the cellular zinc sensor that coordinates the expression of genes involved in zinc efflux and storage, as well as those that protect against metal toxicity. In this study, we cloned MTF-1 in oysters and examined its regulation mechanism for its classic target genes, including MTs and ZnT1 under zinc exposure conditions. We cloned CgMTF-1 and determined the subcellular locations of its protein product in HEK293 cells. CgMTF-1 has a 2826 bp open reading frame that encodes a predicted polypeptide with 707 amino acid residues, showing six well-conserved zinc finger domains that are required for metal binding. In HEK293 cell lines, CgMTF-1 primarily localizes in the cell nucleus under unstressed conditions and nuclear translocation was not critical for the activation of this gene. We searched for CgMTF-1-regulated genes in oysters using RNA interference. Decreased expression levels of CgMT1, CgMT4, and CgZnT1 were observed after CgMTF-1 interference (>70% inhibition) under zinc exposure, indicating the critical role of CgMTF-1 in the regulation of these genes. We searched for a direct regulation mechanism involving CgMTF-1 for CgMT1, CgMT4, and CgZnT1 in vitro. EMSA experiments indicated that CgMTF-1 can bind with the MREs found in the CgZnT1, CgMT1 and CgMT4 promoter regions. Additionally, luciferase reporter gene experiments indicated that CgMTF-1 could activate the CgMT1, CgMT4, and CgZnT1 promoters. Overall, our results suggest that CgMTF-1 directly coordinates the regulation of CgMTs and CgZnT1 expression and plays

  15. Biological functions of hCG and hCG-related molecules

    Directory of Open Access Journals (Sweden)

    Cole Laurence A

    2010-08-01

    Full Text Available Abstract Background hCG is a term referring to 4 independent molecules, each produced by separate cells and each having completely separate functions. These are hCG produced by villous syncytiotrophoblast cells, hyperglycosylated hCG produced by cytotrophoblast cells, free beta-subunit made by multiple primary non-trophoblastic malignancies, and pituitary hCG made by the gonadotrope cells of the anterior pituitary. Results and discussion hCG has numerous functions. hCG promotes progesterone production by corpus luteal cells; promotes angiogenesis in uterine vasculature; promoted the fusion of cytotrophoblast cell and differentiation to make syncytiotrophoblast cells; causes the blockage of any immune or macrophage action by mother on foreign invading placental cells; causes uterine growth parallel to fetal growth; suppresses any myometrial contractions during the course of pregnancy; causes growth and differentiation of the umbilical cord; signals the endometrium about forthcoming implantation; acts on receptor in mother's brain causing hyperemesis gravidarum, and seemingly promotes growth of fetal organs during pregnancy. Hyperglycosylated hCG functions to promote growth of cytotrophoblast cells and invasion by these cells, as occurs in implantation of pregnancy, and growth and invasion by choriocarcinoma cells. hCG free beta-subunit is produced by numerous non-trophoblastic malignancies of different primaries. The detection of free beta-subunit in these malignancies is generally considered a sign of poor prognosis. The free beta-subunit blocks apoptosis in cancer cells and promotes the growth and malignancy of the cancer. Pituitary hCG is a sulfated variant of hCG produced at low levels during the menstrual cycle. Pituitary hCG seems to mimic luteinizing hormone actions during the menstrual cycle.

  16. NEC1, a regulator of nectary development and nectar production in Petunia hybrida

    NARCIS (Netherlands)

    Ge, Ya-Xin

    2001-01-01

    This thesis describes an efficient cloning, characterization and functional analysis of a nectary-specific gene in Petunia hybrida. NEC1, a novel gene, is highly expressed in nectaries. NEC1 is involved in nectar production and nectar secretion. Nectar secreted from floral nectaries is the main

  17. Recent development on pelletron systems at NEC

    International Nuclear Information System (INIS)

    Yan Shengqing

    1992-01-01

    Some of the most recent developments at NEC are presented. They are: the high current pelletron systems; a variety of small machines for different special purpose; some of the improvements on the accelerating tube and the terminal potential stabilizer; the large horizontal pelletron 8 UDH; the electron cooling technique

  18. Physical activity and gastric residuals as biomarkers for region-specific NEC lesions in preterm neonates

    DEFF Research Database (Denmark)

    Cao, Muqing; Andersen, Anders Daniel; Li, Yanqi

    2016-01-01

    onset of NEC can be predicted by decreased physical activity during the first few days after birth. Methods: Cesarean-delivered preterm pigs were fed parenteral nutrition and increasing amounts of formula for 5 days after birth (n = 120). Their physical activity was quantified by a continuous camera....... Results: Half of the pigs (48%) showed clear NEC-like lesions on day 5, and these individuals had more adverse clinical symptoms from day 3 but decreased physical activity already from day 2 relative to the unaffected pigs (both p ... physical activity on days 2 and 3, and the increased volume of gastric residuals was specifically related to colon lesions (both p physical activity precedes the clinical symptoms of NEC in the small intestine of preterm pigs, and increased gastric residuals predict NEC...

  19. Nec-1 Enhances Shikonin-Induced Apoptosis in Leukemia Cells by Inhibition of RIP-1 and ERK1/2

    Directory of Open Access Journals (Sweden)

    Hongming Pan

    2012-06-01

    Full Text Available Necrostatin-1 (Nec-1 inhibits necroptosis by allosterically inhibiting the kinase activity of receptor-interacting protein 1 (RIP1, which plays a critical role in necroptosis. RIP1 is a crucial adaptor kinase involved in the activation of NF-κB, production of reactive oxygen species (ROS and the phosphorylation of mitogen activated protein kinases (MAPKs. NF-κB, ROS and MAPKs all play important roles in apoptotic signaling. Nec-1 was regarded as having no effect on apoptosis. Here, we report that Nec-1 increased the rate of nuclear condensation and caspases activation induced by a low concentration of shikonin (SHK in HL60, K562 and primary leukemia cells. siRNA-mediated knockdown of RIP1 significantly enhanced shikonin-induced apoptosis in K562 and HL60 cells. Shikonin treatment alone could slightly inhibit the phosphorylation of ERK1/2 in leukemia cells, and the inhibitory effect on ERK1/2 was significantly augmented by Nec-1. We also found that Nec-1 could inhibit NF-κB p65 translocation to the nucleus at a later stage of SHK treatment. In conclusion, we found that Nec-1 can promote shikonin-induced apoptosis in leukemia cells. The mechanism by which Nec-1 sensitizes shikonin-induced apoptosis appears to be the inhibition of RIP1 kinase-dependent phosphorylation of ERK1/2. To our knowledge, this is the first study to document Nec-1 sensitizes cancer cells to apoptosis.

  20. Validation of 125I-hCG as a marker for elimination of hCG and stability of 125I-hCG after in vivo injection in humans

    OpenAIRE

    Christensen, T B; Marqversen, J; Engbaek, F; Berger, P; Bacher, T; Maase, H von der

    1999-01-01

    We have recently introduced 125I-hCG as an elimination marker in patients with human chorionic gonadotrophin (hCG) producing testicular cancer. 125I-hCG is a well-known reagent in clinical biochemistry and is used extensively in hCG assays. Previous studies have shown that the iodination process leaves the hCG molecule mainly intact. The iodination, purification and stability of 125I-hCG tracer are described. The aim of the present study was to determine whether or not 125I is associated with...

  1. Delayed initiation but not gradual advancement of enteral formula feeding reduces the incidence of necrotizing enterocolitis (NEC in preterm pigs.

    Directory of Open Access Journals (Sweden)

    Nada Ghoneim

    Full Text Available Enteral formula feeding is a risk factor for necrotizing enterocolitis (NEC in premature infants, yet studies are conflicting regarding the safest timing for introduction and advancement of feeds. Our aim was to test the effects of early vs. late initiation and abrupt vs. gradual advancement of enteral feeding of an intact vs. hydrolyzed protein formula on NEC incidence and severity in preterm pigs. In Experiment 1, preterm pigs received total parenteral nutrition (TPN at birth with abrupt initiation of enteral formula feeds (50% full intake on d of life (DOL 2 (EA or 5 (LA while PN continued. Pigs were also fed formula containing either intact or hydrolyzed protein. In Experiment 2, preterm pigs received TPN at birth with enteral, hydrolyzed-protein formula feeds introduced on DOL 2 either abruptly (EA; 50% full feeds or gradually (EG; 10-50% full feeds over 5 d while PN continued. NEC incidence and severity were assessed based on macroscopic and histological scoring. In Experiment 1, NEC incidence (41% vs. 70%, P<0.05 and severity were reduced in LA vs. EA groups and LA was associated with a higher survival rate, daily weight gain and jejunum villus height. Piglets fed hydrolyzed vs. intact protein formula had lower stomach content weights and similar NEC incidence. In Experiment 2, NEC incidence and severity were not different between pigs the EG vs. EA group. Proinflammatory gene expression (IL-1β, IL-6 and S100A9 in the ileum was lower in both LA and EG vs. EA groups. In conclusion, delayed initiation but not gradual advancement of enteral feeding is protective against NEC in preterm pigs. Feeding hydrolyzed vs. intact protein formula improved gastric transit without affecting the NEC incidence.

  2. [FACTORS RELATED TO MORTALITY IN NECROTIZINGENTEROCOLITIS(NEC) IN NEONATES AND OLDER INFANTS

    Science.gov (United States)

    Ríos D , Hugo; Rivera M , Juan

    1997-01-01

    In order to determine the factors related to mortality in Necrotizing enterocolitis (NEC), medical records of neonates and older infants diagnosed of NEC in the Instituto de Salud del Niño between 1984 and 1993 were retrospectively reviewed. Only the cases with a reliable roentgenologic, surgical or pathologic diagnosis were included. Sixty cases (46 infants and 14 neonates) were found, with a higher incidence in males (37 males vs 23 females). Twenty six cases required surgical treatment. Overall mortality was 77%, with no significant differences between neonates and infants, nor between those who were operated or not. Moderate or severe malnutrition, diarrhea as an early clinical manifestations, bronchopneumonia, shock and poor nutricional management were found as factors related to mortality.

  3. hCGbeta core fragment is a metabolite of hCG: evidence from infusion of recombinant hCG.

    Science.gov (United States)

    Norman, R J; Buchholz, M M; Somogyi, A A; Amato, F

    2000-03-01

    The availability of recombinant human chorionic gonadotrophin (r-hCG) has allowed us to measure its metabolic and renal clearance rates and to study the origin of the beta core fragment of hCG (hCGbetacf). Serum and urine samples were collected from six subjects, after an intravenous injection of 2 mg (equivalent to 44 000 IU Urinary hCG) r-hCG, and assayed for hCG and the beta subunit (hCGbeta). Urine from four of the subjects was also subjected to gel chromatography and assayed for hCGbetacf and hCG. r-hCG, administered as an intravenous dose, was distributed, initially in a volume of 3.4+/-0.7 l (mean+/-s.d.) and then in 6.5+/-1.15 l at steady-state. The disappearance of r-hCG from serum was bi-exponential, with an initial half-life of 4.5+/-0.7 h and a terminal half-life of 29.0+/-4.6 h. The mean residence time was 28. 6+/- 3.6 h and the total systemic clearance rate of r-hCG was 226+/-18 ml/h. The renal clearance rate was 28.75+/-6.2 ml/h (mean+/-s.d). hCGbetacf was detected in all urine samples collected at 6 h intervals. Over the 138 h period of urine collection, 12.9% (range 10.1-17.3% ) of r-hCG injected was recovered as the intact molecule and 1.7% (range 0.8-2.9%) was recovered as the hCGbetacf, in 4 subjects. The molar ratio of hCGbetacf to hCG in urine increased from 3.1+/-1.7%, on day 1, to 76+/-34.3% (mean+/-s.e.m.) on day 5, after r-hCG infusion, suggesting that hCGbetacf is a metabolic product of the infused r-hCG.

  4. Analysis list: CG8478 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available CG8478 Cell line,Embryo,Pupae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/...target/CG8478.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/CG8478.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/target/CG8478.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/CG8478.Ce...ll_line.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/CG8478.Embryo.tsv,http://dbarchive.bioscie...ncedbc.jp/kyushu-u/dm3/colo/CG8478.Pupae.tsv http://dbarchive.biosciencedbc.jp/kyus

  5. First-in-human study of the toxicity, pharmacokinetics, and pharmacodynamics of CG200745, a pan-HDAC inhibitor, in patients with refractory solid malignancies.

    Science.gov (United States)

    Kim, Kyu-pyo; Park, Seong Joon; Kim, Jeong-Eun; Hong, Yong Sang; Lee, Jae-Lyun; Bae, Kyun-Seop; Cha, Hyunju; Kwon, Sool-Ki; Ro, Seonggu; Cho, JoongMyung; Kim, Tae Won

    2015-10-01

    The aim of the present study was to assess the safety, maximum tolerated dose (MTD), pharmacokinetics, pharmacodynamics, and efficacy of single and multiple doses of intravenous CG200745, a novel histone deacetylase (HDAC) inhibitor, in patients with advanced solid malignancies. Two to six patients received intravenous CG200745 according to the 2 + 4 dose-escalating method. This first-in-human trial was comprised of two parts: Part 1 was a single ascending dose, and Part 2 was multiple ascending doses weekly for 3 weeks, and then 1 week off. For the first cycle, pharmacokinetic sampling for CG200745 and pharmacodynamic sampling for acetylated histone H4 in peripheral blood mononuclear cells (PBMCs) were performed on day 1 for Part 1 and on days 1 and 15 for Part 2. Examination of acetylated histone H4 in pre- and post-biopsy samples was performed in accessible patients. In all, 28 patients were treated at 13 dose levels (1.8-250 mg/m(2)) and received a total of 71 cycles of CG200745. Hematologic toxicities included grade 3/4 neutropenia (22.2 %) that did not last a week and non-hematologic toxicities included fatigue (22.2 %) and anorexia (16.7 %) that did not exceed grade 2. No dose-limiting toxic effects were noted. Dose proportionality was observed for both the maximum concentration and area under the curve. The elimination half-life was 5.67 ± 2.69 h (mean ± standard deviation). An increase in PBMC acetylated histone H4 was observed at dose levels up to 51 mg/m(2), which plateaued at higher dose levels. At 24 h, 75 % of patients (6/8) showed higher relative acetylation in tumor tissue compared to PBMCs. Although there was no partial or complete response, 57.1 % of patients (16/28) had stable disease that lasted at least 6 weeks. CG200745 can be safely administered at effective dose levels that inhibit HDAC in PBMCs and tumor tissue. Although MTD was not reached, further escalation was not performed because acetylated histone H4 plateaued at dose

  6. USA hCG reference service, 10-year report.

    Science.gov (United States)

    Cole, Laurence A; Laidler, Laura L; Muller, Carolyn Y

    2010-08-01

    The USA hCG Reference Service has been dealing with cases of persistent low levels of hCG and gestational trophoblastic diseases for 10years. Here we present the complete experience. Total hCG in serum and urine was measured using the Siemen's Immulite 1000 assay. Hyperglycosylated hCG, nicked hCG, free ss-subunit and ss-core fragment were measured using microtiterplate assays with antibodies B152, B151, FBT11 and B210, respectively. The USA hCG Reference Service has identified 83 cases of false-positive hCG, 71 cases of aggressive gestational trophoblastic disease (GTD), 52 cases of minimally invasive GTD, 168 cases of quiescent GTD and 22 cases of placenta site trophoblastic tumor (PSTT). In addition, 103 cases of pituitary hCG have been identified, 60 cases of nontrophoblastic tumor, 4 cases of inherited hCG and 2 cases of Munchausen's syndrome. This is 565 cases total. Multiple new methods are described and tested for diagnosing all of these disorders. The USA hCG Reference Service experience shows new methods for detecting multiple hCG-related disorders and recommends new approaches for detecting these hCG-related disorders. 2010 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  7. Protective Effects of Bifidobacterium on Intestinal Barrier Function in LPS-Induced Enterocyte Barrier Injury of Caco-2 Monolayers and in a Rat NEC Model.

    Directory of Open Access Journals (Sweden)

    Xiang Ling

    Full Text Available Zonulin protein is a newly discovered modulator which modulates the permeability of the intestinal epithelial barrier by disassembling intercellular tight junctions (TJ. Disruption of TJ is associated with neonatal necrotizing enterocolitis (NEC. It has been shown bifidobacterium could protect the intestinal barrier function and prophylactical administration of bifidobacterium has beneficial effects in NEC patients and animals. However, it is still unknown whether the zonulin is involved in the gut barrier dysfunction of NEC, and the protective mechanisms of bifidobacterium on intestinal barrier function are also not well understood. The present study aims to investigate the effects of bifidobacterium on intestinal barrier function, zonulin regulation, and TJ integrity both in LPS-induced enterocyte barrier injury of Caco-2 monolayers and in a rat NEC model. Our results showed bifidobacterium markedly attenuated the decrease in transepithelial electrical resistance and the increase in paracellular permeability in the Caco-2 monolayers treated with LPS (P < 0.01. Compared with the LPS group, bifidobacterium significantly decreased the production of IL-6 and TNF-α (P < 0.01 and suppressed zonulin release (P < 0.05. In addition, bifidobacterium pretreatment up-regulated occludin, claudin-3 and ZO-1 expression (P < 0.01 and also preserved these proteins localization at TJ compared with the LPS group. In the in vivo study, bifidobacterium decreased the incidence of NEC from 88 to 47% (P < 0.05 and reduced the severity in the NEC model. Increased levels of IL-6 and TNF-α in the ileum of NEC rats were normalized in bifidobacterium treated rats (P < 0.05. Moreover, administration of bifidobacterium attenuated the increase in intestinal permeability (P < 0.01, decreased the levels of serum zonulin (P < 0.05, normalized the expression and localization of TJ proteins in the ileum compared with animals with NEC. We concluded that bifidobacterium may

  8. Present capabilities and new developments in antenna modeling with the numerical electromagnetics code NEC

    Energy Technology Data Exchange (ETDEWEB)

    Burke, G.J.

    1988-04-08

    Computer modeling of antennas, since its start in the late 1960's, has become a powerful and widely used tool for antenna design. Computer codes have been developed based on the Method-of-Moments, Geometrical Theory of Diffraction, or integration of Maxwell's equations. Of such tools, the Numerical Electromagnetics Code-Method of Moments (NEC) has become one of the most widely used codes for modeling resonant sized antennas. There are several reasons for this including the systematic updating and extension of its capabilities, extensive user-oriented documentation and accessibility of its developers for user assistance. The result is that there are estimated to be several hundred users of various versions of NEC world wide. 23 refs., 10 figs.

  9. A convenient way to double the capacity of a NEC type foil stripper

    International Nuclear Information System (INIS)

    Chapman, K.R.

    1988-01-01

    A convenient method is described to increase the capacity of a NEC type terminal stripper. This renders the necessity for tank entry to renew foils less frequent. This is especially useful when the use of heavy ion beams renders foil lifetimes very short. (orig.)

  10. The effect of administering equine chorionic gonadotropin (eCG) and human chorionic gonadotropin (hCG) post artificial insemination on fertility of lactating dairy cows.

    Science.gov (United States)

    Bartolome, J A; Wallace, S Perez; de la Sota, R L; Thatcher, W W

    2012-09-15

    The objective was to evaluate the effect of equine chorionic gonadotropin (eCG) and hCG post artificial insemination (AI) on fertility of lactating dairy cows. In Experiment 1, cows were either treated with eCG on Day 22 post AI (400 IU; n = 80) or left untreated (n = 84). On Day 29, pregnant cows were either treated with hCG (2500 IU; n = 32) or left untreated (n = 36). Pregnancy and progesterone were evaluated on Days 29 and 45. In Experiment 2, cows (n = 28) were either treated with eCG on Day 22 (n = 13) or left untreated (n = 15) and either treated with hCG on Day 29 (n = 14) or left untreated (n = 14). Blood sampling and ultrasonography were conducted between Days 22 and 45. In Experiment 3, cows were either treated with eCG on Day 22 post AI (n = 229) or left untreated (n = 241). Pregnancy was evaluated on Days 36 and 85. In Experiment 1, eCG on Day 22 increased (P cows on Day 29 (50.0 vs. 33.3%) and on Day 45, the increase was higher (P cows with timed AI (41.2 vs. 6.5%) than in cows AI at detected estrus (50.0 vs. 37.8%). Pregnancy losses were reduced by eCG and hCG, but increased in cows that did not receive eCG but were given hCG (P cows, but not in cows treated with eCG. In Experiment 2, hCG increased (P cows (P cows with low body condition (eCG = 45.6 and 43.5%; Control = 22.9 and 22.9%). In conclusion, eCG at 22 days post insemination increased fertility, primarily in cows with low body condition and reduced pregnancy losses when given 7 days before hCG; hCG induced accessory CLs and slightly increased progesterone, but hCG given in the absence of a prior eCG treatment reduced fertility. Copyright © 2012 Elsevier Inc. All rights reserved.

  11. Target organ of hCG

    International Nuclear Information System (INIS)

    Yanaginuma, Tsutomu; Kobayashi, Takuro

    1974-01-01

    The author and his associated gave intravenous infusions of hCG labeled with 125 I to female rats and investigated its distribution in their brains. The results showed a significantly higher radioactivity in the median eminence than in the other parts of the brain. This indicated that there were receptors of hCG in the median eminence of the hypothalamus of a female rat. The mechanism of gonadotropin action was also discussed in this report. By giving 125 I and 125 I-BSA to the same rats which had been used in the study of hCG distribution in the brain, and by investigating the radioactivity of their ovaries, the author explained the receptor of gonadotropin in corpora lutea. (Serizawa, K.)

  12. Parallel preconditioning techniques for sparse CG solvers

    Energy Technology Data Exchange (ETDEWEB)

    Basermann, A.; Reichel, B.; Schelthoff, C. [Central Institute for Applied Mathematics, Juelich (Germany)

    1996-12-31

    Conjugate gradient (CG) methods to solve sparse systems of linear equations play an important role in numerical methods for solving discretized partial differential equations. The large size and the condition of many technical or physical applications in this area result in the need for efficient parallelization and preconditioning techniques of the CG method. In particular for very ill-conditioned matrices, sophisticated preconditioner are necessary to obtain both acceptable convergence and accuracy of CG. Here, we investigate variants of polynomial and incomplete Cholesky preconditioners that markedly reduce the iterations of the simply diagonally scaled CG and are shown to be well suited for massively parallel machines.

  13. DW_CG-832

    Data.gov (United States)

    Department of Homeland Security — Flat file data from the Office of Resource Management - Financial Analysis Division, CG-832 used for reporting cost allocation models within the Coast Guard Business...

  14. Determination of hCG-alpha subunit in threatened pregnancy

    International Nuclear Information System (INIS)

    Talas, M.; Pohanka, J.; Fingerova, H.; Janouskova, M.; Krikal, Z.; Prasilova, J.; Zupkova, H.

    1987-01-01

    Radioimmunoassay of the hCG-alpha subunit was made using an antibody anti hCG-alpha serum, highly purified hCG-alpha for 125 I-labelling and the standard hCG-alpha. Sera of healthy pregnant women sampled throughout the whole pregnancies were used to determine x-bar±S.D. of hCG-alpha for 14-day intervals. Included in the study were groups of women with high risk of premature labor, late toxemia of pregnancy, twins and fetal hypotrophy. It was shown that increased hCG-alpha is found in pregnant women in whom signs of late toxemia of pregnancy are combined with high risk of premature labor, or with twin pregnancies, while in those with fetal hypotrophy hCG-alpha is within normal limits. (author). 3 figs., 7 refs

  15. Tests of compressed geometry NEC acceleration tubes

    International Nuclear Information System (INIS)

    Raatz, J.E.; Rathmell, R.D.; Stelson, P.H.; Ziegler, N.F.

    1985-01-01

    Tests have been performed in the 3 MV Pelletron test machine at NEC on a compressed geometry tube which increases the insulating length of the tube by eliminating the heated electrode assemblies (approx.2.5 cm thick) at the end of each tube section. Some insert electrodes are changed to provide some trapping of secondary ions. The geometry tested provided an 18% increase in live ceramic in the tube. The compressed geometry tube allowed a terminal voltage of 3.55 MV on the 3 MV column at normal gradients of 30.3 kv/tube gap. The tube was also conditioned to more than 4 MV and remained stable in voltage with few sparks and with low x-ray levels for days at about 4 MV. This same performance could be achieved with or without arc discharge cleaning. 4 refs., 4 figs

  16. Prolog+CG: A Maintainer's Perspective

    DEFF Research Database (Denmark)

    Petersen, Ulrik

    2006-01-01

    Prolog+CG is an implementation of Prolog with Conceptual Graphs as first-class datastructures, on a par with terms. As such, it lends itself well to applications in which reasoning with Conceptual Graphs and/or ontologies plays a role. It  as originally developed by Prof. Dr. Adil Kabbaj, who......, we offer some general observations about the tenets that make Prolog+CG a success....

  17. PICTURE, 2-D Slices Through 3-D CG of MORSE, QAD-CG

    International Nuclear Information System (INIS)

    1994-01-01

    1 - Description of program or function: Picture generates plots of two-dimensional slices through the three-dimensional geometry described by the combinatorial geometry (CG) package used in such codes as MORSE and QAD-CG. These plots are printed on a standard line printer. 2 - Method of solution: Several different ways are available to obtain a two-dimensional slice through the geometry. The geometry ray tracing capability is tested by forcing the geometry package to execute the routines and logic of the Monte Carlo random walk or kernel integration algorithms. 3 - Restrictions on the complexity of the problem: None tested besides those listed in the input descriptions

  18. VAM3D-CG configuration management plan

    International Nuclear Information System (INIS)

    Langford, D.W.

    1994-01-01

    The VAM3D-CG computer code has been licensed for use at Hanford, from HydroGeologic, Inc., of Herndon, VA. Version 2.4b has been installed on the 3200GWW workstations, and is currently under configuration management. The purpose of this report is to describe the installation and configuration management of VAM3D-CG on the Hanford Computer System. VAM3D-CG is written in standard FORTRAN F77

  19. Protective Effects of Bifidobacterium on Intestinal Barrier Function in LPS-Induced Enterocyte Barrier Injury of Caco-2 Monolayers and in a Rat NEC Model.

    Science.gov (United States)

    Ling, Xiang; Linglong, Peng; Weixia, Du; Hong, Wei

    2016-01-01

    Zonulin protein is a newly discovered modulator which modulates the permeability of the intestinal epithelial barrier by disassembling intercellular tight junctions (TJ). Disruption of TJ is associated with neonatal necrotizing enterocolitis (NEC). It has been shown bifidobacterium could protect the intestinal barrier function and prophylactical administration of bifidobacterium has beneficial effects in NEC patients and animals. However, it is still unknown whether the zonulin is involved in the gut barrier dysfunction of NEC, and the protective mechanisms of bifidobacterium on intestinal barrier function are also not well understood. The present study aims to investigate the effects of bifidobacterium on intestinal barrier function, zonulin regulation, and TJ integrity both in LPS-induced enterocyte barrier injury of Caco-2 monolayers and in a rat NEC model. Our results showed bifidobacterium markedly attenuated the decrease in transepithelial electrical resistance and the increase in paracellular permeability in the Caco-2 monolayers treated with LPS (P zonulin release (P zonulin (P zonulin protein release and improvement of intestinal TJ integrity.

  20. [Children with hyperthyroidism due to elevated hCG levels].

    Science.gov (United States)

    Jöbsis, Jasper J; van Trotsenburg, A S Paul; Merks, Johannes H M; Kamp, Gerdine A

    2014-01-01

    We describe two children with hyperthyroidism secondary to elevated hCG levels: one patient with gestational trophoblastic disease and one patient with choriocarcinoma. hCG resembles other glycoproteins that can lead to hyperthyroidism through TSH receptor activation. Also, through its LH-mimicking effect, hCG can induce high oestradiol levels, resulting in stormy pubertal development. False negative hCG tests due to the high-dose hook effect may complicate the diagnostic process. In patients with antibody-negative thyrotoxicosis, the diagnosis of hCG-induced hyperthyroidism must be considered.

  1. Application of {sup 222} Rn as a tracer of groundwater discharge at the coastal zone of Ubatuba, Sao Paulo State, Brazil; Aplicacao de {sup 222} Rn como tracador da descarga de aguas subterraneas na regiao costeira de Ubatuba, Sao Paulo

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Joselene de; Farias, Luciana A.; Mazzilli, Barbara P. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Dept. de Radiometria Ambiental]. E-mail: jolivei@net.ipen.br; Burnett, William C. [Florida State Univ., Tallahassee, FL (United States); Saraiva, Elisabete de S.B. e; Furtado, Valdenir V. [Sao Paulo Univ., SP (Brazil). Inst. Oceanografico. Dept. de Oceanografia Quimica e Geologica

    2002-07-01

    Submarine groundwater discharge (SGD) and recycled seawater can provide chemical constituents to coastal zone, representing an important material flux pathway from land to sea in some areas. Geochemical tracers, like {sup 222} Rn and {sup 226} Ra, are advantageous for regional-scale assessment of SGD, because their signals represent values integrated through the water column that removes small-scale variations. These radionuclides are usually enriched in groundwater compared to seawater, can be measured at very low concentrations and are conservative. This work reports preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil, covering latitudes between 23 deg 26{sup '}S and 23 deg 46{sup '}S and longitudes between 45 deg02{sup '}W and 45 deg 11{sup '}W. The main aims of this research were to set up an analytical method to assess {sup 222} Rn and {sup 226} Ra activities in seawater samples and to apply the excess {sup 222} Rn inventories obtained to estimate the submarine groundwater discharge. Measurements made during 2001/2002 included {sup 222} Rn and {sup 226} Ra in seawater, {sup 222} Rn in sediment, seawater and sediment physical properties. (author)

  2. Proportion hyperglycosylated hCG: a new test for discriminating gestational trophoblastic diseases.

    Science.gov (United States)

    Cole, Laurence A

    2014-11-01

    Hyperglycosylated human chorionic gonadotropin (hCG) is a variant of hCG with large oligosaccharide side chains. Although hCG is produced by syncytiotrophoblast cells, hyperglycosylated hCG marks cytotrophoblast cell. Hyperglycosylated hCG signals placental implantation. Total hCG in serum and urine is measured by the Siemens Immulite hCG pregnancy test; the result is in milli-international unit per milliliter. Hyperglycosylated hCG is determined by the B152 microtiter plate assay; the result is in nanogram per milliliter. Hyperglycosylated hCG results can be converted to milli-international unit per milliliter equivalents by multiplying by 11. The test measures proportion hyperglycosylated hCG, hyperglycosylated hCG / total hCG. Proportion hyperglycosylated hCG marks cases intent on developing persistent hydatidiform mole (68% detection at 17% false detection). Proportion hyperglycosylated hCG also marks persistent hydatidiform mole (100% detection at 5.1% false detection). Proportion hyperglycosylated hCG distinguishes choriocarcinoma and gestational trophoblastic neoplasm cases, absolutely discriminating aggressive cases and minimally aggressive cases. Proportion hyperglycosylated hCG identifies quiescent gestational trophoblastic disease cases. It recognizes quiescent cases that become persistent disease (100% detection at 0% false positive). Proportion hyperglycosylated hCG is an invaluable test for discriminating gestational trophoblastic diseases.

  3. Internalization of Rat FSH and LH/CG Receptors by rec-eCG in CHO-K1 Cells.

    Science.gov (United States)

    Park, Jong-Ju; Seong, Hun-Ki; Kim, Jeong-Soo; Munkhzaya, Byambaragchaa; Kang, Myung-Hwa; Min, Kwan-Sik

    2017-06-01

    Equine chorionic gonadotropin (eCG) is a unique molecule that elicits the response characteristics of both follicle-stimulating hormone (FSH) and luteinizing hormone (LH) in other species. Previous studies from this laboratory had demonstrated that recombinant eCG (rec-eCG) from Chinese hamster ovary (CHO-K1) cells exhibited both FSH- and LH-like activity in rat granulosa and Leydig cells. In this study, we analyzed receptor internalization through rec-eCGs, wild type eCG (eCGβ/α) and mutant eCG (eCGβ/αΔ56) with an N-linked oligosaccharide at Asn 56 of the α-subunit. Both the rec-eCGs were obtained from CHO-K1 cells. The agonist activation of receptors was analyzed by measuring stimulation time and concentrations of rec-eCGs. Internalization values in the stably selected rat follicle-stimulating hormone receptor (rFSHR) and rat luteinizing/chorionic gonadotropin receptor (rLH/CGR) were highest at 50 min after stimulation with 10 ng of rec-eCGβ/α. The dose-dependent response was highest when 10 ng of rec-eCGβ/α was used. The deglycosylated eCGβ/αΔ56 mutant did not enhance the agonist-stimulated internalization. We concluded that the state of activation of rFSHR and rLH/CGR could be modulated through agonist-stimulated internalization. Our results suggested that the eLH/CGRs are mostly internalized within 60 min by agonist-stimulation by rec-eCG. We also suggested that the lack of responsiveness of the deglycosylated eCGβ/ αΔ56 was likely because the site of glycosylation played a pivotal role in agonist-stimulated internalization in cells expressing rFSHR and rLH/CGR.

  4. Clinical effects of CG (Hythiol) tablets on leukopenia resulting from radiotherapy

    International Nuclear Information System (INIS)

    Fukui, Hideki; Sakaguchi, Kokichi; Sekiba, Kaoru

    1984-01-01

    A double-blind comparative study of CG(L-cysteine) tablets and approved drugs (CG capsules) was made to assess clinical effects of CG tablets on leukopenia. The subjects were 75 patients with cancer of the uterine cervix in whom the number of WBC was 4,500-7,500/mm before irradiation. The ratios of patients who kept WBC as 3,500/mm or more were 64.7% in the group with CG tablets and 50% in the group with CG capsules with no statistical significance. The ratios of patients who kept WBC as 3,000/mm or more were 82.4% in the group with CG tablets and 79.4% in the group with CG capsules with no statistical significance. The ratios to prevent leukopenia were 70.6% in the group with CG tablets and 58.8% in the group with CG capsules with no significant difference. Other hematological findings, subjective symptoms and the performance of radiotherapeutic protocol were not different between the groups. No marked side effects were observed. These results suggest that CG tablets, as well as CG capsules, are effective for preventing leukopenia resulting from radiotherapy. (Namekawa, K.)

  5. Kathon CG y Dermatología Laboral: Actualización Kathon CG and Occupational Dermatology: An update

    Directory of Open Access Journals (Sweden)

    Ana Rita Rodrigues Barata

    2012-09-01

    Full Text Available El Kathon CG constituye el nombre comercial de una mezcla de isotiazolinas: Metilcloroisotiazolinona y Metilisotiazolinona. Es un conservante muy utilizado, sobre todo en la industria cosmética, aunque en los últimos años también se ha impuesto su presencia en productos de limpieza de uso doméstico y actualmente a concentraciones más altas en preparados de uso industrial como aceites de corte, emulsiones de látex, pinturas al temple, aceites para motores Diesel, etc. Por su alto poder sensibilizante y amplia utilización, constituye actualmente una de las causas más frecuentes de alergia de contacto por preservativos, tanto en nuestra vida privada, como en el ámbito profesional. Objetivos: Estudiar la capacidad sensibilizante del Kathon CG y su relación con el desarrollo de eczema de contacto alérgico de origen profesional. Métodos: Estudio observacional descriptivo, a través de la revisión de las historias clínicas de los pacientes vistos en el Servicio de Dermatología Laboral del Instituto Nacional de Medicina y Seguridad en el Trabajo durante los años 2008-2012; 1520 pacientes fueron evaluados y estudiados mediante pruebas epicutáneas para descartar una posible dermatosis profesional. Se registraron los casos de sensibilización al Kathon CG y se analizaron las siguientes variables: genero, edad, grupo profesional, localización de las lesiones cutáneas, relevancia y relación profesional. El análisis estadístico se realizó con el programa SPSS 15.0. Resultados: Se observó sensibilización al Kathon CG en 88 pacientes (5,8%, correspondiendo un 42% a sensibilizaciones de origen profesional. Conclusiones: La alergia de contacto profesional por Kathon CG constituye actualmente es un problema de alta prevalencia. Ante un paciente con positividad a este alérgeno hay que interrogar siempre por su profesión.Kathon CG is the tradename for a mixture of isothiazolines: methylchloroisothiazolinone and methylisothiazolinone. It

  6. Declarative Programming with Temporal Constraints, in the Language CG

    Directory of Open Access Journals (Sweden)

    Lorina Negreanu

    2015-01-01

    Full Text Available Specifying and interpreting temporal constraints are key elements of knowledge representation and reasoning, with applications in temporal databases, agent programming, and ambient intelligence. We present and formally characterize the language CG, which tackles this issue. In CG, users are able to develop time-dependent programs, in a flexible and straightforward manner. Such programs can, in turn, be coupled with evolving environments, thus empowering users to control the environment’s evolution. CG relies on a structure for storing temporal information, together with a dedicated query mechanism. Hence, we explore the computational complexity of our query satisfaction problem. We discuss previous implementation attempts of CG and introduce a novel prototype which relies on logic programming. Finally, we address the issue of consistency and correctness of CG program execution, using the Event-B modeling approach.

  7. Declarative Programming with Temporal Constraints, in the Language CG.

    Science.gov (United States)

    Negreanu, Lorina

    2015-01-01

    Specifying and interpreting temporal constraints are key elements of knowledge representation and reasoning, with applications in temporal databases, agent programming, and ambient intelligence. We present and formally characterize the language CG, which tackles this issue. In CG, users are able to develop time-dependent programs, in a flexible and straightforward manner. Such programs can, in turn, be coupled with evolving environments, thus empowering users to control the environment's evolution. CG relies on a structure for storing temporal information, together with a dedicated query mechanism. Hence, we explore the computational complexity of our query satisfaction problem. We discuss previous implementation attempts of CG and introduce a novel prototype which relies on logic programming. Finally, we address the issue of consistency and correctness of CG program execution, using the Event-B modeling approach.

  8. Differences in Signal Activation by LH and hCG are Mediated by the LH/CG Receptor's Extracellular Hinge Region.

    Science.gov (United States)

    Grzesik, Paul; Kreuchwig, Annika; Rutz, Claudia; Furkert, Jens; Wiesner, Burkhard; Schuelein, Ralf; Kleinau, Gunnar; Gromoll, Joerg; Krause, Gerd

    2015-01-01

    The human lutropin (hLH)/choriogonadotropin (hCG) receptor (LHCGR) can be activated by binding two slightly different gonadotropic glycoprotein hormones, choriogonadotropin (CG) - secreted by the placenta, and lutropin (LH) - produced by the pituitary. They induce different signaling profiles at the LHCGR. This cannot be explained by binding to the receptor's leucine-rich-repeat domain (LRRD), as this binding is similar for the two hormones. We therefore speculate that there are previously unknown differences in the hormone/receptor interaction at the extracellular hinge region, which might help to understand functional differences between the two hormones. We have therefore performed a detailed study of the binding and action of LH and CG at the LHCGR hinge region. We focused on a primate-specific additional exon in the hinge region, which is located between LRRD and the serpentine domain. The segment of the hinge region encoded by exon10 was previously reported to be only relevant to hLH signaling, as the exon10-deletion receptor exhibits decreased hLH signaling, but unchanged hCG signaling. We designed an advanced homology model of the hormone/LHCGR complex, followed by experimental characterization of relevant fragments in the hinge region. In addition, we examined predictions of a helical exon10-encoded conformation by block-wise polyalanine (helix supporting) mutations. These helix preserving modifications showed no effect on hormone-induced signaling. However, introduction of a structure-disturbing double-proline mutant LHCGR-Q303P/E305P within the exon10-helix has, in contrast to exon10-deletion, no impact on hLH, but only on hCG signaling. This opposite effect on signaling by hLH and hCG can be explained by distinct sites of hormone interaction in the hinge region. In conclusion, our analysis provides details of the differences between hLH- and hCG-induced signaling that are mainly determined in the L2-beta loop of the hormones and in the hinge

  9. Nuclear Energy Center: upper St. Lawrence region. Part I. Siting. Part II. Fort Drum surrogate site, description and impact assessment. Part III. Dispersed sites impact assessment and comparison with the NEC

    Energy Technology Data Exchange (ETDEWEB)

    Merry, P.A.; Luner, C.; Hong, S.W.; Canham, H.O.; Boggs, J.F.; McCool, T.P.

    1976-12-01

    This report is one of many supporting documents used by the Nuclear Regulatory commission in the preparation of the Nuclear Energy Center Site Survey (NECSS) mandated by Congress. While the overall study focuses on the feasibility and practicability of nuclear energy centers (NECs), this report is directed towards choosing a suitable surrogate site in the upper St. Lawrence region of New York State, assessing the probable impacts associated with construction and operation of the NEC, and comparing these impacts with those associated with small dispersed nuclear power stations. The upper St. Lawrence region is surveyed to identify a specific site that might be suitable for a surrogate NEC. Several assumptions about the basic design of an NEC are delineated, and a general overview of the characteristics of the region is given. The Fort Drum Military Reservation is chosen as a suitable surrogate site. Fort Drum and the surrounding area are described in terms of land use and population patterns, terrestrial and aquatic ecology, water use and quality, meteorology, institutional framework, and socioeconomic structure. The impacts associated with NEC development are assessed. Then the impacts associated with smaller dispersed nuclear power stations located throughout New York State are assessed and compared with the impacts associated with the NEC. Finally, the impacts due to development of the transmission line networks associated with the NEC and with the dispersed power stations are assessed and compared.

  10. Comparative evaluation of antimicrobial activity of three cements: new endodontic cement (NEC), mineral trioxide aggregate (MTA) and Portland.

    Science.gov (United States)

    Hasan Zarrabi, Mohammad; Javidi, Maryam; Naderinasab, Mahboube; Gharechahi, Maryam

    2009-09-01

    Using the agar diffusion method, we conducted an in vitro study to evaluate the antimicrobial activity of mineral trioxide aggregate (MTA), new endodontic cement (NEC) and Portland cement at different concentrations against five different microorganisms. A base layer was made using Muller-Hinton agar for Escherichia coli (ATCC 10538) and Candida (ATCC 10231). For Actinomyces viscosus (ATCC 15987), Enterococcus faecalis (ATCC 10541) and Streptococcus mutans (ATCC 25175) blood agar medium was used. Wells were formed by removing the agar, and the materials were placed in the well immediately after manipulation. The plates were kept at room temperature for 2 h for prediffusion, and then incubated at 37 degrees C for 72 h. The inhibition zones were then measured. The data were analyzed using ANOVA and the Tukey test to compare the differences among the three cements at different concentrations. The positive controls showed bacterial growth, while the negative controls showed no bacterial growth. All materials showed antimicrobial activity against the tested strains except for Enterococcus faecalis. NEC created larger inhibition zones than MTA and Portland cement. This difference was significant for Portland cement (P 0.05). Among the examined microorganisms, the largest inhibition zone was observed for Actinomyces group (P < 0.05). The antimicrobial activity of the materials increased with time and concentration (P < 0.05). It was concluded that NEC is a potent inhibitor of microorganism growth.

  11. Differences in Signal Activation by LH and hCG are Mediated by the LH/CG Receptor’s Extracellular Hinge Region

    Science.gov (United States)

    Grzesik, Paul; Kreuchwig, Annika; Rutz, Claudia; Furkert, Jens; Wiesner, Burkhard; Schuelein, Ralf; Kleinau, Gunnar; Gromoll, Joerg; Krause, Gerd

    2015-01-01

    The human lutropin (hLH)/choriogonadotropin (hCG) receptor (LHCGR) can be activated by binding two slightly different gonadotropic glycoprotein hormones, choriogonadotropin (CG) – secreted by the placenta, and lutropin (LH) – produced by the pituitary. They induce different signaling profiles at the LHCGR. This cannot be explained by binding to the receptor’s leucine-rich-repeat domain (LRRD), as this binding is similar for the two hormones. We therefore speculate that there are previously unknown differences in the hormone/receptor interaction at the extracellular hinge region, which might help to understand functional differences between the two hormones. We have therefore performed a detailed study of the binding and action of LH and CG at the LHCGR hinge region. We focused on a primate-specific additional exon in the hinge region, which is located between LRRD and the serpentine domain. The segment of the hinge region encoded by exon10 was previously reported to be only relevant to hLH signaling, as the exon10-deletion receptor exhibits decreased hLH signaling, but unchanged hCG signaling. We designed an advanced homology model of the hormone/LHCGR complex, followed by experimental characterization of relevant fragments in the hinge region. In addition, we examined predictions of a helical exon10-encoded conformation by block-wise polyalanine (helix supporting) mutations. These helix preserving modifications showed no effect on hormone-induced signaling. However, introduction of a structure-disturbing double-proline mutant LHCGR-Q303P/E305P within the exon10-helix has, in contrast to exon10-deletion, no impact on hLH, but only on hCG signaling. This opposite effect on signaling by hLH and hCG can be explained by distinct sites of hormone interaction in the hinge region. In conclusion, our analysis provides details of the differences between hLH- and hCG-induced signaling that are mainly determined in the L2-beta loop of the hormones and in the

  12. 42 CFR 93.222 - Research.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Research. 93.222 Section 93.222 Public Health... STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT Definitions § 93.222 Research. Research means a systematic experiment, study, evaluation...

  13. Differences in signal activation by LH and hCG are mediated by the LH/CG receptor`s extracellular hinge region

    Directory of Open Access Journals (Sweden)

    Paul eGrzesik

    2015-09-01

    Full Text Available The human lutropin/choriogonadotropin receptor (LHCGR can be activated by binding two slightly different gonadotropic glycoprotein hormones, choriogonadotropin (CG - secreted by the placenta, and lutropin (LH - produced by the pituitary. They induce different signaling profiles at the LHCGR. This cannot be explained by binding to the receptor's leucine-rich repeat domain (LRRD, as this binding is similar for the two hormones. We therefore speculate that there are previously unknown differences in the hormone/receptor interaction at the extracellular hinge region, which might help to understand functional differences between the two hormones. We have therefore performed a detailed study of the binding and action of LH and CG at the LHCGR hinge region. We focused on a primate-specific additional exon in the hinge region, which is located between LRRD and the serpentine domain. The segment of the hinge region encoded by exon10 was previously reported to be only relevant to hLH signaling, as the exon10-deletion receptor exhibits decreased hLH signaling, but unchanged hCG signaling. We designed an advanced homology model of the hormone/LHCGR complex, followed by experimental characterization of relevant fragments in the hinge region. In addition, we examined predictions of a helical exon10-encoded conformation by block-wise polyalanine (helix supporting mutations. These helix preserving modifications showed no effect on hormone induced signaling. However, introduction of a structure-disturbing double-proline mutant LHCGR-Q303P/E305P within the exon10-helix has, in contrast to exon10 deletion, no impact on hLH, but only on hCG signaling. This opposite effect on signaling by hLH and hCG can be explained by distinct sites of hormone interaction in the hinge region s. In conclusion, our analysis provides details of the differences between hLH- and hCG-induced signaling that are mainly determined in the L2-beta loop of the hormones and in the hinge region

  14. Diagnostic usefulness of CT attenuation coefficients of urine after enteral administration of iodinated water (iohexol) in neonates with NEC

    International Nuclear Information System (INIS)

    Moon, Jeung Hee; Yun, Eun Joo; Yoon, Dae Young

    2006-01-01

    We wanted to evaluate the clinical efficacy of an increased computed tomography attenuation coefficient (CTAC) of urine after the oral administration of iohexol in neonates who are suspected of suffering with neonatal necrotizing enterocolitis (NEC). During a recent 1 year-period, seventeen neonates were admitted for suspected NEC, and they were divided into the suspected and definite groups based on their clinical signs and radiographic findings; we also included ten normal neonates as the control group. Diluted iohexol was administered and the CTACs of collected urine samples at 8-12 hour intervals were measured. Comparative analysis of the three groups was done and statistical significance was determined by the Scheffe test. Among 17 neonates, there were 13 neonates in the suspect group and 4 neonates in the definite group. The mean CTACs of urine in each group were 2711 HU (control group), 3411 HU (suspected group), and 7625 HU (definite group), respectively. There was a significant difference between the mean CTAC of the definite group and that of the control or suspected groups (Scheffe t >2.65). However, no statistically significant difference was seen between the suspected and control groups (Scheffe t=1.14). Although measurements of the CTAC of urine showed no significant diagnostic efficacy in the suspected group, the CTAC of urine, which reflects the correlated degree of bowel mucosal injury, can be a useful aid for determining the severity and progression of NEC

  15. 20 CFR 222.1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 222.1 Section 222.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS General § 222.1 Introduction. This part sets forth and describes the family relationships that may make a...

  16. Kinderen met hyperthyreoïdie door verhoogd hCG

    NARCIS (Netherlands)

    Jöbsis, Jasper J.; van Trotsenburg, A. S. Paul; Merks, Johannes H. M.; Kamp, Gerdine A.

    2014-01-01

    We describe two children with hyperthyroidism secondary to elevated hCG levels: one patient with gestational trophoblastic disease and one patient with choriocarcinoma. hCG resembles other glycoproteins that can lead to hyperthyroidism through TSH receptor activation. Also, through its LH-mimicking

  17. hCG Test (Pregnancy Test)

    Science.gov (United States)

    ... Acidosis and Alkalosis Adrenal Insufficiency and Addison Disease Alcoholism Allergies Alzheimer Disease Anemia Angina Ankylosing Spondylitis Anthrax ... Patient Resources For Health Professionals Subscribe Search hCG Pregnancy Send Us Your Feedback Choose Topic At a ...

  18. Dicty_cDB: SLH222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH222 (Link to dictyBase) - - - Contig-U16475-1 SLH222Z (Link... to Original site) - - SLH222Z 433 - - - - Show SLH222 Library SL (Link to library) Clone ID SLH222 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH222Q.Seq.d/ Representative seq. ID SLH22...2Z (Link to Original site) Representative DNA sequence >SLH222 (SLH222Q) /CSM/SL/SLH2-A/SLH222Q.Seq.d/ XXXXX...603Q.Seq.d/ 728 0.0 SLI537 (SLI537Q) /CSM/SL/SLI5-B/SLI537Q.Seq.d/ 728 0.0 SLH222 (SLH222Q) /CSM/SL/SLH2

  19. Ultrasensitive immunoradiometric assay for chorionic gonadotropin which does not cross-react with luteinizing hormone nor free β chain of hCG and which detects hCG in blood of non-pregnant humans

    International Nuclear Information System (INIS)

    Griffin, J.; Odell, W.D.

    1987-01-01

    A sensitive, non-competitive, two-monoclonal antibody, sandwich-type or immunoradiometric assay has been developed for human chorionic gonadotropin (hCG) which shows no cross-reaction with the free β chain of hCG nor with human luteinizing hormone (LH). In the assay procedure, two, highly selected monoclonal antibodies reacted in solution with hCG to be quantified. One antibody was covalently conjugated to biotin. This antibody was specific for the β subunit of hCG, and showed no reaction with LH nor the α subunit. The second antibody was labelled with 125 I and was specific for intact hCG and LH, showing no cross-reaction with βhCG nor the α subunit. The separation system was a polystyrene ball conjugated with biotin. This ball bound via an avidin bridge the monoclonal 'sandwich' containing hCG. Counts per minute bound to the ball were directly proportional to the amount of hCG present. The assay was specific for whole hCG and showed no reaction with βhCG, βLH, intact LH nor the free α subunit. Sensitivity was adequate to detect 'hCG-like' material in all post menopausal women and, when single samples were obtained, in over 2/3 of normal men. When multiple samples were obtained, 'hCG-like' material was detectable in all eugonadal adults studied. 27 refs.; 4 figs.; 1 table

  20. The Association Between LH Serum Levels at the time of hCG Injection and Clinical Pregnancy during IVF

    Directory of Open Access Journals (Sweden)

    Budi Wiweko

    2015-12-01

    Desember 2009 di klinik Yasmin, Rumah Sakit dr. Cipto Mangunkusumo, Jakarta. Protokol hiperstimulasi ovarium yang digunakan adalah agonis gonadotropin-releasing hormone (GnRH dan r-FSH. Kadar LH serum diukur pada hari pemberian hCG dan outcome penelitian yang dievaluasi adalah kehamilan klinis. Kehamilan terjadi pada 32 siklus FIV dari 136 siklus (23,5%. Terdapat  perbedaan bermakna antara kadar serum LH pada hari penyuntikan hCG dengan kehamilan klinis (p = 0,036. Titik potong kadar serum LH ≥1,050IU/l adalah nilai terbaik untuk memprediksi hasil kehamilan dengan sensitivitas 62,5%, 59,4% spesifisitas, nilai prediksi 83,3% positif, dan nilai prediksi 32,76% negatif. Disimpulkan bahwa terdapat hubungan antara kadar serum LH pada hari penyuntikan hCG dengan kehamilan klinis selama FIV. Kata kunci: siklus IVF, kadar LH serum, pemberian hCG Normal 0 false false false EN-US X-NONE X-NONE <w:LsdException Locked="false" Priority="50" Name="Grid Table 5 Dark Accent 1

  1. 12 CFR 222.2 - Examples.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Examples. 222.2 Section 222.2 Banks and Banking... (REGULATION V) General Provisions § 222.2 Examples. The examples in this part are not exclusive. Compliance with an example, to the extent applicable, constitutes compliance with this part. Examples in a...

  2. 2607-W6 sanitary drainfield replacement

    International Nuclear Information System (INIS)

    Simmons, F.M.

    1994-05-01

    The septic 2607-W6 which supports the 222-S complex is operating at 200% capacity. The septic tank has been inspected and found to be sound. Test hole excavations of the existing drainfield indicate that it is disposing of the current waste water effluent load as opposed to treating it. The system is over 40 years old and has not been approved by the Washington State Department of Health. Under the existing operating conditions it is subject to imminent failure. No additional tie-ins or increases in personnel are allowed which will increase the flow to the 2607-W6 system

  3. 29 CFR 22.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Definitions. 22.2 Section 22.2 Labor Office of the Secretary of Labor PROGRAM FRAUD CIVIL REMEDIES ACT OF 1986 § 22.2 Definitions. (a) ALJ means an Administrative... accounting or bookkeeping entry made— (1) With respect to a claim or to obtain the approval or payment of a...

  4. Review: hCG, Preeclampsia and Regulatory T cells

    OpenAIRE

    Norris, Wendy; Nevers, Tania; Sharma, Surendra; Kalkunte, Satyan

    2011-01-01

    Human chorionic gonadotropin (hCG) is crucial for successful pregnancy. Its many functions include angiogenesis and immune regulation. Despite years of research, the etiology of preeclampsia remains unknown. Marked by insufficient trophoblast invasion and poor spiral artery remodeling, preeclampsia has also been linked to immune dysregulation. Here we discuss the roles of hCG in the context of endovascular cross-talk between trophoblasts and endothelial cells and immune tolerance. We propose ...

  5. Subpart W: National Emission Standards for Radon Emissions From Operating Mill Tailings

    Science.gov (United States)

    Subpart W limits the radon-222 emissions rate from uranium tailings piles to 20 picocuries per square meter per second and requires that new tailings impoundments meet certain work practice standards.

  6. Quantum mechanics/coarse-grained molecular mechanics (QM/CG-MM).

    Science.gov (United States)

    Sinitskiy, Anton V; Voth, Gregory A

    2018-01-07

    Numerous molecular systems, including solutions, proteins, and composite materials, can be modeled using mixed-resolution representations, of which the quantum mechanics/molecular mechanics (QM/MM) approach has become the most widely used. However, the QM/MM approach often faces a number of challenges, including the high cost of repetitive QM computations, the slow sampling even for the MM part in those cases where a system under investigation has a complex dynamics, and a difficulty in providing a simple, qualitative interpretation of numerical results in terms of the influence of the molecular environment upon the active QM region. In this paper, we address these issues by combining QM/MM modeling with the methodology of "bottom-up" coarse-graining (CG) to provide the theoretical basis for a systematic quantum-mechanical/coarse-grained molecular mechanics (QM/CG-MM) mixed resolution approach. A derivation of the method is presented based on a combination of statistical mechanics and quantum mechanics, leading to an equation for the effective Hamiltonian of the QM part, a central concept in the QM/CG-MM theory. A detailed analysis of different contributions to the effective Hamiltonian from electrostatic, induction, dispersion, and exchange interactions between the QM part and the surroundings is provided, serving as a foundation for a potential hierarchy of QM/CG-MM methods varying in their accuracy and computational cost. A relationship of the QM/CG-MM methodology to other mixed resolution approaches is also discussed.

  7. Quantum mechanics/coarse-grained molecular mechanics (QM/CG-MM)

    Science.gov (United States)

    Sinitskiy, Anton V.; Voth, Gregory A.

    2018-01-01

    Numerous molecular systems, including solutions, proteins, and composite materials, can be modeled using mixed-resolution representations, of which the quantum mechanics/molecular mechanics (QM/MM) approach has become the most widely used. However, the QM/MM approach often faces a number of challenges, including the high cost of repetitive QM computations, the slow sampling even for the MM part in those cases where a system under investigation has a complex dynamics, and a difficulty in providing a simple, qualitative interpretation of numerical results in terms of the influence of the molecular environment upon the active QM region. In this paper, we address these issues by combining QM/MM modeling with the methodology of "bottom-up" coarse-graining (CG) to provide the theoretical basis for a systematic quantum-mechanical/coarse-grained molecular mechanics (QM/CG-MM) mixed resolution approach. A derivation of the method is presented based on a combination of statistical mechanics and quantum mechanics, leading to an equation for the effective Hamiltonian of the QM part, a central concept in the QM/CG-MM theory. A detailed analysis of different contributions to the effective Hamiltonian from electrostatic, induction, dispersion, and exchange interactions between the QM part and the surroundings is provided, serving as a foundation for a potential hierarchy of QM/CG-MM methods varying in their accuracy and computational cost. A relationship of the QM/CG-MM methodology to other mixed resolution approaches is also discussed.

  8. 222Rn in the Antarctic Peninsula during 1986

    International Nuclear Information System (INIS)

    Pereira, E.B.; Setzer, A.W.; Cavalcanti, I.F.A.

    1988-01-01

    222 Rn was continuously measured at the Brazilian Antarctic Station (62 0 S, 58 0 W) during the year of 1986. Baseline radon concentration averaged 0.02 Bq.m -3 with surges peaking 0.4 Bq.m -3 . The data exhibited a characteristic periodicity of about 25 days and a strong positive association with short term fluctuations of atmospheric temperature. No seasonal variations of radon were observed. Interpretation of the radon surges with reference to synoptic charts and weather satellite pictures showed that the continental influence of radon at the Antarctic Peninsula is very small and comes only from the tip of the South American cone. (author)

  9. 39 CFR 222.3 - Other delegation.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Other delegation. 222.3 Section 222.3 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION DELEGATIONS OF AUTHORITY § 222.3 Other delegation. (a) Documentation. All delegations of authority must be officially documented. (b...

  10. 1 CFR 22.2 - Authority citation.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Authority citation. 22.2 Section 22.2 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL, AND PROCESSING OF DOCUMENTS PREPARATION OF NOTICES AND PROPOSED RULES Notices § 22.2 Authority citation. The authority under...

  11. Extending the QUDA Library with the eigCG Solver

    Energy Technology Data Exchange (ETDEWEB)

    Strelchenko, Alexei [Fermilab; Stathopoulos, Andreas [William-Mary Coll.

    2014-12-12

    While the incremental eigCG algorithm [ 1 ] is included in many LQCD software packages, its realization on GPU micro-architectures was still missing. In this session we report our experi- ence of the eigCG implementation in the QUDA library. In particular, we will focus on how to employ the mixed precision technique to accelerate solutions of large sparse linear systems with multiple right-hand sides on GPUs. Although application of mixed precision techniques is a well-known optimization approach for linear solvers, its utilization for the eigenvector com- puting within eigCG requires special consideration. We will discuss implementation aspects of the mixed precision deflation and illustrate its numerical behavior on the example of the Wilson twisted mass fermion matrix inversions

  12. Functional reconstitution into liposomes of purified human RhCG ammonia channel.

    Directory of Open Access Journals (Sweden)

    Isabelle Mouro-Chanteloup

    Full Text Available BACKGROUND: Rh glycoproteins (RhAG, RhBG, RhCG are members of the Amt/Mep/Rh family which facilitate movement of ammonium across plasma membranes. Changes in ammonium transport activity following expression of Rh glycoproteins have been described in different heterologous systems such as yeasts, oocytes and eukaryotic cell lines. However, in these complex systems, a potential contribution of endogenous proteins to this function cannot be excluded. To demonstrate that Rh glycoproteins by themselves transport NH(3, human RhCG was purified to homogeneity and reconstituted into liposomes, giving new insights into its channel functional properties. METHODOLOGY/PRINCIPAL FINDINGS: An HA-tag introduced in the second extracellular loop of RhCG was used to purify to homogeneity the HA-tagged RhCG glycoprotein from detergent-solubilized recombinant HEK293E cells. Electron microscopy analysis of negatively stained purified RhCG-HA revealed, after image processing, homogeneous particles of 9 nm diameter with a trimeric protein structure. Reconstitution was performed with sphingomyelin, phosphatidylcholine and phosphatidic acid lipids in the presence of the C(12E(8 detergent which was subsequently removed by Biobeads. Control of protein incorporation was carried out by freeze-fracture electron microscopy. Particle density in liposomes was a function of the Lipid/Protein ratio. When compared to empty liposomes, ammonium permeability was increased two and three fold in RhCG-proteoliposomes, depending on the Lipid/Protein ratio (1/300 and 1/150, respectively. This strong NH(3 transport was reversibly inhibited by mercuric and copper salts and exhibited a low Arrhenius activation energy. CONCLUSIONS/SIGNIFICANCE: This study allowed the determination of ammonia permeability per RhCG monomer, showing that the apparent Punit(NH3 (around 1x10(-3 microm(3xs(-1 is close to the permeability measured in HEK293E cells expressing a recombinant human RhCG (1.60x10

  13. SDS-PAGE Electrophoretic Property of Human Chorionic Gonadotropin (hCG) and its β-subunit

    OpenAIRE

    Gam, Lay-Harn; Latiff, Aishah

    2005-01-01

    The microheterogeneity property of hCG with regards to its sialic acid contents resulted in variable mobility of the glycoprotein in SDS-PAGE. The intact hCG molecule is composed of two dissimilar subunits, namely α- and β-subunits. The identification of hCG bands in SDS-PAGE was accomplished by the immunoblotting experiment, whereby the antibody directed toward the specific region of β-subunit of hCG was used. The data shows that the different mobility of intact hCG was attributed to the dif...

  14. Decreased levels of genuine large free hCG alpha in men presenting with abnormal semen analysis

    Directory of Open Access Journals (Sweden)

    Plas Eugen

    2011-08-01

    Full Text Available Abstract Background The pregnancy hormone human chorionic gonadotropin (hCG and its free subunits (hCG alpha, hCG beta are produced in the male reproductive tract and found in high concentrations in seminal fluid, in particular hCG alpha. This study aimed to elucidate changes in peptide hormone profiles in patients showing abnormal semen analyses and to determine the genuineness of the highly abundant hCG alpha. Methods Seminal plasma was obtained from 45 male patients undergoing semen analysis during infertility workups. Comprehensive peptide hormone profiles were established by a panel of immunofluorometric assays for hCG, hCG alpha, hCG beta and its metabolite hCG beta core fragment, placental lactogen, growth hormone and prolactin in seminal plasma of patients with abnormal semen analysis results (n = 29 versus normozoospermic men (n = 16. The molecular identity of large hyperglycosylated hCG alpha was analyzed by mass-spectrometry and selective deglycosylation. Results hCG alpha levels were found to be significantly lower in men with impaired semen quality (1346 +/- 191 vs. 2753 +/- 533 ng/ml, P = 0.022. Moreover, patients with reduced sperm count had reduced intact hCG levels compared with normozoospermic men (0.097 +/- 0.022 vs. 0.203 +/- 0.040 ng/ml, P = 0.028. Using mass-spectrometry, the biochemical identity of hCG alpha purified from seminal plasma was verified. Under non-reducing conditions in SDS-PAGE, hCG alpha isolated from seminal plasma migrated in a manner comparable with large free hCG alpha with an apparent molecular mass (Mr, app of 24 kDa, while hCG alpha dissociated from pregnancy-derived holo-hCG migrated at approximately 22 kDa. After deglycosylation with PNGase F under denaturing conditions, all hCG alpha variants showed an Mr, app of 15 kDa, indicating identical amino acid backbones. Conclusions The findings indicate a pathophysiological relevance of hCG, particularly its free alpha subunit, in spermatogenesis. The

  15. Inferring 222Rn soil fluxes from ambient 222Rn activity and eddy covariance measurements of CO2

    Directory of Open Access Journals (Sweden)

    S. van der Laan

    2016-11-01

    Full Text Available We present a new methodology, which we call Single Pair of Observations Technique with Eddy Covariance (SPOT-EC, to estimate regional-scale surface fluxes of 222Rn from tower-based observations of 222Rn activity concentration, CO2 mole fractions and direct CO2 flux measurements from eddy covariance. For specific events, the regional (222Rn surface flux is calculated from short-term changes in ambient (222Rn activity concentration scaled by the ratio of the mean CO2 surface flux for the specific event to the change in its observed mole fraction. The resulting 222Rn surface emissions are integrated in time (between the moment of observation and the last prior background levels and space (i.e. over the footprint of the observations. The measurement uncertainty obtained is about ±15 % for diurnal events and about ±10 % for longer-term (e.g. seasonal or annual means. The method does not provide continuous observations, but reliable daily averages can be obtained. We applied our method to in situ observations from two sites in the Netherlands: Cabauw station (CBW and Lutjewad station (LUT. For LUT, which is an intensive agricultural site, we estimated a mean 222Rn surface flux of (0.29 ± 0.02 atoms cm−2 s−1 with values  > 0.5 atoms cm−2 s−1 to the south and south-east. For CBW we estimated a mean 222Rn surface flux of (0.63 ± 0.04 atoms cm−2 s−1. The highest values were observed to the south-west, where the soil type is mainly river clay. For both stations good agreement was found between our results and those from measurements with soil chambers and two recently published 222Rn soil flux maps for Europe. At both sites, large spatial and temporal variability of 222Rn surface fluxes were observed which would be impractical to measure with a soil chamber. SPOT-EC, therefore, offers an important new tool for estimating regional-scale 222Rn surface fluxes. Practical applications furthermore include

  16. Scyntygrafia kości w diagnostyce reumatoidalnego zapalenia stawów

    Directory of Open Access Journals (Sweden)

    Witold Tłustochowicz

    2010-04-01

    Full Text Available Celem pracy była ocena przydatności trójfazowej dynamicznejscyntygrafii kości w diagnostyce reumatoidalnego zapalenia stawów.Badaniem objęto 39 chorych hospitalizowanych i diagnozowanychz powodu dolegliwości stawowych. Przeprowadzono diagnostykęobejmującą: badanie podmiotowe, przedmiotowe, badania laboratoryjneoraz obrazowe, w tym trójfazową scyntygrafię kości z użyciemtechnetu 99m. Scyntygraficzne cechy zapalenia stawówstwierdzano, gdy obserwowano wzmożone gromadzenie znacznikawe wszystkich trzech fazach badania.Po ukończeniu diagnostyki rozpoznano u 13 chorych wczesne reumatoidalnezapalenie stawów, u 4 reumatoidalne zapalenie stawów(łącznie 17 pacjentów, a u 1 niezróżnicowane zapalenie stawów.Scyntygrafia kości wykazała cechy zapalenia stawów u 13spośród nich (72,2%, u 4 osób (22,2% wzmożone gromadzeniestwierdzono tylko w fazie statycznej, a u 1 pacjenta (5,6% uzyskanoprawidłowy wynik badania. U 21 chorych wykluczono chorobęzapalną stawów (u 19 rozpoznano fibromialgię, u 2 chorobęzwyrodnieniową. W grupie bez zapalenia stawów u 14 pacjentów(66,6% nie stwierdzono istotnych nieprawidłowości w obraziescyntygraficznym, u 6 (28,6% występowało wzmożone gromadzenieznacznika w badaniu statycznym, a u 1 chorego (4,8% opisanoscyntygraficzne cechy zapalenia stawów.Wbadanej grupie czułość scyntygrafii dynamicznej kości w wykrywaniuzapalenia stawów wynosiła 72,2% (95% CI: 57,5–76,8, a swoistość 95,2% (95% CI: 82,8–99,1. Dodatni wynik badaniadynamicznego wskazuje z dużym prawdopodobieństwem naobecność zapalenia stawów [PPV 92,9% (95% CI: 74,2–98,7].Mniej wiarygodny był ujemny wynik badania [NPV 80% (95% CI:69,5–83,3]. Wyniki niniejszej pracy wskazują, że trójfazowa scyntygrafia dynamicznakości może mieć zastosowanie w diagnostyce reumatoidalnegozapalenia stawów.

  17. 29 CFR 553.222 - Sleep time.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Sleep time. 553.222 Section 553.222 Labor Regulations... Enforcement Employees of Public Agencies Tour of Duty and Compensable Hours of Work Rules § 553.222 Sleep time... enforcement personnel in accordance with section 7(a)(1) of the Act, the public agency may exclude sleep time...

  18. Radioimmunoassay and evaluation for serum SIgA and CG of the hepatopathy patients

    International Nuclear Information System (INIS)

    Liu Junchi; Du Shujun; Lu Jun; Tang Xiaolin; Mao Shaorong

    1995-01-01

    Serum SIgA and CG of 247 hepatopathy (male 140, female 99) are radioimmunoassayed. The Clinical Significance of SIgA, CG for hepatisms is evaluated. The results show that the assay of SIgA, CG has an important significance for the doctor to choose the treatment plans and determine the prognosis

  19. Coast Guard Enterprise Project Management (CG-EPM)

    Data.gov (United States)

    Department of Homeland Security — CG-EPM provides the following capabilities: A Project Center, Portfolio Analysis Tools, Project Planning Tool, Web-based Project Plan Updater, Project Collaboration...

  20. Contribution of 222Rn in domestic water supplies to 222Rn in indoor air in Colorado homes

    International Nuclear Information System (INIS)

    Lawrence, E.P.; Wanty, R.B.; Nyberg, P.

    1992-01-01

    The contribution of 222Rn from domestic water wells to indoor air was investigated in a study of 28 houses near Conifer, CO. Air concentrations determined by alpha-track detectors (ATDs) and continuous radon monitors were compared with the predictions of a single-cell model. In many of the houses, the water supply was shown to contribute significantly to levels of indoor 222Rn. The data from the ATD study were augmented with a continuous monitoring study of a house near Lyons, CO. The well water in that house has the highest known concentration of 222Rn in water yet reported (93 MBq m-3). The temporal pattern in the indoor 222Rn concentration corresponds to water-use records. In general, it is difficult to quantify the proportion of indoor radon attributable to water use. Several lines of evidence suggest that the single-cell model underestimates this proportion. Continuous-monitoring data, although useful, are impractical due to the cost of the equipment. We propose a protocol for 222Rn measurement based on three simultaneous integrating radon detectors that may help estimate the proportion of indoor 222Rn derived from the water supply

  1. 20 CFR 222.12 - Ceremonial marriage relationship.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Ceremonial marriage relationship. 222.12 Section 222.12 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.12 Ceremonial marriage...

  2. 18 CFR 284.222 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.222 Section 284.222 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Blanket Certificates Authorizing Certain Transportation by Interstate Pipelines on Behalf of Others and...

  3. Data of evolutionary structure change: 1CG5B-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 0 C 2QU0C DLHAHKLRVDPence>...0 C 2QU0C FPHFD--LSHGSence...1CG5B-2QU0C 1CG5 2QU0 B C VKLSEDQEHYIKGVWKDVD--HKQITAKALERVFVVYPW... 1CG5 B 1CG5B ence>WKDVD--HKQIT... 384 THR CA 441 2QU0 C 2QU

  4. Data of evolutionary structure change: 1CG5B-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available Chain>A 2QU0A ence>AWGKVGGNAGAYence> 2QU0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG5B-2QU0A 1CG5 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...dex>0 1CG5 B 1CG5B

  5. Data of evolutionary structure change: 1CG8B-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG8B-2QU0A 1CG8 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...> 1CG8 B 1CG8B ence>VWKDV--DHKQI...ine> ILE CA 383 2QU0 A 2QU

  6. Seasonal variation of 222Rn in seawater samples from Ubatuba embayments, SP, Brazil, for the assessment of submarine groundwater discharge

    International Nuclear Information System (INIS)

    Lopes, Patricia da Costa

    2005-01-01

    We describe here an application of excess 222 Rn to estimate SGD in a series of small embayments of Ubatuba, Sao Paulo State, Brazil, covering latitudes between 23 deg 26'S and 23 deg 46'S and longitudes between 45 deg 02'W e 45 deg 11'W. Excess 222 Rn inventories obtained in 24 vertical profiles established from March/03 to July/05 varied from 345 ±±24 to 18,700 ± 4,900 dpm/m 2 . The highest inventories of excess 222 Rn were observed both in Flamengo and Fortaleza embayments, during summer campaigns (rainy season). The estimated total fluxes required to support inventories measured varied from 62 ± 4 to 3,385 +- 880 dpm/m 2 d. Considering these results, the SGD advective rates necessary to balance the fluxes calculated in Ubatuba embayments ranged from 0.1 x 10 -1 to 1.9 cm/d. Taking into account all SGD fluxes obtained, the percentual variability was 89% (seasonal variation in 3 years period, n = 24 measurements). Although, if we consider each year of study separately, the respective percentual variabilities estimated are 72% in 2003 (n = 10 measurements), 127% in 2004 (n = 6 measurements) and 97% in 2005 (n = 8 measurements). (author)

  7. 50 CFR 222.404 - Observer program sampling.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Observer program sampling. 222.404 Section 222.404 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... Requirement § 222.404 Observer program sampling. (a) During the program design, NMFS would be guided by the...

  8. Vaginal Fluid hCG Levels for Detecting Premature Rupture of Membranes

    Directory of Open Access Journals (Sweden)

    T. Artimani

    2004-04-01

    Full Text Available The aim of this study was to determine whether there is any different in hCG levels of vaginal fluids from normal pregnant women, women with confirmed PROM and with suspected PROM. After irrigating the posterior vaginal fornix with 3 ml of sterile saline and procuring vaginal washing , we measured hCG levels. Samples were analyzed from 38 normal pregnant women , 31 women with confirmed PROM , 28 women with suspected PROM. The mean of vaginal fluid hCG levels of normal pregnant women were 11.2 (0.00-98.6 mIu/ml. That of women with PROM was 140.2 (0.5 , 390.1 and that of women with suspected PROM was 21.5 (0.0 , 143.9. Sensivity was 80%, specility 83% , positive predictive value 73.7% , negative predictive value 88.1% , using a cut-value 20. It was concluded that the hCG level in vaginal fluid is a marker of PROM during third trimester.

  9. Negative βhCG and Molar Pregnancy: The Hook Effect

    Directory of Open Access Journals (Sweden)

    Isabel Lobo Antunes

    2017-09-01

    Full Text Available Molar pregnancy, included in gestational trophoblastic disease, is a benign pathology with ability to metastasize, usually occurring with excessively high βhCG levels. Clinical scenario is usually a woman in extremes of reproductive age presenting with amenorrhoea, pain and vaginal blood loss; signs derived from high βhCG levels may be present (hyperthyroidism, hyperemesis. Diagnosis is based on a positive pregnancy test – usually a qualitative urinary test. The limitation of this test results from its inability to become positive in presence of markedly high levels of βhCG, saturating the antigens used – known as the ‘hook effect’. With the widespread use of gynaecological ultrasound cases of molar pregnancy have been diagnosed in timely fashion. We describe a case referred as a degenerating fibroid, with a negative urinary pregnancy test. Transvaginal ultrasound was highly suggestive of molar pregnancy, which was confirmed with a quantitative βhCG test, allowing for timely treatment. The importance of a high index of suspicion for this pathology is tremendous to avoid the devastating consequences of a delayed diagnosis.

  10. Postmenopausal pregnancy? Evaluation of elevated hCG in a 59-year-old woman.

    Science.gov (United States)

    Basham, Mary Margaret; Bryan, Teresa

    2017-06-05

    Slightly elevated serum human chorionic gonadotropin (hCG) can be a normal finding in postmenopausal women. We report a case of a 59-year-old woman with a history of abnormal uterine bleeding who presented with a concern for pregnancy after developing nausea and vomiting a few weeks after unprotected intercourse. Although pregnancy was extremely unlikely, hCG was obtained in order to reassure the patient since she reported that her mother conceived at the age of 60. Serum hCG was positive, prompting concern for malignancy versus pregnancy. Stable serum hCG levels, elevated follicle-stimulating hormone and negative transvaginal ultrasound ruled out both malignancy and pregnancy. Positive serum pregnancy test and hCG elevation was attributed to normal postmenopausal state. © BMJ Publishing Group Ltd (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  11. Radon-222 and beryllium-7 as natural tracer; Radon-222 und Beryllium-7 als natuerliche Tracer

    Energy Technology Data Exchange (ETDEWEB)

    Frank, G.; Steinkopff, T. [Deutscher Wetterdienst, Offenbach (Germany). Radioaktivitaetsueberwachung; Salvamoser, J. [Institut fuer Angewandte Isotopen-, Gas- und Umweltuntersuchungen (IGU), Woerthsee (Germany)

    2016-07-01

    The Global Atmosphere Watch Program (GAW) is intended to analyse worldwide the influence of anthropogenic emissions to the atmosphere. Data are continuously transferred to the ''World Data Centre for Green House Gases'' of the WMO. For the study of atmospheric transports the natural radionuclides Rn-222, Be-7, Pb-210, Pb- 214 and Bi-214 are continuously measured at the Umweltforschungsstation Schneefernerhaus (2650 m) and at the Zugspitze (2962 m) by the Deutscher Wetterdienst (DWD, German Weather Service). The measurements support the classification of atmospheric transport, atmospheric dilution and dispersion models of gaseous and aerosol bond micro pollutants. Results are carried out in combination with meteorological data. It is shown the optimization and effect of a new sampling site for the measurement of Rn-222 activity at the Zugspitze. Results of Rn-222 and Be-7 concentrations are shown in relation to horizontal and vertical dispersion of air masses. The origin of natural Rn-222 and Be-7 are known, therefore both nuclides are well suited for the research of atmospheric transport. Rn-222 is an ideal tracer, because there is no influence by atmospheric processes (chemical processes, wash out effects).

  12. Early oral-motor management on feeding performance in premature neonates

    Directory of Open Access Journals (Sweden)

    Yan-Lin Liu

    2013-03-01

    Conclusion: Abnormal brain sonography [odds ratio (OR: 2.222, p = 0.047 and necrotizing enterocolitis (NEC (OR: 2.857, p = 0.017 did affect the first trial in the study group. Early intervention of oral-motor management in very-low-birth-weight premature infants improved feeding performance and neonatal outcome in terms of shorter hospital days. Abnormal brain image and NEC could interfere with the success rate of initial challenge of transitioning from tube to oral feeding in the study group.

  13. 20 CFR 222.4 - Homicide of employee.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Homicide of employee. 222.4 Section 222.4... RELATIONSHIPS General § 222.4 Homicide of employee. No person convicted of the felonious and intentional homicide of an employee can be entitled to an annuity or lump-sum payment based on the employee's earnings...

  14. Modeling an HF NVIS Towel-Bar Antenna on a Coast Guard Patrol Boat. A Comparison of WIPL-D and the Numerical Electromagnetics Code (NEC)

    National Research Council Canada - National Science Library

    Mora, Darla; Weiser, Christopher; McKaughan, Michael

    2005-01-01

    A Coast Guard patrol boat high-frequency (HF) near-vertical incident skywave (NVIS) antenna is selected as a test case to compare the electromagnetic modeling programs Numerical Electromagnetics Code, NEC and WIPL-D code...

  15. Estimation of 222Rn flux and its effect on the atmospheric 222Rn concentration at Hachijo-jima Island, Japan

    International Nuclear Information System (INIS)

    Ohkura, Takehisa; Yamazawa, Hiromi; Moriizumi, Jun; Hirao, Shigekazu; Iida, Takao

    2010-01-01

    222 Rn fluxes from the ground surface and 226 Ra contents in soil were measured on Hachijo-jima Island, which is a solitary island in the Pacific Ocean located about 200 km to the south of the main island of Japan, to evaluate fractional contributions of the locally exhaled 222 Rn and the long-range transported one to the surface air concentration measured on this island. Averages of 222 Rn flux and 226 Ra content in dry soil were evaluated to be 0.9±0.4 mBq m -2 s -1 and 6.8±0.2 Bq kg -1 , respectively. These are considerably smaller than the respective values of 9.7±0.8 mBq m -2 s -1 and 23.2±0.4 Bq kg -1 measured at Nagoya as a reference. The lower value of the 226 Ra content and the even lower 222 Rn flux on this island can be attributed to the basaltic geology and the soil's coarse texture moisture, respectively. A simple model calculation assuming a typical nocturnal condition showed that the measured 222 Rn flux would cause only a small increase in the surface air concentration by 0.035 to 0.072 Bq m -3 (relative contribution of 1 to 12%) in addition to the long-range transported 222 Rn under a typical nocturnal condition. The contribution of the local flux would be smaller than that under nocturnal condition. This local 222 Rn component is negligible as compared with the concentration of the long-range transported 222 Rn (0.6 to 3.6 Bq m -3 ). It is, therefore, concluded that Hachijo-jima Island is suitable for measuring the long-range transported atmospheric 222 Rn in East Asia region. (author)

  16. Variations of Rn-222 concentration in the Bratislava air

    International Nuclear Information System (INIS)

    Holy, K.; Bohm, R.; Polaskova, A.

    1996-01-01

    222 Rn is produced by alpha decay of 222 Ra in roil. A small fraction of totally produced 222 Rn escapes from coil particles into soil air. Then 222 Rn is transported predominantly by molecular diffusion into outdoor atmosphere. The radon concentration in the outdoor atmosphere is not stable. It varies irregularly depending on meteorological conditions. However there were found out regular daily and remand variations of 222 Rn concentration in outdoor atmosphere. These variations were measured in numerous works and results are summarized f.e. in work of Gesell. A simple model described the annual variations of 222 Rn concentration war published by Minato. A mathematical analysis of daily course of 222 Rn concentration in outdoor atmosphere was realized by Garzon et al. Some results of our study of 222 Rn variations in outdoor atmosphere of Bratislava are shown in this report. (author)

  17. Dicty_cDB: SFI222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFI222 (Link to dictyBase) - - - Contig-U13893-1 - (Link to Or...iginal site) - - SFI222Z 716 - - - - Show SFI222 Library SF (Link to library) Clone ID SFI222 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dictycdb.b...LLSIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT...SIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT

  18. RADON 222 AND TROPOSPHERIC VERTICAL TRANSPORT.

    OpenAIRE

    Liu, SC; McAfee, JR; Cicerone, RJ

    1984-01-01

    Radon 222 is an inert gas whose loss is due only to radioactive decay with a half life of 3. 83 days (5. 51-day 'exponential' lifetime). It is a very useful tracer of continental air because only ground level continental sources are significant. Previously published measured **2**2**2Rn profiles are analyzed here by averaging for the summer, winter, and spring-fall seasons. The analysis shows that in summer, about 55% of the **2**2**2Rn is transported above the planetary boundary layer, consi...

  19. Early hCG addition to rFSH for ovarian stimulation in IVF provides better results and the cDNA copies of the hCG receptor may be an indicator of successful stimulation

    Directory of Open Access Journals (Sweden)

    Paraskevis Dimitris

    2009-10-01

    Full Text Available Abstract A simple, safe and cost-effective treatment protocol in ovarian stimulation is of great importance in IVF practice, especially in the case of previous unsuccessful attempts. hCG has been used as a substitute of LH because of the degree of homology between the two hormones. The main aim of this prospective randomized study was to determine, for the first time, whether low dose hCG added to rFSH for ovarian stimulation could produce better results compared to the addition of rLH in women entering IVF-ET, especially in those women that had previous IVF failures. An additional aim was to find an indicator that would allow us to follow-up ovarian stimulation and, possibly, modify it in order to achieve a better IVF outcome; and that indicator may be the cDNA copies of the LH/hCG receptor. Group A patients (n = 58 were administered hCG and Group B rLH (n = 56 in addition to rFSH in the first days of ovarian stimulation. The number of follicles and oocytes and, most importantly, implantation and pregnancy rates were shown to be statistically significantly higher in the hCG group. This study has also determined, for the first time to our best knowledge, m-RNA for LH/hCG receptors in the lymphocytes of peripheral blood 40 h before ovum pick-up. cDNA levels of the hCG receptor after ovarian stimulation were significantly higher among women receiving hCG compared to those receiving LH. In addition, higher levels were encountered among women with pregnancy compared to those without, although this was not statistically significant due to the small number of pregnancies. It seems that hCG permits a highly effective and more stable occupancy of rLH/hCG receptors and gives more follicles and more oocytes. The determination of cDNA copies could be, in the future, a marker during ovulation induction protocols and of course a predictor for the outcome of ART in the special subgroup of patients with previous failures.

  20. A novel HDAC inhibitor, CG200745, inhibits pancreatic cancer cell growth and overcomes gemcitabine resistance.

    Science.gov (United States)

    Lee, Hee Seung; Park, Soo Been; Kim, Sun A; Kwon, Sool Ki; Cha, Hyunju; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Song, Si Young

    2017-01-30

    Pancreatic cancer is predominantly lethal, and is primarily treated using gemcitabine, with increasing resistance. Therefore, novel agents that increase tumor sensitivity to gemcitabine are needed. Histone deacetylase (HDAC) inhibitors are emerging therapeutic agents, since HDAC plays an important role in cancer initiation and progression. We evaluated the antitumor effect of a novel HDAC inhibitor, CG200745, combined with gemcitabine/erlotinib on pancreatic cancer cells and gemcitabine-resistant pancreatic cancer cells. Three pancreatic cancer-cell lines were used to evaluate the antitumor effect of CG200745 combined with gemcitabine/erlotinib. CG200745 induced the expression of apoptotic proteins (PARP and caspase-3) and increased the levels of acetylated histone H3. CG200745 with gemcitabine/erlotinib showed significant growth inhibition and synergistic antitumor effects in vitro. In vivo, gemcitabine/erlotinib and CG200745 reduced tumor size up to 50%. CG200745 enhanced the sensitivity of gemcitabine-resistant pancreatic cancer cells to gemcitabine, and decreased the level of ATP-binding cassette-transporter genes, especially multidrug resistance protein 3 (MRP3) and MRP4. The novel HDAC inhibitor, CG200745, with gemcitabine/erlotinib had a synergistic anti-tumor effect on pancreatic cancer cells. CG200745 significantly improved pancreatic cancer sensitivity to gemcitabine, with a prominent antitumor effect on gemcitabine-resistant pancreatic cancer cells. Therefore, improved clinical outcome is expected in the future.

  1. A long range transport model of Rn-222

    International Nuclear Information System (INIS)

    Ikebe, Y.; Kojima, S.; Shimo, M.

    1993-01-01

    In this report, we propose an analytical treatment about temporal variation of 222 Rn concentration in the atmosphere with an aim to clarify origin and transport of 222 Rn. Based on the results of numerical simulation of radon, we separate the 222 Re concentration measured at Nagoya into the following two components : (1) 222 Rn atom originated near from the measuring site, which is denoted by 'diurnal variation component'. From numerical simulation of radon, it has been shown that the measured diurnal variation can be explained by this component. (2) 222 Rn atoms originated far from the measuring site (including Chinese Continent), which is denoted by 'background component'. For this component, we propose here a one layer transport model using air mass trajectory technique. By this model we can explain the temporal variation of background component and seasonal variation of 222 Rn at Nagoya. (3 figs.)

  2. AHRR (cg05575921) hypomethylation marks smoking behaviour, morbidity and mortality

    DEFF Research Database (Denmark)

    Bojesen, Stig E; Timpson, Nicholas; Relton, Caroline

    2017-01-01

    were followed for up to 22 years for exacerbations of COPD, event of lung cancer and all-cause mortality. Six-year lung cancer risk was calculated according to the Prostate, Lung, Colorectal and Ovarian Cancer Screening Trial (PLCOM2012). MEASUREMENTS AND MAIN RESULTS: AHRR (cg05575921) hypomethylation......RATIONALE AND OBJECTIVES: Self-reported smoking underestimates disease risk. Smoking affects DNA methylation, in particular the cg05575921 site in the aryl hydrocarbon receptor repressor (AHRR) gene. We tested the hypothesis that AHRR cg05575921 hypomethylation is associated with risk of smoking...... 4.58 (95% CI 2.83 to 7.42) for COPD exacerbations, 4.87 (2.31 to 10.3) for lung cancer and 1.67 (1.48 to 1.88) for all-cause mortality. Finally, among 2576 high-risk smokers eligible for lung cancer screening by CT, observed cumulative incidences of lung cancer after 6 years for individuals...

  3. 20 CFR 222.13 - Common-law marriage relationship.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Common-law marriage relationship. 222.13 Section 222.13 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.13 Common-law marriage...

  4. "hCG priming" effect in controlled ovarian stimulation through a long protocol

    Directory of Open Access Journals (Sweden)

    Antsaklis Aris

    2009-08-01

    Full Text Available Abstract Background Recently, it has been demonstrated that, in patients down-regulated by GnRH analogues (GnRHa, a short-term pre-treatment with recombinant LH (rLH, prior to recombinant FSH (rFSH administration, increases the number of small antral follicle prior to FSH stimulation and the yield of normally fertilized embryos. However, no data exist in the literature regarding the potential beneficial effect of "hCG priming" in controlled ovarian hyperstimulation (COH through a long GnRH-a protocol, which binds the same receptor (LH/hCGR, though it is a much more potent compared to LH. The primary aims of this study were to assess the effect of short-term pre-rFSH administration of hCG in women entering an ICSI treatment cycle on follicular development, quality of oocytes and early embryo development. The secondary endpoints were to record the effects on endometrial quality and pregnancy rate. Methods Patients with a history of at least one previous unsuccessful ICSI cycle were randomly assigned into two groups to receive treatment with either a long protocol with rFSH (control group or a long protocol with rFSH and pre-treatment with hCG (hCG group. In particular, in the latter group, a fixed 7 days course of 200 IU/day hCG was administered as soon as pituitary desensitization was confirmed. Results The mean number of oocytes retrieved was not significantly different between the two treatment groups, although the percentage of mature oocytes tended to be higher but not significantly different in hCG-treated patients. The percentage of patients with more than one grade 3 embryos was higher in the pre-treatment group, which also showed a higher pregnancy rate. Conclusion All the above clinical observations, in conjunction with previous data, suggest a point towards a beneficial "hCG priming" effect in controlled ovarian hyperstimulation through a long GnRH-a down-regulation protocol, particularly in patients with previous ART failures.

  5. 21 CFR 1305.17 - Preservation of DEA Forms 222.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Preservation of DEA Forms 222. 1305.17 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.17 Preservation of DEA Forms 222. (a) The purchaser must retain Copy 3 of each executed DEA Form 222 and all copies of unaccepted or defective forms with each...

  6. Data of evolutionary structure change: 1CG8B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8B-2ZLWD 1CG8 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK... GLY CA 249 2ZLW D 2ZLWD...2ZLW D 2ZLWD ELHCDKLHVDP

  7. 222Rn in wine cellars in Hungary

    International Nuclear Information System (INIS)

    Csige, I.; Hunyadi, I.; Szerbin, P.; Juhasz, L.

    2004-01-01

    We measured seasonal average 222 Rn activity concentrations in the air of 60 wine cellars in the Tokajhegyalja and Villany wine regions of Hungary using Radamon type etched track radon detectors. The exposure period was 3 months, matching the seasons of 2003-2004. We also used an ionization chamber-type continuous 222 Rn-monitor (AlphaGUARD PQ222, Genitron Instruments, Germany) to study temporal variations of 222 Rn activity concentration in a selected wine cellar in the Tokajhegyalja wine region. This instruments also recorded temperature, atmospheric pressure and relative humidity data. The etched track detector data revealed that the 222 Rn activity concentrations in the air of wine cellars spread over a wide range, from the ambient outdoor concentration of 6 Bq.m -3 up to 6 kBq.m -3 characteristic of natural caves. The temporal variation of 222 Rn activity concentration in the air of the selected cellar varied inversely with the variation of the atmospheric pressure. Earlier we observed similar phenomena in natural karstic caves connected to the surface with vertical shafts only. This suggests that relatively large volume of pore space of the embedding rock communicates with the volume of the cellar induced by the variation of the atmospheric pressure

  8. GnRHa trigger and individualized luteal phase hCG support according to ovarian response to stimulation

    DEFF Research Database (Denmark)

    Humaidan, Peter; Polyzos, N P; Alsbjerg, B

    2013-01-01

    , there was a lack of blinding in the RCTs. WIDER IMPLICATIONS OF THE FINDINGS: Although a non-significant result, one bolus of 1.500 IU hCG after GnRHa trigger tended to reduce the OHSS rate in patients with 15-25 follicles ≥11 mm as well as secure the ongoing pregnancy rate. In contrast, in patients at low risk......STUDY QUESTION: Does a GnRH agonist (GnRHa) trigger followed by a bolus of 1.500 IU hCG in a group of patients at risk of ovarian hyperstimulation syndrome (OHSS) reduce the OHSS incidence compared with hCG trigger? SUMMARY ANSWER: A GnRHa trigger followed by early luteal hCG support with one bolus...... of 1.500 IU hCG appears to reduce OHSS in patients at risk of OHSS; however, in a low-risk group a second bolus of 1.500 IU hCG induced two cases of late onset OHSS. WHAT IS KNOWN ALREADY: A GnRHa trigger is an alternative to hCG in GnRH antagonist co-treated cycles. STUDY DESIGN, SIZE, DURATION: Two...

  9. 12 CFR 222.27 - Renewal of opt-out.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Renewal of opt-out. 222.27 Section 222.27 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.27 Renewal of opt-out. (a) Renewal notice and...

  10. 4 CFR 22.2 - Board Consideration [Rule 2].

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Board Consideration [Rule 2]. 22.2 Section 22.2 Accounts... OFFICE CONTRACT APPEALS BOARD § 22.2 Board Consideration [Rule 2]. (a) Offices. The office of the Board... consideration of a matter by all members of the Contract Appeals Board will not be granted in any appeal filed...

  11. Dynamic GnRH and hCG testing

    DEFF Research Database (Denmark)

    Bang, A. Kirstine; Nordkap, Loa; Almstrup, Kristian

    2017-01-01

    OBJECTIVE: Gonadotropin-releasing hormone (GnRH) and human chorionic gonadotropin (hCG) stimulation tests may be used to evaluate the pituitary and testicular capacity. Our aim was to evaluate changes in follicular-stimulating hormone (FSH), luteinizing hormone (LH) and testosterone after Gn...... influence of the tests was illustrated by results from 45 patients suspected of disordered hypothalamic-pituitary-gonadal axis. METHODS: Baseline, stimulated, relative and absolute changes in serum FSH and LH were determined by ultrasensitive TRIFMA, and testosterone was determined by LC-MS/MS. RESULTS......: For the reference group, LH and FSH increased almost 400% and 40% during GnRH testing, stimulated levels varied from 4.4 to 58.8 U/L and 0.2 to 11.8 U/L and FSH decreased in nine men. Testosterone increased approximately 110% (range: 18.7-67.6 nmol/L) during hCG testing. None of the polymorphisms had any major...

  12. Development of Mycoplasma synoviae (MS) core genome multilocus sequence typing (cgMLST) scheme.

    Science.gov (United States)

    Ghanem, Mostafa; El-Gazzar, Mohamed

    2018-05-01

    Mycoplasma synoviae (MS) is a poultry pathogen with reported increased prevalence and virulence in recent years. MS strain identification is essential for prevention, control efforts and epidemiological outbreak investigations. Multiple multilocus based sequence typing schemes have been developed for MS, yet the resolution of these schemes could be limited for outbreak investigation. The cost of whole genome sequencing became close to that of sequencing the seven MLST targets; however, there is no standardized method for typing MS strains based on whole genome sequences. In this paper, we propose a core genome multilocus sequence typing (cgMLST) scheme as a standardized and reproducible method for typing MS based whole genome sequences. A diverse set of 25 MS whole genome sequences were used to identify 302 core genome genes as cgMLST targets (35.5% of MS genome) and 44 whole genome sequences of MS isolates from six countries in four continents were used for typing applying this scheme. cgMLST based phylogenetic trees displayed a high degree of agreement with core genome SNP based analysis and available epidemiological information. cgMLST allowed evaluation of two conventional MLST schemes of MS. The high discriminatory power of cgMLST allowed differentiation between samples of the same conventional MLST type. cgMLST represents a standardized, accurate, highly discriminatory, and reproducible method for differentiation between MS isolates. Like conventional MLST, it provides stable and expandable nomenclature, allowing for comparing and sharing the typing results between different laboratories worldwide. Copyright © 2018 The Authors. Published by Elsevier B.V. All rights reserved.

  13. Maria Spławska-Korczak, Zamek krzyżacki w Świeciu. Próba rekonstrukcji zamku wysokiego w średniowieczu [The Teutonic Order’s Castle in Schwetz. An attempt at reconstructing the High Castle in the Middle Ages], Wydawnictwo Naukowe UMK ...

    OpenAIRE

    Kwiatkowski, Krzyszof

    2017-01-01

    Maria Spławska-Korczak, Zamek krzyżacki w Świeciu. Próba rekonstrukcji zamku wysokiego w średniowieczu [ The Teutonic Order’s Castle in Schwetz. An attempt at reconstructing the High Castle in the Middle Ages ], Wydawnictwo Naukowe Uniwersytetu Mikołaja Kopernika, Toruń 2014, 222 pp. + 70 illustrations, ISBN: 978-83-231-3247-9

  14. 222Rn flux and soil air concentration profiles in West-Germany. Soil 222Rn as tracer for gas transport in the unsaturated soil zone

    International Nuclear Information System (INIS)

    Doerr, H.; Muennich, K.O.

    1990-01-01

    Measurements of the 222 Rn activity concentration profile in the soil and the 222 Rn flux in West-Germany are presented. The spatial pattern of the 222 Rn flux depends more on soil type than on the 226 Ra activity of the soil material. The average 222 Rn flux from sandy soils is 1000-2000 dpm m -2 h -1 and 4000-6000 dpm m -2 h -1 froam loamy and clayey soils. Weekly 222 Rn flux measurements during a period of 1 year at a sandy site show no significant temporal variations. At a clayey site, the 222 Rn flux tends to be higher in summer than in winter. The permeability coefficient P Rn , obtained from simultaneous 222 Rn flux and concentration profile measurements in various soils, can be expressed as a function of the soil parameters total porosity ε 0 , soil moisture F, tortuosity k and the molecular diffusion coefficient D 0 of 222 Rn in air: P = D 0 ((ε 0 -F)/k-const.). The flux of any other gas into or out of the soil can thus be calculated from its measured concentration profile in the soil and from the 222 Rn permeability coefficient, replacing the molecular diffusion coefficient of 222 Rn by that of the specific gas under consideration. As an example, this method of flux determination is demonstrated for the soil CO 2 flux to the atmosphere and for the flux of atmospheric CH 4 into the soil. (author) 14 refs

  15. Data of evolutionary structure change: 1CG8A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8A-2ZLWD 1CG8 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...> 2ZLW D 2ZLWD ARHFG...fEVID> 2 2ZLW D 2ZLWD LWD... CA 218 GLN CA 251 2ZLW D

  16. Data of evolutionary structure change: 1CG5A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5A-2ZLWD 1CG5 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...ne> GLN CA 254 2ZLW D 2ZLWD...ain> 2ZLW D 2ZLWD AR...fEVID> 2 2ZLW D 2ZLWD

  17. Intrauterine administration of human chorionic gonadotropin (hCG) for subfertile women undergoing assisted reproduction.

    Science.gov (United States)

    Craciunas, Laurentiu; Tsampras, Nikolaos; Coomarasamy, Arri; Raine-Fenning, Nick

    2016-05-20

    Subfertility affects 15% of couples and represents the inability to conceive naturally following 12 months of regular unprotected sexual intercourse. Assisted reproduction refers to procedures involving the in vitro handling of both human gametes and represents a key option for many subfertile couples. Most women undergoing assisted reproduction treatment will reach the stage of embryo transfer (ET) but the proportion of embryos that successfully implant following ET has remained small since the mid-1990s. Human chorionic gonadotropin (hCG) is a hormone synthesised and released by the syncytiotrophoblast and has a fundamental role in embryo implantation and the early stages of pregnancy. Intrauterine administration of synthetic or natural hCG via an ET catheter during a mock procedure around the time of ET is a novel approach that has recently been suggested to improve the outcomes of assisted reproduction. To investigate whether the intrauterine administration of hCG around the time of ET improves the clinical outcomes in subfertile women undergoing assisted reproduction. We performed a comprehensive literature search of the Cochrane Gynaecology and Fertility Group Specialised Register, Cochrane Central Register of Controlled Trials (CENTRAL), MEDLINE, EMBASE, CINAHL, PsycINFO, registers of ongoing trials andreference lists of all included studies and relevant reviews (from inception to 10 November 2015), in consultation with the Cochrane Gynaecology and Fertility Group Trials Search Co-ordinator. We included all randomised controlled trials (RCTs) evaluating intrauterine administration of hCG around the time of ET in this review irrespective of language and country of origin. Two authors independently selected studies, assessed risk of bias, extracted data from studies and attempted to contact the authors where data were missing. We performed statistical analysis using Review Manager 5 in accordance with the Cochrane Handbook for Systematic Reviews of

  18. 222-S laboratory quality assurance plan

    International Nuclear Information System (INIS)

    Meznarich, H.K.

    1995-01-01

    This document provides quality assurance guidelines and quality control requirements for analytical services. This document is designed on the basis of Hanford Analytical Services Quality Assurance Plan (HASQAP) technical guidelines and is used for governing 222-S and 222-SA analytical and quality control activities. The 222-S Laboratory provides analytical services to various clients including, but not limited to, waste characterization for the Tank Waste Remediation Systems (TWRS), waste characterization for regulatory waste treatment, storage, and disposal (TSD), regulatory compliance samples, radiation screening, process samples, and TPA samples. A graded approach is applied on the level of sample custody, QC, data verification, and data reporting to meet the specific needs of the client

  19. 20 CFR 222.34 - Relationship resulting from equitable adoption.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship resulting from equitable adoption. 222.34 Section 222.34 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.34 Relationship resulting from...

  20. Dependence of indoor 222Rn level on building materials

    International Nuclear Information System (INIS)

    Tso, M.W.; Ng, C.; Leung, J.K.C.

    1993-01-01

    The radionuclide contents of typical building materials used in Hong Kong were studied by γ spectroscopic analysis. The physical properties of these building materials affecting the production and transportation of 222 Rn to the surrounding air were examined; these include the emanation coefficient of 2 '2 2 Rn of the material, the diffusion coefficient of 222 Rn in the material and the effect of surface coating and temperature on the rate of 222 Rn exhalation. Results obtained in this study explain the indoor 222 Rn concentration observed in our previous surveys and also suggest that the main source of indoor 222 Rn in Hong Kong is building material. (3 figs., 4 tabs.)

  1. 21 CFR 1305.12 - Procedure for executing DEA Forms 222.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for executing DEA Forms 222. 1305.12... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.12 Procedure for executing DEA Forms 222. (a) A purchaser must prepare and execute a DEA Form 222 simultaneously in triplicate by means of interleaved...

  2. 20 CFR 222.33 - Relationship resulting from legal adoption.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship resulting from legal adoption. 222.33 Section 222.33 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.33 Relationship resulting from legal adoption...

  3. Use of Tricaine Methanesulfonate (MS222) for Euthanasia of Reptiles

    Science.gov (United States)

    Conroy, CJ; Papenfuss, T; Parker, J; Hahn, NE

    2009-01-01

    Tricaine methanesulfonate (MS222) injected into the intracoelomic cavity of reptiles was evaluated as a chemical euthanasia method. Three western fence lizards, 2 desert iguanas, 4 garter snakes, and 6 geckos were euthanized by intracoelomic injection of 250 to 500 mg/kg of 0.7% to 1% sodium-bicarbonate–buffered MS222 solution followed by intracoelomic injection of 0.1 to 1.0 ml unbuffered 50% (v/v) MS222 solution. A simple 2-stage protocol for euthanasia of reptiles by using MS222 is outlined. In addition, the conditions for safe use of MS222 are discussed. MS222 offers an alternative to sodium pentobarbital for euthanasia of reptiles. PMID:19245747

  4. Correlation among the terrestrial gamma radiation, the indoor air 222Rn, and the tap water 222Rn in Switzerland

    International Nuclear Information System (INIS)

    Buchli, R.; Burkart, W.

    1989-01-01

    The external gamma radiation and the indoor air Rn (222Rn) concentration were measured in 55 houses of the South East Grisons, the Urseren valley, and the Upper Rhine valley (crystalline subsoils) and in 39 houses of the Molasse basin and the Helvetic nappes (sedimentary subsoils). In homes located on a crystalline subsoil, a mean cellar gamma level of 1.40 mGy y-1 was measured, which is twice the mean gamma level of 0.70 mGy y-1 found in homes built on a sedimentary subsoil. The cellar 222Rn gas concentration is about six times higher in houses with a crystalline subsoil (1232 Bq m-3) than in houses with a sedimentary subsoil (201 Bq m-3). Although a weak correlation is observed between the mean gamma radiation levels and mean cellar 222Rn gas concentrations for the five subregions investigated, the gamma levels and the 222Rn gas concentrations do not correlate for single homes. For the population living on the ground floor of a house with a crystalline subsoil, the gamma radiation and the indoor air 222Rn lead to estimated mean exposures of 1.16 mSv and 9.44 mSv effective dose equivalent per year, respectively. In houses with a sedimentary subsoil, these mean exposures lead to 0.68 mSv y-1 and 3.22 mSv y-1, respectively. A mean tap water 222Rn content of 38.3 Bq L-1 and 10.4 Bq L-1 was measured in 31 villages with a crystalline subsoil and 73 villages with a sedimentary subsoil, respectively. Radon-222 degasing from the tap water into the indoor air leads to an additional exposure of about 0.11 mSv y-1 and 0.03 mSv y-1 in homes with a crystalline subsoil and homes with a sedimentary subsoil, respectively

  5. 21 CFR 1305.18 - Return of unused DEA Forms 222.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Return of unused DEA Forms 222. 1305.18 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.18 Return of unused DEA Forms 222. If the registration... substances for which the purchaser is registered, the purchaser must return all unused DEA Forms 222 to the...

  6. 21 CFR 1305.16 - Lost and stolen DEA Forms 222.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Lost and stolen DEA Forms 222. 1305.16 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.16 Lost and stolen DEA Forms 222. (a) If a purchaser ascertains that an unfilled DEA Form 222 has been lost, he or she must execute another in triplicate and...

  7. 21 CFR 1305.15 - Unaccepted and defective DEA Forms 222.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Unaccepted and defective DEA Forms 222. 1305.15... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.15 Unaccepted and defective DEA Forms 222. (a) A DEA Form 222 must not be filled if either of the following apply: (1) The order is not complete...

  8. 21 CFR 1305.11 - Procedure for obtaining DEA Forms 222.

    Science.gov (United States)

    2010-04-01

    ... the name, address, and registration number of the registrant and the number of books of DEA Forms 222... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for obtaining DEA Forms 222. 1305.11... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.11 Procedure for obtaining DEA Forms 222. (a) DEA...

  9. Cross-linking of hCG to luteal receptors

    Energy Technology Data Exchange (ETDEWEB)

    Ji, T.H.; Ji, I.

    1985-01-01

    Photoaffinity labeling of the lutropin/choriogonadotropin (LH/hCG) receptor system on porcine granulosa cells has demonstrated that both the ..cap alpha.. and ..beta.. subunits of hCG directly photoaffinity label the hormone receptor. Three new bands appear on SDS-PAGE as a consequence of photoaffinity labeling by each subunit: the molecular weights of the three bands (106K, 88K, and 83K) produced by the subunit are larger by approximately 10K than those of the three bands (96K, 76K, and 73K) labeled by the ..cap alpha.. subunit. Although it could be a coincidence that the molecular weight of the ..beta.. subunit is approximately 10K larger than that of the ..cap alpha.. subunit, the similarity in these differences suggests the possibility that both the ..cap alpha.. and ..beta.. subunits have labeled the same polypeptides.

  10. 20 CFR 222.55 - When a stepchild is dependent.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a stepchild is dependent. 222.55 Section 222.55 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.55 When a stepchild is dependent. An employee's...

  11. 21 CFR 1305.13 - Procedure for filling DEA Forms 222.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for filling DEA Forms 222. 1305.13... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.13 Procedure for filling DEA Forms 222. (a) A purchaser must submit Copy 1 and Copy 2 of the DEA Form 222 to the supplier and retain Copy 3 in the...

  12. 21 CFR 1305.14 - Procedure for endorsing DEA Forms 222.

    Science.gov (United States)

    2010-04-01

    ... on the reverse sides of Copies 1 and 2 of the DEA Form 222) the name and address of the second... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for endorsing DEA Forms 222. 1305.14... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.14 Procedure for endorsing DEA Forms 222. (a) A...

  13. Rhipicephalus (Boophilus microplus: expression and characterization of Bm86-CG in Pichia pastoris Rhipicephalus (Boophilus microplus: expressão e caracterização da Bm86-CG em Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Rodrigo Casquero Cunha

    2011-06-01

    Full Text Available The cattle tick Rhipicephalus (Boophilus microplus is responsible for great economic losses. It is mainly controlled chemically, with limitations regarding development of resistance to the chemicals. Vaccines may help control this parasite, thereby reducing tick pesticide use. In this light, we performed subcloning of the gene of the protein Bm86-GC, the homologue protein that currently forms the basis of vaccines (GavacTM and TickGardPLUS that have been developed against cattle ticks. The subcloning was done in the pPIC9 expression vector, for transformation in the yeast Pichia pastoris. This protein was characterized by expression of the recombinant Mut+ strain, which expressed greater quantities of protein. The expressed protein (rBm86-CG was recognized in the Western-blot assay using anti-Gavac, anti-TickGard, anti-larval extract and anti-rBm86-CG polyclonal sera. The serum produced in cattle vaccinated with the antigen CG rBm86 presented high antibody titers and recognized the native protein. The rBm86-GC has potential relevance as an immunogen for vaccine formulation against cattle ticks.O carrapato-do-boi Rhipicephalus (Boophilus microplus é responsável por grandes perdas econômicas. Seu controle é principalmente químico e apresenta limitações quanto ao desenvolvimento de resistência aos princípios ativos. As vacinas podem auxiliar no controle deste parasita diminuindo as aplicações de carrapaticidas. Considerando isso, foi realizada a subclonagem do gene da proteína Bm86-CG, proteína homologa a que atualmente é a base das vacinas desenvolvidas (GavacTM e TickGardPLUS contra o carrapato-do-boi, no vetor de expressão pPIC9, para ser transformado em levedura, Pichia pastoris. Esta proteína foi caracterizada pela expressão da cepa recombinante Mut+ que expressou maior quantidade de proteína. A proteína expressa, rBm86-CG, foi reconhecida no ensaio de Western-blot pelos soros policlonais anti-Gavac, anti-TickGard, anti

  14. Amphiregulin mediates hCG-induced StAR expression and progesterone production in human granulosa cells

    OpenAIRE

    Fang, Lanlan; Yu, Yiping; Zhang, Ruizhe; He, Jingyan; Sun, Ying-Pu

    2016-01-01

    Progesterone plays critical roles in maintaining a successful pregnancy at the early embryonic stage. Human chorionic gonadotropin (hCG) rapidly induces amphiregulin (AREG) expression. However, it remains unknown whether AREG mediates hCG-induced progesterone production. Thus, the objective of this study was to investigate the role of AREG in hCG-induced progesterone production and the underlying molecular mechanism in human granulosa cells; primary cells were used as the experimental model. ...

  15. CG13250, a novel bromodomain inhibitor, suppresses proliferation of multiple myeloma cells in an orthotopic mouse model

    International Nuclear Information System (INIS)

    Imayoshi, Natsuki; Yoshioka, Makoto; Chauhan, Jay; Nakata, Susumu; Toda, Yuki; Fletcher, Steven; Strovel, Jeffrey W.; Takata, Kazuyuki; Ashihara, Eishi

    2017-01-01

    Multiple myeloma (MM) is characterized by the clonal proliferation of neoplastic plasma cells. Despite a stream of new molecular targets based on better understanding of the disease, MM remains incurable. Epigenomic abnormalities contribute to the pathogenesis of MM. bromodomain 4 (BRD4), a member of the bromodomain and extraterminal (BET) family, binds to acetylated histones during M/G1 transition in the cell cycle promoting progression to S phase. In this study, we investigated the effects of a novel BET inhibitor CG13250 on MM cells. CG13250 inhibited ligand binding to BRD4 in a dose-dependent manner and with an IC 50 value of 1.1 μM. It inhibited MM proliferation in a dose-dependent manner and arrested cells in G1, resulting in the induction of apoptosis through caspase activation. CG13250 inhibited the binding of BRD4 to c-MYC promoter regions suppressing the transcription of the c-MYC gene. Administered in vivo, CG13250 significantly prolonged survival of an orthotopic MM-bearing mice. In conclusion, CG13250 is a novel bromodomain inhibitor that is a promising molecular targeting agent against MM. - Highlights: • A novel bromodomain inhibitor CG13250 suppresses MM cell proliferation. • CG13250 decreases C-MYC expression, resulting in the induction of apoptosis. • CG13250 prolongs the survivals of MM-bearing mice.

  16. 33 CFR 222.4 - Reporting earthquake effects.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Reporting earthquake effects. 222..., DEPARTMENT OF DEFENSE ENGINEERING AND DESIGN § 222.4 Reporting earthquake effects. (a) Purpose. This... significant earthquakes. It primarily concerns damage surveys following the occurrences of earthquakes. (b...

  17. Micro-dose hCG as luteal phase support without exogenous progesterone administration

    DEFF Research Database (Denmark)

    Andersen, C Yding; Fischer, R; Giorgione, V

    2016-01-01

    RHa trigger to induce ovulation showed that exogenous progesterone administration without hCG supplementation was insufficient to obtain satisfactory pregnancy rates. This has prompted development of alternative strategies for LPS. Augmenting the local endogenous production of progesterone by the multiple......For the last two decades, exogenous progesterone administration has been used as luteal phase support (LPS) in connection with controlled ovarian stimulation combined with use of the human chorionic gonadotropin (hCG) trigger for the final maturation of follicles. The introduction of the Gn...... corpora lutea has been one focus with emphasis on one hand to avoid development of ovarian hyper-stimulation syndrome and, on the other hand, to provide adequate levels of progesterone to sustain implantation. The present study evaluates the use of micro-dose hCG for LPS support and examines the potential...

  18. 27 CFR 26.222 - Still wines containing carbon dioxide.

    Science.gov (United States)

    2010-04-01

    ... carbon dioxide. 26.222 Section 26.222 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... ISLANDS Formulas for Products From the Virgin Islands § 26.222 Still wines containing carbon dioxide. (a) General. Still wines may contain not more than 0.392 gram of carbon dioxide per 100 milliliters of wine...

  19. 7 CFR 1280.222 - Books and Records of Board.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and Records of Board. 1280.222 Section 1280.222... INFORMATION ORDER Lamb Promotion, Research, and Information Order Reports, Books, and Records § 1280.222 Books and Records of Board. The Board shall: (a) Maintain such books and records, which shall be made...

  20. Measurements of octupole collectivity in $^{220,222}$Rn and $^{222,224}$Ra using Coulomb excitation

    CERN Multimedia

    Kruecken, R; Larsen, A; Hurst, A M; Voulot, D; Grahn, T; Clement, E; Wadsworth, R; Gernhaeuser, R A; Siem, S; Huyse, M L; Iwanicki, J S

    2008-01-01

    We propose to exploit the unique capability of ISOLDE to provide post-accelerated $^{220,222}$Rn and $^{222,224}$Ra ion beams from the REX facility to enable the Coulomb excitation of the first 3$^{-}$ states in these nuclei. By measuring the $\\gamma$-ray yields of the E1 decays from the 3$^{-}$ state using the MINIBALL array we can obtain the transition matrix elements. This will give quantitative information about octupole correlations in these nuclei. We require 22 shifts to fulfil the aims of the experiment.

  1. CG2Real: Improving the Realism of Computer Generated Images Using a Large Collection of Photographs.

    Science.gov (United States)

    Johnson, Micah K; Dale, Kevin; Avidan, Shai; Pfister, Hanspeter; Freeman, William T; Matusik, Wojciech

    2011-09-01

    Computer-generated (CG) images have achieved high levels of realism. This realism, however, comes at the cost of long and expensive manual modeling, and often humans can still distinguish between CG and real images. We introduce a new data-driven approach for rendering realistic imagery that uses a large collection of photographs gathered from online repositories. Given a CG image, we retrieve a small number of real images with similar global structure. We identify corresponding regions between the CG and real images using a mean-shift cosegmentation algorithm. The user can then automatically transfer color, tone, and texture from matching regions to the CG image. Our system only uses image processing operations and does not require a 3D model of the scene, making it fast and easy to integrate into digital content creation workflows. Results of a user study show that our hybrid images appear more realistic than the originals.

  2. 20 CFR 222.35 - Relationship as stepchild.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as stepchild. 222.35 Section 222.35 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY... the relationship of stepchild of an employee, and will be considered a child for annuity but not for...

  3. 48 CFR 252.222-7002 - Compliance with local labor laws (overseas).

    Science.gov (United States)

    2010-10-01

    ... labor laws (overseas). 252.222-7002 Section 252.222-7002 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.222-7002 Compliance with local labor laws (overseas). As prescribed in 222.7201(a), use the following clause: Compliance with Local Labor Laws (Overseas) (JUN 1997...

  4. Development of SCINFUL-CG code to calculate response functions of scintillators in various shapes used for neutron measurement

    Energy Technology Data Exchange (ETDEWEB)

    Endo, Akira; Kim, Eunjoo; Yamaguchi, Yasuhiro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2001-10-01

    A Monte Carlo code SCINFUL has been utilized for calculating response functions of organic scintillators for high-energy neutron spectroscopy. However, the applicability of SCINFUL is limited to the calculations for cylindrical NE213 and NE110 scintillators. In the present study, SCINFUL-CG was developed by introducing a geometry specifying function and high-energy neutron cross section data into SCINFUL. The geometry package MARS-CG, the extended version of the CG (Combinatorial Geometry), was programmed into SCINFUL-CG to express various geometries of detectors. Neutron spectra in the regions specified by the CG can be evaluated by the track length estimator. The cross section data of silicon, oxygen and aluminum for neutron transport calculation were incorporated up to 100 MeV using the data of LA150 library. Validity of SCINFUL-CG was examined by comparing calculated results with those by SCINFUL and MCNP and experimental data measured using high-energy neutron fields. SCINFUL-CG can be used for the calculations of the response functions and neutron spectra in the organic scintillators in various shapes. The computer code will be applicable to the designs of high-energy neutron spectrometers and neutron monitors using the organic scintillators. The present report describes the new features of SCINFUL-CG and explains how to use the code. (author)

  5. Exposure of burrowing mammals to {sup 222}Rn

    Energy Technology Data Exchange (ETDEWEB)

    Beresford, N.A., E-mail: nab@ceh.ac.uk [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Barnett, C.L. [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Vives i Batlle, J. [Belgian Nuclear Research Centre (SCK-CEN), Boeretang 200, 2400 Mol (Belgium); Potter, E.D. [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Ibrahimi, Z.-F. [Health Protection Agency, Centre for Radiation, Chemical and Environmental Hazards, Chilton, Didcot OX11 0RQ (United Kingdom); Barlow, T.S.; Schieb, C.; Jones, D.G. [British Geological Survey, Environmental Science Centre, Keyworth, Nottingham NG12 5GG (United Kingdom); Copplestone, D. [School of Natural Sciences, University of Stirling, Stirling FK9 4LA (United Kingdom)

    2012-08-01

    Estimates of absorbed dose rates to wildlife from exposure to natural background radionuclides are required to put estimates of dose rates arising from regulated releases of radioactivity and proposed benchmarks into context. Recent review papers have estimated dose rates to wildlife from {sup 40}K, and {sup 238}U and {sup 232}Th series radionuclides. However, only one study previous has considered the potential dose rates to burrowing animals from inhaled {sup 222}Rn and its daughter products. In this paper we describe a study conducted at seven sites in northwest England. Passive track etch detectors were used to measure the {sup 222}Rn concentrations in artificial burrows over a period of approximately one year. Results suggest that absorbed dose rates to burrowing mammals as a consequence of exposure to {sup 222}Rn are likely to be at least an order of magnitude higher than those suggested in previous evaluations of natural background exposure rates which had omitted this radionuclide and exposure pathway. Dose rates in some areas of Great Britain will be considerably in excess of incremental no-effects benchmark dose rates suggested for use as screening levels. Such advised benchmark dose rates need to be better put into context with background dose rates, including exposure to {sup 222}Rn, to ensure credibility; although the context will be determined by the purpose of the benchmark and the assessment level. - Highlights: Black-Right-Pointing-Pointer Determined {sup 222}Rn concentrations in artificial burrows. Black-Right-Pointing-Pointer Estimated dose rates to burrowing mammals from inhaled {sup 222}Rn and daughter products. Black-Right-Pointing-Pointer {sup 222}Rn likely to dominate exposure of burrowing mammals due to natural radionuclides.

  6. 20 CFR 222.14 - Deemed marriage relationship.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Deemed marriage relationship. 222.14 Section... FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.14 Deemed marriage relationship... may still be found to have the relationship as spouse of an employee based upon a deemed marriage. A...

  7. Ten tandem repeats of β-hCG 109-118 enhance immunogenicity and anti-tumor effects of β-hCG C-terminal peptide carried by mycobacterial heat-shock protein HSP65

    International Nuclear Information System (INIS)

    Zhang Yankai; Yan Rong; He Yi; Liu Wentao; Cao Rongyue; Yan Ming; Li Taiming; Liu Jingjing; Wu Jie

    2006-01-01

    The β-subunit of human chorionic gonadotropin (β-hCG) is secreted by many kinds of tumors and it has been used as an ideal target antigen to develop vaccines against tumors. In view of the low immunogenicity of this self-peptide,we designed a method based on isocaudamer technique to repeat tandemly the 10-residue sequence X of β-hCG (109-118), then 10 tandemly repeated copies of the 10-residue sequence combined with β-hCG C-terminal 37 peptides were fused to mycobacterial heat-shock protein 65 to construct a fusion protein HSP65-X10-βhCGCTP37 as an immunogen. In this study, we examined the effect of the tandem repeats of this 10-residue sequence in eliciting an immune by comparing the immunogenicity and anti-tumor effects of the two immunogens, HSP65-X10-βhCGCTP37 and HSP65-βhCGCTP37 (without the 10 tandem repeats). Immunization of mice with the fusion protein HSP65-X10-βhCGCTP37 elicited much higher levels of specific anti-β-hCG antibodies and more effectively inhibited the growth of Lewis lung carcinoma (LLC) in vivo than with HSP65-βhCGCTP37, which should suggest that HSP65-X10-βhCGCTP37 may be an effective protein vaccine for the treatment of β-hCG-dependent tumors and multiple tandem repeats of a certain epitope are an efficient method to overcome the low immunogenicity of self-peptide antigens

  8. Revisiting the role of hCG: new regulation of the angiogenic factor EG-VEGF and its receptors.

    Science.gov (United States)

    Brouillet, S; Hoffmann, P; Chauvet, S; Salomon, A; Chamboredon, S; Sergent, F; Benharouga, M; Feige, J J; Alfaidy, N

    2012-05-01

    Endocrine gland-derived vascular endothelial growth factor (EG-VEGF) is an angiogenic factor reported to be specific for endocrine tissues, including the placenta. Its biological activity is mediated via two G protein-coupled receptors, prokineticin receptor 1 (PROKR1) and prokineticin receptor 2 (PROKR2). We have recently shown that (i) EG-VEGF expression peaks between the 8th and 11th weeks of gestation, (ii) its mRNA and protein levels are up-regulated by hypoxia, (iii) EG-VEGF is a negative regulator of trophoblast invasion and (iv) its circulating levels are increased in preeclampsia (PE), the most threatening pathology of pregnancy. Here, we investigated the regulation of the expression of EG-VEGF and its receptors by hCG, a key pregnancy hormone that is also deregulated in PE. During the first trimester of pregnancy, hCG and EG-VEGF exhibit the same pattern of expression, suggesting that EG-VEGF is potentially regulated by hCG. Both placental explants (PEX) and primary cultures of trophoblasts from the first trimester of pregnancy were used to investigate this hypothesis. Our results show that (i) LHCGR, the hCG receptor, is expressed both in cyto- and syncytiotrophoblasts, (ii) hCG increases EG-VEGF, PROKR1 and PROKR2 mRNA and protein expression in a dose- and time-dependent manner, (iii) hCG increases the release of EG-VEGF from PEX conditioned media, (iv) hCG effects are transcriptional and post-transcriptional and (v) the hCG effects are mediated by cAMP via cAMP response elements present in the EG-VEGF promoter region. Altogether, these results demonstrate a new role for hCG in the regulation of EG-VEGF and its receptors, an emerging regulatory system in placental development.

  9. 36 CFR 222.10 - Range betterment fund.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Range betterment fund. 222.10... MANAGEMENT Grazing and Livestock Use on the National Forest System § 222.10 Range betterment fund. In... also be accomplished through use of the range betterment fund as follows: (a) On National Forest land...

  10. 2,2,2-Trifluoroethyl methacrylate-graft-natural rubber: Synthesis and application as compatibilizer in natural rubber/fluoroelastomer blends

    Energy Technology Data Exchange (ETDEWEB)

    Hinchiranan, N., E-mail: nhn78@hotmail.com [Department of Chemical Technology, Faculty of Science, Chulalongkorn University, Bangkok 10330 (Thailand); Wannako, P. [Program in Petrochemistry and Polymer Science, Faculty of Science, Chulalongkorn University, Bangkok 10330 (Thailand); Paosawatyanyong, B. [Department of Physics, Faculty of Science, Chulalongkorn University, Bangkok 10330 (Thailand); Prasassarakich, P. [Department of Chemical Technology, Faculty of Science, Chulalongkorn University, Bangkok 10330 (Thailand)

    2013-05-15

    The incompatibility and immiscibility of natural rubber (NR)/fluoroelastomers (FKM) blends were improved by incorporation of a graft copolymer synthesized from the free radical graft copolymerization of 2,2,2-trifluoroethyl methacrylate (TFEM) onto NR initiated by benzoyl peroxide via a melt-mixing process. The grafting properties were investigated as functions of the initiator and monomer concentrations, reaction temperature and time. At the optimal conditions, the obtained graft NR (GNR) purified by Soxhlet extraction contained a maximum grafting efficiency of 1.34% with 49.1% monomer conversion. The structure of the purified GNR was analyzed using attenuated total reflectance Fourier transform infrared spectroscopy (ATR-FTIR) and nuclear magnetic resonance spectroscopy ({sup 1}H NMR and {sup 19}F NMR). The gross GNR was then applied as the compatibilizer for NR/FKM vulcanizates (20/80 (w/w)) cured by peroxide vulcanization. The addition of GNR at 15 parts per hundred of rubber (phr) gave a vulcanizate with the highest tensile strength (9.93 MPa), some 5.31-fold higher than that of the incompatibilized one (1.87 MPa). This is likely to be due to the higher degree of homogeneity of the constituent phases in the GNR-compatibilized blends, as observed by scanning electron microscopy (SEM). The GNR-compatibilized NR/FKM vulcanizates were also resistant to gasohol E85 (85% (w/w) of ethanol). Highlights: ► 2,2,2-Trifluoroethyl methacrylate could be grafted on NR via melt-mixing process. ► Effect of grafting parameters on grafting efficiency and gel content was observed. ► NR/FKM containing graft NR had higher tensile strength than uncompatibilized ones. ► The compatibilized NR/FKM vulcanizates had higher gasohol-swelling resistance.

  11. Measurement of 222Rn in soil concentrations in interstitial air

    International Nuclear Information System (INIS)

    Duenas, C.; Fernandez, M.C.; Carretero, J.; Liger, E.

    1996-01-01

    Measurements of 222 Rn soil concentrations were made by inserting stainless-steel sampling tubes into the soil. The samples of the soil interstitial air were taken in to pre-evacuated 1 L glass flasks. The glass flasks are cylindrical and coated with a film of ZnS(Ag). 222 Rn was measured by counting the alpha particles emitted by 222 Rn and its daughter products, 218 Po and 214 Bi, when they reached radioactive equilibrium. Measurements of 222 Rn gas concentrations in the soil air interstices by the method at different depths were used to calculate the diffusion coefficient of the 222 Rn in the soil air. This study has been carried out for diverse soils. (Author)

  12. Serum Beta-hCG of 11 Days after Embryo Transfer to Predict Pregnancy Outcome

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Objective To assess the clinic value of a single maternal serum beta-human chorionic gonadotropin (β-hCG) assay 11 d after embryo transfer in ART pregnancies and to predict pregnancy outcome.Methods A total of 384 pregnancies after embryo transfer were included.Inviable pregnancies were defined as biochemical pregnancies,ectopic pregnancies and first trimester abortions.Ongoing pregnancies were defined as singleton pregnancies and multiple pregnancies whose gestation were achieved more than 12 weeks.Serum β-hCG concentrations were compared among different groups.Results On the post embryo transfer d 11,the mean β-hCG concentration of the ongoing pregnancy group (323.7±285.2 mIU/ml) was significantly higher than that of the inviable pregnancy group(81.4±68.1 mmIU/ml)(P<0.001).In multiple gestations,the levels of β-hCG were significantly higher compared with singleton pregnancies.If the β-hCG level was between 10 mIU/ml and 50 mIU/ml,the positive predictive value of biochemical pregnancies and ectopic pregnancies was 81.8%,the negative predictive value was 94.4%.If the level was less than 100 mIU/ml,the positive predictive value of first trimester abortions was 80.8% the negative predictive value was 77.8%.If the level was greater than 250 mIU/ml,the positive predictive value of multiple pregnancies was 83.3%.the negative predictive value was 74.4%.Conclusions A single serum β-hCG level on d 11 after embryo transfer has good predictive valuefor clinical pregnancy outcome in controlled ovarian stimulation cycles and helps to plan the subsequent follow-up.

  13. Histone deacetylase inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in DOCA-induced hypertensive rats.

    Science.gov (United States)

    Lee, Eunjo; Song, Min-Ji; Lee, Hae-Ahm; Kang, Seol-Hee; Kim, Mina; Yang, Eun Kyoung; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Kim, Inkyeom

    2016-09-01

    CG200745 is a novel inhibitor of histone deacetylases (HDACs), initially developed for treatment of various hematological and solid cancers. Because it is water-soluble, it can be administered orally. We hypothesized that the HDAC inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in deoxycorticosterone acetate (DOCA)-induced hypertensive rats. For establishment of hypertension, 40 mg/kg of DOCA was subcutaneously injected four times weekly into Sprague-Dawley rats. All the rats used in this study including those in the sham group had been unilaterally nephrectomized and allowed free access to drinking water containing 1% NaCl. Systolic blood pressure was measured by the tail-cuff method. Blood chemistry including sodium, potassium, glucose, triglyceride, and cholesterol levels was analyzed. Sections of the heart were visualized after trichrome and hematoxylin and eosin stain. The expression of hypertrophic genes such as atrial natriuretic peptide A (Nppa) and atrial natriuretic peptide B (Nppb) in addition to fibrotic genes such as Collagen-1, Collagen-3, connective tissue growth factor (Ctgf), and Fibronectin were measured by quantitative real-time PCR (qRT-PCR). Injection of DOCA increased systolic blood pressure, heart weight, and cardiac fibrosis, which was attenuated by CG200745. Neither DOCA nor CG200745 affected body weight, vascular contraction and relaxation responses, and blood chemistry. Injection of DOCA increased expression of both hypertrophic and fibrotic genes, which was abrogated by CG200745. These results indicate that CG200745 attenuates cardiac hypertrophy and fibrosis in DOCA-induced hypertensive rats.

  14. Amphiregulin mediates hCG-induced StAR expression and progesterone production in human granulosa cells.

    Science.gov (United States)

    Fang, Lanlan; Yu, Yiping; Zhang, Ruizhe; He, Jingyan; Sun, Ying-Pu

    2016-04-26

    Progesterone plays critical roles in maintaining a successful pregnancy at the early embryonic stage. Human chorionic gonadotropin (hCG) rapidly induces amphiregulin (AREG) expression. However, it remains unknown whether AREG mediates hCG-induced progesterone production. Thus, the objective of this study was to investigate the role of AREG in hCG-induced progesterone production and the underlying molecular mechanism in human granulosa cells; primary cells were used as the experimental model. We demonstrated that the inhibition of EGFR and the knockdown of AREG abolished hCG-induced steroidogenic acute regulatory protein (StAR) expression and progesterone production. Importantly, follicular fluid AREG levels were positively correlated with progesterone levels in the follicular fluid and serum. Treatment with AREG increased StAR expression and progesterone production, and these stimulatory effects were abolished by EGFR inhibition. Moreover, activation of ERK1/2, but not PI3K/Akt, signaling was required for the AREG-induced up-regulation of StAR expression and progesterone production. Our results demonstrate that AREG mediates hCG-induced StAR expression and progesterone production in human granulosa cells, providing novel evidence for the role of AREG in the regulation of steroidogenesis.

  15. 20 CFR 222.42 - When employee is contributing to support.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When employee is contributing to support. 222.42 Section 222.42 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.42 When...

  16. Method for determination of radon-222 in water by liquid scintillation counting

    International Nuclear Information System (INIS)

    Suomela, J.

    1993-06-01

    The procedure for the determination of radon-222 by liquid scintillation counting is quite specific for this radionuclide. Radon-222 is extracted readily from the water sample by an organic scintillant. The decay products of radon-222 will remain in the water phase whilst radon-222 will be extracted into the organic phase. Before measurement the sample is stored for three hours until equilibrium is reached between radon-222 and its alpha emitting decay products. The alpha activity from radon-222 and its decay products is measured in a liquid scintillation counter

  17. 21 CFR 1305.19 - Cancellation and voiding of DEA Forms 222.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Cancellation and voiding of DEA Forms 222. 1305.19... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.19 Cancellation and voiding of DEA Forms 222. (a) A purchaser may cancel part or all of an order on a DEA Form 222 by notifying the supplier in...

  18. AtPP2CG1, a protein phosphatase 2C, positively regulates salt tolerance of Arabidopsis in abscisic acid-dependent manner

    International Nuclear Information System (INIS)

    Liu, Xin; Zhu, Yanming; Zhai, Hong; Cai, Hua; Ji, Wei; Luo, Xiao; Li, Jing; Bai, Xi

    2012-01-01

    Highlights: ► AtPP2CG1 positively regulates salt tolerance in ABA-dependent manner. ► AtPP2CG1 up-regulates the expression of marker genes in different pathways. ► AtPP2CG1 expresses in the vascular system and trichomes of Arabidopsis. -- Abstract: AtPP2CG1 (Arabidopsis thaliana protein phosphatase 2C G Group 1) was predicted as an abiotic stress candidate gene by bioinformatic analysis in our previous study. The gene encodes a putative protein phosphatase 2C that belongs to Group G of PP2C. There is no report of Group G genes involved in abiotic stress so far. Real-time RT-PCR analysis showed that AtPP2CG1 expression was induced by salt, drought, and abscisic acid (ABA) treatment. The expression levels of AtPP2CG1 in the ABA synthesis-deficient mutant abi2–3 were much lower than that in WT plants under salt stress suggesting that the expression of AtPP2CG1 acts in an ABA-dependent manner. Over-expression of AtPP2CG1 led to enhanced salt tolerance, whereas its loss of function caused decreased salt tolerance. These results indicate that AtPP2CG1 positively regulates salt stress in an ABA-dependent manner. Under salt treatment, AtPP2CG1 up-regulated the expression levels of stress-responsive genes, including RD29A, RD29B, DREB2A and KIN1. GUS activity was detected in roots, leaves, stems, flower, and trichomes of AtPP2CG1 promoter–GUS transgenic plants. AtPP2CG1 protein was localized in nucleus and cytoplasm via AtPP2CG1:eGFP and YFP:AtPP2CG1 fusion approaches.

  19. AtPP2CG1, a protein phosphatase 2C, positively regulates salt tolerance of Arabidopsis in abscisic acid-dependent manner

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xin, E-mail: fangfei6073@126.com [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Zhu, Yanming, E-mail: ymzhu2001@neau.edu.cn [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Zhai, Hong, E-mail: Zhai.h@neigaehrb.ac.cn [Northeast Institute of Geography and Agroecology, Chinese Academy of Sciences, Harbin 150040 (China); Cai, Hua, E-mail: small-big@sohu.com [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Ji, Wei, E-mail: iwei_j@hotmail.com [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Luo, Xiao, E-mail: luoxiao2010@yahoo.cn [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Li, Jing, E-mail: lijing@neau.edu.cn [Plant Secondary Metabolism Laboratory, Northeast Agricultural University, Harbin 150030 (China); Bai, Xi, E-mail: baixi@neau.edu.cn [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China)

    2012-06-15

    Highlights: Black-Right-Pointing-Pointer AtPP2CG1 positively regulates salt tolerance in ABA-dependent manner. Black-Right-Pointing-Pointer AtPP2CG1 up-regulates the expression of marker genes in different pathways. Black-Right-Pointing-Pointer AtPP2CG1 expresses in the vascular system and trichomes of Arabidopsis. -- Abstract: AtPP2CG1 (Arabidopsis thaliana protein phosphatase 2C G Group 1) was predicted as an abiotic stress candidate gene by bioinformatic analysis in our previous study. The gene encodes a putative protein phosphatase 2C that belongs to Group G of PP2C. There is no report of Group G genes involved in abiotic stress so far. Real-time RT-PCR analysis showed that AtPP2CG1 expression was induced by salt, drought, and abscisic acid (ABA) treatment. The expression levels of AtPP2CG1 in the ABA synthesis-deficient mutant abi2-3 were much lower than that in WT plants under salt stress suggesting that the expression of AtPP2CG1 acts in an ABA-dependent manner. Over-expression of AtPP2CG1 led to enhanced salt tolerance, whereas its loss of function caused decreased salt tolerance. These results indicate that AtPP2CG1 positively regulates salt stress in an ABA-dependent manner. Under salt treatment, AtPP2CG1 up-regulated the expression levels of stress-responsive genes, including RD29A, RD29B, DREB2A and KIN1. GUS activity was detected in roots, leaves, stems, flower, and trichomes of AtPP2CG1 promoter-GUS transgenic plants. AtPP2CG1 protein was localized in nucleus and cytoplasm via AtPP2CG1:eGFP and YFP:AtPP2CG1 fusion approaches.

  20. 48 CFR 52.222-20 - Walsh-Healey Public Contracts Act.

    Science.gov (United States)

    2010-10-01

    ... Contracts Act. 52.222-20 Section 52.222-20 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.222-20 Walsh-Healey Public Contracts Act. As prescribed in 22.610, insert the following clause in solicitations and contracts covered by the Act: Walsh-Healey Public Contracts Act (OCT 2010) If...

  1. 222 S Laboratory complex hazards assessment

    International Nuclear Information System (INIS)

    Sutton, L.N.

    1998-01-01

    This report documents the hazards assessment for the 222-S Analytical Laboratory located on the US Department of Energy (DOE) Hanford Site. Operation of the laboratory is the responsibility of Waste Management Federal Services, Inc. (WMFS). This hazards assessment was conducted to provide the emergency planning technical basis for the 222-S Facility. DOE Orders require an emergency planning hazards assessment for each facility that has the potential to reach or exceed the lowest level emergency classification

  2. Excess bottom radon 222 distribution in deep ocean passages

    International Nuclear Information System (INIS)

    Sarmiento, J.L.; Broecker, W.S.; Biscaye, P.E.

    1978-01-01

    Radon 222 and STD profiles were obtained as part of the Geosecs program in the Vema Channel in the southwest Atlantic Ocean and in the Samoan, Clarion, and Wake Island passages in the Pacific Ocean. The standing crop of excess radon 222 is higher in the passages than at other nearby locations. The most likely explanation for this is that there is a high flux of radon 222 from the floor of the passages. Since much of the floor is covered with manganese nodules and encrustations, the high flux of radon 222 may be attributable to the high concentrations of radium 226 in the outer few millimeters of such deposits. Laboratory measurements of radon 222 emissivity from maganese encrustations obtained in Vema Channel support this hypothesis. The excess radon 222 in the Vema Channel and Wake Island Passage is found in substantial quantities at heights above bottom greatly exceeding the heights at which excess radon 222 is found in nonpassage areas. The horizontal diffusion of radon emanating from the walls of the passages is unlikely to be the cause of the observed concentrations because the ratio of wall surface area to water volume is very low. The profiles must therefore be a result of exceptionally high apparent vertical mixing in the passages. Further work is needed to determine the nature of this apparent vertical mixing. The excess radon 222 and STD data in all four passages have been fit with an empirical model in which it is assumed that the bouyancy flux is constant with distance above bottom. The fits are very good and yield apparent buoyancy fluxes that are between 1 and 3 orders of magnitude greater than those obtained at nearby stations outside the passages for three of the four passages

  3. Theoretical study of the diffusion 222Rn gas on activated charcoal

    International Nuclear Information System (INIS)

    Lopez, Fabio O.; Canoba, Analia C.

    2001-01-01

    The 222 Rn adsorption coefficient is the fundamental parameter characterizing activated carbon's ability to adsorb 222 Rn . In this work, it has been determined the 222 Rn coefficient adsorption for 222 Rn activated carbon detectors. Scintillation vials were used as detectors. The measurement of the 222 Rn activity adsorbed in activated carbon was made by a liquid scintillation measurement of its alpha-beta progeny decay. On the other hand, in this work a diffusion and adsorption model has been developed for the transport of 222 Rn in an activated carbon porous bed. The equation that describes these processes is a partial differential equation, of the second order with respect to axial coordinate, and the first order with respect to time. The equation was numerically solved using a finites differences method. With this model the 222 Rn activity adsorbed in the detector, for several situations, was calculated. The results were tested with the data obtained from series of experiences made in our laboratories. (author)

  4. 110GHz-500kW long-pulse gyrotron with built-in quasi-optical mode converter

    International Nuclear Information System (INIS)

    Sakamoto, Keishi; Kariya, Tsuyoshi; Hayashi, Ken-ichi.

    1994-01-01

    We have designed, fabricated, and tested a 110 GHz-500 kW long-pulse gyrotron. The gyrotron incorporates a quasi-optical mode converter which transforms the oscillation mode, TE 22,2 , into a Gaussian radiation beam. The adoption of a built-in mode converter enabled us to design the electron beam collector so as to be capable of tolerating a 2 MW heat load. Attention was also paid to designing the gyrotron cavity and output window so as to permit long-pulse operations. In an experiment, we observed a maximum output power of 550 kW and achieved 1.3 s operation at a power level of 410 kW. (author)

  5. 20 CFR 222.15 - When spouse is living with employee.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When spouse is living with employee. 222.15 Section 222.15 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.15 When spouse is living with...

  6. 20 CFR 222.3 - Other regulations related to this part.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Other regulations related to this part. 222.3 Section 222.3 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS General § 222.3 Other regulations related to this part. This part is related to a...

  7. Effects of hormonehCG following injection of estnanate of reproductive performances ofswamp buffalo (Bubalus bubalis

    Directory of Open Access Journals (Sweden)

    Polmer Situmorang

    1998-12-01

    Full Text Available Low reproductive performance of buffalo resulted the population growth in Indonesia was only slightly increase during the last 50 year. Reproductive performance can be improved by hormone treatment during synchronization . One study was conducted in Porsea and Siborong-borong to see the effects of hormone hCG on the reproductive performances of swamp buffalo . A total of 34 buffaloes were kept in field grazing and commercial concentrate 4 kg/head/day was given for supplementation in 27 buffaloes and the rest 7 buffaloes treated as control with no supplemeniation . Synchronization performed by two intromuscular (IM injections of2 ml estrumate in 11 days interval . The buffaloes were divided into 2 groups of 16 buffaloes without hCG (Control group and 18 buffaloes with hCG (Treated group. Treated group wereinjected with 500 IU hCG intro-muscularly (IM 24-48 hours following second injection of estrumate . All buffaloes were artificially inseminated (AI 48 and 72 hours after the second injection of estrumate. Results showed that injection of estrurnate twice in 11 days interval was very effective to synchronize oestrus of buffaloes. The persentage of buffalo showing oestrus was 67 .5 and 85 .3% following 48 and 72 Ins of thesecond injection of estrumate resfectively . The effectiveness of estrumate was significantly affected by body condition of buffaloes where the persentage of oestrus 48 and 72 hours following estrumate injection was significantly higher (P<0.01 in buffaloes with good body condition than those in poor body condition (74.5 and 92.5% vs 42 .9 and 57 .1%. Injection ofhCG following estrumate increased the percentage of oestrus and pregnancy of buffalo. Percentages of oestrus of buffaloes 48 and 72 hours following estrumate injections was significantly higher (P<0 .01 in hCG treatment (83 .3 and 100% than those in control groups (68 .8 and 81 .3% . The pregnancy rate of buffalo with good body condition was significantly higher (P<0

  8. 5 CFR 9901.222 - Review of classification decisions.

    Science.gov (United States)

    2010-01-01

    ....222 Section 9901.222 Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND LABOR RELATIONS SYSTEMS (DEPARTMENT OF DEFENSE-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF DEFENSE...., pay system, career group, occupational series, official title, pay schedule, or pay band) of his or...

  9. Variation, Evolution, and Correlation Analysis of C+G Content and Genome or Chromosome Size in Different Kingdoms and Phyla

    Science.gov (United States)

    Li, Xiu-Qing; Du, Donglei

    2014-01-01

    C+G content (GC content or G+C content) is known to be correlated with genome/chromosome size in bacteria but the relationship for other kingdoms remains unclear. This study analyzed genome size, chromosome size, and base composition in most of the available sequenced genomes in various kingdoms. Genome size tends to increase during evolution in plants and animals, and the same is likely true for bacteria. The genomic C+G contents were found to vary greatly in microorganisms but were quite similar within each animal or plant subkingdom. In animals and plants, the C+G contents are ranked as follows: monocot plants>mammals>non-mammalian animals>dicot plants. The variation in C+G content between chromosomes within species is greater in animals than in plants. The correlation between average chromosome C+G content and chromosome length was found to be positive in Proteobacteria, Actinobacteria (but not in other analyzed bacterial phyla), Ascomycota fungi, and likely also in some plants; negative in some animals, insignificant in two protist phyla, and likely very weak in Archaea. Clearly, correlations between C+G content and chromosome size can be positive, negative, or not significant depending on the kingdoms/groups or species. Different phyla or species exhibit different patterns of correlation between chromosome-size and C+G content. Most chromosomes within a species have a similar pattern of variation in C+G content but outliers are common. The data presented in this study suggest that the C+G content is under genetic control by both trans- and cis- factors and that the correlation between C+G content and chromosome length can be positive, negative, or not significant in different phyla. PMID:24551092

  10. Extending the eigCG algorithm to nonsymmetric Lanczos for linear systems with multiple right-hand sides

    Energy Technology Data Exchange (ETDEWEB)

    Abdel-Rehim, A M; Stathopoulos, Andreas; Orginos, Kostas

    2014-08-01

    The technique that was used to build the EigCG algorithm for sparse symmetric linear systems is extended to the nonsymmetric case using the BiCG algorithm. We show that, similarly to the symmetric case, we can build an algorithm that is capable of computing a few smallest magnitude eigenvalues and their corresponding left and right eigenvectors of a nonsymmetric matrix using only a small window of the BiCG residuals while simultaneously solving a linear system with that matrix. For a system with multiple right-hand sides, we give an algorithm that computes incrementally more eigenvalues while solving the first few systems and then uses the computed eigenvectors to deflate BiCGStab for the remaining systems. Our experiments on various test problems, including Lattice QCD, show the remarkable ability of EigBiCG to compute spectral approximations with accuracy comparable to that of the unrestarted, nonsymmetric Lanczos. Furthermore, our incremental EigBiCG followed by appropriately restarted and deflated BiCGStab provides a competitive method for systems with multiple right-hand sides.

  11. Characterization of CG6178 gene product with high sequence similarity to firefly luciferase in Drosophila melanogaster.

    Science.gov (United States)

    Oba, Yuichi; Ojika, Makoto; Inouye, Satoshi

    2004-03-31

    This is the first identification of a long-chain fatty acyl-CoA synthetase in Drosophila by enzymatic characterization. The gene product of CG6178 (CG6178) in Drosophila melanogaster genome, which has a high sequence similarity to firefly luciferase, has been expressed and characterized. CG6178 showed long-chain fatty acyl-CoA synthetic activity in the presence of ATP, CoA and Mg(2+), suggesting a fatty acyl adenylate is an intermediate. Recently, it was revealed that firefly luciferase has two catalytic functions, monooxygenase (luciferase) and AMP-mediated CoA ligase (fatty acyl-CoA synthetase). However, unlike firefly luciferase, CG6178 did not show luminescence activity in the presence of firefly luciferin, ATP, CoA and Mg(2+). The enzymatic properties of CG6178 including substrate specificity, pH dependency and optimal temperature were close to those of firefly luciferase and rat fatty acyl-CoA synthetase. Further, phylogenic analyses strongly suggest that the firefly luciferase gene may have evolved from a fatty acyl-CoA synthetase gene as a common ancestral gene.

  12. Conceptual design report, 219-S secondary containment upgrade, Project W-178

    International Nuclear Information System (INIS)

    Beyer, J.J.

    1993-05-01

    The 219-S Facility is located in the 200-West Area on the Hanford Site and was constructed in 1951. The facility receives and treats liquid, low-level mixed waste from the 222-S Laboratory prior to transfer of that waste to the SY Tank Farm. The 219-S Facility consists of Cell A containing Tanks 101 and 102 and Cell B containing Tank 103 and a spare space. Project W-178 will modify the 219-S Facility to bring it into compliance with the tank system standards in WAC 173-303-640. The secondary containment upgrade will consist of a stainless steel cell liner in both Cell A and the spare space in Cell B. Additionally, Cell B will be modified by taking Tank 103 out of service and installing a new tank: Tank 104. The construction work will be accomplished in phases to minimize service interruption to the 222-S Laboratory. The proposed design and construction method is the most cost effective of four alternatives evaluated during a value engineering session. Project W-178 is a fiscal year 1995 Line Item. Total estimated construction costs of the project are $2,600,000; other project costs are $710,000. The total project cost is $3,300,000

  13. 20 CFR 222.22 - Relationship as divorced spouse.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as divorced spouse. 222.22 Section 222.22 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...

  14. Data of evolutionary structure change: 1CG5A-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available D> C 2QU0C ence>YFPHF-DLSHGence> 0 A C VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...n> 1CG5 A 1CG5A ence>VNLQA-FTPVT...line> THR CA 269 2QU0 C 2QU...0C ence>CHLPNDFTPAVence> HHHH HHH

  15. 48 CFR 252.222-7005 - Prohibition on use of nonimmigrant aliens-Guam.

    Science.gov (United States)

    2010-10-01

    ... nonimmigrant aliens-Guam. 252.222-7005 Section 252.222-7005 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.222-7005 Prohibition on use of nonimmigrant aliens—Guam. As prescribed in 222.7302, use the following clause: Prohibition on Use of Nonimmigrant Aliens—Guam (SEP 1999...

  16. Enatioselective[2+2+2] Cycloaddition as A Synthetic Tool

    Institute of Scientific and Technical Information of China (English)

    T.Shibata; S.Yoshida; M.Otsuka; Y.Arai; K.Endo

    2007-01-01

    1 Results Transition metal-catalyzed [2+2+2] cycloaddition is one of the most efficient protocols for the construction of six-membered ring system.Our group has comprehensively studied various types of highly enantioselective [2+2+2] cycloaddition for the synthesis of chiral cycloadducts; we already reported an iridium-catalyzed intermolecular [2+2+2] cycloaddition between α,ω-diynes,having various tethers and substituents on the alkyne termini,and monoalkynes,possessing oxygen or/and nitrogen functiona...

  17. Novel histone deacetylase inhibitor CG200745 induces clonogenic cell death by modulating acetylation of p53 in cancer cells.

    Science.gov (United States)

    Oh, Eun-Taex; Park, Moon-Taek; Choi, Bo-Hwa; Ro, Seonggu; Choi, Eun-Kyung; Jeong, Seong-Yun; Park, Heon Joo

    2012-04-01

    Histone deacetylase (HDAC) plays an important role in cancer onset and progression. Therefore, inhibition of HDAC offers potential as an effective cancer treatment regimen. CG200745, (E)-N(1)-(3-(dimethylamino)propyl)-N(8)-hydroxy-2-((naphthalene-1-loxy)methyl)oct-2-enediamide, is a novel HDAC inhibitor presently undergoing a phase I clinical trial. Enhancement of p53 acetylation by HDAC inhibitors induces cell cycle arrest, differentiation, and apoptosis in cancer cells. The purpose of the present study was to investigate the role of p53 acetylation in the cancer cell death caused by CG200745. CG200745-induced clonogenic cell death was 2-fold greater in RKO cells expressing wild-type p53 than in p53-deficient RC10.1 cells. CG200745 treatment was also cytotoxic to PC-3 human prostate cancer cells, which express wild-type p53. CG200745 increased acetylation of p53 lysine residues K320, K373, and K382. CG200745 induced the accumulation of p53, promoted p53-dependent transactivation, and enhanced the expression of MDM2 and p21(Waf1/Cip1) proteins, which are encoded by p53 target genes. An examination of CG200745 effects on p53 acetylation using cells transfected with various p53 mutants showed that cells expressing p53 K382R mutants were significantly resistant to CG200745-induced clonogenic cell death compared with wild-type p53 cells. Moreover, p53 transactivation in response to CG200745 was suppressed in all cells carrying mutant forms of p53, especially K382R. Taken together, these results suggest that acetylation of p53 at K382 plays an important role in CG200745-induced p53 transactivation and clonogenic cell death.

  18. Natural and technologically enhanced sources of radon-222

    International Nuclear Information System (INIS)

    Travis, C.C.; Watson, A.P.; McDowell-Boyer, L.M.; Cotter, S.J.; Randolph, M.L.; Fields, D.E.

    1979-01-01

    An assessment of 222 Rn releases (curies/year) from major natural and technologically enhanced sources in the United States is presented. The resulting inhalation population dose commitments to the bronchial epithelium of the lung (lung-rem) are also estimated. The sources of radon considered are natural soil, evapotranspiration, potable water supplies, building materials, natural gas, uranium mining and milling, coal and phosphate mining, phosphate fertilizer, liquefied petroleum gas, geothermal power facilities, coal-fired power plants, and gas and oil wells. The most important natural source of 222 Rn is decay of 226 Ra in the soil and rocks of the earth's crust. This source results in approximately 40% of the total population dose from all sources of radon. The largest technoligcally enhanced contributor to population dose is airborne 222 Rn in building interiors, which is estimated to contribute 55% to the total population exposure to 222 Rn. Each of the other sources is estimated to contribute less than 3% to the total

  19. Data of evolutionary structure change: 1CG8A-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /pdbChain> 2QU0A ence>YFPHF-DLSHGence> G - 0 A A VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...hain> 1CG8 A 1CG8A ence>VNLQA-FTPVT...ine>THR CA 278 2QU0 A 2QU...0A ence>CHLPNDFTPAV HH HHHH HHH

  20. 22 CFR 40.68 - Aliens subject to INA 222(g).

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Aliens subject to INA 222(g). 40.68 Section 40... § 40.68 Aliens subject to INA 222(g). An alien who, under the provisions of INA 222(g), has voided a... new nonimmigrant visa unless the alien complies with the requirements in 22 CFR 41.101 (b) or (c...

  1. Study on the changes of serum HA and CG levels in several diseases besides liver disorders

    Energy Technology Data Exchange (ETDEWEB)

    Zhiping, Lu; Yunbao, Ma; Xiaoyi, Zhang; Weihua, Lv [Changshu Hospital Attached to Medical College of Yangzhou Univ., Changshu No.2 People' s Hospital, Changshu (China)

    2005-12-15

    Objective: To study the changes of serum hyaluronic acid (HA) and cholyglycine (CG) in several diseases besides liver disorders. Methods: Serum HA and CG levels were measured with RIA in 78 patients with chronic liver diseases (with 70 controls), (84 patients with primary hepatic carcinoma ), 70 pediatric patients with various infections diseases (with 40 controls), 50 pediatric patients with recurrent respiratory infection (RRI, with 30 controls) and 428 pregnant women ( with 60 controls). In addition, RBC C{sub 3}b receptor ratio (RBCC{sub 3} bRR) and RBC immune-complex ratio (RBCICR) (both with yeast rosette method) as well as serum IgG,IgM,IgA,C{sub 3} levels (with immunoturbidity test) were examined in the 50 RRI pediatric patients, ALT levels were examined in the 70 pediatric patients with infectious diseases and SF examined in the 78 patients with chronic liver diseases. Results: The serum CG, HA and SF levels in the three groups of patients with chronic liver diseases ( CPH, CAH, Cirrhosis) were significantly higher than those in the controls (all P<0.01 ) with the exception of HA in CPH patients (P > 0.05). In patients with hepatic carcinoma, the CG and HA levels were positively correlated with the mortality at 4 months (P < 0.05). Among pregnant women, serum levels of HA and CG were significantly higher during the second and third trimesters (P<0.05-0.01) than those in the controls but not so during the first trimester. In the pediatric patients with infectious diseases, CG and HA levels were significantly higher in all these patients (P<0.01) with the only exception of HA in patients with mumps (P>0.05). For ALT, levels only increased in patients with hepatitis and typhoid fever with none in bacillary dysentery and mumps. In pediatric patients with RRI, RBCC{sub 3}bRR (%), CG, C{sub 3}, IgG levels were significantly higher than those in controls (P<0.05 ) with no significant differences in the case of RBCICR (%), HA, IgM and IgA levels (P>0

  2. Study on the changes of serum HA and CG levels in several diseases besides liver disorders

    International Nuclear Information System (INIS)

    Lu Zhiping; Ma Yunbao; Zhang Xiaoyi; Lv Weihua

    2005-01-01

    Objective: To study the changes of serum hyaluronic acid (HA) and cholyglycine (CG) in several diseases besides liver disorders. Methods: Serum HA and CG levels were measured with RIA in 78 patients with chronic liver diseases (with 70 controls), (84 patients with primary hepatic carcinoma ), 70 pediatric patients with various infections diseases (with 40 controls), 50 pediatric patients with recurrent respiratory infection (RRI, with 30 controls) and 428 pregnant women ( with 60 controls). In addition, RBC C 3 b receptor ratio (RBCC 3 bRR) and RBC immune-complex ratio (RBCICR) (both with yeast rosette method) as well as serum IgG,IgM,IgA,C 3 levels (with immunoturbidity test) were examined in the 50 RRI pediatric patients, ALT levels were examined in the 70 pediatric patients with infectious diseases and SF examined in the 78 patients with chronic liver diseases. Results: The serum CG, HA and SF levels in the three groups of patients with chronic liver diseases ( CPH, CAH, Cirrhosis) were significantly higher than those in the controls (all P 0.05). In patients with hepatic carcinoma, the CG and HA levels were positively correlated with the mortality at 4 months (P 0.05). For ALT, levels only increased in patients with hepatitis and typhoid fever with none in bacillary dysentery and mumps. In pediatric patients with RRI, RBCC 3 bRR (%), CG, C 3 , IgG levels were significantly higher than those in controls (P 0.05). Conclusion: Various infectious diseases in pediatric patients could induce mild liver damage, which was closely related to the depressed immune status. High CG and HA levels in liver cancer patients suggested high mortality at 4 months. Women in late pregnancy might harbour disturbances in CG metabolism and mild liver injury though without overt symptoms. (authors)

  3. Vibrations in the urban environment controlling 222Rn migration in soils

    International Nuclear Information System (INIS)

    Wiegand, J.

    1998-01-01

    Comparable to investigations looking for a connection of 222 Rn and earthquakes, this study shows the influence of subsurface vibrations on the 222 Rn concentration of the soil-gas in urban environments. Generally, the 222 Rn concentration increases through vibrations induced by trains, street-traffic and activities at project sites. The spatial radius of the 222 Rn increase due to vibrations reach highest values at project sites where piled foundations or metal panels are rammed into the ground (> 60 m). Along railway tracks the radius is wider (> 30 m) than along heavy traffic roads ( 222 Rn concentrations in soil-gas due to vibrations is the highest at project sites (53%). Along heavy traffic roads the increase of 222 Rn concentrations by motor vehicle traffic is higher (37%) than that by railway traffic (11.5%). The maximum increase of 400% was observed in a distance of 1 m from a railway track. In the vicinity of railway tracks a difference of the vibration influence according to unconsolidated rock (11.1%) or solid rock (11.8%) was not noticed. Beside this vibration effect, the overall 222 Rn level decreases with increasing distance to the vibration source, but only at locations laying above solid rocks. The observation of the increase of 222 Rn concentrations can be explained by a 'pump effect': the mechanical vibration of soil and mineral particles leads to an upward motion of the whole volume of soil-gas. Therefore, 222 Rn is pumped out of the soil to the atmosphere and as a result the upward transport is increased. (author)

  4. 20 CFR 222.11 - Determination of marriage relationship.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Determination of marriage relationship. 222... RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.11 Determination of marriage relationship. A claimant will be considered to be the husband, wife, or widow(er) of an employee...

  5. 12 CFR 222.83 - Disposal of consumer information.

    Science.gov (United States)

    2010-01-01

    ... RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Duties of Users of Consumer Reports Regarding Identity Theft § 222.83 Disposal of consumer information. (a) Definitions as used in this section. (1) You means... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Disposal of consumer information. 222.83...

  6. Bridging CAGD knowledge into CAD/CG applications: Mathematical theories as stepping stones of innovations

    Science.gov (United States)

    Gobithaasan, R. U.; Miura, Kenjiro T.; Hassan, Mohamad Nor

    2014-07-01

    Computer Aided Geometric Design (CAGD) which surpasses the underlying theories of Computer Aided Design (CAD) and Computer Graphics (CG) has been taught in a number of Malaysian universities under the umbrella of Mathematical Sciences' faculty/department. On the other hand, CAD/CG is taught either under the Engineering or Computer Science Faculty. Even though CAGD researchers/educators/students (denoted as contributors) have been enriching this field of study by means of article/journal publication, many fail to convert the idea into constructive innovation due to the gap that occurs between CAGD contributors and practitioners (engineers/product/designers/architects/artists). This paper addresses this issue by advocating a number of technologies that can be used to transform CAGD contributors into innovators where immediate impact in terms of practical application can be experienced by the CAD/CG practitioners. The underlying principle of solving this issue is twofold. First would be to expose the CAGD contributors on ways to turn mathematical ideas into plug-ins and second is to impart relevant CAGD theories to CAD/CG to practitioners. Both cases are discussed in detail and the final section shows examples to illustrate the importance of turning mathematical knowledge into innovations.

  7. Monitoring network of atmospheric Radon-222 concentration in East Asia and backward trajectory analysis of Radon-222 concentration trend at a small solitary island on pacific ocean

    International Nuclear Information System (INIS)

    Ohkura, Takehisa; Yamazawa, Hiromi; Moriizumi, Jun; Hirao, Shigekazu; Iida, Takao; Guo Qiuju; Tohjima, Yasunori

    2009-01-01

    A monitoring network of atmospheric 222 Rn concentration as a tracer for long-range transport in East Asia was established. Atmospheric 222 Rn concentration at Beijing, which is located on China Continent was 10-20 Bq m -3 , at Nagoya, which is located on edge of terrestrial area was 3-10 Bq m -3 and at Hachijo-jima and Hateruma-jima, which are solitary islands in Pacific Ocean was 0.5-3 Bq m -3 , respectively. The atmospheric 222 Rn concentration variations were different from sites. The 222 Rn concentration was the lowest in the summer and the highest in the winter except Nagoya where the highest was observed in the autumn and the lowest in the spring. Diurnal variations were measured at Beijing and Nagoya. In contrast, diurnal variations were not measured but several-day-cycle variations were measured at Hachijo-jima and Hateruma-jima. It was pointed out by this study that the several-day-cycle variations at Hachijo-jima were dependent on synoptic-scale atmospheric disturbance. 222 Rn concentration increased rapidly after a cold front passed through Hachijo-jima. Backward trajectory analysis of the relationship between atmospheric 222 Rn concentrations at Hachijo-jima and transport pathway of air mass indicates that air mass transported from China and Siberia has high concentration 222 Rn and air mass transported from Pacific Ocean has low concentration 222 Rn. In winter, atmospheric 222 Rn concentrations at Hachijo-jima is dependent on vertical transport pathway rather than horizontal transport pathway. (author)

  8. 20 CFR 222.41 - Determination of relationship and support for parent.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Determination of relationship and support for parent. 222.41 Section 222.41 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.41...

  9. 20 CFR 222.56 - When a grandchild or stepgrandchild is dependent.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a grandchild or stepgrandchild is dependent. 222.56 Section 222.56 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.56 When a grandchild or...

  10. Preliminary experiences with 222Rn gas in Arizona homes

    International Nuclear Information System (INIS)

    Kearfott, K.J.

    1989-01-01

    Results of a survey of 222Rn gas using four-day charcoal canister tests in 759 Arizona homes are reported. Although the study was not random with respect to population or land area, it was useful in identifying areas at risk and locating several homes having elevated indoor 222Rn air concentrations. Approximately 18% of the homes tested exceeded 150 Bq m-3 (4 pCi L-1), with 7% exceeding 300 Bq m-3 (8 pCi L-1). Several Arizona cities had larger fractions of homes exceeding 150 Bq m-3 (4 pCi L-1), such as Carefree and Cave Creek (23%), Paradise Valley (30%), Payson (33%), and Prescott (31%). The Granite Dells and Groom Creek areas of Prescott had in excess of 40-60% of the houses tested exceeding 150 Bq m-3 (4 pCi L-1). Elevated 222Rn concentrations were measured for a variety of home types having different construction materials. Private well water was identified as a potentially significant source of 222Rn gas in Prescott homes, with water from one well testing over 3.5 MBq m-3 (94,000 pCi L-1). A 222Rn concentration in air exceeding 410,000 Bq m-3 (11,000 pCi L-1) was measured using a four-day charcoal canister test in a house in Prescott which had a well opening into a living space. Additional measurements in this 150-m3 dwelling revealed a strikingly heterogeneous 222Rn concentration. The excessive 222Rn level in the dwelling was reduced to less than 190 Bq m-3 (5.2 pCi L-1) by sealing the well head with caulking and providing passive ventilation through a pipe

  11. 20 CFR 222.57 - When an equitably adopted child is dependent.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When an equitably adopted child is dependent. 222.57 Section 222.57 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.57 When an equitably adopted child is...

  12. 36 CFR 222.3 - Issuance of grazing and livestock use permits.

    Science.gov (United States)

    2010-07-01

    ... livestock use permits. 222.3 Section 222.3 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE RANGE MANAGEMENT Grazing and Livestock Use on the National Forest System § 222.3 Issuance of grazing and livestock use permits. (a) Unless otherwise specified by the Chief, Forest Service, all...

  13. Education System Using Interactive 3D Computer Graphics (3D-CG) Animation and Scenario Language for Teaching Materials

    Science.gov (United States)

    Matsuda, Hiroshi; Shindo, Yoshiaki

    2006-01-01

    The 3D computer graphics (3D-CG) animation using a virtual actor's speaking is very effective as an educational medium. But it takes a long time to produce a 3D-CG animation. To reduce the cost of producing 3D-CG educational contents and improve the capability of the education system, we have developed a new education system using Virtual Actor.…

  14. Radon 222 and tropospheric vertical transport

    International Nuclear Information System (INIS)

    Liu, S.C.; McAfee, J.R.; Cicerone, R.J.

    1984-01-01

    Radon 222 is an inert gas whose loss is due only to radioactive decay with a half life of 3.83 days (5.51-day ''exponential'' lifetime). It is a very useful tracer of continental air because only ground level continental sources are significant. Thus it is similar in several ways to many air pollutants (e.g., NO/sub x/) (NO+NO 2 ), SO 2 , and certain hydrocarbons. Previously published measured 222 Rn profiles are analyzed here by averaging for the summer, winter, and spring-fall seasons. The analysis shows that in summer, about 55% of the 222 Rn is transported above the planetary boundary layer, considerably more than during the other seasons. Similarly, in summer, about 20% rises to over 5.5 km (500 mbar). The average profiles have been used to derive vertical eddy diffusion coefficients with maximum values of 5-7 x 10 5 cm 2 s -1 in the midtroposphere and 8 x 10 3 to 5 x 10 4 cm 2 s -1 near the surface

  15. TMV-Cg Coat Protein stabilizes DELLA proteins and in turn negatively modulates salicylic acid-mediated defense pathway during Arabidopsis thaliana viral infection.

    Science.gov (United States)

    Rodriguez, Maria Cecilia; Conti, Gabriela; Zavallo, Diego; Manacorda, Carlos Augusto; Asurmendi, Sebastian

    2014-08-03

    Plant viral infections disturb defense regulatory networks during tissue invasion. Emerging evidence demonstrates that a significant proportion of these alterations are mediated by hormone imbalances. Although the DELLA proteins have been reported to be central players in hormone cross-talk, their role in the modulation of hormone signaling during virus infections remains unknown. This work revealed that TMV-Cg coat protein (CgCP) suppresses the salicylic acid (SA) signaling pathway without altering defense hormone SA or jasmonic acid (JA) levels in Arabidopsis thaliana. Furthermore, it was observed that the expression of CgCP reduces plant growth and delays the timing of floral transition. Quantitative RT-qPCR analysis of DELLA target genes showed that CgCP alters relative expression of several target genes, indicating that the DELLA proteins mediate transcriptional changes produced by CgCP expression. Analyses by fluorescence confocal microscopy showed that CgCP stabilizes DELLA proteins accumulation in the presence of gibberellic acid (GA) and that the DELLA proteins are also stabilized during TMV-Cg virus infections. Moreover, DELLA proteins negatively modulated defense transcript profiles during TMV-Cg infection. As a result, TMV-Cg accumulation was significantly reduced in the quadruple-DELLA mutant Arabidopsis plants compared to wild type plants. Taken together, these results demonstrate that CgCP negatively regulates the salicylic acid-mediated defense pathway by stabilizing the DELLA proteins during Arabidopsis thaliana viral infection, suggesting that CgCP alters the stability of DELLAs as a mechanism of negative modulation of antiviral defense responses.

  16. Addition of low dose hCG to rFSh benefits older women during ovarian stimulation for IVF

    Directory of Open Access Journals (Sweden)

    Gomaa Hala

    2012-08-01

    Full Text Available Abstract Background To compare the outcome of IVF cycles in women receiving controlled ovarian stimulation with recFSH or recFSH plus low dose hCG. Methods A retrospective case control study, performed at a private practice affiliated with an academic institute. Patients were infertile women who were treated with IVF/ICSI and controlled ovarian stimulation in a long GnRH agonist protocol using either low dose hCG in addition to recFSH [N = 88] or recFSH alone [N = 99]. Primary outcomes were mean FSH dose, number of mature eggs, number of fertilized eggs, and serum levels of estradiol. Secondary outcomes were endometrial thickness, cycle cancellations and pregnancy rates. Results A significant increase in number of mature and fertilized eggs was observed in women over 40 years of age using low dose hCG in addition to recFSH. The estradiol level was significantly higher on the day of hCG administration and the serum level of FSH on cycle day 7 and on the day of hCG administration were lower. Conclusion Addition of low dose hCG to recFSH compared with recFSH alone significantly modified cycle characteristics in patients >/= 40 years and could be of potential benefit for IVF cycles in older infertile women.

  17. Effects of eCG and progesterone on superovulation and embryo production in wood bison (Bison bison athabascae).

    Science.gov (United States)

    Palomino, J Manuel; Cervantes, Miriam P; Woodbury, Murray R; Mapletoft, Reuben J; Adams, Gregg P

    2017-06-01

    Experiments were done to determine if inclusion of eCG and progesterone in the superstimulation protocol will increase the ovarian response and embryo production in wood bison, and to provide preliminary information regarding the effect of season. In Experiment 1 (anovulatory season), bison (n=26) were synchronized by follicular ablation (Day -1) and given FSH on Days 0 and 2, and assigned to 3 groups: Progesterone (Days 0-4), eCG (Day 3), or progesterone+eCG. On Day 5, bison were given hCG and inseminated 12 and 24h later. Ova/embryos were collected 8days after hCG. In Experiment 2 (ovulatory season), bison (n=24) were synchronized and assigned randomly to two groups in which superstimulation was induced with FSH, either with or without eCG, as in Experiment 1. No differences among groups were found in ovarian response or embryo production in either experiment. The follicular count at wave emergence was positively correlated with the number of large follicles at the end of superstimulation in all groups. A significantly greater number of follicles present at wave emergence in the anovulatory vs. ovulatory season was associated with a greater number of CL at the time of embryo collection, but only half the number of freezable embryos. In conclusion, the number of transferable embryos collected (1-2/bison) was higher than in any previous report, but was not attributable to the inclusion of eCG or progesterone in the superovulatory protocol. The apparent effect of season on oocyte competence, and not superovulatory response, is worthy of further investigation. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Porting the 3D Gyrokinetic Particle-in-cell Code GTC to the CRAY/NEC SX-6 Vector Architecture: Perspectives and Challenges

    International Nuclear Information System (INIS)

    Ethier, S.; Lin, Z.

    2003-01-01

    Several years of optimization on the super-scalar architecture has made it more difficult to port the current version of the 3D particle-in-cell code GTC to the CRAY/NEC SX-6 vector architecture. This paper explains the initial work that has been done to port this code to the SX-6 computer and to optimize the most time consuming parts. Early performance results are shown and compared to the same test done on the IBM SP Power 3 and Power 4 machines

  19. Assessment and association of two useful tumour markers: alpha feto protein and human chornionic gonodotropin (beta hCG) hormone

    International Nuclear Information System (INIS)

    Subhan, F.; Tahir, F.; Sultan, S.; Subhan, K.

    2008-01-01

    This study was designed to determine serum Alpha-fetoprotein (AFP) and beta-h Chornionic Gonodotropin hormone (beta-hCG) levels among adult Pakistani population, and to observe their correlation. Serum AFP and beta-hCG levels were evaluated, using Micro-particle Enzyme Immuno Assay (MEIA) technology of M/s Abbott Laboratories. Data were compared using students t-test and correlation was computed. In the patients advised serum AFP assessment, 52% had normal AFP levels. comprising 37% male and 63% female subjects. For patients having a non-pathological picture, AFP levels varied non-significantly (p>0.05) between the Genders however, age varied highly significantly (p 0.05) and highly significant (p 0.05). Comparison of the population in the same age groups of both genders revealed significant (p 0.05), due to a large standard error. Although the differences in beta-hCG levels were highly significant (p 0.05). Among the studied cases, 67% patients had normal and 33% patients had raised beta-hCG levels. Beta-hCG levels show a decreasing trend with increasing age and beta-hCG levels were statistically significant (p<0.05) when patients under 50 years of age were compared with patients above 50 years. The coefficient of correlation between serum AFP and beta- hCG levels was 0.996454, which indicated a very strong. Significant positive correlation between the two tumour markers. The study showed that both serum AFP and beta-hCG are useful tumour markers and had a very strong positive correlation. (author)

  20. 20 CFR 222.23 - Relationship as surviving divorced spouse.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as surviving divorced spouse. 222.23 Section 222.23 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried...

  1. Project management plan for Project W-178, 219-S secondary containment

    International Nuclear Information System (INIS)

    Buckles, D.I.

    1995-01-01

    This Project Management Plan (PMP) establishes the organizational responsibilities, control systems, and procedures for managing the execution of project activities for Project W-178, the 219-S Secondary Containment Upgrade. The scope of this project will provide the 219-S Facility with secondary containment for all tanks and piping systems. Tank 103 will be replaced with a new tank which will be designated as Tank 104. Corrosion protection shall be installed as required. The cells shall be cleaned and the surface repaired as required. The 219-S Waste Handling Facility (219-S Facility), located in the 200 West Area, was constructed in 1951 to support the 222-S Laboratory Facility. The 219-S Facility has three tanks, TK-101, TK-102, and TK-103, which receive and neutralize low level radioactive wastes from the 222-S Laboratory. For purposes of the laboratory, the different low level waste streams have been designated as high activity and intermediate activity. The 219-S Facility accumulates and treats the liquid waste prior to transferring it to SY Tank Farm in the 200-W Area. Transfers are normally made by pipeline from the 219-S Facility to the 241-SY Tank Farm. Presently transfers are being made by tanker truck to the 200-E Area Tank Farms due to the diversion box catch tank which has been removed from service

  2. Intercomparison of Rn-222 determination from groundwater

    DEFF Research Database (Denmark)

    Vesterbacka, P.; Pettersson, H.; Hanste, U.-M.

    2010-01-01

    An intercomparison exercise on Rn-222 determination in groundwater was organized between eight Nordic laboratories. The individual laboratory results were in most cases within 20% of the median value and within reported uncertainties. Considering the particular difficulties in preparing, transpor......An intercomparison exercise on Rn-222 determination in groundwater was organized between eight Nordic laboratories. The individual laboratory results were in most cases within 20% of the median value and within reported uncertainties. Considering the particular difficulties in preparing...

  3. Quantification of Groundwater Discharge in a Subalpine Stream Using Radon-222

    Directory of Open Access Journals (Sweden)

    Elizabeth Avery

    2018-01-01

    Full Text Available During the dry months of the water year in Mediterranean climates, groundwater influx is essential to perennial streams for sustaining ecosystem health and regulating water temperature. Predicted earlier peak flow due to climate change may result in decreased baseflow and the transformation of perennial streams to intermittent streams. In this study, naturally occurring radon-222 (222Rn was used as a tracer of groundwater influx to Martis Creek, a subalpine stream near Lake Tahoe, CA. Groundwater 222Rn is estimated based on measurements of 222Rn activity in nearby deep wells and springs. To determine the degassing constant (needed for quantification of water and gas flux, an extrinsic tracer, xenon (Xe, was introduced to the stream and monitored at eight downstream locations. The degassing constant for 222Rn is based on the degassing constant for Xe, and was determined to be 1.9–9.0 m/day. Applying a simple model in which stream 222Rn activity is a balance between the main 222Rn source (groundwater and sink (volatilization, the influx in reaches of the upstream portion of Martis Creek was calculated to be <1 to 15 m3/day/m, which cumulatively constitutes a significant portion of the stream discharge. Experiments constraining 222Rn emanation from hyporheic zone sediments suggest that this should be considered a maximum rate of influx. Groundwater influx is typically difficult to identify and quantify, and the method employed here is useful for identifying locations for focused stream flow measurements, for formulating a water budget, and for quantifying streamwater–groundwater interaction.

  4. Effect of hCG priming on embryonic development of immature oocytes collected from unstimulated women with polycystic ovarian syndrome

    Directory of Open Access Journals (Sweden)

    Zheng Xiaoying

    2012-05-01

    Full Text Available Abstract Backgroud The effect of hCG priming on oocyte maturation and subsequently outcome in IVM cycles has remained a debated issue. A randomized controlled study was performed to investigate whether or not hCG priming prior to oocyte aspiration can improve the developmental competence of immature oocytes from unstimulated ovaries in women with polycystic ovarian syndrome (PCOS. Methods Eighty two patients with PCOS underwent IVM cycles. Each patient was randomly assigned to the hCG-primed (10,000 IU or non-primed groups 36–38 hours before oocyte retrieval depending on the computerized random table. After the oocytes had in vitro matured, fertilization, culture and embryo transfer were performed. Results The average number of cumulus-oocyte complexes (COCs recovered was 13.80 and 14.35 in the hCG-primed and non-primed groups, respectively (p > 0.05. The maturation rate of COCs was significantly improved in the hCG-primed group (55.43% vs. 42.29%; p  Conclusions While a significant improvement in the nuclear maturation rate of immature oocytes was observed in hCG-primed IVM cycles with PCOS patients, the use of hCG prior to oocyte retrieval did not improve the subsequent embryo developmental competence. The high rate of pregnancy loss in IVM cycles should receive more attention.

  5. 20 CFR 222.24 - Relationship as remarried widow(er).

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as remarried widow(er). 222.24 Section 222.24 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...

  6. cgHeliParm : analysis of dsDNA helical parameters for coarse-grained MARTINI molecular dynamics simulations

    NARCIS (Netherlands)

    Faustino, Ignacio; Marrink, S. J.

    2017-01-01

    Summary: We introduce cgHeliParm, a python program that provides the conformational analysis of Martini-based coarse-grained double strand DNA molecules. The software calculates the helical parameters such as base, base pair and base pair step parameters. cgHeliParm can be used for the analysis of

  7. Methotrexate treatment in progressive tubal ectopic pregnancies and hCG-related clinicosurgical implications

    Directory of Open Access Journals (Sweden)

    Askin Dogan

    2016-06-01

    Full Text Available Our aim was to evaluate the relationship between the success of methotrexate treatment and β-hCG levels in progressive tubal ectopic pregnancies. We defined a retrospective cohort of 394 progressive tubal ectopic pregnancy patients treated with methotrexate. A single-dose methotrexate protocol using 50 mg/m2 was administered to patients with progressive tubal ectopic pregnancy. Surgery was performed in patients who exhibited signs of acute abdomen due to tubal rupture. Of 394 patients that received methotrexate treatment, 335 (84.6% responded to medical treatment, while the remaining 59 (15.36% underwent surgery due to treatment failure. β-hCG levels in the failure group were significantly higher as compared with the success group at Day 1, Day 4, and Day 7 (2116±3157 vs. 4178±3422, 2062±3551 vs. 4935±4103, and 1532±3007 vs. 3900±4783, respectively. The receiver operating characteristics curve for β-hCG levels at Day 1 was 0.738, with a cutoff value of 1418 mIU/mL, while sensitivity and specificity values reached the optimum for treatment success (83.1% and 59.4%, respectively. Medical treatment with methotrexate achieved an 85.02% success rate for the treatment of progressive tubal ectopic pregnancy, while success rates for medical treatment decreased significantly when initial β-hCG levels were >1418 mIU/mL.

  8. Analytical characterization of recombinant hCG and comparative studies with reference product

    Directory of Open Access Journals (Sweden)

    Thennati R

    2018-01-01

    Full Text Available Rajamannar Thennati,1 Sanjay Kumar Singh,1 Nitin Nage,1 Yena Patel,1 Sandip Kumar Bose,1 Vinod Burade,2 Ranjit Sudhakar Ranbhor1 1Sun Pharmaceutical Industries Limited, 2Sun Pharmaceutical Advanced Research Center, Vadodara, Gujarat, India Introduction: Regulatory agencies recommend a stepwise approach for demonstrating biosimilarity between a proposed biosimilar and reference biological product emphasizing for functional and structural characterization to trace if there is any difference which may impact safety and efficacy. We studied the comparative structural and biological attributes of recombinant human chorionic gonadotropin (rhCG, SB005, with reference product, Ovidrel® and Ovitrelle®. Recombiant hCG was approved in 2000 by the US Food and Drug Administration for the induction of final follicular maturation, early luteinization in infertile women as part of assisted reproductive technology program. It is also indicated for the induction of ovulation and pregnancy in ovulatory infertile patients whose cause of infertility is not due to ovarian failure. Materials and methods: Primary structure was studied by intact mass analysis, peptide fingerprinting, peptide mass fingerprinting and sequence coverage analysis. Higher order structure was studied by circular dichroism, ultraviolet-visible spectroscopy, fluorescence spectroscopy, and disulfide bridge analysis. Different isoforms of reference product and SB005 were identified using capillary isoelectric focusing and capillary zone electrophoresis. Glycosylation was studied by N-glycan mapping using LC-ESI-MS, point of glycosylation, released glycan analysis using ultra performance liquid chromatography and sialic acid analysis. Product related impurities such as oligomer content analysis and oxidized impurities were studied using size exclusion chromatography and reverse phase high performance liquid chromatography, respectively. Biological activity in term of potency of reference product

  9. 36 CFR 222.29 - Relocation and disposal of animals.

    Science.gov (United States)

    2010-07-01

    ... animals. 222.29 Section 222.29 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... disposal of animals. (a) The Chief, Forest Service, shall, when he determines over-population of wild... animals from that particular territory. Such action shall be taken until all excess animals have been...

  10. Relationship between 222Rn concentration in soil water and degree of saturation

    International Nuclear Information System (INIS)

    Hamada, Hiromasa; Komae, Takami

    1996-01-01

    The object of the researches an analyzing downward flow to groundwater using 222 Rn concentration in water as an indicator has been saturated flow. However, when groundwater table is low, downward flow from surface is unsaturated flow. In this paper, the authors represented the relationship between 222 Rn concentration in soil water and degree of saturation, and measured the vertical distributions of 222 Rn concentrations in groundwater and 222 Rn concentration in water table in the fields. As the results, it was found that 222 Rn concentrations in the vicinity of groundwater table decreased by unsaturated downward flow. Moreover, from the variation of 222 Rn concentrations in groundwater table, it was possible to show the occurrence of the unsaturated downward flow by paddy fields irrigation, i.e., the downward flow of the soil water pushed out by irrigation water, the unsaturated percolation in the irrigation period, and the redistribution of the soil water after the release of ponding water. The degree of saturation in downward flow was calculated to be about 50% from 222 Rn concentrations in the irrigation period and in the non-irrigation period. It was deduced that the value was within reasonable range considering the difference of the hydraulic conductivities between of the upper layer and of the lower layer. These results proved that the relationship between 222 Rn concentrations in soil water and degree of saturation represented by the authors was reasonable and that the analytical method using 222 Rn concentrations in groundwater table as an indicator was useful 10 analyze the actual stale of unsaturated downward flow. (author)

  11. Association between resistin promoter -420C>G polymorphisms and producing ability with type 2 diabetes mellitus

    Directory of Open Access Journals (Sweden)

    Kuo-Ting Ho

    2017-11-01

    Full Text Available Elevated resistin levels and the polymorphisms located at gene encoding resistin (RETN are associated with diabetic pathogenesis. However, the correlation between RETN genotypes and T2DM is controversial due to discrepancies among reports. This study aimed at investigating and clarifying the putative association of RETN and T2DM in Taiwanese population. The resistin levels and RETN -420C>G genotypes in 244 control and 305 T2DM subjects were examined. Meanwhile, the association between genetic polymorphism of RETN -420C>G and resistin levels, as well as between RETN -420C>G and subjects’ clinical characteristics was statistically analyzed. The RETN -420C>G genotypes (p = 0.01 and G allele (p = 0.002 were significantly associated with T2DM. In addition, concanavalin A-stimulated peripheral blood mononuclear cells from T2DM subjects had higher resistin-secreting ability (p = 0.044. Nevertheless, no significant association between the subjects’ biochemical data and RETN -420 SNPs was found. Our results indicate that RETN -420C>G SNPs and G allele are significantly associated with T2DM. Investigation of RETN polymorphisms in T2DM patients from various ethnic populations are crucial and will contribute to the understanding of this gene in the diabetic etiology. The present results may contribute to gain knowledge on the complex genetic heterogeneity of type 2 diabetes.

  12. 24 CFR 92.222 - Reduction of matching contribution requirement.

    Science.gov (United States)

    2010-04-01

    ... major disaster pursuant to the Robert T. Stafford Disaster Relief and Emergency Assistance Act is made... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reduction of matching contribution requirement. 92.222 Section 92.222 Housing and Urban Development Office of the Secretary, Department of...

  13. Use of 222Rn for estimation of greenhouse gases emissions at Russian territory

    Science.gov (United States)

    Berezina, E. V.; Elansky, N. F.

    2009-04-01

    It is well known that 222Rn is widely used as a tracer for studying different atmospheric processes including estimations of greenhouse gases emissions. Calculation of 222Rn fluxes from the soil into the atmosphere allows quantitative estimation of greenhouse gases emissions having the soil origin or sources of which are located near the surface. For accurate estimation of 222Rn fluxes detailed investigations of spatial and temporal variations of its concentrations are necessary. 222Rn concentrations data in the atmospheric surface layer over continental Russia from Moscow to Vladivostok obtained during the six TROICA (Transcontinental Observations Into the Chemistry of the Atmosphere) expeditions of the mobile laboratory along the Trans-Siberian railroad are analyzed. Spatial distribution, diurnal and seasonal variations of surface 222Rn concentrations along the Trans-Siberian railroad are investigated. According to the obtained data surface 222Rn concentration values above continental Russia vary from 0.5 to 75 Bq/m3 depending on meteorological conditions and geological features of the territory with the average value being 8.42 ± 0.10 Bq/m3. The average 222Rn concentration is maximum in the autumn expedition and minimum in the spring one. The factors mostly influencing 222Rn concentration variations are studied: surface temperature inversions, geological features of the territory, precipitations. 222Rn accumulation features in the atmospheric surface layer during night temperature inversions are analyzed. It was noted that during night temperature inversions the surface 222Rn concentration is 7 - 8 times more than the one during the nights without temperature inversions. Since atmospheric stratification determines accumulation and diurnal variations of many atmospheric pollutants as well as greenhouse gases its features are analyzed in detail. Surface temperature inversions were mainly observed from 18:00-19:00 to 06:00-07:00 in the warm season and from 16

  14. Surface-water radon-222 distribution along the west-central Florida shelf

    Science.gov (United States)

    Smith, C.G.; Robbins, L.L.

    2012-01-01

    In February 2009 and August 2009, the spatial distribution of radon-222 in surface water was mapped along the west-central Florida shelf as collaboration between the Response of Florida Shelf Ecosystems to Climate Change project and a U.S. Geological Survey Mendenhall Research Fellowship project. This report summarizes the surface distribution of radon-222 from two cruises and evaluates potential physical controls on radon-222 fluxes. Radon-222 is an inert gas produced overwhelmingly in sediment and has a short half-life of 3.8 days; activities in surface water ranged between 30 and 170 becquerels per cubic meter. Overall, radon-222 activities were enriched in nearshore surface waters relative to offshore waters. Dilution in offshore waters is expected to be the cause of the low offshore activities. While thermal stratification of the water column during the August survey may explain higher radon-222 activities relative to the February survey, radon-222 activity and integrated surface-water inventories decreased exponentially from the shoreline during both cruises. By estimating radon-222 evasion by wind from nearby buoy data and accounting for internal production from dissolved radium-226, its radiogenic long-lived parent, a simple one-dimensional model was implemented to determine the role that offshore mixing, benthic influx, and decay have on the distribution of excess radon-222 inventories along the west Florida shelf. For multiple statistically based boundary condition scenarios (first quartile, median, third quartile, and maximum radon-222 inshore of 5 kilometers), the cross-shelf mixing rates and average nearshore submarine groundwater discharge (SGD) rates varied from 100.38 to 10-3.4 square kilometers per day and 0.00 to 1.70 centimeters per day, respectively. This dataset and modeling provide the first attempt to assess cross-shelf mixing and SGD on such a large spatial scale. Such estimates help scale up SGD rates that are often made at 1- to 10-meter

  15. 20 CFR 222.43 - How the one-half support determination is made.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How the one-half support determination is made. 222.43 Section 222.43 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.43...

  16. AHRR (cg05575921) hypomethylation marks smoking behaviour, morbidity and mortality

    DEFF Research Database (Denmark)

    Bojesen, Stig E; Timpson, Nicholas; Relton, Caroline

    2017-01-01

    was associated with former and current smoking status, high daily and cumulative smoking, short time since smoking cessation (all p values 7×10-31), and the smoking-related CHRN3A genotype (-0.48% per T-allele, p=0.002). The multifactorially adjusted HRs for the lowest versus highest methylation quintiles were...... in the lowest and highest methylation quintiles were 3.7% and 0.0% (p=2×10-7), whereas predicted PLCOM2012 6-year risks were similar (4.3% and 4.4%, p=0.77). CONCLUSION: AHRR (cg05575921) hypomethylation, a marker of smoking behaviour, provides potentially clinical relevant predictions of future smoking-related...... morbidity and mortality. METHODS: From the Copenhagen City Heart Study representing the Danish general population, we studied 9234 individuals. Using bisulphite treated leucocyte DNA, AHRR (cg05575921) methylation was measured. Rs1051730 (CHRN3A) genotype was used to evaluate smoking heaviness. Participants...

  17. cgDNA: a software package for the prediction of sequence-dependent coarse-grain free energies of B-form DNA.

    Science.gov (United States)

    Petkevičiūtė, D; Pasi, M; Gonzalez, O; Maddocks, J H

    2014-11-10

    cgDNA is a package for the prediction of sequence-dependent configuration-space free energies for B-form DNA at the coarse-grain level of rigid bases. For a fragment of any given length and sequence, cgDNA calculates the configuration of the associated free energy minimizer, i.e. the relative positions and orientations of each base, along with a stiffness matrix, which together govern differences in free energies. The model predicts non-local (i.e. beyond base-pair step) sequence dependence of the free energy minimizer. Configurations can be input or output in either the Curves+ definition of the usual helical DNA structural variables, or as a PDB file of coordinates of base atoms. We illustrate the cgDNA package by comparing predictions of free energy minimizers from (a) the cgDNA model, (b) time-averaged atomistic molecular dynamics (or MD) simulations, and (c) NMR or X-ray experimental observation, for (i) the Dickerson-Drew dodecamer and (ii) three oligomers containing A-tracts. The cgDNA predictions are rather close to those of the MD simulations, but many orders of magnitude faster to compute. Both the cgDNA and MD predictions are in reasonable agreement with the available experimental data. Our conclusion is that cgDNA can serve as a highly efficient tool for studying structural variations in B-form DNA over a wide range of sequences. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

  18. COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison

    International Nuclear Information System (INIS)

    Skliarov, V.; Rottger, A.; Honig, A.; Korostin, S.; Kuznetsov, S.; Lapenas, A.; Milevsky, V.; Ivaniukovich, A.; Kharitonov, I.; Sepman, S.

    2009-01-01

    According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5. meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. (authors)

  19. COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison

    Energy Technology Data Exchange (ETDEWEB)

    Skliarov, V. [National Scientific Centre, Institute of Metrology (NSC IM), Kharkiv (Ukraine); Rottger, A.; Honig, A. [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany); Korostin, S.; Kuznetsov, S. [All-Russian Scientific Research Institute of Physical, Technical and Radio Measurements (VNIIFTRI), Moscow Region, Mendeleyevo (Russian Federation); Lapenas, A. [Latvian National Metrology Centre Ltd, Radiation Metrology and Testing Centre (RMTC), Salaspils (Latvia); Milevsky, V.; Ivaniukovich, A. [Belarussian State Institute of Metrology (BelGIM), Minsk (Belarus); Kharitonov, I.; Sepman, S. [D I Mendeleyev Institute of metrology (VNIIM), Saint Petersburg (Russian Federation)

    2009-06-15

    According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5. meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. (authors)

  20. 36 CFR 222.2 - Management of the range environment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Management of the range environment. 222.2 Section 222.2 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... environment. (a) Allotments will be designated on the National Forest System and on other lands under Forest...

  1. 20 CFR 222.52 - When a legally adopted child is dependent-general.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-general. 222.52 Section 222.52 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.52 When a legally adopted...

  2. Radon-222 measurements at Chester

    International Nuclear Information System (INIS)

    Fisenne, I.M.

    1982-01-01

    The Environmental Measurements Laboratory has compiled a five year record of continuous hourly radon-222 measurements at Chester, New Jersey. The data for the 1977-1978, 1978-1979, 1979-1980, and 1980-1981 have been reported previously

  3. 20 CFR 222.58 - When a child is living with an employee.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a child is living with an employee. 222.58 Section 222.58 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.58 When a child is living with an...

  4. Rn 222 in the Black Sea waters

    International Nuclear Information System (INIS)

    Arbuzova, A.P.; Batrakov, G.F.; Eremeev, V.N.; Zemlyanoj, A.D.; Ivanova, T.M.

    1988-01-01

    Results of Rn 222 concentration measurements in the Black Sea waters obtained in the summer of 1986 during the expedition of the Akademik Vernadskij research ship are presented. It is ascertained that the intensity of vertical turbulent exchange produces the main effect on Rn 222 distribution in the sea surface waters. The vertical distribution in a 200 m layer is characterized by the growth of concentration with depth, which is caused by the presence of Ra 226 increased concentration region, that coincides with the boundary layer between oxygen and hydrogen sulfide

  5. Analytical characterization of recombinant hCG and comparative studies with reference product.

    Science.gov (United States)

    Thennati, Rajamannar; Singh, Sanjay Kumar; Nage, Nitin; Patel, Yena; Bose, Sandip Kumar; Burade, Vinod; Ranbhor, Ranjit Sudhakar

    2018-01-01

    Regulatory agencies recommend a stepwise approach for demonstrating biosimilarity between a proposed biosimilar and reference biological product emphasizing for functional and structural characterization to trace if there is any difference which may impact safety and efficacy. We studied the comparative structural and biological attributes of recombinant human chorionic gonadotropin (rhCG), SB005, with reference product, Ovidrel ® and Ovitrelle ® . Recombiant hCG was approved in 2000 by the US Food and Drug Administration for the induction of final follicular maturation, early luteinization in infertile women as part of assisted reproductive technology program. It is also indicated for the induction of ovulation and pregnancy in ovulatory infertile patients whose cause of infertility is not due to ovarian failure. Primary structure was studied by intact mass analysis, peptide fingerprinting, peptide mass fingerprinting and sequence coverage analysis. Higher order structure was studied by circular dichroism, ultraviolet-visible spectroscopy, fluorescence spectroscopy, and disulfide bridge analysis. Different isoforms of reference product and SB005 were identified using capillary isoelectric focusing and capillary zone electrophoresis. Glycosylation was studied by N-glycan mapping using LC-ESI-MS, point of glycosylation, released glycan analysis using ultra performance liquid chromatography and sialic acid analysis. Product related impurities such as oligomer content analysis and oxidized impurities were studied using size exclusion chromatography and reverse phase high performance liquid chromatography, respectively. Biological activity in term of potency of reference product and SB005 was studied by in vivo analysis. In this study we have compared analytical similarity of recombinant rhCG (SB005) produced at Sun Pharmaceuticals with the reference product with respect to its primary, higher order structure, isoforms, charge variants, glycosylation, sialyation

  6. Absolute measurement of the activity of 222Rn using a proportional counter

    International Nuclear Information System (INIS)

    Busch, Ingo; Greupner, Heinz; Keyser, Uwe

    2002-01-01

    A measuring set-up comprising a proportional counter of calculable 222 Rn efficiency and quantifiable active volume (δ V 222 Rn efficiency is determined by computer simulation of the measured α-spectra. The procedures necessary for absolute measurements by means of the counter are described, and the suitability of the counter for absolute measurements of the 222 Rn activity is proved by experiments. Thus, a new method for the realization of the unit of activity of 222 Rn is obtained, which is independent of the unit of activity of 226 Ra

  7. A novel histone deacetylase inhibitor, CG200745, potentiates anticancer effect of docetaxel in prostate cancer via decreasing Mcl-1 and Bcl-XL.

    Science.gov (United States)

    Hwang, Jung Jin; Kim, Yong Sook; Kim, Taelim; Kim, Mi Joung; Jeong, In Gab; Lee, Je-Hwan; Choi, Jene; Jang, Sejin; Ro, Seonggu; Kim, Choung-Soo

    2012-08-01

    We synthesized a novel hydroxamate-based pan-histone deacetylase inhibitor (HDACI), CG200745 {(E)-2-(Naphthalen-1-yloxymethyl)-oct-2-enedioic acid 1-[(3-dimethylamino-propyl)-amide] 8-hydroxyamide]}. Like other inhibitors, for example vorinostat and belinostat, CG200745 has the hydroxamic acid moiety to bind zinc at the bottom of catalytic pocket. Firstly, we analyzed its inhibitory activity against histone deacetylase (HDAC) in hormone-dependent LNCaP cells and hormone-independent DU145 and PC3 cells. CG200745 inhibited deacetylation of histone H3 and tubulin as much as vorinostat and belinostat did. CG200745 also inhibited growth of prostate cancer cells, increased sub-G1 population, and activated caspase-9, -3 and -8 in LNCaP, DU145 and PC3 cells. These results indicate that CG200745 induces apoptosis. Next, we examined the effect of CG200745 on cell death induced by docetaxel in DU145 cells in vitro and in vivo. Compared to mono-treatment with each drug, pre-treatment of DU145 cells with docetaxel followed by CG200745 showed synergistic cytotoxicity, and increased the apoptotic sub-G1 population, caspase activation, and tubulin acetylation. Moreover, the combination treatment decreased Mcl-1 and Bcl-(XL). Docetaxel and CG200745 combination reduced tumor size in the DU145 xenograft model. These preclinical results show that combination treatment with docetaxel and new HDACI, CG200745, potentiated anti-tumor effect in hormone-refractory prostate cancer (HRPC) cells via activation of apoptosis.

  8. Factors affecting radon removal from Rn-222 enriched water

    International Nuclear Information System (INIS)

    Abulfaraj, W.H.; Mamoon, A.

    1994-01-01

    Continued use of potable well water that has elevated levels of Rn-222 is harmful to human health. activated carbon, aeration and heating can remove radon from treated water. Water artificially enriched with Rn-222 using a pitchblende source was studied in a laboratory scale model under controlled conditions. (author), 3 figs., 3 refs

  9. Standards, calibration and quality assurance of 222Rn measurements in Sweden

    International Nuclear Information System (INIS)

    Falk, R.; Hagberg, N.; Mjoenes, L.; Moere, H.; Nyblom, L.; Swedjemark, G.A.

    1994-01-01

    Inhaled decay products of 222 Rn are the dominant components of the natural radiation exposure to the general population. Limits have been introduced in Sweden, and recommendations were made in 1980 for decreasing indoor 222 Rn concentration. The need for the coordinated calibration of measuring instruments as well as for quality assurance was obvious for both health and economic reasons. 222 Rn measurements in Sweden are based on standards traceable to the National Institute of Standard and Technology (NIST) through the use of standard reference material 226 Ra. Standards for both 222 Rn and short-lived 222 Rn progeny are described together with the reference instrument adopted for these studies. The calibration of field instruments was performed in a ''radon room'', a climate chamber in which it is possible to vary and monitor the concentration of 222 Rn as well as other characteristics of the indoor air such as temperature, humidity, ventilation rate and aerosol concentration. The rules and regulations for field measurements imply a calibration of the instruments yearly, as well as accreditation and training for the companies that carry out the measurements. Examples are given of the official measurement protocols used for the different types of instruments. (orig.)

  10. A micromegas detector for {sup 222}Rn emanations measurements

    Energy Technology Data Exchange (ETDEWEB)

    García, J. A.; Garza, J. G.; Irastorza, I. G.; Mirallas, H. [Laboratorio de Física Nuclear y Altas Energías, Universidad de Zaragoza, Zaragoza (Spain)

    2013-08-08

    The {sup 222}Rn emanation has significant contribution in the overall background for rare event searches experiments. In order to measure this emanations a high sensitivity detector has been designed. The detection method is based on the electrostatic collection of the {sup 222}Rn daughters on a Micromegas detector. Using a chamber with a volume of 21.2 l for the collection of {sup 218}Po and {sup 214}Po progeny of {sup 222}Rn and a 12 × 12cm{sup 2} pixelized Micromegas for the α detection. The advantages of the Micromegas detectors are the low intrinsic radioactivity and the track reconstruction of the α’s, having excellent capabilities for event discrimination.

  11. Radon-222 and radium-226 in southeastern Bering Sea shelf waters and sediment

    International Nuclear Information System (INIS)

    Glover, D.M.; Reeburgh, W.S.

    1987-01-01

    Radon-222 and 226 Ra activities were measured in the waters and sediment of the southeastern Bering Sea shelf to evaluate the use of radon as a tracer of gas exchange, water column mixing and sediment-water exchange. Cross-shelf distributions of 222 Rn and 226 Ra are presented. Gas transfer coefficients were estimated using near-surface 222 Rn deficiency measurements. A statistically significant linear relationship between averaged wind speed and transfer coefficient was found. Vertical eddy diffusivities were evaluated by applying a one-dimensional model to near-bottom excess 222 Rn distributions; these diffusivities were compared to independently determined values. The one-dimensional model applied to the near-bottom 222 Rn data was found to be inadequate and a two-dimensional model was applied to improve the fit between model and data. Exchange across the sediment-water interface was computed from the deficiency of 222 Rn measured in sediment cores, standing crop estimates of excess 222 Rn in the water column and 222 Rn production rates of sediment surface grab samples. Biological irrigation of the sediments appeared to be the primary exchange mechanism between the sediment and water columns. Distributions in the water column showed finestructure reported previously and suggested biological removal of 226 Ra. (author)

  12. Effect of human chorionic gonadotropin (hCG) on in vitro oocyte ...

    African Journals Online (AJOL)

    use

    2011-11-23

    Nov 23, 2011 ... In vitro exposure of Barilius vagra ovarian follicles to human chorionic gonadotropin (hCG) .... breakdown (GVBD) by treating them with egg clearing solution ..... trihydroxy-5Я-pregnen-20-one, in female plaice (Pleuronectes.

  13. Viewing MORSE-CG radiation transport with 3-D color graphics

    International Nuclear Information System (INIS)

    Namito, Yoshihito; Jenkins, T.M.; Nelson, W.R.

    1990-01-01

    In this paper we present the coupling of MORSE-CG with the SLAC Unified Graphics System (UGS77) through an add-on package called MORSGRAF which allows for real-time display of neutron and photon tracks in the Monte Carlo simulation. In addition to displaying the myriad of complicated geometries that can be created with the MORSE Combinatorial Geometry program, MORSGRAF permits color tagging of neutrons (green) and photons (red) with the variation of track intensity an indicator of the energy of the particle. Particle types can be switched off and on by means of a mouse-icon system, and the perspective can be changed (i.e., rotated, translated, and zoomed). MORSGRAF also allows one to display the propagation of radiation through shields and mazes on an ordinary graphics terminal, as well as in documents printed on a laser printer. Several examples will be given to demonstrate the various capabilities of MORSGRAF coupled to MORSE-CG. 12 refs., 8 figs

  14. Electron correlation in molecules: concurrent computation Many-Body Perturbation Theory (ccMBPT) calculations using macrotasking on the NEC SX-3/44 computer

    International Nuclear Information System (INIS)

    Moncrieff, D.; Wilson, S.

    1992-06-01

    The ab initio determination of the electronic structure of molecules is a many-fermion problem involving the approximate description of the motion of the electrons in the field of fixed nuclei. It is an area of research which demands considerable computational resources but having enormous potential in fields as diverse as interstellar chemistry and drug design, catalysis and solid state chemistry, molecular biology and environmental chemistry. Electronic structure calculations almost invariably divide into two main stages: the approximate solution of an independent electron model, in which each electron moves in the average field created by the other electrons in the system, and then, the more computationally demanding determination of a series of corrections to this model, the electron correlation effects. The many-body perturbation theory expansion affords a systematic description of correlation effects, which leads directly to algorithms which are suitable for concurrent computation. We term this concurrent computation Many-Body Perturbation Theory (ccMBPT). The use of a dynamic load balancing technique on the NEC SX-3/44 computer in electron correlation calculations is investigated for the calculation of the most demanding energy component in the most accurate of contemporary ab initio studies. An application to the ground state of the nitrogen molecule is described. We also briefly discuss the extent to which the calculation of the dominant corrections to such studies can be rendered computationally tractable by exploiting both the vector processing and parallel processor capabilities of the NEC SX-3/44 computer. (author)

  15. 40 CFR 22.2 - Use of number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Use of number and gender. 22.2 Section... PERMITS General § 22.2 Use of number and gender. As used in these Consolidated Rules of Practice, words in the singular also include the plural and words in the masculine gender also include the feminine, and...

  16. Comment: 222 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available 222.png Shinobu Okamoto (Kazusa DNA Research Institute ) licensed under CC Attribution2.1 Japan シアノバクテリア 光学顕微鏡写真 撮影:岡本忍(かずさDNA研究所) bando 2010/02/15 15:28:38 2010/02/16 10:25:09 ...

  17. Easy fix for clinical laboratories for the false-positive defect with the Abbott AxSym total beta-hCG test.

    Science.gov (United States)

    Cole, Laurence A; Khanlian, Sarah A

    2004-05-01

    False-positive hCG results can lead to erroneous diagnoses and needless chemotherapy and surgery. In the last 2 years, eight publications described cases involving false-positive hCG tests; all eight involved the AxSym test. We investigated the source of this abundance of cases and a simple fix that may be used by clinical laboratories. False-positive hCG was primarily identified by absence of hCG in urine and varying or negative hCG results in alternative tests. Seventeen false-positive serum samples in the AxSym test were evaluated undiluted and at twofold dilution with diluent containing excess goat serum or immunoglobulin. We identified 58 patients with false-positive hCG, 47 of 58 due to the Abbott AxSym total hCGbeta test (81%). Sixteen of 17 of these "false-positive" results (mean 100 mIU/ml) became undetectable when tested again after twofold dilution. A simple twofold dilution with this diluent containing excess goat serum or immunoglobulin completely protected 16 of 17 samples from patients having false-positive results. It is recommended that laboratories using this test use twofold dilution as a minimum to prevent false-positive results.

  18. Visualization of reaction mechanism by CG based on quantum ...

    African Journals Online (AJOL)

    In this work, the change in the molecular configuration in fundamental chemical reactions such as, F + HCl ¨ HF + Cl, I + H2¨ HI + H, OH- + CH3Cl ¨ CH3OH + Cl-, and esterification of acetic acid and ethyl alcohol were visualized by the quantum chemical calculation MOPAC with PM5 Hamiltonian. The CG teaching material ...

  19. Effects of equine chorionic gonadotropin (eCG) administration and ...

    African Journals Online (AJOL)

    Pregnancy rate in group F was more than the control group (p < 0.05). Twinning rates and kid crops in groups E+F and F were significantly higher than control group (p < 0.05). Time of onset of estrus decreased in groups with eCG administration (E and E+F). Therefore, it is concluded that the flushing especially coupled with ...

  20. Histone deacetylase inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in DOCA-induced hypertensive rats

    OpenAIRE

    Lee, Eunjo; Song, Min-ji; Lee, Hae-Ahm; Kang, Seol-Hee; Kim, Mina; Yang, Eun Kyoung; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Kim, Inkyeom

    2016-01-01

    CG200745 is a novel inhibitor of histone deacetylases (HDACs), initially developed for treatment of various hematological and solid cancers. Because it is water-soluble, it can be administered orally. We hypothesized that the HDAC inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in deoxycorticosterone acetate (DOCA)-induced hypertensive rats. For establishment of hypertension, 40 mg/kg of DOCA was subcutaneously injected four times weekly into Sprague-Dawley rats. All the rats...

  1. Primary measuring of equipment factor of 222Rn/220Rn indoor

    International Nuclear Information System (INIS)

    Liu Yanyang; Liu Fudong; Wang Chunhong; Sheng Mingwei

    2010-01-01

    The activity concentration of 222 Rn, 220 Rn and their progenies of certain working places and dwellings in Baotou city were measured simultaneously. Based on these results, the equipment factor of 222 Rn is 0.35 for working places and 0.43 for dwellings, while equipment factor of 220 Rn measured at 20 cm distance from wall is 0.030 for both working places and dwellings. Preliminary results show that the temporal change of 220 Rn equilibrium equivalent concentration is same as 222 Rn which is high in midnight and low in afternoon,and significant difference between instant and accumulated measure result of 222 Rn, 220 Rn activity concentration is found, with the factor of 2.1 and 1.7. (authors)

  2. Development of 360-W LD pumped Nd:YAG amplifier with a phase conjugation mirror

    International Nuclear Information System (INIS)

    Kiriyama, Hiromitsu; Nagai, Toru; Yamakawa, Koichi; Kageyama, Nobuto; Miyajima, Hirofumi; Kan, Hirofumi; Yoshida, Hidetsugu; Nakatsuka, Masahiro

    2004-01-01

    We report on a high-average-power laser-diode (LD) pumped Nd:YAG master-oscillator-power-amplifier (MOPA) system with a minimum number of element for the single multi-pass zigzag-slab amplifier-stage for pumping of a high-peak and high-average power Ti:sapphire laser system. This phase conjugated system produces an average-power of 362 W at 1 kHz in a 30 ns pulse with an optical-to-optical conversion efficiency of 14%. With an external KTP doubler, this system generates 132 W of green average-output-power at 1 kHz with a conversion efficiency of 60% when pumped at a power level of 222 W. To the best of our knowledge, these results represent the highest average-output-power at both infrared and green wavelengths achieved in a single-amplifier-stage. (author)

  3. CG200745, an HDAC inhibitor, induces anti-tumour effects in cholangiocarcinoma cell lines via miRNAs targeting the Hippo pathway.

    Science.gov (United States)

    Jung, Dawoon E; Park, Soo Been; Kim, Kahee; Kim, Chanyang; Song, Si Young

    2017-09-07

    Cholangiocarcinoma is a devastating malignancy with fatal complications that exhibits low response and resistance to chemotherapy. Here, we evaluated the anticancer effects of CG200745, a novel histone deacetylase inhibitor, either alone or in combination with standard chemotherapy drugs in cholangiocarcinoma cells. CG200745 dose-dependently reduced the viability of cholangiocarcinoma cells in vitro and decreased tumour volume and weight in a xenograft model. Administering CG200745 along with other chemotherapeutic agents including gemcitabine, 5-fluorouracil (5-FU), cisplatin, oxaliplatin, or gemcitabine plus cisplatin further decreased cholangiocarcinoma cell viability, with a combination index CG200745 also enhanced the sensitivity of gemcitabine-resistant cells to gemcitabine and 5-FU, thereby decreasing cell viability and inducing apoptosis. This was accompanied by downregulation of YAP, TEAD4, TGF-β2, SMAD3, NOTCH3, HES5, Axl, and Gas6 and upregulation of the miRNAs miR-22-3p, miR-22-5p, miR-194-5p, miR-194-3p, miR-194-5p, miR-210-3p, and miR-509-3p. The Ingenuity Pathway Analysis revealed that CG200745 mainly targets the Hippo signalling pathway by inducing miR-509-3p expression. Thus, CG200745 inhibits cholangiocarcinoma growth in vitro and in vivo, and acts synergistically when administered in combination with standard chemotherapeutic agents, enabling dose reduction. CG200745 is therefore expected to improve the outcome of cholangiocarcinoma patients who exhibit resistance to conventional therapies.

  4. First Impressions of a Scintrex CG-6 Portable Gravimeter in an Extensive Field Campaign

    Science.gov (United States)

    van Westrum, D.; Kanney, J.

    2017-12-01

    First Impressions of a Scintrex CG-6 Portable Gravimeter in an Extensive Field Campaign AGU Fall Meeting 2017 Derek van Westrum and Jeff Kanney NOAA's National Geodetic Survey conducted its third and final Geoid Slope Validation Survey (GSVS) this past summer in the rugged mountains of southern Colorado. In addition to leveling, long period GPS, and defelction of vertical observations, absolute gravity and vertical gravity gradients were measured at 235 bench marks (approximately 1.5 km spacing) along US-160 between Durango and Walsenburg, Colorado. In previous surveys (Texas-2011 and Iowa-2014), an A10 absolute gravimeter was used to measure graivty at approximately 10-15% of the bench marks. The remaining marks were determined by using LaCoste & Romberg relative gravimeters. The same relative instruments were also used to measure two-tier (linear) vertical gravity gradients at the A10 sites. In the current work - becuase of the rapidly changing terrain in the Rocky Mountains - it was decided to employ the A10 at all 235 bench marks, and acquire three-tier (quadratic) gradients at every bench mark using the new Scintrex CG-6 Autograv relative gravimeter. Using these results, we will provide a real worldsummary of the CG-6's behavior by examining noise levels, repeatability, and acquisition rates. In addition, the coincident A10 absolute data set allows us to evaluate the CG-6's accuracy, and allows us to simulate and discuss various relative gravity survey designs.

  5. A study of the Herbig-Haro object HH 120 and the associated cometary globule CG 30

    International Nuclear Information System (INIS)

    Pettersson, B.

    1984-01-01

    Infrared and spectroscopic observations are presented of a new Herbig-Haro object, here named HH 120, in the cometary globule CG 30. The emission line spectrum indicates a very low degree of excitation of the same order as that found for HH 47, HH 7, and HH 11. From several spectra a radial velocity of -42 km -1 +-12 km s -1 is deduced and the electron temperature, Tsub(e), and electron number density, Nsub(e), are found to be 9100 K+-400 K and 1700 cm -3 +-600 cm -3 , respectively. A prominent continuum is shown to be composed of a collisionally enhanced two-photon continuum and a reflected late-type stellar component, probably originating in the hidden source of energy. Infrared scans of CG 30 revealed five sources, two of which are very close to HH 120. It is argued that one of them, CG 30-IRS4, is the source of energy producing HH 120 and an associated reflection nebula. The bolometric luminosity of CG 30-IRS4 is estimated to be at least 0.9 Lsub(sun), its mass 1.1 Msub(sun) and its radius 1.6 Rsub(sun). (orig.)

  6. CG200745, an HDAC inhibitor, induces anti-tumour effects in cholangiocarcinoma cell lines via miRNAs targeting the Hippo pathway

    OpenAIRE

    Jung, Dawoon E.; Park, Soo Been; Kim, Kahee; Kim, Chanyang; Song, Si Young

    2017-01-01

    Cholangiocarcinoma is a devastating malignancy with fatal complications that exhibits low response and resistance to chemotherapy. Here, we evaluated the anticancer effects of CG200745, a novel histone deacetylase inhibitor, either alone or in combination with standard chemotherapy drugs in cholangiocarcinoma cells. CG200745 dose-dependently reduced the viability of cholangiocarcinoma cells in vitro and decreased tumour volume and weight in a xenograft model. Administering CG200745 along with...

  7. 28 CFR 22.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... is obtained for purposes directly related to enforcement of the criminal laws. (d) Research or... Administration DEPARTMENT OF JUSTICE CONFIDENTIALITY OF IDENTIFIABLE RESEARCH AND STATISTICAL INFORMATION § 22.2... capacity. (c) Research or statistical project means any program, project, or component thereof which is...

  8. Regulation of the angiopoietin-2 gene by hCG in ovarian cancer cell line OVCAR-3.

    Science.gov (United States)

    Pietrowski, D; Wiehle, P; Sator, M; Just, A; Keck, C

    2010-05-01

    Angiogenesis is a crucial step in growing tissues including many tumors. It is regulated by pro- and antiangiogenic factors including the family of angiopoietins and their corresponding receptors. In previous work we have shown that in human ovarian cells the expression of angiopoietin 2 (ANG2) is regulated by human chorionic gonadotropin (hCG). To better understand the mechanisms of hCG-dependent regulation of the ANG2-gene we have now investigated upstream regulatory active elements of the ANG2-promoter in the ovarian carcinoma cell line OVCAR-3. We cloned several ANG2-promoter-fragments of different lengths into a luciferase reporter-gene-vector and analyzed the corresponding ANG2 expression before and after hCG stimulation. We identified regions of the ANG2-promoter between 1 048 bp and 613 bp upstream of the transcriptional start site where hCG-dependent pathways promote a significant downregulation of gene expression. By sequence analysis of this area we found several potential binding sites for transcription factors that are involved in regulation of ANG2-expression, vascular development and ovarian function. These encompass the forkhead family transcription factors FOXC2 and FOXO1 as well as the CCAAT/enhancer binding protein family (C/EBP). In conclusion, we have demonstrated that the regulation of ANG2-expression in ovarian cancer cells is hCG-dependent and we suggest that forkhead transcription factor and C/EBP-dependent pathways are involved in the regulation of ANG2-expression in ovarian cancer cells. Georg Thieme Verlag KG Stuttgart-New York.

  9. Desempenho reprodutivo de cabras alpinas tratadas com hCG cinco dias após o acasalamento Reproductive performance of alpine goats treated with hCG five days after breeding

    Directory of Open Access Journals (Sweden)

    Jeferson Ferreira da Fonseca

    2005-04-01

    Full Text Available Objetivou-se com este estudo avaliar o efeito da administração de hCG sobre o desempenho reprodutivo de cabras Alpinas durante a estação de acasalamento natural. Trinta e duas fêmeas nulíparas e 124 lactantes, após a identificação de estro e acasalamento, foram aleatoriamente divididas, de acordo com a categoria, em dois tratamentos. Em T1 (n=75 e T2 (n=81, os animais receberam 1 mL de solução salina ou 250 UI de hCG, respectivamente, por via intramuscular cinco dias após o acasalamento. A gestação foi verificada por ultra-sonografia transabdominal (probe de 3,5 MHz nos dias 35 e 70 após o acasalamento, para detecção e confirmação da gestação, respectivamente. As taxas de gestação não diferiram entre T1 (86,7% e T2 (70,6% para nulíparas e T1 (78,3 % e T2 (84,4 % para lactantes. Não houve diferença entre a taxa de parição (75,0 e 75,7%, o período de gestação (150,47 e 150,80 dias e a prolificidade (1,75 e 1,80 fetos entre os animais do T1 e T2, respectivamente. A prolificidade foi superior em cabras lactantes (1,90 que em nulíparas (1,41. A administração de hCG cinco dias após o acasalamento não elevou o desempenho reprodutivo em cabras da raça Alpina.The effect of hCG administration on reproductive performance of Alpine goats during the natural breeding season was evaluated. Thirty-two nulliparous and 124 lactating goats, after estrus identification and breeding, were randomly assigned according to the categories to two treatments. In T1 (n=75 and T2 (n=81 the animals received 1 mL of saline solution or 250 IU of hCG intramuscularly, respectively, five days after breeding. Pregnancy was detected and confirmed on days 35 and 70 after breeding by transabdominal ultrasonography (3.5 MHz probe, respectively. Pregnancy rate did not differ between T1 (86.7 % and T2 (70.6% for nulliparous and T1 (78.3% and T2 (84.4% for lactating does. There were no differences for kidding rate (75.0 and 75.7%, gestation period

  10. Intrafollicular Endocrine Milieu After Addition of hCG to Recombinant FSH During Controlled Ovarian Stimulation for In Vitro Fertilization

    DEFF Research Database (Denmark)

    Thuesen, L L; Andersen, A Nyboe; Loft, A

    2014-01-01

    CONTEXT: The role of human chorionic gonadotropin (hCG) supplementation on the intrafollicular steroid milieu has been studied. OBJECTIVE: The objective of the study was to assess the impact on steroid levels in follicular fluids (FFs) after different doses of hCG supplementation to recombinant FSH...... protocol with recombinant FSH 150 IU/d and randomized from stimulation day 1 to supplementation with hCG: D0, 0 IU/d; D50, 50 IU/d; D100, 100 IU/d; and D150, 150 IU/d. MAIN OUTCOME MEASURE: Intrafollicular hormone concentrations in relation to treatment groups, follicular sizes, and embryo quality were...... measured. RESULTS: In large follicles, hCG supplementation induced a nearly 3-fold increase of estradiol (nanomoles per liter) [D0: 1496; D50: 3138; D100: 4338; D150: 4009 (P

  11. Rn-222 release to the environment: comparison between different granite sources

    International Nuclear Information System (INIS)

    Mamoon, M.; Kamal, S.M.

    2005-01-01

    In this work three different types of granites were studied, namely: pure granite, alkali granite and altered (hydrated) alkali granite. General radioactivity of the granites was studied along with the potential for 222 Rn emanation. The study indicated that altered alkali granite releases, relatively, the highest 222 Rn emanation to the surrounding air while alkali granite emits the more intense gamma radiation of the three granites. Hence, altered alkali granite can be used as a laboratory source for 222 Rn.

  12. MicroRNA-221 and -222 Regulate Radiation Sensitivity by Targeting the PTEN Pathway

    International Nuclear Information System (INIS)

    Zhang Chunzhi; Kang Chunsheng; Wang Ping; Cao Yongzhen; Lv Zhonghong; Yu Shizhu; Wang Guangxiu; Zhang Anling; Jia Zhifan; Han Lei; Yang Chunying; Ishiyama, Hiromichi; Teh, Bin S.; Xu Bo; Pu Peiyu

    2011-01-01

    Purpose: MicroRNAs (miRNAs) are noncoding RNAs inhibiting expression of numerous target genes by posttranscriptional regulation. miRNA-221 and miRNA-222 (miRNA-221/-222) expression is elevated in radioresistant tumor cell lines; however, it is not known whether and how miRNAs control cellular responses to ionizing irradiation. Methods and Materials: We used bioinformatic analyses, luciferase reporter assay, and genetic knockdown and biochemical assays to characterize the regulation pathways of miRNA-221/-222 in response to radiation treatment. Results: We identified the PTEN gene as a target of miRNA-221/-222. Furthermore, we found that knocking down miRNA-221/-222 by antisense oligonucleotides upregulated PTEN expression. Upregulated PTEN expression suppressed AKT activity and increased radiation-induced apoptosis, resulting in enhancement of radiosensitivity in tumor cells. Conclusions: miRNA-221/-222 control radiation sensitivity by regulating the PTEN/AKT pathway and can be explored as novel targets for radiosensitization.

  13. Clinical significance of changes of serum TBA, CG, HA levels in neonate with parenteral nutrition

    International Nuclear Information System (INIS)

    Huang Weiliang; Zhou Jiongying; Zhang Xiaoyi; Lv Weihua; Ma Yunbao; He Qizhi

    2010-01-01

    Objective: To study the clinical significance of changes of serum levels of TBA, CG, HA in neonate with parenteral nutrition. Methods: Serum total bile acid (TBA, with biochemistry) and CG, HA (with RIA) contents were measured in 52 neonates (full-term 32, preterm 20) with parenteral nutrition and 28 neonates (full-term 16, preterm 12) without parenteral nutrition (as controls). Results: Before parenteral nutrition,the serum TBA, CG and HA levels in full-term neonates were not significantly different from those in the controls (P>0.05). After parenteral nutrition,serum levels were significantly higher than those before parenteral nutrition (P<0.01). The levels in pre-term neonates were significantly higher after parenteral nutrition than those in full-term neonates (P<0.05). Conclusion: Long term parenteral nutrition might be harmful to hepatic and gall bladder function in neonates especially in premature ones. (authors)

  14. PecS regulates the urate-responsive expression of type 1 fimbriae in Klebsiella pneumoniae CG43.

    Science.gov (United States)

    Wang, Zhe-Chong; Liu, Chia-Jui; Huang, Ying-Jung; Wang, Yu-Seng; Peng, Hwei-Ling

    2015-12-01

    In the Klebsiella pneumoniae CG43 genome, the divergently transcribed genes coding for PecS, the MarR-type transcription factor, and PecM, the drug metabolite transporter, are located between the type 1 and type 3 fimbrial gene clusters. The intergenic sequence pecO between pecS and pecM contains three putative PecS binding sites and a CpxR box. Electrophoretic mobility shift assay revealed that the recombinant PecS and CpxR could specifically bind to the pecO sequence, and the specific interaction of PecS and pecO could be attenuated by urate. The expression of pecS and pecM was negatively regulated by CpxAR and PecS, and was inducible by exogenous urate in the absence of cpxAR. Compared with CG43S3ΔcpxAR, the derived mutants CG43S3ΔcpxARΔpecS and CG43S3ΔcpxARΔpecSΔpecM exerted similar levels of sensitivity to H2O2 or paraquat, but higher levels of mannose-sensitive yeast agglutination activity and FimA production. The promoter activity and transcript levels of fimA in CG43S3ΔcpxAR were also increased by deleting pecS. However, no binding activity between PecS and the fimA promoter could be observed. Nevertheless, PecS deletion could reduce the expression of the global regulator HNS and release the negative effect of HNS on FimA expression. In CG43S3ΔcpxAR, the expression of FimA as well as PecS was inducible by urate, whilst urate-induced FimA expression was inhibited by the deletion of pecS. Taken together, we propose that K. pneumoniae PecS indirectly and negatively regulates the expression of type 1 fimbriae, and the regulation is urate-inducible in the absence of CpxAR.

  15. bZIP transcription factor CgAP1 is essential for oxidative stress tolerance and full virulence of the poplar anthracnose fungus Colletotrichum gloeosporioides.

    Science.gov (United States)

    Sun, Yingjiao; Wang, Yonglin; Tian, Chengming

    2016-10-01

    Yeast AP1 transcription factor is a regulator of oxidative stress response. Here, we report the identification and characterization of CgAP1, an ortholog of YAP1 in poplar anthracnose fungus Colletotrichum gloeosporioides. The expression of CgAP1 was highly induced by reactive oxygen species. CgAP1 deletion mutants displayed enhanced sensitivity to oxidative stress compared with the wild-type strain, and their poplar leaf virulence was obviously reduced. However, the mutants exhibited no obvious defects in aerial hyphal growth, conidia production, and appressoria formation. CgAP1::eGFP fusion protein localized to the nucleus after TBH (tert-Butyl hydroperoxide) treatment, suggesting that CgAP1 functions as a redox sensor in C. gloeosporioides. In addition, CgAP1 prevented the accumulation of ROS during early stages of biotrophic growth. CgAP1 also acted as a positive regulator of several ROS-related genes (i.e., Glr1, Hyr1, and Cyt1) involved in the antioxidative response. These results highlight the key regulatory role of CgAP1 transcription factor in oxidative stress response and provide insights into the function of ROS detoxification in virulence of C. gloeosporioides. Copyright © 2016 Elsevier Inc. All rights reserved.

  16. Applications of environmental radon-222 to some cases of water circulation

    International Nuclear Information System (INIS)

    Kimura, S.; Komae, T.

    1980-01-01

    We have proposed three methods to analyze water circulation and the changes caused by human activities by studying the changing distribution patterns of 222 Rn concentrations in water. We investigated the results by applying the methods to some water circulation problems of Japan. The first method was a detailed analysis of the hydrogeological structure of an area, using the fact that the 222 Rn concentration of water takes a value characteristic of the aquifer. In the second method we analyzed the state of mixing of surface water and groundwater by taking advantage of the fact that the 222 Rn concentrations of the two are quite different. In the third method, we used the differing 222 Rn concentrations in vadose water and in retention water to analyze the pressure acting on the aquifer or the groundwater

  17. 49 CFR Appendix B to Part 222 - Alternative Safety Measures

    Science.gov (United States)

    2010-10-01

    .... 222, App. B Appendix B to Part 222—Alternative Safety Measures Introduction A public authority seeking... requirements associated with an SSM as listed in appendix A is revised or deleted, data or analysis supporting...); d. Photographic or video equipment deployed to capture images sufficient to document the violation...

  18. 48 CFR 222.7301 - Prohibition on use of nonimmigrant aliens.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Prohibition on use of nonimmigrant aliens. 222.7301 Section 222.7301 Federal Acquisition Regulations System DEFENSE ACQUISITION... aliens. (a) Any alien who is issued a visa or otherwise provided nonimmigrant status under Section 101(a...

  19. 49 CFR 222.51 - Under what conditions will quiet zone status be terminated?

    Science.gov (United States)

    2010-10-01

    ...-Quiet Zones § 222.51 Under what conditions will quiet zone status be terminated? (a) New Quiet Zones... 49 Transportation 4 2010-10-01 2010-10-01 false Under what conditions will quiet zone status be terminated? 222.51 Section 222.51 Transportation Other Regulations Relating to Transportation (Continued...

  20. Factors controlling temporal variability of near-ground atmospheric 222Rn concentration over central Europe

    Science.gov (United States)

    Zimnoch, M.; Wach, P.; Chmura, L.; Gorczyca, Z.; Rozanski, K.; Godlowska, J.; Mazur, J.; Kozak, K.; Jeričević, A.

    2014-09-01

    Concentration of radon (222Rn) in the near-ground atmosphere has been measured quasi-continuously from January 2005 to December 2009 at two continental sites in Europe: Heidelberg (south-west Germany) and Krakow (southern Poland). The atmosphere was sampled at ca. 30 and 20 m above the local ground. Both stations were equipped with identical instruments. Regular observations of 222Rn were supplemented by measurements of surface fluxes of this gas in the Krakow urban area, using two different approaches. The measured concentrations of 222Rn varied at both sites in a wide range, from less than 2.0 Bq m-3 to approximately 40 Bq m-3 in Krakow and 35 Bq m-3 in Heidelberg. The mean 222Rn content in Krakow, when averaged over the entire observation period, was 30% higher than in Heidelberg (5.86 ± 0.09 and 4.50 ± 0.07 Bq m-3, respectively). Distinct seasonality of 222Rn signal is visible in the obtained time series of 222Rn concentration, with higher values recorded generally during late summer and autumn. The surface 222Rn fluxes measured in Krakow also revealed a distinct seasonality, with broad maximum observed during summer and early autumn and minimum during the winter. When averaged over a 5-year observation period, the night-time surface 222Rn flux was equal to 46.8 ± 2.4 Bq m-2 h-1. Although the atmospheric 222Rn levels at Heidelberg and Krakow appeared to be controlled primarily by local factors, it was possible to evaluate the "continental effect" in atmospheric 222Rn content between both sites, related to gradual build-up of 222Rn concentration in the air masses travelling between Heidelberg and Krakow. The mean value of this build-up was equal to 0.78 ± 0.12 Bq m-3. The measured minimum 222Rn concentrations at both sites and the difference between them was interpreted in the framework of a simple box model coupled with HYSPLIT (Hybrid Single Particle Lagrangian Integrated Trajectory) analysis of air mass trajectories. The best fit of experimental data was

  1. Enhancement of curcumin oral absorption and pharmacokinetics of curcuminoids and curcumin metabolites in mice

    Science.gov (United States)

    Zhongfa, Liu; Chiu, Ming; Wang, Jiang; Chen, Wei; Yen, Winston; Fan-Havard, Patty; Yee, Lisa D.; Chan, Kenneth K.

    2012-01-01

    Purpose Curcumin has shown a variety of biological activity for various human diseases including cancer in preclinical setting. Its poor oral bioavailability poses significant pharmacological barriers to its clinical application. Here, we established a practical nano-emulsion curcumin (NEC) containing up to 20% curcumin (w/w) and conducted the pharmacokinetics of curcuminoids and curcumin metabolites in mice. Methods This high loading NEC was formulated based on the high solubility of curcumin in polyethylene glycols (PEGs) and the synergistic enhancement of curcumin absorption by PEGs and Cremophor EL. The pharmacokinetics of curcuminoids and curcumin metabolites was characterized in mice using a LC–MS/MS method, and the pharmacokinetic parameters were determined using WinNonlin computer software. Results A tenfold increase in the AUC0→24h and more than 40-fold increase in the Cmax in mice were observed after an oral dose of NEC compared with suspension curcumin in 1% methylcellulose. The plasma pharmacokinetics of its two natural congeners, demethoxycurcumin and bisdemethoxycurcumin, and three metabolites, tetrahydrocurcumin (THC), curcumin-O-glucuronide, and curcumin-O-sulfate, was characterized for the first time in mice after an oral dose of NEC. Conclusion This oral absorption enhanced NEC may provide a practical formulation to conduct the correlative study of the PK of curcuminoids and their pharmacodynamics, e.g., hypomethylation activity in vivo. PMID:21968952

  2. 39 CFR 222.2 - Authority to administer oaths or function as notaries public.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Authority to administer oaths or function as notaries public. 222.2 Section 222.2 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION DELEGATIONS OF AUTHORITY § 222.2 Authority to administer oaths or function as notaries public. (a...

  3. hCG-dependent regulation of angiogenic factors in human granulosa lutein cells.

    Science.gov (United States)

    Phan, B; Rakenius, A; Pietrowski, D; Bettendorf, H; Keck, C; Herr, D

    2006-07-01

    As prerequisite for development and maintenance of many diseases angiogenesis is of particular interest in medicine. Pathologic angiogenesis takes place in chronic arthritis, collagen diseases, arteriosclerosis, retinopathy associated with diabetes, and particularly in cancers. However, angiogenesis as a physiological process regularly occurs in the ovary. After ovulation the corpus luteum is formed by rapid vascularization of initially avascular granulosa lutein cell tissue. This process is regulated by gonadotropic hormones. In order to gain further insights in the regulatory mechanisms of angiogenesis in the ovary, we investigated these mechanisms in cell culture of human granulosa lutein cells. In particular, we determined the expression and production of several angiogenic factors including tissue inhibitor of matrix metalloproteinases-1 (TIMP-1), Leptin, connective tissue growth factor (CTGF), meningioma-associated complimentary DNA (Mac25), basic fibroblast growth factor (bFGF), and Midkine. In addition, we showed that human chorionic gonadotropin (hCG) has distinct effects on their expression and production. hCG enhances the expression and production of TIMP-1, whereas it downregulates the expression of CTGF and Mac25. Furthermore it decreases the expression of Leptin. Our results provide evidence that hCG determines growth and development of the corpus luteum by mediating angiogenic pathways in human granulosa lutein cells. Hence we describe a further approach to understand the regulation of angiogenesis in the ovary.

  4. 12 CFR 222.21 - Affiliate marketing opt-out and exceptions.

    Science.gov (United States)

    2010-01-01

    ... solicitation for marketing purposes to a consumer with whom you have a pre-existing business relationship; (2... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Affiliate marketing opt-out and exceptions. 222... FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.21 Affiliate...

  5. A paralogue of the phosphomutase-like gene family in Candida glabrata, CgPmu2, gained broad-range phosphatase activity due to a small number of clustered substitutions.

    Science.gov (United States)

    Orlando, Kelly A; Iosue, Christine L; Leone, Sarah G; Davies, Danielle L; Wykoff, Dennis D

    2015-10-15

    Inorganic phosphate is required for a range of cellular processes, such as DNA/RNA synthesis and intracellular signalling. The phosphate starvation-inducible phosphatase activity of Candida glabrata is encoded by the gene CgPMU2 (C. glabrata phosphomutase-like protein). CgPMU2 is part of a three-gene family (∼75% identical) created through gene duplication in the C. glabrata clade; only CgPmu2 is a PHO-regulated broad range acid phosphatase. We identified amino acids that confer broad range phosphatase activity on CgPmu2 by creating fusions of sections of CgPMU2 with CgPMU1, a paralogue with little broad range phosphatase activity. We used site-directed mutagenesis on various fusions to sequentially convert CgPmu1 to CgPmu2. Based on molecular modelling of the Pmu proteins on to a histidine phosphatase crystal structure, clusters of amino acids were found in two distinct regions that were able to confer phosphatase activity. Substitutions in these two regions together conferred broad phosphatase activity on CgPmu1. Interestingly, one change is a histidine adjacent to the active site histidine of CgPmu2 and it exhibits a novel ability to partially replace the conserved active site histidine in CgPmu2. Additionally, a second amino acid change was able to confer nt phosphatase activity to CgPmu1, suggesting single amino acid changes neofunctionalize CgPmu2. © 2015 Authors; published by Portland Press Limited.

  6. Predictive value of modeled AUC(AFP-hCG), a dynamic kinetic parameter characterizing serum tumor marker decline in patients with nonseminomatous germ cell tumor.

    Science.gov (United States)

    You, Benoit; Fronton, Ludivine; Boyle, Helen; Droz, Jean-Pierre; Girard, Pascal; Tranchand, Brigitte; Ribba, Benjamin; Tod, Michel; Chabaud, Sylvie; Coquelin, Henri; Fléchon, Aude

    2010-08-01

    The early decline profile of alpha-fetoprotein (AFP) and human chorionic gonadotropin (hCG) in patients with nonseminomatous germ cell tumors (NSGCT) treated with chemotherapy may be related to the risk of relapse. We assessed the predictive values of areas under the curve of hCG (AUC(hCG)) and AFP (AUC(AFP)) of modeled concentration-time equations on progression-free survival (PFS). Single-center retrospective analysis of hCG and AFP time-points from 65 patients with IGCCCG intermediate-poor risk NSGCT treated with 4 cycles of bleomycin-etoposide-cisplatin (BEP). To determine AUC(hCG) and AUC(AFP) for D0-D42, AUCs for D0-D7 were calculated using the trapezoid rule and AUCs for D7-D42 were calculated using the mathematic integrals of equations modeled with NONMEM. Combining AUC(AFP) and AUC(hCG) enabled us to define 2 predictive groups: namely, patients with favorable and unfavorable AUC(AFP-hCG). Survival analyses and ROC curves assessed the predictive values of AUC(AFP-hCG) groups regarding progression-free survival (PFS) and compared them with those of half-life (HL) and time-to-normalization (TTN). Mono-exponential models best fit the patterns of marker decreases. Patients with a favorable AUC(AFP-hCG) had a significantly better PFS (100% vs 71.5%, P = .014). ROC curves confirmed the encouraging predictive accuracy of AUC(AFP-hCG) against HL or TTN regarding progression risk (ROC AUCs = 79.6 vs 71.9 and 70.2 respectively). Because of the large number of patients with missing data, multivariate analysis could not be performed. AUC(AFP-hCG) is a dynamic parameter characterizing tumor marker decline in patients with NSGCT during BEP treatment. Its value as a promising predictive factor should be validated. Copyright 2010 Elsevier Inc. All rights reserved.

  7. Oxidation and Volatilization from Tantalum Alloy T-222 During Air Exposure

    Energy Technology Data Exchange (ETDEWEB)

    Smolik, Galen Richard; Petti, David Andrew; Sharpe, John Phillip; Schuetz, Stanley Thomas

    2000-10-01

    Tantalum alloys are one of the refractory metals with renewed consideration for high temperatures in fusion reactor applications. Tantalum alloys perform well in protective environments but oxidized readily in gases containing higher oxygen levels. In addition, the radioactive isotope Ta-182 would be produced in tantalum and could be a significant contributor to dose if mobilized. Other isotopes of importance are produced from tungsten and hafnium. Mobilization of activated products during an accident with air ingress is therefore a safety issue. In this study, we measured the extent of oxidation and mobilization from tantalum alloy T-222 oxidized in flowing air between 500 and 1200°C. This alloy nominally contains 10 wt% tungsten, 2.5 wt% hafnium and 0.01 wt% carbon. We found that the mobilization of Ta and Hf was closely linked to the occurrence of oxide spalling. These elements showed no migration from the test chamber. Some W was mobilized by volatilization as evidenced by transport from the chamber. Tungsten volatilization could occur primarily during initial stages of oxidation before an oxide scale forms and impedes the process. The mobilization of Ta and W are presented in terms of the mass flux (g/m 2 -h) as a function of test temperature. These measurements along with specific designs, activation calculations, and accident scenarios provide information useful for dose calculations of future fusion devices

  8. Oxidation and Volatilization from Tantalum Alloy T-222 During Air Exposure

    Energy Technology Data Exchange (ETDEWEB)

    Smolik, G.R.; Petti, D.A.; Sharpe, J.P.; Schuetz, S.T.

    2000-10-31

    Tantalum alloys are one of the refractory metals with renewed consideration for high temperatures in fusion reactor applications. Tantalum alloys perform well in protective environments but oxidized readily in gases containing higher oxygen levels. In addition, the radioactive isotope Ta-182 would be produced in tantalum and could be a significant contributor to dose if mobilized. Other isotopes of importance are produced from tungsten and hafnium. Mobilization of activated products during an accident with air ingress is therefore a safety issue. In this study, we measured the extent of oxidation and mobilization from tantalum alloy T-222 oxidized in flowing air between 500 and 1200 C. This alloy nominally contains 10 wt% tungsten, 2.5 wt% hafnium and 0.01 wt% carbon. We found that the mobilization of Ta and Hf was closely linked to the occurrence of oxide spalling. These elements showed no migration from the test chamber. Some W was mobilized by volatilization as evidenced by transport from the chamber. Tungsten volatilization could occur primarily during initial stages of oxidation before an oxide scale forms and impedes the process. The mobilization of Ta and W are presented in terms of the mass flux (g/m 2 -h) as a function of test temperature. These measurements along with specific designs, activation calculations, and accident scenarios provide information useful for dose calculations of future fusion devices.

  9. 20 CFR 222.51 - When a natural child is dependent.

    Science.gov (United States)

    2010-04-01

    ... FAMILY RELATIONSHIPS Child Support and Dependency § 222.51 When a natural child is dependent. The... employee's earnings record and the relationship of the child to the employee, the child will be considered... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a natural child is dependent. 222.51...

  10. Waste analysis plan for 222-S dangerous and mixed waste storage area

    International Nuclear Information System (INIS)

    Warwick, G.J.

    1994-01-01

    The 222-S Laboratory Complex, in the southeast corner of the 200 West Area, consists of the 222-S Laboratory, the 222-SA Standards Laboratory, and several ancillary facilities. Currently, 222-S Laboratory activities are in supporting efforts to characterize the waste stored in the 200 Areas single shell and double shell tanks. Besides this work, the laboratory also provides analytical services for waste-management processing plants, Tank Farms, B Plant, 242-A Evaporator Facility, Plutonium-Uranium Extraction Plant, Plutonium Finishing Plant, Uranium-Oxide Plant, Waste Encapsulation Storage Facility, environmental monitoring and surveillance programs, and activities involving essential materials and research and development. One part of the 222-SA Laboratory prepares nonradioactive standards for the 200 Area laboratories. The other section of the laboratory is used for cold (nonradioactive) process development work and standards preparation. The 219-S Waste Handling Facility has three storage tanks in which liquid acid waste from 222-S can be received, stored temporarily, and neutralized. From this facility, neutralized waste, containing radionuclides, is transferred to the Tank Farms. A 700-gallon sodium-hydroxide supply tank is also located in this facility. This plan provides the methods used to meet the acceptance criteria required by the 204-AR Waste Receiving Facility

  11. Cannonball lung metastases as a presenting feature of ectopic hCG expression

    Directory of Open Access Journals (Sweden)

    Rong-Hsin Yang

    2016-08-01

    Full Text Available Cannonball metastases refer to well-defined spherical nodules scattered over both lungs, being a classical presentation of hematogenous tumor spreading. Striking progression of lung metastases without established primary malignancy can raise a diagnostic challenge. We herein report three cases with cannonball metastases at initial presentation. Two patients ended up having a choriocarcinoma but no awareness of the presence of primary tumors, and the third had abrupt lung metastases of endometrial cancer while she was being asymptomatic. Relentless progression was illustrated by clinical and radiographic changes. Ectopic expression of human chorionic gonadotropin (hCG would seemingly go some way responsible for fulminant cancer spreading associated with poor prognosis in our patients. The goal of this presentation is to raise awareness of ectopic hCG expression in patients presenting with similar astonishing scenarios.

  12. Early gradual feeding with bovine colostrum improves gut function and NEC resistance relative to infant formula in preterm pigs

    DEFF Research Database (Denmark)

    Shen, Rene L; Thymann, Thomas; Østergaard, Mette V

    2015-01-01

    It is unclear when and how to start enteral feeding for preterm infants when mother's milk is not available. We hypothesized that early and slow advancement with either formula or bovine colostrum stimulates gut maturation and prevents necrotizing enterocolitis (NEC) in preterm pigs, used as models...... for preterm infants. Pigs were given either total parenteral nutrition (TPN, n = 14) or slowly advancing volumes (16–64 ml·kg−1·day−1) of preterm infant formula (IF, n = 15) or bovine colostrum (BC, n = 13), both given as adjunct to parenteral nutrition. On day 5, both enteral diets increased intestinal mass......), and higher intestinal permeability, compared with BC pigs (all P colostrum supports gut maturation when mother's milk is absent during the first week after...

  13. Production of specific antisera for radioimmunoassay of human luteinizing hormone (LH) in the presence of human chorionic gonadotropin (hCG)

    International Nuclear Information System (INIS)

    Thorell, J.I.; Jeppsson, S.; Holmstrom, B.

    1976-01-01

    A specific radioimmunoassay for LH, which measures plasma LH in the presence of human chorionic gonadotropin (hCG) is described. Rabbits were immunized with highly purified native LH. One of the antisera with a difference in its reactivity against LH and hCG was further purified by affinity chromatography on a column with hCG coupled to Sepharose 4B. The adsorbed antiserum and 125 I-LH was used in a double antibody assay. The LH standard (MRC/68/40) efficiently inhibited the binding of 125 I-LH, and the standard curve showed a sensitivity of 0.5 ng/ml in the sample. hCG up to 10,000 ng/ml did not inhibit the binding of 125 I-LH. The plasma level of LH in pregnant women in the first trimester was low (1.3 +- 0.1 ng/ml). When LH was measured in fertile or menopausal women with or without stimulation with LH/FSH releasing hormone (LH-RH)/sup x/ the results agreed to those found with our conventional LH-assay based on antiserum against hCG

  14. 36 CFR 222.23 - Removal of other horses and burros.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Removal of other horses and... AGRICULTURE RANGE MANAGEMENT Management of Wild Free-Roaming Horses and Burros § 222.23 Removal of other horses and burros. Horses and burros not within the definition in § 222.20(b)(13) which are introduced...

  15. Lidocaine Hydrochloride Compared with MS222 for the Euthanasia of Zebrafish (Danio rerio)

    Science.gov (United States)

    Collymore, Chereen; Banks, E Kate; Turner, Patricia V

    2016-01-01

    Despite several shortcomings, MS222 is the most commonly used chemical agent for euthanasia of zebrafish. Although lidocaine hydrochloride has some advantages over MS222, its effectiveness as a euthanasia agent for zebrafish is unknown. Larvae at 9 to 16 d postfertilization were exposed to 250 mg/L MS222 or 400, 500, 600, 700, 800, 900, or 1000 mg/L lidocaine and observed for cessation of heartbeat. Adult zebrafish were exposed to 250 mg/L MS222 or 400, 500, or 600 mg/L lidocaine; times to loss of righting reflex, cessation of opercular movement, and complete recovery; body length; aversive behavior; and gross and microscopic evidence of acute toxicity were evaluated. The heartbeat was not lost from any larvae in any group, regardless of drug or dosage. For adults, time to loss of righting reflex was greatest in the 500-mg/L lidocaine group. Opercular movement ceased earlier in all lidocaine groups compared with the MS222 group. Fish in the 500-mg/L lidocaine group were smaller than those in other groups. Fewer fish in the lidocaine groups displayed aversive behavior (erratic swimming and piping) compared with the MS222 group. No fish in the lidocaine hydrochloride groups (n = 30) recovered from euthanasia, whereas one fish in the MS222 group did (n = 10). Neither the MS222 nor lidocaine groups showed any gross or histologic changes suggestive of acute toxicity. Our results suggest that lidocaine hydrochloride may be an effective alternative chemical euthanasia agent for adult zebrafish but should not be used in larval fish. PMID:27931323

  16. microRNA-222 modulates liver fibrosis in a murine model of biliary atresia

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Wen-jun; Dong, Rui; Chen, Gong, E-mail: chengongzlp@hotmail.com; Zheng, Shan

    2014-03-28

    Highlights: • The RRV infected group showed cholestasis, retardation and extrahepatic biliary atresia. • miR-222 was highly expressed, and PPP2R2A was inhibited in the murine biliary atresia model. • miR-222 profoundly modulated the process of fibrosis in the murine biliary atresia model. • miR-222 might represent a potential target for improving biliary atresia prognosis. - Abstract: microRNA-222 (miR-222) has been shown to initiate the activation of hepatic stellate cells, which plays an important role in the pathogenesis of liver fibrosis. The aim of our study was to evaluate the role of miR-22 in a mouse model of biliary atresia (BA) induced by Rhesus Rotavirus (RRV) infection. New-born Balb/c mice were randomized into control and RRV infected groups. The extrahepatic bile ducts were evaluated. The experimental group was divided into BA group and negative group based on histology. The expression of miR-222, protein phosphatase 2 regulatory subunit B alpha (PPP2R2A), proliferating cell nuclear antigen (PCNA) and phospho-Akt were detected. We found that the experimental group showed signs of cholestasis, retardation and extrahepatic biliary atresia. No abnormalities were found in the control group. In the BA group, miR-222, PCNA and Akt were highly expressed, and PPP2R2A expression was significantly inhibited. Our findings suggest that miR-222 profoundly modulated the process of fibrosis in the murine BA model, which might represent a potential target for improving BA prognosis.

  17. microRNA-222 modulates liver fibrosis in a murine model of biliary atresia

    International Nuclear Information System (INIS)

    Shen, Wen-jun; Dong, Rui; Chen, Gong; Zheng, Shan

    2014-01-01

    Highlights: • The RRV infected group showed cholestasis, retardation and extrahepatic biliary atresia. • miR-222 was highly expressed, and PPP2R2A was inhibited in the murine biliary atresia model. • miR-222 profoundly modulated the process of fibrosis in the murine biliary atresia model. • miR-222 might represent a potential target for improving biliary atresia prognosis. - Abstract: microRNA-222 (miR-222) has been shown to initiate the activation of hepatic stellate cells, which plays an important role in the pathogenesis of liver fibrosis. The aim of our study was to evaluate the role of miR-22 in a mouse model of biliary atresia (BA) induced by Rhesus Rotavirus (RRV) infection. New-born Balb/c mice were randomized into control and RRV infected groups. The extrahepatic bile ducts were evaluated. The experimental group was divided into BA group and negative group based on histology. The expression of miR-222, protein phosphatase 2 regulatory subunit B alpha (PPP2R2A), proliferating cell nuclear antigen (PCNA) and phospho-Akt were detected. We found that the experimental group showed signs of cholestasis, retardation and extrahepatic biliary atresia. No abnormalities were found in the control group. In the BA group, miR-222, PCNA and Akt were highly expressed, and PPP2R2A expression was significantly inhibited. Our findings suggest that miR-222 profoundly modulated the process of fibrosis in the murine BA model, which might represent a potential target for improving BA prognosis

  18. Observation and modeling of 222Rn daughters in liquid nitrogen

    International Nuclear Information System (INIS)

    Frodyma, N.; Pelczar, K.; Wójcik, M.

    2014-01-01

    The results of alpha spectrometric measurements of the activity of 222 Rn daughters dissolved in liquefied nitrogen are presented. A direct detection method of ionized alpha-emitters from the 222 Rn decay chain ( 214 Po and 218 Po) in a cryogenic liquid in the presence of an external electric field is shown. Properties of the radioactive ions are derived from a proposed model of ion production and transport in the cryogenic liquid. Ionic life-time of the ions was found to be on the order of 10 s in liquid nitrogen (4.0 purity class). The presence of positive and negative ions was observed. - Highlights: • A direct detection method of the alpha-emitters in a cryogenic liquid is shown. • We examine electrostatic drifting of the radioactive ions in liquid nitrogen. • The ions belong to the Radon-222 decay chain; Radon-222 is dissolved in the liquid. • The model of the ions production and behaviour in the liquid is proposed. • The ion production significantly depends on the nuclear decay type (alpha or beta)

  19. Maintenance Implementation Plan for the 222-S Laboratory

    International Nuclear Information System (INIS)

    Stark, T.E.

    1992-10-01

    This Maintenance Implementation Plan (MIP) has been developed for the 222-S Laboratory at Hanford. It is based on assessments of the existing maintenance program to the requirements specified by US Department of Energy (DOE) Order 4330.4A, Maintenance Management Program (DOE 1990), Chapter II, Change 3. The results of these assessments were evaluated to determine corrective actions required. The 222-S Laboratory is currently supporting the waste management, chemical processing, and environmental monitoring programs presently under Westinghouse Hanford Company (Westinghouse Hanford) responsibility. This is done through quality analytical and process chemistry services

  20. The Ongoing Evolution of the K2-22 System

    Science.gov (United States)

    Colon, Knicole D.; Zhou, George; Shporer, Avi; Collins, Karen A.; Bieryla, Allyson; Latham, David W.; Espinoza, Nestor; Murgas, Felipe; Pattarakijwanich, Petchara; Awiphan, Supachai; TECH Collaboration

    2018-06-01

    Of the thousands of exoplanets known, only three disintegrating planets have been identified. These disintegrating planets appear to have tails of dusty material that produce asymmetric transit shapes. K2-22b is one of these few disintegrating planets discovered to date, and its light curve not only displays highly variable transit depths but also uniquely displays evidence of a leading dust tail. Here, we present results from a large ground-based photometric observing campaign of the K2-22 system that took place between December 2016 and May 2017, which we use to investigate the evolution of the transit of K2-22b. Last observed in early 2015, in these new observations we recover the transit around the expected time and measure a typical depth of K2-22b, although the overall shallowness of the transit makes a detailed analysis of the transit shape and timing difficult. In addition, we find no strong evidence of wavelength-dependent transit depths for epochs where we have simultaneous coverage at multiple wavelengths. Given the observed decrease in the transit depth between 2015 and 2017, we encourage continued high-precision photometric monitoring of this system in order to further constrain the evolution timescale and to aid comparative studies with the other few disintegrating planets known.

  1. 222Rn alpha dose to organs other than lung

    International Nuclear Information System (INIS)

    Harley, N.H.; Robbins, E.S.

    1991-01-01

    The alpha dose to cells in tissues or organs other theft the lung has been calculated using the solubility coefficients for 222 Rn measured in human tissue. The annual alpha dose equivalent f rom 222 Rn and decay products in most tissues is a maximum of 30% of the annual average natural background dose equivalent (1 mSv) for external and internally deposited nuclides. The dose to the small population of lymphocytes located in or under the bronchial epithelium is a special case and their annual dose equivalent is essentially the same as that to basal cells in bronchial epithelium (200 mSv) for continuous exposure to 200 Bq M -3 . The significance of this dose is uncertain because the only excess cancer observed in follow up studies of underground miners with high 222 Rn exposure is bronchogenic carcinoma

  2. A concurrent visualization system for large-scale unsteady simulations. Parallel vector performance on an NEC SX-4

    International Nuclear Information System (INIS)

    Takei, Toshifumi; Doi, Shun; Matsumoto, Hideki; Muramatsu, Kazuhiro

    2000-01-01

    We have developed a concurrent visualization system RVSLIB (Real-time Visual Simulation Library). This paper shows the effectiveness of the system when it is applied to large-scale unsteady simulations, for which the conventional post-processing approach may no longer work, on high-performance parallel vector supercomputers. The system performs almost all of the visualization tasks on a computation server and uses compressed visualized image data for efficient communication between the server and the user terminal. We have introduced several techniques, including vectorization and parallelization, into the system to minimize the computational costs of the visualization tools. The performance of RVSLIB was evaluated by using an actual CFD code on an NEC SX-4. The computational time increase due to the concurrent visualization was at most 3% for a smaller (1.6 million) grid and less than 1% for a larger (6.2 million) one. (author)

  3. A study of the physico-chemical characteristics of a solid radon 222 source

    International Nuclear Information System (INIS)

    Chuiton, G.

    1990-01-01

    A solid radon 222 source is described; it is made of a manganese oxide impregnated acrylic felt disc on which radium 226 is fixed. The disc is incorporated into a scanning device allowing the passage through the felt of a radon 222 free gas (air or nitrogen) previously led to a relative humidity of air near to saturation. At the device outlet, a stable activity of radon 222 is obtained. The preparation, characteristics and radiochemical stability conditions of the 226 radium source are presented. Following a description of the scanning device, the radon 222 emanation coefficient is studied as a function of the relative humidity of air. The reliability of the device is assessed by an uncertainty calculation for the utilisation conditions recommended. Finally, an approach to the physico-chemical processes governing radon 222 emanation rate in the device is set forth [fr

  4. 34 CFR 222.30 - What is “free public education”?

    Science.gov (United States)

    2010-07-01

    ... Section 8003(b) and (e) of the Act § 222.30 What is “free public education”? In addition to the terms defined in § 222.2, the following definition applies to this part: Free public education. (1) The term... provide a free public education to the children claimed under section 8003. (5) For the purpose of...

  5. Radon 222 levels in deep well waters of Toluca municipality (county)

    International Nuclear Information System (INIS)

    Olguin Gutierrez, Maria Teresa.

    1990-01-01

    The levels of Radon 222 were determined in 46 deep (50-180m) wells in the city and county of Toluca, as well as the annual radiation dose that the stomach admits when ingesting such water. The method used for the quantification of Radon 222 was liquid scintillation counting. The result revealed that levels of Radon 222 in the studied area in the range of 0 to 320 pCi l -1 . In the case of the equivalent annual dose that the stomach (empty) admits due to ingestion of water from the wells, values are in an interval between 0 to 95 mrem a -1 . This values are well below the level established by the International Commission of Radiological Protection (ICRP). The wells that had the higher concentration of Radon 222 were found in the regions of Lodo Prieto, Seminario; San Antonio Buenavista and La Trinidad Huichochitlan. (Author)

  6. St 2-22 - Another Symbiotic Star with High-Velocity Bipolar Jets

    Science.gov (United States)

    Tomov, T.; Zamanov, R.; Gałan, C.; Pietrukowicz, P.

    2017-09-01

    We report the detection of high-velocity components in the wings of Hα emission line in spectra of symbiotic binary star St 2-22 obtained in 2005. This finding encouraged us to start the present investigation in order to show that this poorly-studied object is a jet-producing system. We have used high-resolution optical and low-resolution near-infrared spectra, as well as available optical and infrared photometry, to evaluate some physical parameters of the St 2-22 components and characteristics of the jets. We confirm that St 2-22 is a S-type symbiotic star. Our results demonstrate that an unnoticed outburst, similar to those in classical symbiotic systems, occurred in the first half of 2005. During the outburst, collimated bipolar jets were ejected by the hot component of St 2-22 with an average velocity of about 1700 km/s.

  7. Scintillation detectors for radon-222 in air and water

    International Nuclear Information System (INIS)

    Mastinu, G.G.

    1980-01-01

    A scintillation detector and an emanation circuit that enable sensitive measurements of 222 Rn in water, in field practice, and in laboratory routine have been developed. Activities as low as 0.1 pCi per sample can be measured with a very simple procedure. The detector is also well suited to measure 222 Rn in air at concentrations down to 0.001 pCi/liter if a large-size detector is used

  8. The structure of the polynomials in preconditioned BiCG algorithms and the switching direction of preconditioned systems

    OpenAIRE

    Itoh, Shoji; Sugihara, Masaaki

    2016-01-01

    We present a theorem that defines the direction of a preconditioned system for the bi-conjugate gradient (BiCG) method, and we extend it to preconditioned bi-Lanczos-type algorithms. We show that the direction of a preconditioned system is switched by construction and by the settings of the initial shadow residual vector. We analyze and compare the polynomial structures of four preconditioned BiCG algorithms.

  9. Distinct responses of human granulosa lutein cells after hCG or LH stimulation in a spheroidal cell culture system.

    Science.gov (United States)

    Becker, Julia; Walz, Andrea; Daube, Stefanie; Keck, Christoph; Pietrowski, Detlef

    2007-10-01

    The growth and development of the corpus luteum (CL) is regulated by gonadotropic hormones. It is formed by granulosa cells (GCs), theca cells, and endothelial cells, and is the primary source of circulating progesterone. During early pregnancy only human chorionic gonadotropin (hCG) but not luteinizing hormone (LH) extends the life span of the CL, although hCG and LH interact with the same receptor and have similar actions on the CL. In this study a recently by our group established spheroidal GC culture assay served as a model of CL development on which we compared the actions of the gonadotropic hormones LH and hCG. To find out which signal pathways take part in the hormonal regulation of GC we stimulated GC-spheroids with modulators of protein kinases A and C dependent signaling cascades and determined their impact on sprout forming activity in GC. Our results indicate that PKA-dependent signaling pathways play a major role in mediating the hormonal-induced signaling cascades leading to sprouting in GC. Furthermore, this study strongly indicates that the different effects of hCG and LH in the maintenance of the CL may be reasoned in different signal transduction pathways triggered by hCG or LH. (c) 2007 Wiley-Liss, Inc.

  10. Nonirradiated NOD,B6.SCID Il2rγ−/− KitW41/W41 (NBSGW Mice Support Multilineage Engraftment of Human Hematopoietic Cells

    Directory of Open Access Journals (Sweden)

    Brian E. McIntosh

    2015-02-01

    Full Text Available In this study, we demonstrate a newly derived mouse model that supports engraftment of human hematopoietic stem cells (HSCs in the absence of irradiation. We cross the NOD.Cg-PrkdcscidIl2rgtm1Wjl/SzJ (NSG strain with the C57BL/6J-KitW-41J/J (C57BL/6.KitW41 strain and engraft, without irradiation, the resulting NBSGW strain with human cord blood CD34+ cells. At 12-weeks postengraftment in NBSGW mice, we observe human cell chimerism in marrow (97% ± 0.4%, peripheral blood (61% ± 2%, and spleen (94% ± 2% at levels observed with irradiation in NSG mice. We also detected a significant number of glycophorin-A-positive expressing cells in the developing NBSGW marrow. Further, the observed levels of human hematopoietic chimerism mimic those reported for both irradiated NSG and NSG-transgenic strains. This mouse model permits HSC engraftment while avoiding the complicating hematopoietic, gastrointestinal, and neurological side effects associated with irradiation and allows investigators without access to radiation to pursue engraftment studies with human HSCs.

  11. Iterative methods for solving Ax=b, GMRES/FOM versus QMR/BiCG

    Energy Technology Data Exchange (ETDEWEB)

    Cullum, J. [IBM Research Division, Yorktown Heights, NY (United States)

    1996-12-31

    We study the convergence of GMRES/FOM and QMR/BiCG methods for solving nonsymmetric Ax=b. We prove that given the results of a BiCG computation on Ax=b, we can obtain a matrix B with the same eigenvalues as A and a vector c such that the residual norms generated by a FOM computation on Bx=c are identical to those generated by the BiCG computations. Using a unitary equivalence for each of these methods, we obtain test problems where we can easily vary certain spectral properties of the matrices. We use these test problems to study the effects of nonnormality on the convergence of GMRES and QMR, to study the effects of eigenvalue outliers on the convergence of QMR, and to compare the convergence of restarted GMRES, QMR, and BiCGSTAB across a family of normal and nonnormal problems. Our GMRES tests on nonnormal test matrices indicate that nonnormality can have unexpected effects upon the residual norm convergence, giving misleading indications of superior convergence over QMR when the error norms for GMRES are not significantly different from those for QMR. Our QMR tests indicate that the convergence of the QMR residual and error norms is influenced predominantly by small and large eigenvalue outliers and by the character, real, complex, or nearly real, of the outliers and the other eigenvalues. In our comparison tests QMR outperformed GMRES(10) and GMRES(20) on both the normal and nonnormal test matrices.

  12. Navy DD(X) and CG(X) Program: Background and Issues for Congress

    National Research Council Canada - National Science Library

    O'Rourke, Ronald

    2005-01-01

    The FY2006-FY2011 Future Years Defense Plan (FYDP) reduces planned DD(X) destroyer procurement to one ship per year in FY2007-FY2011 and accelerates procurement of the first CG(X) cruiser to FY2011...

  13. 20 CFR 222.16 - When spouse is living in the same household with employee.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When spouse is living in the same household with employee. 222.16 Section 222.16 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.16...

  14. Radon-222 as an indicator of geothermal reservoirs behaviour

    International Nuclear Information System (INIS)

    Segovia, N.; De La Cruz-Reyna, S.; Mena, M.; Seidel, J.L.; Monnin, M.

    1991-01-01

    Radon-222 concentration in soils at shallow depth was measured at the ''Los Azufres'' geothermal field, Michoacan State, Mexico, in order to observe possible temporal variations in relation to the peculiar conditions of the area. A four years' survey is reported using the SSNTD technique. The data obtained indicate the feasibility of the technique for this type of investigation and illustrate the role of Radon-222 as a tracer of pore fluids motion in the substratum. (author)

  15. Relation between 222Rn concentration in outdoor air and lower atmosphere

    International Nuclear Information System (INIS)

    Kataoka, Toshio; Mori, Tadashige; Yunoki, Eiji; Michihiro, Kenshuh; Sugiyama, Hirokazu; Shimizu, Mitsuo; Tsukamoto, Osamu; Sahashi, Ken.

    1991-01-01

    Using the height of the surface-based inversion layer obtained by the acoustic sounder returns and the variation of the 222 Rn concentration in the outdoor air during the presence of the surface-based inversion layer, the exhalation rate of 222 Rn is estimated to be 0.020 Bq·m -2 ·s -1 , which is observed elsewhere on land. Furthermore, the exposure rate at 1 m above the air-ground interface due to the short-lived 222 Rn daughters in the outdoor air during the presence of the surface-based inversion layer can be estimated using the height of the surface-based inversion layer and the 222 Rn concentrations in the outdoor air at the ground level before and after the onset of the surface-based inversion layer. From these treatment, it is clearly demonstrated that the monostatic acoustic sounder is useful as a supplementary method for a weather survey which forms a part of monitoring around the nuclear facilities. (author)

  16. Investigations into the long-distance atmospheric transport in Central Europe using Rn-222

    International Nuclear Information System (INIS)

    Volpp, H.J.

    1984-01-01

    An measuring network was used to determine the atmospheric Rn-222 content in Central Europe (Northern and Southern Germany, Poland). Rn-222 is to serve as tracer for the long-distance atmospheric transport in central Europe. For several areas, an average Rn-222 flux density was found. The radon source 'continent' and the soil as radon source have been taken into account. (DG) [de

  17. Anaerobic co-digestion of swine manure and crude glycerol derived from animal fat - Effect of hydraulic retention time

    DEFF Research Database (Denmark)

    Lymperatou, Anna; Skiadas, Ioannis V.; Gavala, Hariklia N.

    2018-01-01

    Crude glycerol (CG), an abundant by-product of bio-diesel production, has been identified as a suitable co-substrate for improving the biogas production of livestock manure through anaerobic digestion (AD). In this study, the potential of utilizing CG generated from the esterification of animal......, biochemical methane potential tests indicated that the addition of 1% w/w CG to swine manure-AD is more efficient in terms of percent of theoretical amount of methane obtained than the addition of 3% w/w. However, in continuous experiments, co-digestion of manure with 3% w/w CG did not exhibit any sign...... fats for biogas production was studied in both batch and continuous AD experiments, with emphasis on the importance of the hydraulic retention time (HRT). Batch experiments showed that the limiting step in the methane production rate during CG mono-digestion was the 1,3-propanediol uptake. Additionally...

  18. Early gradual feeding with bovine colostrum improves gut function and NEC resistance relative to infant formula in preterm pigs

    DEFF Research Database (Denmark)

    Shen, René L.; Thymann, Thomas; Østergaard, Mette V.

    2015-01-01

    It is unclear when and how to start enteral feeding for preterm infants when mother’s milk is not available. We hypothesized that early and slow advancement with either formula or bovine colostrum stimulates gut maturation and prevents necrotizing enterocolitis (NEC) in preterm pigs, used as models...... for preterm infants. Pigs were given either total parenteral nutrition (TPN, n = 14) or slowly advancing volumes (16–64 ml·kg-1·day-1) of preterm infant formula (IF, n = 15) or bovine colostrum (BC, n = 13), both given as adjunct to parenteral nutrition. On day 5, both enteral diets increased intestinal mass...... intestinal permeability, compared with BC pigs (all P colostrum supports gut maturation when mother’s milk is absent during the first week after preterm birth...

  19. 222-S Laboratory complex hazards assessment

    International Nuclear Information System (INIS)

    Sutton, L.N.

    1996-01-01

    This document establishes the technical basis in support of Emergency Planning activities for the 222-S Laboratory Complex on the Hanford Site. Through this document, the technical basis for the development of facility specific Emergency Action Levels and Emergency Planning Zone is demonstrated

  20. Evaluation of radon-222 concentration in air of workplaces at Curitiba/PR, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson, E-mail: flaviadelclaro@gmail.com, E-mail: spaschuk@gmail.com, E-mail: janine_nicolosi@hotmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy, E-mail: denyak@gmail.com [Instituto de Pesquisa Pele Pequeno Principe (IPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita O., E-mail: rocha@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2013-07-01

    The isotope Rn-222 is a noble gas that is responsible for approximately half of the effective annual dose received by the world population, and has very high probability to induce the lung cancer. The goal of present research is to evaluate the activity concentration of Rn-222 in the air of workplaces at Curitiba, Parana State. Simultaneously there were performed the measurements of Rn-222 emanation from soil and building materials occurred at evaluated workplaces. Indoor measurements of Rn-222 activity were performed using CR-39 detectors. The instant radon detector AlphaGUARD (Saphymo GmbH) was used in the measurements of the average concentrations of Rn-222 in soil gas and building materials. The average concentration of indoor Rn-222 obtained in the measurements of workplaces vary between 36+/-49 Bq/m³ and 164+/-51 Bq/m³. These values are considered within the reference limit of 200 Bq/m³ established by international agencies such as the United Nations Scientific Committee on the Effects of Atomic Radiation and the International Commission on Radiological Protection, but slightly above the limit of 148 Bq/m³ established by the United States Environmental Protection Agency. The measurements involving building materials presented the concentration values of Rn-222 in a range from 427+/-310 Bq/m³ to 2053+/-700 Bq/m³. The Rn-222 concentrations in soil ranged from 31+/-2 kBq/m³ to 35+/-4 kBq/m³ and the average values of Rn-220 are found in a range of 41+/-6 kBq/m³ and 25+/-11 kBq/m³, thus the concentrations of radon gas soil are below the swedish criterion of 50 kBq/m³ that represent the minimum value for high-risk situation. (author)

  1. Evaluation of radon-222 concentration in air of workplaces at Curitiba/PR, Brazil

    International Nuclear Information System (INIS)

    Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson; Denyak, Valeriy; Rocha, Zildete; Santos, Talita O.

    2013-01-01

    The isotope Rn-222 is a noble gas that is responsible for approximately half of the effective annual dose received by the world population, and has very high probability to induce the lung cancer. The goal of present research is to evaluate the activity concentration of Rn-222 in the air of workplaces at Curitiba, Parana State. Simultaneously there were performed the measurements of Rn-222 emanation from soil and building materials occurred at evaluated workplaces. Indoor measurements of Rn-222 activity were performed using CR-39 detectors. The instant radon detector AlphaGUARD (Saphymo GmbH) was used in the measurements of the average concentrations of Rn-222 in soil gas and building materials. The average concentration of indoor Rn-222 obtained in the measurements of workplaces vary between 36+/-49 Bq/m³ and 164+/-51 Bq/m³. These values are considered within the reference limit of 200 Bq/m³ established by international agencies such as the United Nations Scientific Committee on the Effects of Atomic Radiation and the International Commission on Radiological Protection, but slightly above the limit of 148 Bq/m³ established by the United States Environmental Protection Agency. The measurements involving building materials presented the concentration values of Rn-222 in a range from 427+/-310 Bq/m³ to 2053+/-700 Bq/m³. The Rn-222 concentrations in soil ranged from 31+/-2 kBq/m³ to 35+/-4 kBq/m³ and the average values of Rn-220 are found in a range of 41+/-6 kBq/m³ and 25+/-11 kBq/m³, thus the concentrations of radon gas soil are below the swedish criterion of 50 kBq/m³ that represent the minimum value for high-risk situation. (author)

  2. Assessing urban air quality and its relation with radon (222Rn)

    International Nuclear Information System (INIS)

    Zoran, Maria; Savastru, Dan; Dida, Adrian

    2016-01-01

    This paper focuses on the assessment of air quality and its relation with radon ( 222 Rn) for Bucharest metropolitan area in Romania. Specifically, daily mean concentrations of particle matter (PM2.5, PM10), ozone (O 3 ), nitrogen dioxide (NO 2 ), sulphur dioxide (SO 2 ) and global air quality indices have been analyzed in relation with radon ( 222 Rn) concentrations measured in the air near the ground with AlphaGUARD Radon Monitoring System and CR-39 SSNTDs during 2012 year. Such new information is required by atmospheric sciences to prove suitability of 222 Rn as a tracer for atmospheric dynamics analysis as well as by epidemiological and radiological protection studies. (author)

  3. Utilization of MS 222 in Transport of Catfish (Pangasius sutchi Seed

    Directory of Open Access Journals (Sweden)

    Harton Arfah

    2007-12-01

    Full Text Available ABSTRACTProblems faced in supplying seed out of Java especially Bogor to Sumatera, for instance, are it only contains few seed (100 seeds/l and it has a high mortality rate because of stress during transport.  This experiment was conducted to know the effect of MS 222 in keeping fish metabolism activity down while taking note of its survival rate and change of water quality. The experimental design used here was factorial design 3x5 with 3 repetitions.  Dosages of MS–222 were 0, 25 and 50 ppm and the fish densities were 100, 300, 400, 500 and 600 per liter.  As container was plastic bag (volume 10 l.  After putting the fish into the plastic bag, it was filled up with oxygen, which the volume was 3 times than water volume, than the plastic bag was closed by tying it.  After 18 hours of treatment the survival rate and water quality were checked.  Based on evaluation of survival rate, it was concluded that the combination between 25 ppm of MS 222 and fish density, which was 500 per liter, gave an optimum result.Keywords: Catfish, Pangasius sutchi, live transport, stress, MS–222, survival rate ABSTRAKKendala yang dihadapi dalam pemasokan benih ikan patin dari pulau Jawa terutama Bogor, keluar pulau Jawa terutama Sumatera adalah jumlah ikan yang terangkut masih sedikit (± 100 ekor/l dan tingkat kematian yang cukup tinggi, karena stres selama perjalanan. Penelitian ini dilakukan untuk mengetahui pengaruh penggunaan MS–222 dalam menekan aktivitas metabolisme ikan dengan memperhatikan tingkat kelangsungan ikan dan perubahan kualitas air. Penelitian ini menggunakan rancangan faktorial 3x5 dengan 3 ulangan. Dosis MS–222 yang digunakan: 0,25 dan 50 ppm dan kepadatan ikan: 100, 300, 400, 500 dan 600 ekor/l. Wadah pengangkutan berupa kantong plastik (volume 10 l. Ikan yang diangkut dimasukkan ke dalam kantong plastik, kemudian dipompakan oksigen sebanyak 3 kali volume air, selanjutnya dilakukan pengikatan. Setelah 18 jam perlakuan dilakukan

  4. Study on the relationship between the levels of serum cholylglycine (CG) and blood lipids in pregnant women

    International Nuclear Information System (INIS)

    You Jianfei; Lv Shiming; Wang Qiong; Zhu Yuning

    2005-01-01

    Objective: To investigate the prevalence of intrahepatic cholestasis during pregnancy and the relationship between levels of serum CG and blood lipids. Methods: Serum CG, blood lipid and liver function profile were examined in 2040 women with pregnancy during the second or third trimester. Among these pregnant women, 57 were diagnosed as with intrahepatic cholestasis. Blood lipids (TG, cholesterol, HDL, LDL) and ALP levels in 50 of the 57 pregnant women were studied and compared with those in 50 otherwise normal pregnant women as controls. Results: Serum CG levels were above normal range in 372 of the 2040 pregnant women (18.5%). Fifty seven of these 372 pregnant women were confirmed to be with intrahepatic cholestasis (2.8% of the 2040 pregnancies). The TG, cholesterol, LDL contents and ALP levels in the pregnant women with intrahepatic cholestasis were significantly higher (P 0.05) than those in controls. Conclusion: Intrahepatic cholestasis developed in a substantial proportion of pregnant women (2.8% in this study) and should be carefully monitored due to possible damage to the fetus. Serum CG was shown to be an early and sensitive marker for the diagnosis of intrahepatic cholestasis. Changes of blood lipid and ALP levels were related to disease status. (authors)

  5. USO DA eCG PARA FORMAÇÃO DO CORPO LÚTEO EQÜINO E PRODUÇÃO DE PROGESTERONA

    Directory of Open Access Journals (Sweden)

    Tiago Gomes RODRIGUES

    2015-12-01

    Full Text Available Este estudo foi conduzido com a finalidade de avaliar o uso da gonadotrofina coriônica eqüina (eCG logo após a ovulação de éguas com o objetivo avaliar a formação do corpo lúteo e produção de progesterona. Utilizou-se 50 éguas durante 2 estações de monta 2011/2012 e 2012/2013. Com auxílio da ultrassonografia as éguas foram monitoradas as características dos órgãos genitais durante o estro até o dia da ovulação (D0 e no diestro em D2, D4 e D8. O experimento foi dividido em 2 tratamentos: Tratamento I (n=25 – éguas com ovulação natural e tratamento II (n=25  – éguas com ovulação induzida. Verificada a ovulação, os tratamentos foram sub divididas em 5 grupos de 5 animais, obedecendo a administração do fármaco estudado (eCG, sendo GI: controle; GII: 250 UI eCG no DO; GIII: 250 UI eCG no DO + 250 UI eCG no D2; GIV: 500 UI no Do; e GV: 500 UI eCG no D0 + 500 UI no D2. Para a avaliação do efeito dose resposta do fármaco e influência do eCG sob a glândula luteínica, foram coletados os dados: tônus uterino, ecogenicidade e tamanho do corpo lúteo (CL e concentração de progesterona. Na análise estatística somente quando comparando o GV entre os dois tratamentos há diferença estatística para o D8 na concentração de progesterona. Portanto o uso da eCG no momento da ovulação, não produziu efeito significativo esperado, mas este trabalho inicial abre portas para novas investigações a respeito desta biomolécula, e que venha contribuir na biotecnologia reprodutiva equina.

  6. 75 FR 10026 - Proposed Collection; Comment Request for Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR...

    Science.gov (United States)

    2010-03-04

    ... W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR, W-3PR, and W-3SS AGENCY: Internal Revenue Service....C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W- 3cPR, W-3PR, and W-3SS. DATES: Written comments should be received on or...

  7. Upregulation of miR-222 in both Helicobacter pylori-infected and ...

    Indian Academy of Sciences (India)

    MINA NOORMOHAMMAD

    of this study was to analyse the expression level of miR-222 in gastric cancer tissues, evaluating the relationship between. miR-222 ... using RT-qPCR and compared with 88 healthy samples. ... observed in some diseases; for instance, hepatocellular carci- noma .... cellular matrix proteins in stomach cells (Chun-Zhi et al.

  8. Epigenetic Modulation with HDAC Inhibitor CG200745 Induces Anti-Proliferation in Non-Small Cell Lung Cancer Cells

    OpenAIRE

    Chun, Sung-Min; Lee, Ji-Young; Choi, Jene; Lee, Je-Hwan; Hwang, Jung Jin; Kim, Chung-Soo; Suh, Young-Ah; Jang, Se Jin

    2015-01-01

    Histone modification plays a pivotal role on gene regulation, as regarded as global epigenetic markers, especially in tumor related genes. Hence, chemical approaches targeting histone-modifying enzymes have emerged onto the main stage of anticancer drug discovery. Here, we investigated the therapeutic potentials and mechanistic roles of the recently developed histone deacetylase inhibitor, CG200745, in non-small cell lung cancer cells. Treatment with CG200745 increased the global level of his...

  9. Measurement of Rn-222 concentration in underground water in Osaka stratum group in Sennan area

    International Nuclear Information System (INIS)

    Fukui, Masami; Katsurayama, Kosuke

    1977-01-01

    The Rn-222 concentration in underground water is reported as follows, which is the result obtained when the ground inspection was carried out in the Research Reactor Institute of Kyoto University located at Kumatori area in Osaka stratum group. Underground water, at different depth, well water and rain water were taken, and the contained Rn-222 was extracted with toluene to measure by liquid scintillation technique. Rn-222 concentration in rain water was 3.5 - 8.0 pCi/l, while the concentration in well water was 130 - 250 pCi/l, and that in underground water was 240 - 313 pCi/l. The seasonal change, geographical difference and variation according to depth of Rn-222 concentration were examined. Rn-222 behavior in soil should be investigated more in detail in reference to Rn-222 dispersion, transport and equilibrium problems in soil-water system in the future. (Kobatake, H.)

  10. Measurements of the radon-222 concentration in residences of Lima - Peru; Mediciones de la concentracion de radon 222 en residencias de Lima - Peru

    Energy Technology Data Exchange (ETDEWEB)

    Pereyra, P.; Lopez, M. E.; Perez, B., E-mail: ppereyr@pucp.edu.pe [Pontificia Universidad Catolica del Peru, Seccion Fisica, Av. Universitaria 1801, Lima (Peru)

    2014-08-15

    The measurement of the Radon-222 levels was realized in the first semester of 2013 in residences corresponding to 16 districts of the metropolitan area of Lima, including to the zones North, Center and South of the city, during one period of 3 to 6 months in continuous form, with measurement periods of 1 to 2 months. The houses where the measurements were made were selected considering diverse variables as antiquity, construction materials, coatings, soil type, occupational use of the monitored rooms, etc. The measurements were realized in basements, first and second floor of the residences. For the Radon-222 measurements passive detectors of cellulose nitrate (Lr-115) were used. The procedure of data collection, dosimeters reading and the measurement results are shown in this work; this monitoring is the first one that is carried out in this city. The results are only indicators of the present radon rate, by the detectors type not is possible to discriminate the presence of the Radon-222 descendants. (Author)

  11. Identifying Groundwater Discharge in the Merced River Basin, California Using Radon-222

    Science.gov (United States)

    Shaw, G. D.; Hudson, G. B.; Moran, J.; Conklin, M.

    2004-12-01

    Groundwater flow in fractured granite of the Sierra Nevada is poorly characterized, in particular, contributions of mountain block recharge are not known. Using a combination of water quality and isotopic analyses, groundwater inputs to the Upper Merced River were characterized. Between November 2003 and July 2004, monthly water quality samples were taken from Happy Isles to the inlet of Lake McClure, a 75 km reach. These samples demonstrated the expected dilution due to snowmelt in the spring. In the fall, the spatial profile matched the geology with anion concentrations increasing downstream of the transition from the Sierra Nevada batholith to the country rock, suggesting significant groundwater inputs. From July 19 to 21, 2004, radon-222 and other noble gases (He, Ne, Ar, Kr and Xe abundances and 3He/4He ratio) were measured along a 37 km reach of the Merced River, extending from the top of Yosemite Valley to the confluence of the South Fork of the Merced River. All radon samples were extracted into mineral oil immediately in the field and counted using liquid scintillation; noble gas samples were collected in copper tubes. Radon-222 activity varied from about 1 to 100 pCi/L (at collection time) indicating significant, spatially variable groundwater discharge into the Merced River. Two one-mile reaches of the Merced River were sampled for 222Rn on a fine scale. Large fracture sets in these two locations and previous temperature measurements suggested that groundwater discharge was higher relative to other locations along the river. Radon-222 activity was low upstream and downstream of large fractures observed in the bedrock; whereas, 222Rn activity was high at large fracture zones. Degassing is rapid downstream of fractures where no groundwater discharge is observed. For a representative groundwater end-member, radon-222 activity measured in Fern Spring, Yosemite Valley was about 1200 pCi/L. Excess 4He from U and Th decay is observed in samples with elevated

  12. Results of Long-term Measurement of 222Rn Volume Activity in Soil Air

    International Nuclear Information System (INIS)

    Holy, K.; Matos, M.; Boem, R.; Stanys, T.; Hola, O.; Polaskova, A.

    1999-01-01

    Radon in the soil air was continuously monitored for four years. The measured volume activities differ one from another even three times. On the basis of the measured data the annual and average daily courses of the 222 Rn volume activity were studied for individual months. In annual courses the winter and also summer maxima of the 222 Rn volume activity were found out. The study of the average daily courses revealed that the oscillation of the 222 Rn volume activity about its average value during a day is only a few percent. For dry summer months a linear relation was found out between the changes of the 222 Rn volume activity and the changes of the atmospheric pressure in their average daily courses (Authors)

  13. The human leukocyte antigen G promotes trophoblast fusion and β-hCG production through the Erk1/2 pathway in human choriocarcinoma cell lines

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Ji-meng [School of Medicine, Nankai University, Tianjin 300071 (China); State Key Laboratory of Reproductive Biology, Institute of Zoology, Chinese Academy of Sciences, Beijing 100101 (China); Zhao, Hong-xi [Department of Obstetrics and Gynecology, Tangdu Hospital, Fourth Military Medical University, Xi’an 710038 (China); Wang, Li [Department of Obstetrics and Gynecology, General Hospital of Chinese People’s Liberation Army, Beijing 100853 (China); Gao, Zhi-ying, E-mail: gaozy301@yahoo.com.cn [Department of Obstetrics and Gynecology, General Hospital of Chinese People’s Liberation Army, Beijing 100853 (China); Yao, Yuan-qing, E-mail: yqyao@126.com [Department of Obstetrics and Gynecology, General Hospital of Chinese People’s Liberation Army, Beijing 100853 (China)

    2013-05-10

    Highlights: •HLA-G expression promotes BeWo cells fusion and fusogenic gene expression. •HLA-G is capable of inducing β-hCG production in human choriocarcinoma cell lines. •Up-regulation of β-hCG production by HLA-G is mediated via the Erk1/2 pathway. -- Abstract: The human leukocyte antigen G (HLA-G) is expressed on the fetal–maternal interface and plays a role in protecting fetal-derived trophoblasts from the maternal immune response, allowing trophoblasts to invade the uterus. However, HLA-G also possesses immune suppressing-independent functions. We found that HLA-G expressing BeWo choriocarcinoma cells increased cell–cell fusion compared to control BeWo cells under forskolin treatment. Regardless of forskolin treatment, the expression of fusogenic gene mRNAs, including syncytin-1, the transcription factor glial cell missing 1 (Gcm1), and beta human chorionic gonadotropin (β-hCG) were elevated. HLA-G up-regulates β-hCG production in human choriocarcinoma cells because HLA-G knockdown in JEG-3 cells induces a dramatic decrease in β-hCG compared with control cells. The defect in β-hCG production in HLA-G knocked-down cells could not be completely overcome by stimulating hCG production through increasing intracellular cAMP levels. HLA-G expressing cells have increased phosphorylation levels for extracellular signal-regulated kinase1/2 (Erk1/2) in BeWo cells. The Erk1/2 pathway is inactivated after the inhibition of HLA-G expression in JEG-3 cells. Finally, Erk1/2 inhibition was able to suppress the increased hCG production induced by HLA-G expression. Together, these data suggest novel roles for HLA-G in regulating β-hCG production via the modulation of the Erk1/2 pathway and by inducing trophoblast cell fusion.

  14. Knock-down of miR-221 and miR-222 in the radiosensitization of breast cancer cells

    International Nuclear Information System (INIS)

    Zhang Chunzhi; Kang Chunsheng; Cao Yongzhen; Pu Peiyu; Lu Zhonghong; Du Yue

    2009-01-01

    Objective: To investigate the radiosensitizing effect of knock-down of miR-221 miR-222 on MCF-7 human breast cancer cells and explore the possible mechanism. Methods: Antisense oligonucleotides of miR-221 and miR-222 (AS-miR-221 and AS-miR-222), mediated by lipofectamine, were transfected to MCF-7 cells to knock down miR-221 and miR-222, Northern blotting was conducted to detect the expression of miR-221 and miR-222 in transfected cells. The cell apoptosis was detected by flow cytometry and Caspase-3 and Caspase-7 activity assay. Clonogenic assay was used to measure the sensitizing enhancement ratio. Target genes of miR-221 and miR-222 relevant to radio-sensitivity were searched using bioinformatics analysis. The targeted protein expression was determined by Western blot analysis. Results: The expression of miR-221 and miR-222 in the AS-miR-221/222 cells determined by Northern blotting was significantly reduced. Compared with the control group, the cell apoptosis and mitotic cell death after the radiation were significantly higher in AS-miR-221/222 cells. The sensitizing enhancement ratio was 1.87. Based on bioinformatics analysis, PTEN was a target gene of miR-221 and miR-222 which could enhance the radiosensitivity of MCF-7 cells. In AS-miR-221/222 cells, the expression of PTEN was up-regulated while pAkt down-regulated. Conclusions: AS-miR-221 and AS-miR-222 may enhance the radiosensitivity of MCF-7 breast cancer cells by up-regulating the expression of PTEN. (authors)

  15. 30 CFR 285.222 - What does MMS do with my bid?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What does MMS do with my bid? 285.222 Section... Energy Leases Competitive Lease Award Process § 285.222 What does MMS do with my bid? (a) If sealed... any proposal submitted will be made by a panel composed of members selected by MMS. The details of the...

  16. Dry soil diurnal quasi-periodic oscillations in soil 222Rn concentrations

    International Nuclear Information System (INIS)

    Tommasone Pascale, F.; De Francesco, S.; Carbone, P.; Cuoco, E.; Tedesco, D.

    2014-01-01

    222 Rn concentrations have been monitored during the dry season in August 2009 and August 2010, in a reworked alluvial-pyroclastic soil of the Pietramelara Plain, in Southern Italy, with the aim of determining the role of atmospheric factors in producing the quasi-periodic oscillations in soil 222 Rn concentrations reported in the literature. In this study we present the results of a detailed analysis and matching of soil 222 Rn concentrations, meteorological and solar parameters where the observed oscillations feature a characteristic behavior with second order build-up and depletion limbs, separated by a daily maximum and minimum. All these features are clearly shown to be tied to sunrise and sunset timings and environmental radiative flux regimes. Furthermore, a significant, and previously unreported, second order correlation (r 2  = 0.73) between daily maximum hourly global radiation and the daily range of soil 222 Rn concentrations has been detected, allowing estimates of the amplitude of these oscillations to be made from estimated or measured solar radiation data. The correlation has been found to be valid even in the presence of persistent patchy daytime cloudiness. In this case a daytime prolongation of the night-time build up stage and an attenuation or even suppression of daytime depletion is observed (a previously unreported effect). Neither soil cracking, nor precipitation, both suggested in some studies as causative factors for these oscillations, during the dry season appear to be necessary in explaining their occurrence. We also report the results of an artificial shading experiment, conducted in August 2009, that further support this conclusion. As soil 222 Rn concentrations during the dry season show a characteristic daily cycle, radon monitoring in soils under these conditions necessarily has to be gauged to the timings of the daily maximum and minimum, as well as to the eventual occurrence of cloudiness and to its related effects, in order to

  17. Realization of a reference system for the generation radon 222

    International Nuclear Information System (INIS)

    Guelin, M.

    1990-11-01

    After some general considerations on radon and its calibration techniques, the methods and technologies developed in order to realize a reference system for the generation of radon 222 are presented. Two original patented techniques have been developed. The former technique deals with the realization of radon 222 solid sources from radium 226 deposit on acrylic fibres. This new technology offers the advantage of very quickly obtaining a constant emission rate near to 100%. The latter technique deals with the standard measurement of radon 222 volumic activity via gamma spectrometry of its short-lived daughters. This new procedure is the only one allowing to relate this measure to gaseous standards. An aeraulic/ventilation circuit makes it possible to calibrate the radon measurement instrumentation within a wide volumic activity range from to 4 to 4 000 Bq/m 3

  18. 20 CFR 222.53 - When a legally adopted child is dependent-child adopted after entitlement.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-child adopted after entitlement. 222.53 Section 222.53 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.53 When...

  19. Detection of 222Rn and 226Ra in environmental samples by scintillation method

    International Nuclear Information System (INIS)

    Zafimanjato, J.L.R.; Raoelina Andriambololona; Mobius, S.

    2009-01-01

    222 Rn is considered as the major source of radiological exposure of natural radiations to the population. It represents about the half of exposures of natural radiation sources in the world (UNSCEAR, 1993). 222 Rn gets into human body with inhaled air and sometimes with drinking water. Then, the objective of this work is to know the 222 Rn concentrations in water and in indoor atmosphere, and the risk in order to set up a method of monitoring and to identify high radon level areas. A specific method of detection using liquid scintillation with special emphasis on α/β discrimination, the use of solvent extractive and enrichment of radionuclides have been developed for the determination of both 222 Rn and 226 Ra in water. The method is simple, rapid and sensitive. It was shown that the proposed method was suitable for a large scale monitoring and routine analysis. Considerable concentrations of 222 Rn were found in water and air samples from Vinaninkarena - Antsirabe. 222 Rn concentrations obtained by in situ and in laboratory measurements have been compared to the results of an international intercomparison campaigns organised by the German Society for Liquid Scintillation Spectrometry in 2001. An assesment model of the dose due to ingestion and liberation of radon from water is presented and compared with other models especially to the Crawford Brown's model.

  20. Large-scale genomic 2D visualization reveals extensive CG-AT skew correlation in bird genomes

    Directory of Open Access Journals (Sweden)

    Deng Xuemei

    2007-11-01

    Full Text Available Abstract Background Bird genomes have very different compositional structure compared with other warm-blooded animals. The variation in the base skew rules in the vertebrate genomes remains puzzling, but it must relate somehow to large-scale genome evolution. Current research is inclined to relate base skew with mutations and their fixation. Here we wish to explore base skew correlations in bird genomes, to develop methods for displaying and quantifying such correlations at different scales, and to discuss possible explanations for the peculiarities of the bird genomes in skew correlation. Results We have developed a method called Base Skew Double Triangle (BSDT for exhibiting the genome-scale change of AT/CG skew as a two-dimensional square picture, showing base skews at many scales simultaneously in a single image. By this method we found that most chicken chromosomes have high AT/CG skew correlation (symmetry in 2D picture, except for some microchromosomes. No other organisms studied (18 species show such high skew correlations. This visualized high correlation was validated by three kinds of quantitative calculations with overlapping and non-overlapping windows, all indicating that chicken and birds in general have a special genome structure. Similar features were also found in some of the mammal genomes, but clearly much weaker than in chickens. We presume that the skew correlation feature evolved near the time that birds separated from other vertebrate lineages. When we eliminated the repeat sequences from the genomes, the AT and CG skews correlation increased for some mammal genomes, but were still clearly lower than in chickens. Conclusion Our results suggest that BSDT is an expressive visualization method for AT and CG skew and enabled the discovery of the very high skew correlation in bird genomes; this peculiarity is worth further study. Computational analysis indicated that this correlation might be a compositional characteristic

  1. Development and clinical application of a highly sensitive hCG-β radioimmuno assay with a critical view to cross-reaction with LH

    International Nuclear Information System (INIS)

    Schuessler, B.

    1979-01-01

    A highly sensitive hCG-β-RIA with a lower detection limit of 1 mIU/ml was developed with an hCG-β-antiserum. Despite the crossreaction with LH-concentrations of 30 mIU/ml - 150mIU/ml ocurring between 1 mIU/ml and 5 mIU/ml, also in this region a definite statement on the hCG-concentration could be made, by comparison with the values developed in LH-RIA. The assay for the hCG-determination was applied in carcinomas of the uterine cervix (47%), ovaries (25%), body of the uterus (25%), mamma (17,6B), and prostate (5,8%). Another assay with a sensitivity of 5 mIU/ml was arranged for clinical routine examinations of chorionepithelioma and testis-carcinoma. In contrast to the first two systems which had a reaction time of appr. 100 hrs, we obtained safe results with another hCG-β-RIA with low antibodytiters after 110 min. The sensitivity was 15 mIU/ml. The procedure was found to be valuable for the exclusion of EU-gravidities. (orig.) [de

  2. Health effects assessment in population exposed to 222Rn in drinking water

    International Nuclear Information System (INIS)

    Burkhardt, R.; Mocsy, I.; Muntean, N.

    1996-01-01

    The carcinogenetic effect produce by ionizing radiation upon human health, mainly by drinking water consumption with an elevated 222 Rn content is well documented. The objective of the paper was to demonstrated the possible relationship between the incidence of pulmonary and gastric cancer and 222 Rn presence in water and indoor air. The 222 Rn content was assessed by the standard method in drinking water sampled in two sources in Transylvania area from located in Tirgu Mures and Miercurea Ciuc towns. The 222 Rn concentration in indoor air was indirectly determined. On the basis of the registered values the pulmonary and gastric internal dose received by the residents of the towns was calculated. In parallel was performed a retrospective epidemiological study (1980-1992) regarding the incidence of gastric and pulmonary cancer in two towns in terms of morbidity, mortality and lethality indices. By comparing the estimated carcinogenic risk for this type of cancer with the specific mortality rate registered in our study, we estimate the contribution of 222 R to the cancer mortality percentage in the two towns, as follows: 0.47% for Tirgu Mures and 0.01% for Miercurea Ciuc town for pulmonary cancer and 0.23% and 0.015% for gastric cancer. (author)

  3. Extreme levels of 222Rn and U in a private water supply

    International Nuclear Information System (INIS)

    Lowry, J.D.; Hoxie, D.C.; Moreau, E.

    1987-01-01

    In 1985, the Maine Department of Human Services discovered a private water supply in Leeds, ME, that contains over 40,700 BqL -1 (1.1 x 10 +6 pCil -1 ) of 222 Rn on average, and ranges between 13,300 and 59,200 Bql -1 . The well water also contains a gross alpha concentration of approximately 10.0 BqL -1 (270 pCiL -1 ), of which more than 95 percent is U (403 ugL -1 ). The ratio of 234 U to 238 U averages 1.17, which compares closely to the sea water at 1.14. The Ra content comprises less than 2 percent of the gross alpha. The levels of 222 Rn and U are considered to be extremely high, with the 222 Rn being the highest known level the authors are aware of for a drinking water supply. This area of Maine has geologic features characteristic of those shown by others to have a high potential for elevated levels of 222 Rn and other radioisotopes. The purpose of this paper is to update the information presented previously about this site, in particular to the ramifications on treatment alternatives associated with the presence of both 222 Rn and U in a water supply

  4. 48 CFR 52.222-44 - Fair Labor Standards Act and Service Contract Act-Price Adjustment.

    Science.gov (United States)

    2010-10-01

    ... and Service Contract Act-Price Adjustment. 52.222-44 Section 52.222-44 Federal Acquisition Regulations... CLAUSES Text of Provisions and Clauses 52.222-44 Fair Labor Standards Act and Service Contract Act—Price... Contract Act—Price Adjustment (SEP 2009) (a) This clause applies to both contracts subject to area...

  5. Structural Characterization of Heme Environmental Mutants of CgHmuT that Shuttles Heme Molecules to Heme Transporters

    Directory of Open Access Journals (Sweden)

    Norifumi Muraki

    2016-05-01

    Full Text Available Corynebacteria contain a heme uptake system encoded in hmuTUV genes, in which HmuT protein acts as a heme binding protein to transport heme to the cognate transporter HmuUV. The crystal structure of HmuT from Corynebacterium glutamicum (CgHmuT reveals that heme is accommodated in the central cleft with His141 and Tyr240 as the axial ligands and that Tyr240 forms a hydrogen bond with Arg242. In this work, the crystal structures of H141A, Y240A, and R242A mutants were determined to understand the role of these residues for the heme binding of CgHmuT. Overall and heme environmental structures of these mutants were similar to those of the wild type, suggesting that there is little conformational change in the heme-binding cleft during heme transport reaction with binding and the dissociation of heme. A loss of one axial ligand or the hydrogen bonding interaction with Tyr240 resulted in an increase in the redox potential of the heme for CgHmuT to be reduced by dithionite, though the wild type was not reduced under physiological conditions. These results suggest that the heme environmental structure stabilizes the ferric heme binding in CgHmuT, which will be responsible for efficient heme uptake under aerobic conditions where Corynebacteria grow.

  6. Development of 'SKYSHINE-CG' code. A line-beam method code equipped with combinatorial geometry routine

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Takahiro; Ochiai, Katsuharu [Plant and System Planning Department, Toshiba Corporation, Yokohama, Kanagawa (Japan); Uematsu, Mikio; Hayashida, Yoshihisa [Department of Nuclear Engineering, Toshiba Engineering Corporation, Yokohama, Kanagawa (Japan)

    2000-03-01

    A boiling water reactor (BWR) plant has a single loop coolant system, in which main steam generated in the reactor core proceeds directly into turbines. Consequently, radioactive {sup 16}N (6.2 MeV photon emitter) contained in the steam contributes to gamma-ray skyshine dose in the vicinity of the BWR plant. The skyshine dose analysis is generally performed with the line-beam method code SKYSHINE, in which calculational geometry consists of a rectangular turbine building and a set of isotropic point sources corresponding to an actual distribution of {sup 16}N sources. For the purpose of upgrading calculational accuracy, the SKYSHINE-CG code has been developed by incorporating the combinatorial geometry (CG) routine into the SKYSHINE code, so that shielding effect of in-building equipment can be properly considered using a three-dimensional model composed of boxes, cylinders, spheres, etc. Skyshine dose rate around a 500 MWe BWR plant was calculated with both SKYSHINE and SKYSHINE-CG codes, and the calculated results were compared with measured data obtained with a NaI(Tl) scintillation detector. The C/E values for SKYSHINE-CG calculation were scattered around 4.0, whereas the ones for SKYSHINE calculation were as large as 6.0. Calculational error was found to be reduced by adopting three-dimensional model based on the combinatorial geometry method. (author)

  7. 222Rn levels in Kingsville, Texas, and vicinity near an in situ uranium mine

    International Nuclear Information System (INIS)

    McGehee, T.L.; Martino, M.R.; Harr, T.L.; Samudio, A.

    1994-01-01

    An investigation of the 222 Rn levels in ground water, soils, and indoor air has disclosed two 222 Rn ground-water anomalies in the Kingsville, Texas, area from uranium-enriched sandstones of the Evangeline aquifer. Indoor air 222 Rn levels were measured in summer 1991 (from undetectable to 3.2 pCi/l) and winter 1991-1992 (0.01 to 3.98 pCi/l) to determine seasonal extremes and risk to the public. Soil 222 Rn concentration maps ranging from undetectable to 75.4 pCi/l correlate to the low levels found in homes. Results of this study are based on analyses of 218 water samples, 52 in situ soil samples, and 104 indoor air samples. Water samples were injected into a scintillation mix (EPA/EERF-Manual-78-1) and analyzed by liquid scintillation techniques. Indoor air and soil samples were collected using passive charcoal canisters and analyzed by gamma-ray detection techniques (EPA 520/5-87-005). One ground-water 222 Rn anomaly lies near the permitted boundary of a large uranium deposit that is being mined. Private wells near the ore body yielded, 1,023 to 23,256 pCi/l at the well head. A second anomaly is located 2.5 mi (4 km) north of the uranium ore body near Naval Air Station, Kingsville. Private water wells in this area yielded 442 to 1,950 pCi/l 222 Rn at the well head. The radon anomalies are related to subsurface mineralization, which is one of the known natural geologic hazards of this area. Indoor air 222 Rn levels are well below the U.S. Environmental Protection Agency (US/EPA) action limit of 4 pCi/l. However, the high levels of 222 RN in ground water should be mitigated before entry into the home environment. High 222 Rn levels in ground water were reduced to background levels in household waters by use of a pre-introduction large-capacity holding tank

  8. 36 CFR 222.21 - Administration of wild free-roaming horses and burros and their environment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Administration of wild free-roaming horses and burros and their environment. 222.21 Section 222.21 Parks, Forests, and Public Property... Burros § 222.21 Administration of wild free-roaming horses and burros and their environment. (a) The...

  9. Characterization of CgHIFα-Like, a Novel bHLH-PAS Transcription Factor Family Member, and Its Role under Hypoxia Stress in the Pacific Oyster Crassostrea gigas.

    Directory of Open Access Journals (Sweden)

    Ting Wang

    Full Text Available Hypoxia-inducible factor (HIF, a critical member of the basic-helix-loop-helix (bHLH-containing Per-Arnt-Sim (PAS protein family, is a master transcription factor involved in maintaining oxygen homeostasis. In the present study, we isolated and characterized a novel bHLH-PAS family member, CgHIFα-like gene, from the Pacific oyster Crassostrea gigas, and determined its importance during hypoxia stress. The 3020-bp CgHIFα-like cDNA encoded a protein of 888 amino acids. The predicted CgHIFα-like amino acid sequence was conserved in the N-terminal bHLH, PAS, and PAC domains (but not in the C-terminal domain and was most closely related to the HIF family in the bHLH-PAS protein phylogenic tree. Similar to the mammalian HIF-1α, CgHIFα-like could be expressed as four mRNA isoforms containing alternative 5'-untranslated regions and different translation initiation codons. At the mRNA level, these isoforms were expressed in a tissue-specific manner and showed increased transcription to varying degrees under hypoxic conditions. Additionally, the western blot analysis demonstrated that CgHIFα-like was induced by hypoxia. Electrophoretic mobility shift assay indicated that CgHIFα-like could bind to the hypoxia responsive element (HRE, whereas dual-luciferase reporter analysis demonstrated that CgHIFα-like could transactivate the reporter gene containing the HREs. In addition to CgHIFα-like, we identified CgARNT from the C. gigas, analyzed its expression pattern, and confirmed its interaction with CgHIFα-like using a yeast two-hybrid assay. In conclusion, this is the first report on the cloning and characterization of a novel hypoxia transcription factor in mollusks, which could accumulate under hypoxia and regulate hypoxia related gene expression by binding to HRE and dimerizing with CgARNT. As only one member of HIF has been identified in invertebrates to date, our results provide new insights into the unique mechanisms of hypoxia tolerance in

  10. Characterization of 222Rn entry into a basement structure surrounded by low permeability soil

    International Nuclear Information System (INIS)

    Ward, D.C.

    1992-01-01

    An experimental facility has been developed to monitor the entry rate and concentration of 222 Rn in two basement type structures surrounded by soil having a permeability on the order of 1- -12 m 2 . A data acquisition system recorded environmental conditions outside and inside the structures, including basement air exchange rates, every 15 min. Indoor 222 Rn concentrations ranged from 400 to 1400 Bq m -3 . The observed 222 Rn entry rate is highly variable and has two primary components; a constant input rate caused by diffusion of 222 Rn through the concrete walls and floor, and a variable rate that depends upon indoor-soil pressure differentials of only a few pascals. Pressure differentials are dependent upon wind speed and wind direction. Stack effect was not significant. During a two week period, with relatively calm winds, diffusion through the concrete walls and floor plus the floor-wall joint accounted for more than 80% of the total 222 Rn entry

  11. Overcoming the heterologous bias: An in vivo functional analysis of multidrug efflux transporter, CgCdr1p in matched pair clinical isolates of Candida glabrata

    International Nuclear Information System (INIS)

    Puri, Nidhi; Manoharlal, Raman; Sharma, Monika; Sanglard, Dominique; Prasad, Rajendra

    2011-01-01

    Research highlights: → First report to demonstrate an in vivo expression system of an ABC multidrug transporter CgCdr1p of C. glabrata. → First report on the structure and functional characterization of CgCdr1p. → Functional conservation of divergent but typical residues of CgCdr1p. → CgCdr1p elicits promiscuity towards substrates and has a large drug binding pocket with overlapping specificities. -- Abstract: We have taken advantage of the natural milieu of matched pair of azole sensitive (AS) and azole resistant (AR) clinical isolates of Candida glabrata for expressing its major ABC multidrug transporter, CgCdr1p for structure and functional analysis. This was accomplished by tagging a green fluorescent protein (GFP) downstream of ORF of CgCDR1 and integrating the resultant fusion protein at its native chromosomal locus in AS and AR backgrounds. The characterization confirmed that in comparison to AS isolate, CgCdr1p-GFP was over-expressed in AR isolates due to its hyperactive native promoter and the GFP tag did not affect its functionality in either construct. We observed that in addition to Rhodamine 6 G (R6G) and Fluconazole (FLC), a recently identified fluorescent substrate of multidrug transporters Nile Red (NR) could also be expelled by CgCdr1p. Competition assays with these substrates revealed the presence of overlapping multiple drug binding sites in CgCdr1p. Point mutations employing site directed mutagenesis confirmed that the role played by unique amino acid residues critical to ATP catalysis and localization of ABC drug transporter proteins are well conserved in C. glabrata as in other yeasts. This study demonstrates a first in vivo novel system where over-expression of GFP tagged MDR transporter protein can be driven by its own hyperactive promoter of AR isolates. Taken together, this in vivo system can be exploited for the structure and functional analysis of CgCdr1p and similar proteins wherein the arte-factual concerns encountered in using

  12. Overcoming the heterologous bias: An in vivo functional analysis of multidrug efflux transporter, CgCdr1p in matched pair clinical isolates of Candida glabrata

    Energy Technology Data Exchange (ETDEWEB)

    Puri, Nidhi; Manoharlal, Raman; Sharma, Monika [Membrane Biology Laboratory, School of Life Sciences, Jawaharlal Nehru University, New Delhi 110 067 (India); Sanglard, Dominique [Institut de Microbiologie, Centre Hospitalier Universitaire Vaudois, 1011 Lausanne (Switzerland); Prasad, Rajendra, E-mail: rp47jnu@gmail.com [Membrane Biology Laboratory, School of Life Sciences, Jawaharlal Nehru University, New Delhi 110 067 (India)

    2011-01-07

    Research highlights: {yields} First report to demonstrate an in vivo expression system of an ABC multidrug transporter CgCdr1p of C. glabrata. {yields} First report on the structure and functional characterization of CgCdr1p. {yields} Functional conservation of divergent but typical residues of CgCdr1p. {yields} CgCdr1p elicits promiscuity towards substrates and has a large drug binding pocket with overlapping specificities. -- Abstract: We have taken advantage of the natural milieu of matched pair of azole sensitive (AS) and azole resistant (AR) clinical isolates of Candida glabrata for expressing its major ABC multidrug transporter, CgCdr1p for structure and functional analysis. This was accomplished by tagging a green fluorescent protein (GFP) downstream of ORF of CgCDR1 and integrating the resultant fusion protein at its native chromosomal locus in AS and AR backgrounds. The characterization confirmed that in comparison to AS isolate, CgCdr1p-GFP was over-expressed in AR isolates due to its hyperactive native promoter and the GFP tag did not affect its functionality in either construct. We observed that in addition to Rhodamine 6 G (R6G) and Fluconazole (FLC), a recently identified fluorescent substrate of multidrug transporters Nile Red (NR) could also be expelled by CgCdr1p. Competition assays with these substrates revealed the presence of overlapping multiple drug binding sites in CgCdr1p. Point mutations employing site directed mutagenesis confirmed that the role played by unique amino acid residues critical to ATP catalysis and localization of ABC drug transporter proteins are well conserved in C. glabrata as in other yeasts. This study demonstrates a first in vivo novel system where over-expression of GFP tagged MDR transporter protein can be driven by its own hyperactive promoter of AR isolates. Taken together, this in vivo system can be exploited for the structure and functional analysis of CgCdr1p and similar proteins wherein the arte-factual concerns

  13. 34 CFR 222.192 - What local funds may be considered as available for this project?

    Science.gov (United States)

    2010-07-01

    ... § 222.192 What local funds may be considered as available for this project? To determine the amount of... 34 Education 1 2010-07-01 2010-07-01 false What local funds may be considered as available for this project? 222.192 Section 222.192 Education Regulations of the Offices of the Department of...

  14. 222Rn Determination In Drinking Waters - RAD7 And LSC Technique Comparison

    International Nuclear Information System (INIS)

    Todorovic, N.; Stojkovic, I.; Nikolov, J.; Tenjovic, B.

    2015-01-01

    A procedure for the determination of 222Rn in environmental water samples using liquid scintillation counting (LSC) was applied and optimized. For radon determination in drinking water from groundwater and surface water sources by LSC, the EPA Method 913.0 was used. A minimum detectable activity of 0.029 Bq L-1 in a 20 mL glass vial (10 mL water sample mixed with 10 mL of liquid scintillation cocktail) has been achieved during 300 minutes of measurement time. The procedure was compared with RAD7 radon detector measurements. Factors that affect the measurement accuracy and precision of RAD7 radon detector are the sampling technique, sample concentration, sample size, counting time, temperature, relative humidity and background effects. The minimal detectable activity (MDA) for RAD7 technique was found to be 0.1 Bq/L. From obtained results of 222Rn measurements in 15 water samples with different 222Rn activities, correlation between the two techniques applied for measurements of 222Rn in water samples (A less than 400 Bq/L) was determined. There is reasonable agreement (within statistical uncertainties) between the various techniques in most cases, while disagreements most likely come from systematic uncertainties associated with sampling procedures. Discrepancy in determined activities between the two techniques becomes more evident with increased 222Rn activities in water. LSC technique gives in general higher activity concentrations for about 30 percent than RAD7 spectrometer. The interpretation of shown results could be that RAD7 is not properly calibrated for higher activities, since USA reference level of 222Rn concentrations in water is only 11.1 Bq/L (US EPA, Proposed Radon in Drinking Water Regulation). (author).

  15. A process-based 222radon flux map for Europe and its comparison to long-term observations

    Science.gov (United States)

    Karstens, U.; Schwingshackl, C.; Schmithüsen, D.; Levin, I.

    2015-11-01

    Detailed 222radon (222Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution 222Rn flux map for Europe, based on a parameterization of 222Rn production and transport in the soil. The 222Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based 222Rn soil profile measurements. Monthly 222Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083° × 0.083° and compared to long-term direct measurements of 222Rn exhalation rates in different areas of Europe. The two realizations of the 222Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean 222Rn flux from soils in Europe is estimated to be 10 mBq m-2 s-1 (ERA-Interim/Land soil moisture) or 15 mBq m-2 s-1 (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m-2 s-1 and from ca. 11 to ca. 20 mBq m-2 s-1, respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of 222Rn exhalation rates. Comparison with observations suggests that the flux estimates based on the GLDAS Noah soil moisture model on average better

  16. A process-based 222radon flux map for Europe and its comparison to long-term observations

    International Nuclear Information System (INIS)

    Karstens, U.; Schwingshackl, C.; Schmithuesen, D.; Levin, I.

    2015-01-01

    Detailed 222 radon ( 222 Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution 222 Rn flux map for Europe, based on a parameterization of 222 Rn production and transport in the soil. The 222 Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based 222 Rn soil profile measurements. Monthly 222 Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083 x 0.083 and compared to long-term direct measurements of 222 Rn exhalation rates in different areas of Europe. The two realizations of the 222 Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean 222 Rn flux from soils in Europe is estimated to be 10 mBq m -2 s -1 (ERA-Interim/Land soil moisture) or 15 mBq m -2 s -1 (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m -2 s -1 and from ca. 11 to ca. 20 mBq m -2 s -1 , respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of 222 Rn exhalation rates. Comparison with observations suggests that the flux estimates based on the GLDAS Noah soil moisture model on

  17. T2CG1, a package of preconditioned conjugate gradient solvers for TOUGH2

    International Nuclear Information System (INIS)

    Moridis, G.; Pruess, K.; Antunez, E.

    1994-03-01

    Most of the computational work in the numerical simulation of fluid and heat flows in permeable media arises in the solution of large systems of linear equations. The simplest technique for solving such equations is by direct methods. However, because of large storage requirements and accumulation of roundoff errors, the application of direct solution techniques is limited, depending on matrix bandwidth, to systems of a few hundred to at most a few thousand simultaneous equations. T2CG1, a package of preconditioned conjugate gradient solvers, has been added to TOUGH2 to complement its direct solver and significantly increase the size of problems tractable on PCs. T2CG1 includes three different solvers: a Bi-Conjugate Gradient (BCG) solver, a Bi-Conjugate Gradient Squared (BCGS) solver, and a Generalized Minimum Residual (GMRES) solver. Results from six test problems with up to 30,000 equations show that T2CG1 (1) is significantly (and invariably) faster and requires far less memory than the MA28 direct solver, (2) it makes possible the solution of very large three-dimensional problems on PCs, and (3) that the BCGS solver is the fastest of the three in the tested problems. Sample problems are presented related to heat and fluid flow at Yucca Mountain and WIPP, environmental remediation by the Thermal Enhanced Vapor Extraction System, and geothermal resources

  18. Evaluation of treatments with hCG and carprofen at embryo transfer in a demi-embryo and recipient virgin heifer model.

    Science.gov (United States)

    Torres, A; Chagas E Silva, J; Diniz, P; Lopes-da-Costa, L

    2013-08-01

    An in vivo model, combining a low developmental competence embryo (demi-embryo) and a high-fertility recipient (virgin dairy heifer) was used to evaluate the effects of treatment with human chorionic gonadotropin (hCG) and carprofen at embryo transfer (ET) on plasma progesterone (P₄) concentrations of recipients and on embryonic growth and survival. Embryos were bisected and each demi-embryo was transferred to a recipient on Day 7 of the estrous cycle. At ET, heifers (n = 163) were randomly allocated to treatment with hCG (2500 IU im), carprofen (500 mg iv), hCG plus carprofen or to untreated controls. Plasma P₄ concentrations were measured on Days 0, 7, 14 and 21 of all recipients plus on Days 28, 42 and 63 of pregnant recipients. Pregnancy was presumed to be present in recipients with luteal plasma P4 concentrations until Day 21 and confirmed by using transrectal ultrasonography on Days 28, 42 and 63. Embryonic measurements (crown-rump length and width) were obtained on Day 42. Treatment with hCG induced formation of secondary corpora lutea (CL) in 97% of heifers and increased (P carprofen at ET had no significant effects on plasma P₄ concentrations and rate of embryo mortality. Treatment with hCG plus carprofen at ET induced formation of secondary CL in 90% of heifers but decreased the luteotrophic effect of hCG, resulting in no effect on embryo survival. Low developmental competence embryos showed an intrinsic deficiency in overcoming the maternal recognition of pregnancy challenge and in proceeding to further development until Day 28 of pregnancy, whereas mortality beyond this point was residual. Results on pregnancy rates should be confirmed in further experiments involving a larger sample size.

  19. A novel albumin gene mutation (R222I) in familial dysalbuminemic hyperthyroxinemia.

    Science.gov (United States)

    Schoenmakers, Nadia; Moran, Carla; Campi, Irene; Agostini, Maura; Bacon, Olivia; Rajanayagam, Odelia; Schwabe, John; Bradbury, Sonia; Barrett, Timothy; Geoghegan, Frank; Druce, Maralyn; Beck-Peccoz, Paolo; O'Toole, Angela; Clark, Penelope; Bignell, Michelle; Lyons, Greta; Halsall, David; Gurnell, Mark; Chatterjee, Krishna

    2014-07-01

    Familial dysalbuminemic hyperthyroxinemia, characterized by abnormal circulating albumin with increased T4 affinity, causes artefactual elevation of free T4 concentrations in euthyroid individuals. Four unrelated index cases with discordant thyroid function tests in different assay platforms were investigated. Laboratory biochemical assessment, radiolabeled T4 binding studies, and ALB sequencing were undertaken. (125)I-T4 binding to both serum and albumin in affected individuals was markedly increased, comparable with known familial dysalbuminemic hyperthyroxinemia cases. Sequencing showed heterozygosity for a novel ALB mutation (arginine to isoleucine at codon 222, R222I) in all four cases and segregation of the genetic defect with abnormal biochemical phenotype in one family. Molecular modeling indicates that arginine 222 is located within a high-affinity T4 binding site in albumin, with substitution by isoleucine, which has a smaller side chain predicted to reduce steric hindrance, thereby facilitating T4 and rT3 binding. When tested in current immunoassays, serum free T4 values from R222I heterozygotes were more measurably abnormal in one-step vs two-step assay architectures. Total rT3 measurements were also abnormally elevated. A novel mutation (R222I) in the ALB gene mediates dominantly inherited dysalbuminemic hyperthyroxinemia. Susceptibility of current free T4 immunoassays to interference by this mutant albumin suggests likely future identification of individuals with this variant binding protein.

  20. Progesterone concentration, pregnancy and calving rate in Simmental dairy cows after oestrus synchronisation and hCG treatment during the early luteal phase.

    Science.gov (United States)

    Šuluburić, Adam; Milanović, Svetlana; Vranješ-Đurić, Sanja; Jovanović, Ivan B; Barna, Tomislav; Stojić, Milica; Fratrić, Natalija; Szenci, Ottó; Gvozdić, Dragan

    2017-09-01

    Early embryonic development may be negatively affected by insufficient progesterone (P4) production. Therefore, the aim of our study was to increase P4 by gonadotropin-releasing hormone (GnRH) and/or human chorionic gonadotropin (hCG) treatments after inducing oestrus by prostaglandin (PG) treatment. Lactating Simmental dairy cows (n = 110), between 1 to 5 lactations, with an average milk production of 6,500 1/305 days, at 40-80 days postpartum were used and grouped as follows: (1) PG + GnRH treatment at AI (GnRH group), (2) PG + hCG treatment at day 7 after AI (hCG group), (3) PG + GnRH at AI + hCG treatment at day 7 after AI (GnRH/hCG group), and (4) spontaneous oestrus (C: control group). All animals were double inseminated (at the time of oestrus detection and 12 ± 2 h thereafter). Blood serum and milk samples were collected at the day of observed oestrus (day 0), and 14, 21 and 28 days after AI. Serum P4 was determined using a commercial radioimmunoassay (RIA) test (INEP, Zemun), and milk P4 was determined using enzyme-linked immunoassay (ELISA) test (NIV Novi Sad). Pregnancy status was confirmed by ultrasonography between days 28 and 35 after AI. Differences of serum or milk P4 medians, pregnancy (and calving) rate were determined using Dunn's Multiple Comparison Tests and Z test, respectively. Serum P4 medians were significantly higher at days 14, 21 and 28 after AI in the hCG-treated animals, indicating increased luteal activity, with a similar tendency in whole milk P4 values. Treatment with hCG during the early luteal phase significantly contributed to the maintenance of gestation at days 28-35 after AI, and also increased the calving rate in Simmental dairy cows.

  1. Data of evolutionary structure change: 1CG8B-1OUTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available DHKQI >HHHH -- HHHH> ATOM 1228 C...ryIDChain>1OUTA FWGKISGKADVV ucture>HHHHHGGGHHHH...1CG8B GKHQE-IGVDT >HHHHH- G... >HHHH > ATOM 631 CA ASP A 86 48...ure>G - re> ATOM 329 CA PHE A 43 34.744

  2. Abnormal hCG levels in a patient with treated stage I seminoma: a diagnostic dilemma.

    LENUS (Irish Health Repository)

    Aherne, Noel J

    2008-01-01

    BACKGROUND: We report the case of a patient with treated Stage Ia seminoma who was found to have an elevated beta human chorionic gonadotrophin (hCG) on routine follow - up. This instigated restaging and could have lead to commencement of chemotherapy. CASE PRESENTATION: The patient was a bodybuilder, and following a negative metastatic work - up, admitted to injecting exogenous beta hCG. This was done to reduce withdrawal symptoms from androgen abuse. The patient remains well eight years post diagnosis. CONCLUSION: This case highlights the need for surgical oncologists to conduct vigilant screening of young male patients with a history of testicular germ cell tumours and who may indulge in steroid abuse.

  3. Abnormal hCG levels in a patient with treated stage I seminoma: a diagnostic dilemma

    Directory of Open Access Journals (Sweden)

    Fitzpatrick David G

    2008-06-01

    Full Text Available Abstract Background We report the case of a patient with treated Stage Ia seminoma who was found to have an elevated beta human chorionic gonadotrophin (hCG on routine follow – up. This instigated restaging and could have lead to commencement of chemotherapy. Case presentation The patient was a bodybuilder, and following a negative metastatic work – up, admitted to injecting exogenous beta hCG. This was done to reduce withdrawal symptoms from androgen abuse. The patient remains well eight years post diagnosis. Conclusion This case highlights the need for surgical oncologists to conduct vigilant screening of young male patients with a history of testicular germ cell tumours and who may indulge in steroid abuse.

  4. Mineral water 222 Rn activity decrease due to consumption habits

    International Nuclear Information System (INIS)

    Cipriani, Moacir; Taddei, Maria Helena Tirollo; Silva, Nivaldo Carlos da

    2001-01-01

    Mineral waters from the Pocos de Caldas Plateau springs, an elevated region with high natural radioactivity, in the State of Minas Gerais, Brazil, have significant 222 Rn concentration on site. The highest concentration in the waters are from: Fonte Villela - Aguas da Prata (∼ 1000 Bql -1 ); Fonte Grande Hotel - Pocinhos do Rio Verde (∼ 400 Brq -1 ) and Fonte CNEN Lab - Pocos de Caldas (∼ 290 Bql -1 ). These waters are used by the population as drinking water and due to consumption habits, can lead to internal doses above accepted limits for the public. This work deals with the decrease of 222 Rn activity in mineral waters fro two different popular consumption habits, and with the adult effective dose equivalent reduction due to water consumption habits. It has been found that the estimated dose based on the biokinetic Crawford-Brown model, can be one fourth of dose based on 222 Rn activity on site. (author)

  5. Future Directions in Computer Graphics and Visualization: From CG&A's Editorial Board

    Energy Technology Data Exchange (ETDEWEB)

    Encarnacao, L. M.; Chuang, Yung-Yu; Stork, Andre; Kasik, David; Rhyne, Theresa-Marie; Avila, Lisa; Kohlhammer, Jorn; LaViola, Joseph; Tory, Melanie; Dill, John; Domik, Gitta; Owen, G. Scott; Wong, Pak C.

    2015-01-01

    With many new members joining the CG&A editorial board over the past year, and with a renewed commitment to not only document the state of the art in computer graphics research and applications but to anticipate and where possible foster future areas of scientific discourse and industrial practice, we asked editorial and advisory council members about where they see their fields of expertise going. The answers compiled here aren’t meant to be all encompassing or deterministic when it comes to the opportunities computer graphics and interactive visualization hold for the future. Instead, we aim to accomplish two things: give a more in-depth introduction of members of the editorial board to the CG&A readership and encourage cross-disciplinary discourse toward approaching, complementing, or disputing the visions laid out in this compilation.

  6. Exosome-mediated transfer of miR-222 is sufficient to increase tumor malignancy in melanoma.

    Science.gov (United States)

    Felicetti, Federica; De Feo, Alessandra; Coscia, Carolina; Puglisi, Rossella; Pedini, Francesca; Pasquini, Luca; Bellenghi, Maria; Errico, Maria Cristina; Pagani, Elena; Carè, Alessandra

    2016-02-24

    Growing evidence is showing that metastatic cell populations are able to transfer their characteristics to less malignant cells. Exosomes (EXOs) are membrane vesicles of endocytic origin able to convey their cargo of mRNAs, microRNAs (miRs), proteins and lipids from donors to proximal as well as distant acceptor cells. Our previous results indicated that miR-221&222 are key factors for melanoma development and dissemination. The aim of this study was to verify whether the tumorigenic properties associated with miR-222 overexpression can be also propagated by miR-222-containing EXOs. EXOs were isolated by UltraCentrifugation or Exoquick-TC(®) methods. Preparations of melanoma-derived vesicles were characterized by using the Nanosight™ technology and the expression of exosome markers analyzed by western blot. The expression levels of endogenous and exosomal miRNAs were examined by real time PCR. Confocal microscopy was used to evaluate transfer and uptake of microvesicles from donor to recipient cells. The functional significance of exosomal miR-222 was estimated by analyzing the vessel-like process formation, as well as cell cycle rates, invasive and chemotactic capabilities. Besides microvesicle marker characterization, we evidenced that miR-222 exosomal expression mostly reflected its abundance in the cells of origin, correctly paralleled by repression of its target genes, such as p27Kip1, and induction of the PI3K/AKT pathway, thus confirming its functional implication in cancer. The possible differential significance of PI3K/AKT blockade was assessed by using the BKM120 inhibitor in miR-222-transduced cell lines. In addition, in vitro cultures showed that vesicles released by miR-222-overexpressing cells were able to transfer miR-222-dependent malignancy when taken-up by recipient primary melanomas. Results were confirmed by antagomiR-221&222 treatments and by functional observations after internalization of EXOs devoid of these miRs. All together these data

  7. Indoor 222Rn measurements in the region of Beijing, People's Republic of China

    International Nuclear Information System (INIS)

    Ren, T.S.; Lin, L.Q.; Chen, Z.P.; Li, G.Y.; Chen, A.M.

    1987-01-01

    Passive integrating activated C detectors were used to study the regional distribution and temporal variation of 222 Rn in indoor air in dwellings in the Beijing region. Measurements were made in 537 dwellings, which were either detached houses or multi-family apartments. The city-wide study was completed in 1985. The distributions are approximately log-normal with 90% of the dwellings having 222 Rn levels less than 60 Bq m-3. The weighted average 222 Rn concentration has been found to be 22.4 Bq m-3. Averages for detached houses and multi-family dwellings are 25.9 and 15.2 Bq m-3, respectively. Assuming an equilibrium factor of 0.5 and an occupancy factor of 0.8, the average equilibrium equivalent concentration of 222 Rn progeny is 11.2 Bq m-3 and the annual average effective dose equivalent is 1.1 mSv

  8. Ra-226 and Rn-222 in saline water compartments of the Aral Sea region

    International Nuclear Information System (INIS)

    Schettler, Georg; Oberhänsli, Hedi; Hahne, Knut

    2015-01-01

    Highlights: • 222 Rn and 226 Ra concentrations in different water compartments of the Aral Sea region. • 226 Ra-analysis based on 222 Rn-ingrowth versus MS-analysis after solid-phase extraction. • 226 Ra in different groundwater types of the Aral Sea Basin. • 222 Rn distribution in the Aral Sea, western basin. - Abstract: The Aral Sea has been shrinking since 1963 due to extensive irrigation and the corresponding decline in the river water inflow. Understanding of the current hydrological situation demands an improved understanding of the surface water/groundwater dynamics in the region. 222 Rn and 226 Ra measurements can be used to trace groundwater discharge into surface waters. Data of these radiometric parameters were not previously available for the study region. We determined 222 Rn activities after liquid phase extraction using Liquid Scintillation Counting (LSC) with peak-length discrimination and analyzed 226 Ra concentrations in different water compartments of the Amu Darya Delta (surface waters, unconfined groundwater, artesian water, and water profiles from the closed Large Aral Sea (western basin). The water samples comprise a salinity range between 1 and 263 g/l. The seasonal dynamics of solid/water interaction under an arid climate regime force the hydrochemical evolution of the unconfined groundwater in the Amu Darya Delta to high-salinity Na(Mg)Cl(SO 4 ) water types. The dissolved radium concentrations in the waters were mostly very low due to mineral over-saturation, extensive co-precipitation of radium and adsorption of radium on coexisting solid substrates. The analysis of very low 226 Ra concentrations (<10 ppq) at remote study sites is a challenge. We used the water samples to test and improve different analytical methods. In particular, we modified a procedure developed for the α-spectrometric determination of 226 Ra after solid phase extraction of radium using 3M Empore™ High Performance Extraction Disks (Purkl, 2002) for the

  9. Toprak Radon (222Rn Gazı Anomalilerinin ARIMA Analizi

    Directory of Open Access Journals (Sweden)

    Miraç KAMIŞLIOĞLU

    2014-12-01

    Full Text Available Özet: Zaman serileri analizi, istatistik, ekonomi, fizik ve mühendislik gibi bilim dallarında geniş uygulama alanına sahiptir. Zaman serisi analizi, değişkenlerin gelecekteki değerlerinin doğru bir şekilde tahmin edilmesi için kullanılan bir yöntemdir. Bu çalışmada, bir deprem öncüsü olarak bilinen toprak radon gazı (222Rn ölçümleri ile bir zaman serisi oluşturulmuştur. Bu veriler kullanılarak, otoregresif süreçler (ARIMA yardımıyla dinamik sistem modellemesi yapılmıştır. ARIMA; zaman serileri analizinde, zaman içerisinde rastgele gerçekleşen bir stokastik (olasılıksal sürecin veya hatalarının modellenmesidir. ARIMA modeli, temelde Box-Jenkins modeline dayanmaktadır. Box-Jenkins modeli, tek değişkenli zaman serilerinin ileriye dönük tahmin ve kontrolünde kullanılan istatistiksel tabanlı bir yöntemdir. Elde edilen sonuçlar, ARIMA modellerinin tahmin konusundaki başarısını göstermektedir. Anahtar kelimeler: Zaman Serileri Analizi, Radon Gazı (222Rn, ARIMA ARIMA Analysis of Soil Radon (222Rn Gas Anomalies Abstract: Time series analysis, has wide applications in statistics, economics, physics and engineering such disciplines. This method used for estimate correctly future values of the variables. In this study, is formed a time series with soil radon gas (222Rn measurements known as a pioneer of an earthquake. Dynamic system modelling was performed with autoregressive (ARIMA modelling process by used these measurements. ARIMA; time series analysis is modelled of the recoverable over time a random stochastic (probabilistic process or its errors. ARIMA model is based on Box-Jenkins model. Box-Jenkins model is a statistically based method which is used forward-looking forecasting and control of univariate time series. The obtained results, ARIMA model is indicating success in predict subject. Key words: Time Series Analysis, Radon Gas (222Rn, ARIMA

  10. Online {sup 222}Rn removal by cryogenic distillation in the XENON100 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Aprile, E.; Anthony, M.; De Perio, P.; Gao, F.; Goetzke, L.W.; Greene, Z.; Lin, Q.; Messina, M.; Plante, G.; Rizzo, A.; Zhang, Y. [Columbia University, Physics Department, New York, NY (United States); Aalbers, J.; Breur, P.A.; Brown, A.; Colijn, A.P.; Decowski, M.P.; Hogenbirk, E.; Tiseni, A. [Nikhef and the University of Amsterdam, Science Park, Amsterdam (Netherlands); Agostini, F. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); University of Bologna, Department of Physics and Astrophysics, Bologna (Italy); INFN-Bologna (Italy); Alfonsi, M.; Geis, C.; Grignon, C.; Oberlack, U.; Scheibelhut, M.; Schindler, S. [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik and Exzellenzcluster PRISMA, Mainz (Germany); Amaro, F.D.; Cardoso, J.M.R.; Lopes, J.A.M.; Orrigo, S.E.A.; Santos, J.M.F. dos; Silva, M. [University of Coimbra, Department of Physics, Coimbra (Portugal); Arneodo, F.; Benabderrahmane, M.L.; Di Giovanni, A.; Maris, I. [New York University Abu Dhabi, Abu Dhabi (United Arab Emirates); Barrow, P.; Baudis, L.; Franco, D.; Galloway, M.; Kessler, G.; Kish, A.; Mayani, D.; Pakarha, P.; Piastra, F.; Wei, Y.; Wulf, J. [University of Zurich, Physik-Institut, Zurich (Switzerland); Bauermeister, B. [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik and Exzellenzcluster PRISMA, Mainz (Germany); Stockholm University, AlbaNova, Department of Physics, Oskar Klein Centre, Stockholm (Sweden); Berger, T.; Brown, E.; Piro, M.C. [Rensselaer Polytechnic Institute, Department of Physics, Applied Physics and Astronomy, Troy, NY (United States); Bruenner, S.; Cichon, D.; Eurin, G.; Hasterok, C.; Lindner, M.; Undagoitia, T.M.; Pizzella, V.; Rauch, L.; Rupp, N.; Schreiner, J.; Simgen, H. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Bruno, G.; Gallo Rosso, A.; Molinario, A. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); Budnik, R.; Duchovni, E.; Itay, R.; Landsman, H.; Lellouch, D.; Levinson, L.; Manfredini, A.; Priel, N. [Weizmann Institute of Science, Department of Particle Physics and Astrophysics, Rehovot (Israel); Buetikofer, L.; Coderre, D.; Kaminsky, B.; Schumann, M.; Sivers, M. v. [Universitaet Freiburg, Physikalisches Institut, Freiburg (Germany); Calven, J.; Conrad, J.; Ferella, A.D.; Pelssers, B. [Stockholm University, AlbaNova, Department of Physics, Oskar Klein Centre, Stockholm (Sweden); Cervantes, M.; Lang, R.F.; Masson, D.; Pienaar, J.; Reichard, S.; Reuter, C. [Purdue University, Department of Physics and Astronomy, West Lafayette, IN (United States); Cussonneau, J.P.; Diglio, S.; Le Calloch, M.; Masbou, J.; Micheneau, K.; Persiani, R.; Thers, D. [Universite de Nantes, SUBATECH, Ecole des Mines de Nantes, CNRS/In2p3, Nantes (France); Di Gangi, P.; Garbini, M.; Massoli, F.V.; Sartorelli, G.; Selvi, M. [University of Bologna, Department of Physics and Astrophysics, Bologna (Italy); INFN, Bologna (Italy); Fei, J.; Ni, K.; Ye, J. [University of California, Department of Physics, San Diego, CA (United States); Fieguth, A.; Murra, M.; Rosendahl, S.; Weinheimer, C. [Westfaelische Wilhelms-Universitaet Muenster, Institut fuer Kernphysik, Muenster (Germany); Fulgione, W. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); INFN-Torino (Italy); Osservatorio Astrofisico di Torino, Turin (Italy); Grandi, L.; Saldanha, R.; Shockley, E.; Upole, N. [University of Chicago, Department of Physics and Kavli Institute of Cosmological Physics, Chicago, IL (United States); Lindemann, S. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Universitaet Freiburg, Physikalisches Institut, Freiburg (Germany); Meng, Y.; Stein, A.; Wang, H. [University of California, Physics and Astronomy Department, Los Angeles, CA (United States); Miguez, B.; Trinchero, G. [INFN-Torino (Italy); Osservatorio Astrofisico di Torino, Turin (Italy); Naganoma, J.; Shagin, P. [Rice University, Department of Physics and Astronomy, Houston, TX (United States); Lavina, L.S. [LPNHE, Universite Pierre et Marie Curie, Universite Paris Diderot, CNRS/IN2P3, Paris (France); Tunnell, C. [Nikhef and the University of Amsterdam, Science Park, Amsterdam (Netherlands); University of Chicago, Department of Physics and Kavli Institute of Cosmological Physics, Chicago, IL (United States); Cristescu, I. [Karlsruhe Institute of Technology, Tritium Laboratory Karlsruhe, Eggenstein-Leopoldshafen (Germany); Collaboration: XENON Collaboration

    2017-06-15

    We describe the purification of xenon from traces of the radioactive noble gas radon using a cryogenic distillation column. The distillation column was integrated into the gas purification loop of the XENON100 detector for online radon removal. This enabled us to significantly reduce the constant {sup 222}Rn background originating from radon emanation. After inserting an auxiliary {sup 222}Rn emanation source in the gas loop, we determined a radon reduction factor of R > 27 (95% C.L.) for the distillation column by monitoring the {sup 222}Rn activity concentration inside the XENON100 detector. (orig.)

  11. Structure-function analysis of STING activation by c[G(2',5')pA(3',5')p] and targeting by antiviral DMXAA.

    Science.gov (United States)

    Gao, Pu; Ascano, Manuel; Zillinger, Thomas; Wang, Weiyi; Dai, Peihong; Serganov, Artem A; Gaffney, Barbara L; Shuman, Stewart; Jones, Roger A; Deng, Liang; Hartmann, Gunther; Barchet, Winfried; Tuschl, Thomas; Patel, Dinshaw J

    2013-08-15

    Binding of dsDNA by cyclic GMP-AMP (cGAMP) synthase (cGAS) triggers formation of the metazoan second messenger c[G(2',5')pA(3',5')p], which binds the signaling protein STING with subsequent activation of the interferon (IFN) pathway. We show that human hSTING(H232) adopts a "closed" conformation upon binding c[G(2',5')pA(3',5')p] and its linkage isomer c[G(2',5')pA(2',5')p], as does mouse mSting(R231) on binding c[G(2',5')pA(3',5')p], c[G(3',5')pA(3',5')p] and the antiviral agent DMXAA, leading to similar "closed" conformations. Comparing hSTING to mSting, 2',5'-linkage-containing cGAMP isomers were more specific triggers of the IFN pathway compared to the all-3',5'-linkage isomer. Guided by structural information, we identified a unique point mutation (S162A) placed within the cyclic-dinucleotide-binding site of hSTING that rendered it sensitive to the otherwise mouse-specific drug DMXAA, a conclusion validated by binding studies. Our structural and functional analysis highlights the unexpected versatility of STING in the recognition of natural and synthetic ligands within a small-molecule pocket created by the dimerization of STING. Copyright © 2013 Elsevier Inc. All rights reserved.

  12. Exposure to radon Rn-222 of inhabitants of buildings in Olsztyn

    International Nuclear Information System (INIS)

    Gorzkowski, B.; Pachocki, K.; Rozycki, Z.; Majle, T.; Pensko, J.; Krzeslak, A.

    1998-01-01

    The concentrations of radon-222 in the air of some buildings in Olsztyn were measured. The main source of radon in buildings is in general the ground under building and the materials used for building structure. In this work the results of radon-222 concentration measurements in the air of some buildings constructed before the 1939 year, in the buildings constructed after 1945 year with the traditional use of the bricks and in the buildings constructed with the use of great prefabricated plates are presented. The relations between radon-222 concentrations in the basements and in the first floor flats situated above the basement were evaluated. Based on the mean radon concentrations in the air of the various types of buildings investigated the effective doses for the inhabitants of each type of buildings were estimated. (author)

  13. MicroRNA-222 Promotes the Proliferation of Pulmonary Arterial Smooth Muscle Cells by Targeting P27 and TIMP3

    Directory of Open Access Journals (Sweden)

    Ying Xu

    2017-08-01

    Full Text Available Background/Aims: Aberrant vascular smooth muscle cell (VSMC proliferation plays an important role in the development of pulmonary artery hypertension (PAH. Dysregulated microRNAs (miRNAs, miRs have been implicated in the progression of PAH. miR-222 has a pro-proliferation effect on VSMCs while it has an anti-proliferation effect on vascular endothelial cells (ECs. As the biological function of a single miRNA could be cell-type specific, the role of miR-222 in pulmonary artery smooth muscle cell (PASMC proliferation is not clear and deserves to be explored. Methods: PASMCs were transfected with miR-222 mimic or inhibitor and PASMC proliferation was determined by Western blot for PCNA, Ki-67 and EdU staining, and cell number counting. The target genes of miR-222 including P27 and TIMP3 were determined by luciferase assay and Western blot. In addition, the functional rescue experiments were performed based on miR-222 inhibitor and siRNAs to target genes. Results: miR-222 mimic promoted PASMC proliferation while miR-222 inhibitor decreased that. TIMP3 was identified to be a direct target gene of miR-222 based on luciferase assay. Meanwhile, P27 and TIMP3 were up-regulated by miR-222 inhibitor and down-regulated by miR-222 mimic. Moreover, P27 siRNA and TIMP3 siRNA could both attenuate the anti-proliferation effect of miR-222 inhibitor in PASMCs, supporting that P27 and TIMP3 are at least partially responsible for the regulatory effect of miR-222 in PASMCs. Conclusion: miR-222 promotes PASMC proliferation at least partially through targeting P27 and TIMP3.

  14. Empty follicle syndrome after GnRHa triggering versus hCG triggering in COS

    DEFF Research Database (Denmark)

    Castillo, Juan C; Garcia-Velasco, Juan; Humaidan, Peter

    2012-01-01

    This study aimed to explore the incidence of empty follicle syndrome (EFS) in oocyte donors who had final oocyte maturation triggered with GnRHa and to compare the incidence of EFS in this group of patients with IVF patients who had final oocyte maturation with hCG....

  15. Epigenetic modulation with HDAC inhibitor CG200745 induces anti-proliferation in non-small cell lung cancer cells.

    Directory of Open Access Journals (Sweden)

    Sung-Min Chun

    Full Text Available Histone modification plays a pivotal role on gene regulation, as regarded as global epigenetic markers, especially in tumor related genes. Hence, chemical approaches targeting histone-modifying enzymes have emerged onto the main stage of anticancer drug discovery. Here, we investigated the therapeutic potentials and mechanistic roles of the recently developed histone deacetylase inhibitor, CG200745, in non-small cell lung cancer cells. Treatment with CG200745 increased the global level of histone acetylation, resulting in the inhibition of cell proliferation. ChIP-on-chip analysis with an H4K16ac antibody showed altered H4K16 acetylation on genes critical for cell growth inhibition, although decreased at the transcription start site of a subset of genes. Altered H4K16ac was associated with changes in mRNA expression of the corresponding genes, which were further validated in quantitative RT-PCR and western blotting assays. Our results demonstrated that CG200745 causes NSCLC cell growth inhibition through epigenetic modification of critical genes in cancer cell survival, providing pivotal clues as a promising chemotherapeutics against lung cancer.

  16. Epigenetic modulation with HDAC inhibitor CG200745 induces anti-proliferation in non-small cell lung cancer cells.

    Science.gov (United States)

    Chun, Sung-Min; Lee, Ji-Young; Choi, Jene; Lee, Je-Hwan; Hwang, Jung Jin; Kim, Chung-Soo; Suh, Young-Ah; Jang, Se Jin

    2015-01-01

    Histone modification plays a pivotal role on gene regulation, as regarded as global epigenetic markers, especially in tumor related genes. Hence, chemical approaches targeting histone-modifying enzymes have emerged onto the main stage of anticancer drug discovery. Here, we investigated the therapeutic potentials and mechanistic roles of the recently developed histone deacetylase inhibitor, CG200745, in non-small cell lung cancer cells. Treatment with CG200745 increased the global level of histone acetylation, resulting in the inhibition of cell proliferation. ChIP-on-chip analysis with an H4K16ac antibody showed altered H4K16 acetylation on genes critical for cell growth inhibition, although decreased at the transcription start site of a subset of genes. Altered H4K16ac was associated with changes in mRNA expression of the corresponding genes, which were further validated in quantitative RT-PCR and western blotting assays. Our results demonstrated that CG200745 causes NSCLC cell growth inhibition through epigenetic modification of critical genes in cancer cell survival, providing pivotal clues as a promising chemotherapeutics against lung cancer.

  17. 222Rn in private well water in the vicinity of uranium mines over ten years

    International Nuclear Information System (INIS)

    Yunoki, Eiji; Kataoka, Toshio; Michihiro, Kenshu; Sugiyama, Hirokazu; Shimizu, Mitsuo; Mori, Tadashige

    1994-01-01

    There are many small uranium mines of the sedimentary type in Kamisaibara, Okayama Prefecture, Japan. As inhabitants in Kamisaibara consume water from privately-dug wells, it is important to investigate distributions of 222 Rn in privately-dug well water in the vicinity of the mines. The determination of 222 Rn in well water was carried out from April 1980 to October 1990. Though small in area (16 km 2 ), each well water has its own characteristic activity concentrations of 222 Rn. The activity concentrations of 222 Rn are almost constant for each specific well over a long period (about 10 years). In general, the correlation coefficients for several sampling points are small. As Akawase and Tennoh are situated in the same rock type, the correlation coefficient is the highest value in this area. The estimated dose equivalent for the human stomach is approximately 0.4-54 μSv/year. The type of distribution of 222 Rn in privately-dug well water is log normal. (author)

  18. Basal progesterone level as the main determinant of progesterone elevation on the day of hCG triggering in controlled ovarian stimulation cycles.

    Science.gov (United States)

    Papaleo, Enrico; Corti, Laura; Vanni, Valeria Stella; Pagliardini, Luca; Ottolina, Jessica; De Michele, Francesca; La Marca, Antonio; Viganò, Paola; Candiani, Massimo

    2014-07-01

    Modest increases of serum progesterone at human chorionic gonadotrophin (hCG) administration in controlled ovarian hyperstimulation (COH) cycles have been shown to have a negative impact on pregnancy outcomes. The aim of this study was to identify early predictors of progesterone elevation at hCG. Pregnancy outcome of 303 consecutive patients undergoing COH and fresh day-3 embryo transfer was analysed. Considering the non-linear relationship between progesterone at hCG triggering and pregnancy outcomes, partial area under the curve (pAUC) analysis was used to implement marker identification potential of receiver operating characteristic (ROC) curve analysis. Multivariate logistic analysis was then performed to identify predictors of progesterone rise. Pregnancy outcomes could be predicted by pAUC analysis (pAUC = 0.58, 95 % CI 0.51-0.66, p = 0.02) and a significant detrimental cut-off could be calculated (progesterone at hCG > 1.35 ng/ml). Total dose of rFSH administered, E2 level at hCG but mostly basal progesterone level (OR = 12.21, 95 % CI 1.82-81.70) were predictors of progesterone rise above the cut-off. Basal progesterone is shown to be the main prognostic factor for progesterone elevation. This observation should be taken into consideration in the clinical management of IVF/ICSI cycles to improve pregnancy outcomes.

  19. Production and testing of HENDL-2.1/CG coarse-group cross-section library based on ENDF/B-VII.0

    International Nuclear Information System (INIS)

    Xu Dezheng; He Zhaozhong; Zou Jun; Zeng Qin

    2010-01-01

    A coarse-group coupled neutron and photon (27n + 21γ) cross-section library HENDL-2.1/CG, based on ENDF/B-VII.0 evaluate data source, has been produced by FDS Team in Institute of Plasma Physics, Chinese Academy of Sciences (ASIPP). HENDL-2.1/CG containing 350 nuclide cross-section files (from 1 H to 252 Cf) was generated in MATXS format with the NJOY processing system and then by compiling coarse-group problem-dependent format using the TRANSX code. In order to verify the availability and reliability of the HENDL-2.1/CG data library, requisite benchmark calculations were performed and compared with HENDL-2.0/MG fine-group coupled neutron and photon (175n + 42γ) cross-section library. In general, results using the coarse-group library showed similarly believable as fine-group library.

  20. Mapping of 222Rn and 4He in soil gas over a karstic limestone-granite boundary: correlation of high indoor 222Rn with zones of enhanced permeability

    International Nuclear Information System (INIS)

    O'Connor, P.J.; Gallagher, V.; Van den Boom, G.

    1992-01-01

    Recent indoor radon reconnaissance surveys in Ireland have identified buildings with high radon concentrations (up to 1700 Bq.m -3 ) overlying Carboniferous karstic limestone sequences in the western part of the country. A detailed investigation of indoor 222 Rn and soil gas 222 Rn and 4 He concentrations has been carried out over a karstic limestone-uraniferous granite boundary in County Galway. High indoor 222 Rn concentrations occur in dwellings over both lithologies. Radon migratory routes in bedrock and overburden appear to be controlled by zones of enhanced permeability, e.g. fractures, faults, etc. which are defined by linear arrays of elevated 4 He soil gas values. While the ultimate source of radon remains conjectural, the greatly enhanced permeability of karstified limestone is thought to be of fundamental importance in providing a means of rapid radon transport into overlying soils and buildings. (author)

  1. Rola leptyny w regulacji metabolizmu lipidów i węglowodanów

    Directory of Open Access Journals (Sweden)

    Patrycja Gogga*

    2011-01-01

    Full Text Available Leptyna jest białkiem wydzielanym głównie przez tkankę tłuszczową, a jej stężenie we krwi jest ściśle związane z ilością zapasów energetycznych zgromadzonych w adipocytach. Jako hormon leptyna ma niezwykle szeroki zakres działania. Białko to bezpośrednio lub za pośrednictwem układu współczulnego bierze udział w regulacji metabolizmu energetycznego. Leptyna hamuje biosyntezę triacylogliceroli w wątrobie i tkance tłuszczowej, a także w mięśniach szkieletowych, obniżając tym samym ilość odkładanych w nich lipidów. W adipocytach leptyna zmniejsza ekspresję genów kodujących syntazę kwasów tłuszczowych (FAS i karboksylazę acetylo-CoA (ACC – główne enzymy szlaku biosyntezy kwasów tłuszczowych. Zwiększa z kolei ekspresję genu kodującego lipazę zależną od hormonów (HSL, co stymuluje hydrolizę triacylogliceroli w tkance tłuszczowej. Ponadto leptyna wzmaga utlenianie kwasów tłuszczowych w adipocytach, mięśniach szkieletowych oraz w mięśniu sercowym, wywołując wzrost ekspresji genów kodujących podstawowe dla tego procesu enzymy, palmitoilotransferazę karnitynową 1 (CPT1 i dehydrogenazę acylo-CoA o średniej długości łańcucha (MCAD. Wykazano również, że hormon ten zwiększa wrażliwość tkanek na insulinę i poprawia tolerancję glukozy – pod wpływem leptyny wzrasta transport glukozy do komórek oraz intensywność glikolizy.Wiadomo, że leptyna bierze udział w długoterminowej regulacji pobierania pokarmu, jednak coraz więcej badań wskazuje, że ma ona również wpływ na przemiany substratów energetycznych w tkankach obwodowych. Leptyna może zatem kontrolować homeostaz�� energetyczną organizmu wywołując zmiany metabolizmu lipidów i węglowodanów, przede wszystkim w tkance tłuszczowej i w mięśniach.

  2. 12 CFR 222.20 - Coverage and definitions.

    Science.gov (United States)

    2010-01-01

    ... FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.20 Coverage and definitions. (a...-existing business relationship—(i) In general. The term “pre-existing business relationship” means a relationship between a person, or a person's licensed agent, and a consumer based on— (A) A financial contract...

  3. Pre-evacuation hCG glycoforms in uneventful complete hydatidiform mole and persistent trophoblastic disease.

    NARCIS (Netherlands)

    Thomas, C.M.G.; Kerkmeijer, L.G.W.; Ariaens, H.J.; Steen, R. van der; Massuger, L.F.A.G.; Sweep, F.C.

    2010-01-01

    OBJECTIVE: To investigate whether the glycoform distribution patterns of human chorionic gonadotropin (hCG) obtained by chromatofocusing in pre-evacuation serum are different for patients who will eventually develop into persistent trophoblastic disease in case of complete hydatidiform mole

  4. Evaluate transport processes in MERRA driven chemical transport models using updated 222Rn emission inventories and global observations

    Science.gov (United States)

    Zhang, B.; Liu, H.; Crawford, J. H.; Fairlie, T. D.; Chen, G.; Chambers, S. D.; Kang, C. H.; Williams, A. G.; Zhang, K.; Considine, D. B.; Payer Sulprizio, M.; Yantosca, R.

    2015-12-01

    Convective and synoptic processes play a major role in determining the transport and distribution of trace gases and aerosols in the troposphere. The representation of these processes in global models (at ~100-1000 km horizontal resolution) is challenging, because convection is a sub-grid process and needs to be parameterized, while synoptic processes are close to the grid scale. Depending on the parameterization schemes used in climate models, the role of convection in transporting trace gases and aerosols may vary from model to model. 222Rn is a chemically inert and radioactive gas constantly emitted from soil and has a half-life (3.8 days) comparable to synoptic timescale, which makes it an effective tracer for convective and synoptic transport. In this study, we evaluate the convective and synoptic transport in two chemical transport models (GMI and GEOS-Chem), both driven by the NASA's MERRA reanalysis. Considering the uncertainties in 222Rn emissions, we incorporate two more recent scenarios with regionally varying 222Rn emissions into GEOS-Chem/MERRA and compare the simulation results with those using the relatively uniform 222Rn emissions in the standard model. We evaluate the global distribution and seasonality of 222Rn concentrations simulated by the two models against an extended collection of 222Rn observations from 1970s to 2010s. The intercomparison will improve our understanding of the spatial variability in global 222Rn emissions, including the suspected excessive 222Rn emissions in East Asia, and provide useful feedbacks on 222Rn emission models. We will assess 222Rn vertical distributions at different latitudes in the models using observations at surface sites and in the upper troposphere and lower stratosphere. Results will be compared with previous models driven by other meteorological fields (e.g., fvGCM and GEOS4). Since the decay of 222Rn is the source of 210Pb, a useful radionuclide tracer attached to submicron aerosols, improved

  5. Serum angiopoietin-2 and β-hCG as predictors of prolonged uterine bleeding after medical abortion in the first trimester.

    Directory of Open Access Journals (Sweden)

    Maofeng Wang

    Full Text Available OBJECTIVE: The combination of mifepristone and misoprostol is an established method for induction of early first trimester abortion, but there is no consensus about the best evaluation of treatment outcome. We evaluate serum Angiopoietin-2 (Ang-2 and β human chorionic gonadotropin (β-hCG in women who had undergone a medical abortion as markers of prolonged uterine bleeding (PUB. METHODS: Prospective trial involving 2843 women attending an gynecology outpatient clinic who following a medical abortion with mifepristone and misoprostol, the study cohort was divided into women with duration of uterine bleeding >14 days (PUB and women with duration of uterine bleeding ≤14 days (normal uterine bleeding, NUB. Serum determinations of Ang-2 levels by ELISA and β-hCG levels by electrochemiluminiscence immunoassay. Receiver Operating Characteristics (ROC analyses were calculated and plotted for the diagnostic accuracy of serum β-hCG and Ang-2 concentration to discriminate PUB and NUB. RESULTS: Baseline characteristics for both groups were similar, Only duration of bleeding showed a significant difference between the PUB group and NUB group. Ang-2 serum levels moderately correlated with serum β-hCG levels with statistically significant correlation coefficients of 0.536. Serum β-hCG and Ang-2 levels on day 7 and on day 14 after medical abortion were signifcantly higher in PUB group than in NUB group. Plotted as ROC curves, β-hCG area under curve (AUC was 0.65 (95% CI, 0.53-0.76 on day 7, rising to AUC = 0.83 (95% CI, 0.75-0.92 on day 14. Using Ang-2 on day 7 and day 14 as predictive parameter resulted in an analogous AUC (AUC = 0.61 on day 7, AUC = 0.78 on day 14. CONCLUSIONS: Both parameters are clinically useful as a diagnostic test in predicting PUB after medical abortion, and can be helpful in uncertain clinical situations, but should be considered as supplementary to a general clinical evaluation.

  6. Distribution Log Normal of 222 Rn in the state of Zacatecas, Mexico

    International Nuclear Information System (INIS)

    Garcia, M.L.; Mireles, F.; Quirino, L.; Davila, I.; Rios, C.; Pinedo, J.L.

    2006-01-01

    In this work the evaluation of the concentration of 222 Rn in air for Zacatecas is shown. The Solid State Nuclear Track Detectors were used as the technique for the realization of the measurements in large scale with cellulose nitrate LR-115, type 2, in open chambers of 222 Rn. The measurements were carried out during three months in different times of the year. In the results it is presented the log normal distribution, arithmetic mean and geometric media for the concentration at indoor and outdoor of residence constructions, the concentration at indoor of occupational constructions and in the 57 municipal heads of the state of Zacatecas. The statistics of the values in the concentration showed variation according to the time of the year, obtaining high quantities in winter seasons for both cases. The distribution of the concentration of 222 Rn is presented in the state map for each one of the municipalities, representing the measurement places in the entire state of Zacatecas. Finally the places where the values in the concentration of 222 Rn in air are near to the one limit settled down by the EPA of 148 Bq/m 3 are presented. (Author)

  7. Measurements of 222Rn and its daughters and estimation of internal doses to workers in underground buildings

    International Nuclear Information System (INIS)

    Cao Jianping; Lu Zhizhao; Li Yuanshan

    1993-03-01

    The results of concentration measuring of 222 Ru and its daughters and estimation of internal doses to workers in the underground buildings at Nanjing city are presented. The double filtering membrane method and Thomas method were used in the monitoring of 222 Rn and its daughters, and the dose conversion factor was taken from the latest UNSCEAR report. Concentration distributions of 222 Rn and its daughters were approximately log-normal. The geometric means for 222 Rn was 40.5 Bq · m -3 and for its daughters was 1.4 x 10 -7 J · m -3 . The equilibrium factor was 0.63. The radioactive equilibrium ratio between short-lived 222 Rn daughters was 1:0.57:0.49. The estimation value of annual effective dose equivalent from 222 Rn daughters to workers working at underground sites was 1.3 mSv, which was 86% higher than that of those working on ground sites

  8. Prion protein genotype survey confirms low frequency of scrapie-resistant K222 allele in British goat herds.

    Science.gov (United States)

    Goldmann, W; Marier, E; Stewart, P; Konold, T; Street, S; Langeveld, J; Windl, O; Ortiz-Pelaez, A

    2016-02-13

    Scrapie in goats is a transmissible, fatal prion disease, which is endemic in the British goat population. The recent success in defining caprine PRNP gene variants that provide resistance to experimental and natural classical scrapie has prompted the authors to conduct a survey of PRNP genotypes in 10 goat breeds and 52 herds to find goats with the resistant K222 allele. They report here the frequencies in 1236 tested animals of the resistance-associated K222 and several other alleles by breed and herd. Eight animals were found to be heterozygous QK222 goats (0.64 per cent genotype frequency, 95 per cent CI 0.28 to 1.27 per cent) but no homozygous KK222 goats were detected. The K222 allele was found in Saanen, Toggenburg and Anglo-Nubian goats. The fact that only a few goats with the K222 allele have been identified does not preclude the possibility to design and implement successful breeding programmes at national level. British Veterinary Association.

  9. 48 CFR 52.222-3 - Convict Labor.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Convict Labor. 52.222-3... Labor. As prescribed in 22.202, insert the following clause: Convict Labor (JUN 2003) (a) Except as... union central bodies or similar labor union organizations have been consulted; (iii) Such paid...

  10. Student production: making a realistic stereo CG short film in six months

    Science.gov (United States)

    Ramasamy, Celambarasan

    2010-02-01

    This paper breaks down the R&D and production challenges faced on a stereoscopic CG short film that was developed on a six month time budget. Using this film as an example, the manner in which technical innovation and story telling techniques can be used to emphasize the strengths and hide the weaknesses of a limited timeframe student production is discussed.

  11. Comparative effects of sub-stimulating concentrations of non-human versus human Luteinizing Hormones (LH) or chorionic gonadotropins (CG) on adenylate cyclase activation by forskolin in MLTC cells.

    Science.gov (United States)

    Nguyen, Thi-Mong Diep; Filliatreau, Laura; Klett, Danièle; Combarnous, Yves

    2018-05-15

    We have compared various Luteinizing Hormone (LH) and Chorionic Gonadotropin (CG) preparations from non-human and human species in their ability to synergize with 10 µM forskolin (FSK) for cyclic AMP intracellular accumulation, in MLTC cells. LH from rat pituitary as well as various isoforms of pituitary ovine, bovine, porcine, equine and human LHs and equine and human CG were studied. In addition, recombinant human LH and CG were also compared with the natural human and non-human hormones. Sub-stimulating concentrations of all LHs and CGs (2-100 pM) were found to stimulate cyclic AMP accumulation in MLTC cells in the presence of an also non-stimulating FSK concentration (10 µM). Like rat LH, the most homologous available hormone for mouse MLTC cells, all non-human LHs and CG exhibit a strong potentiating effect on FSK response. The human, natural and recombinant hLH and hCG also do so but in addition, they were found to elicit a permissive effect on FSK stimulation. Indeed, when incubated alone with MLTC cells at non-stimulating concentrations (2-70 pM) hLH and hCG permit, after being removed, a dose-dependent cyclic AMP accumulation with 10 µM FSK. Our data show a clearcut difference between human LH and CG compared to their non-human counterparts on MLTC cells adenylate cyclase activity control. This points out the risk of using hCG as a reference ligand for LHR in studies using non-human cells. Copyright © 2018 Elsevier Inc. All rights reserved.

  12. A process-based {sup 222}radon flux map for Europe and its comparison to long-term observations

    Energy Technology Data Exchange (ETDEWEB)

    Karstens, U. [Max-Planck-Instistut fuer Biogeochemie, Jena (Germany); Schwingshackl, C.; Schmithuesen, D.; Levin, I. [Heidelberg Univ. (Germany). Inst. fuer Umweltphysik

    2015-07-01

    Detailed {sup 222}radon ({sup 222}Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution {sup 222}Rn flux map for Europe, based on a parameterization of {sup 222}Rn production and transport in the soil. The {sup 222}Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based {sup 222}Rn soil profile measurements. Monthly {sup 222}Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083 x 0.083 and compared to long-term direct measurements of {sup 222}Rn exhalation rates in different areas of Europe. The two realizations of the {sup 222}Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean {sup 222}Rn flux from soils in Europe is estimated to be 10 mBq m{sup -2} s{sup -1} (ERA-Interim/Land soil moisture) or 15 mBq m{sup -2} s{sup -1} (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m{sup -2} s{sup -1} and from ca. 11 to ca. 20 mBq m{sup -2} s{sup -1}, respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of {sup 222}Rn exhalation rates. Comparison with

  13. Endometrial Receptivity Profile in Patients with Premature Progesterone Elevation on the Day of hCG Administration

    Directory of Open Access Journals (Sweden)

    Delphine Haouzi

    2014-01-01

    Full Text Available The impact of a premature elevation of serum progesterone level, the day of hCG administration in patients under controlled ovarian stimulation during IVF procedure, on human endometrial receptivity is still debated. In the present study, we investigated the endometrial gene expression profile shifts during the prereceptive and receptive secretory stage in patients with normal and elevated serum progesterone level on the day of hCG administration in fifteen patients under stimulated cycles. Then, specific biomarkers of endometrial receptivity in these two groups of patients were tested. Endometrial biopsies were performed on oocyte retrieval day and on day 3 of embryo transfer, respectively, for each patient. Samples were analysed using DNA microarrays and qRT-PCR. The endometrial gene expression shift from the prereceptive to the receptive stage was altered in patients with high serum progesterone level (>1.5 ng/mL on hCG day, suggesting accelerated endometrial maturation during the periovulation period. This was confirmed by the functional annotation of the differentially expressed genes as it showed downregulation of cell cycle-related genes. Conversely, the profile of endometrial receptivity was comparable in both groups. Premature progesterone rise alters the endometrial gene expression shift between the prereceptive and the receptive stage but does not affect endometrial receptivity.

  14. Prediction of late failure after medical abortion from serial beta-hCG measurements and ultrasonography

    DEFF Research Database (Denmark)

    Rørbye, C; Nørgaard, M; Nilas, Lisbeth

    2004-01-01

    on day 15 were greater among late failures than successes. Used as a predictive test, the positive predictive values of these variables were low. CONCLUSION: Neither beta-hCG nor endometrial thickness can be used clinically as diagnostic tests in predicting late failure after medical abortion.......BACKGROUND: Surgical treatment of failed medical abortion may be performed several weeks after initiation of the abortion. There are no recognized methods for early identification of these late failures. We assessed the prognostic values of beta-hCG and ultrasonography in predicting late failure...... thickness by ultrasonography was performed on day 15 after induction of medical abortion. Failures diagnosed after day 15 and within 15 weeks were identified and classified as late failures. All interventions in this group were due to bleeding problems. The predictive values of different absolute...

  15. KENO-IV/CG, the combinatorial geometry version of the KENO Monte Carlo criticality safety program

    International Nuclear Information System (INIS)

    West, J.T.; Petrie, L.M.; Fraley, S.K.

    1979-09-01

    KENO-IV/CG was developed to merge the simple geometry input description utilized by combinatorial geometry with the repeating lattice feature of the original KENO geometry package. The result is a criticality code with the ability to model a complex system of repeating rectangular lattices inside a complicated three-dimensional geometry system. Furthermore, combinatorial geometry was modified to differentiate between combinatorial zones describing a particular KENO BOX to be repeated in a KENO array and those combinatorial zones describing geometry external to an array. This allows the user to maintain a simple coordinate system without any geometric conflict due to spatial overlap. Several difficult criticality design problems have been solved with the new geometry package in KENO-IV/CG, thus illustrating the power of the code to model difficult geometries with a minimum of effort

  16. SUPPLEMENTARY COMPARISON: COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison

    Science.gov (United States)

    Skliarov, V.; Röttger, A.; Honig, A.; Korostin, S.; Kuznetsov, S.; Lapenas, A.; Milevsky, V.; Ivaniukovich, A.; Kharitonov, I.; Sepman, S.

    2009-01-01

    According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5th meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by COOMET, according to the provisions of the CIPM Mutual Recognition Arrangement (MRA).

  17. Evaluation of {sup 222}Rn concentration of the internal and external environments of residences at Monte Alegre municipality, Para, Brazil; Avaliacao da concentracao do {sup 222}Rn nos ambientes internos e externos de residencias do municipio de Monte Alegre, PA

    Energy Technology Data Exchange (ETDEWEB)

    Melo, Vicente de Paula

    1999-07-01

    The human being is constantly exposed to the natural radioactivity in the environment where he lives. This radioactivity comes mainly from materials present in the terrestrial crust that possess in their constitution chemical elements belonging to the radioactive families of uranium and thorium. The use of such materials for the construction of houses constitutes an important exposure form to the natural radiation, above all to the radioactive gas {sup 222}Rn, that it is exhaled from them. The Brazilian soil is composed, among other, of minerals that contain appreciable concentrations of these elements. The inhabitants of Monte Alegre town in Para, located at 2 deg 00' 24,9 'S ; 54 deg 04 ' 13,5 {sup W}, used in the construction of their houses stones obtained from an area 20 km distant of Monte Alegre, denominated Ingles de Souza, located at 01 deg 56' 4 0,1 S; 54 deg 12 149,7 W, where a small residential village, denominated National Agricultural Colony of Para (CANP), is located. The objective of this work was to evaluate the indoor concentration of {sup 222}Rn in the residences of Monte Alegre and CANP. Determinations of the {sup 238}U and {sup 226}Ra concentrations, measurements of the radon flux in samples of stones and soils of the two regions, as well as measurements to the gamma dose close of the soil and inside the residences, were also carried out. The average results of the radon concentration in the air of the investigated residences did not exceed the limits of 200 Bq. m{sup 3} (action level) and 600 Bq. m{sup 3} (intervention level) recommended by the International Commission on Radiological Protection (ICRP). The concentrations of natural radionuclides and the radon flux determined at the village showed values 17 times higher than those found at the urban area of Monte Alegre, while the average indoor gamma dose rate in the village residences was 0.86 mSv/a. (author)

  18. Evaluation of {sup 222}Rn concentration of the internal and external environments of residences at Monte Alegre municipality, Para, Brazil; Avaliacao da concentracao do {sup 222}Rn nos ambientes internos e externos de residencias do municipio de Monte Alegre, PA

    Energy Technology Data Exchange (ETDEWEB)

    Melo, Vicente de Paula

    1999-07-01

    The human being is constantly exposed to the natural radioactivity in the environment where he lives. This radioactivity comes mainly from materials present in the terrestrial crust that possess in their constitution chemical elements belonging to the radioactive families of uranium and thorium. The use of such materials for the construction of houses constitutes an important exposure form to the natural radiation, above all to the radioactive gas {sup 222}Rn, that it is exhaled from them. The Brazilian soil is composed, among other, of minerals that contain appreciable concentrations of these elements. The inhabitants of Monte Alegre town in Para, located at 2 deg 00' 24,9 'S ; 54 deg 04 ' 13,5 {sup W}, used in the construction of their houses stones obtained from an area 20 km distant of Monte Alegre, denominated Ingles de Souza, located at 01 deg 56' 4 0,1 S; 54 deg 12 149,7 W, where a small residential village, denominated National Agricultural Colony of Para (CANP), is located. The objective of this work was to evaluate the indoor concentration of {sup 222}Rn in the residences of Monte Alegre and CANP. Determinations of the {sup 238}U and {sup 226}Ra concentrations, measurements of the radon flux in samples of stones and soils of the two regions, as well as measurements to the gamma dose close of the soil and inside the residences, were also carried out. The average results of the radon concentration in the air of the investigated residences did not exceed the limits of 200 Bq. m{sup 3} (action level) and 600 Bq. m{sup 3} (intervention level) recommended by the International Commission on Radiological Protection (ICRP). The concentrations of natural radionuclides and the radon flux determined at the village showed values 17 times higher than those found at the urban area of Monte Alegre, while the average indoor gamma dose rate in the village residences was 0.86 mSv/a. (author)

  19. An application of 222Rn alpha particle's tracks to uranium exploration

    International Nuclear Information System (INIS)

    Aguilar H, F.

    1981-01-01

    The uranium exploration method is based on the register of 222 Rn alpha particles; 222 Rn gas is generated in the chain 238 U desintegration. The detection of alpha particles was performed with cellulose nitrate films (NTC), located in a grid at the region in study. The alpha particles produce latent tracks in the NTC films; these tracks may be enlarged by chemical etching and are observed with an ordinary optic microscope, ninety seven NTC films were used, these were distributed in an area of approximately seventeen square kilometers, located in the municipalities of Granados and Huasabas in Sonora Mexico, the detectors remain in the ground for a thirty days mean period. The results obtained show an area with high 222 Rn concentration, this can be related with an underground uranium ore deposit. The more important conclusion is that the results obtained in this work can be used as preliminary results for other prospection methods in this particular area. (author)

  20. Measurements of the radon-222 concentration in residences of Lima - Peru

    International Nuclear Information System (INIS)

    Pereyra, P.; Lopez, M. E.; Perez, B.

    2014-08-01

    The measurement of the Radon-222 levels was realized in the first semester of 2013 in residences corresponding to 16 districts of the metropolitan area of Lima, including to the zones North, Center and South of the city, during one period of 3 to 6 months in continuous form, with measurement periods of 1 to 2 months. The houses where the measurements were made were selected considering diverse variables as antiquity, construction materials, coatings, soil type, occupational use of the monitored rooms, etc. The measurements were realized in basements, first and second floor of the residences. For the Radon-222 measurements passive detectors of cellulose nitrate (Lr-115) were used. The procedure of data collection, dosimeters reading and the measurement results are shown in this work; this monitoring is the first one that is carried out in this city. The results are only indicators of the present radon rate, by the detectors type not is possible to discriminate the presence of the Radon-222 descendants. (Author)

  1. Some remarks on exact methods for WL and 222Rn-daughter determination

    International Nuclear Information System (INIS)

    Groer, P.G.

    1977-01-01

    For an exact determination of the three 222 Rn-daughter concentrations (RaA, B and C) which properly weighted yield the Working Level, three equations relating observed counts (α or β) to these unknown concentrations have to be solved. The half-lives in the 222 Rn decay series, the type of decay and the counting errors, limit the suitable set of equations. Some aspects of two such exact methods are discussed

  2. Update of the BIPM.RI(II)-K1.Rn-222 comparison of activity measurements for the radionuclide {sup 222}Rn to include the LNE-LNHB, France

    Energy Technology Data Exchange (ETDEWEB)

    Michotte, C.; Ratel, G. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Cassette, P. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Laboratoire national de metrologie et d' essais -Laboratoire national Henri Becquerel, 91191 Gif-sur-Yvette cedex (France)

    2012-02-15

    In 2007, the Laboratoire national de metrologie et d'essais - Laboratoire national Henri Becquerel (LNE-LNHB), France submitted a sample of known activity of {sup 222}Rn to the International Reference System (SIR) for comparison. The value of the activity submitted was about 90 kBq. This key comparison result joins that of Switzerland and Germany in the key comparison database that now contains three results, identifier BIPM.RI(II)-K1.Rn-222. Consequently, the KCRV has been updated and the degrees of equivalence with the KCRV have been evaluated. (authors)

  3. Down-regulation of MicroRNAs 222/221 in Acute Myelogenous Leukemia with Deranged Core-Binding Factor Subunits

    Directory of Open Access Journals (Sweden)

    Matteo Brioschi

    2010-11-01

    Full Text Available Core-binding factor leukemia (CBFL is a subgroup of acutemyeloid leukemia (AML characterized by genetic mutations involving the subunits of the core-binding factor (CBF. The leukemogenesis model for CBFL posits that one, or more, gene mutations inducing increased cell proliferation and/or inhibition of apoptosis cooperate with CBF mutations for leukemia development. One of the most commonmutations associated with CBF mutations involves the KIT receptor. A high expression of KIT is a hallmark of a high proportion of CBFL. Previous studies indicate that microRNA (MIR 222/221 targets the 3′ untranslated region of the KIT messenger RNA and our observation that AML1 can bind the MIR-222/221 promoter, we hypothesized that MIR-222/221 represents the link between CBF and KIT. Here, we show that MIR-222/221 expression is upregulated after myeloid differentiation of normal bone marrow AC133+ stem progenitor cells. CBFL blasts with either t(8;21 or inv(16 CBF rearrangements with high expression levels of KIT (CD117 display a significantly lower level of MIR-222/221 expression than non-CBFL blasts. Consistently, we found that the t(8;21 AML1-MTG8 fusion protein binds the MIR-222/221 promoter and induces transcriptional repression of a MIR-222/221-LUC reporter. Because of the highly conserved sequence homology, we demonstrated concomitant MIR-222/221 down-regulation and KIT up-regulation in the 32D/WT1 mouse cell model carrying the AML1-MTG16 fusion protein. This study provides the first hint that CBFL-associated fusion proteins may lead to up-regulation of the KIT receptor by down-regulating MIR-222/221, thus explaining the concomitant occurrence of CBF genetic rearrangements and overexpression of wild type or mutant KIT in AML.

  4. 78 FR 31627 - Thirteenth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S.

    Science.gov (United States)

    2013-05-24

    ... Committee 222, Inmarsat AMS(R)S. AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S DATES: The meeting will be held June 10-11 from 9:00 a.m.-5:00 p.m. ADDRESSES: The meeting...

  5. 78 FR 8684 - Twelfth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S

    Science.gov (United States)

    2013-02-06

    ... Committee 222, Inmarsat AMS(R)S AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S. DATES: The meeting will be held February 20, 2013, from 1:00 p.m.--4:00 p.m. ADDRESSES...

  6. 78 FR 61446 - Fourteenth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S

    Science.gov (United States)

    2013-10-03

    ... Committee 222, Inmarsat AMS(R)S AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S DATES: The meeting will be held November 19, 2013 from 9:00 a.m.-5:00 p.m. ADDRESSES: The...

  7. Functional analysis of a regulator of G-protein signaling CgRGS1 in the rubber tree anthracnose fungus Colletotrichum gloeosporioides.

    Science.gov (United States)

    Liu, Zhi-Qiang; Wu, Man-Li; Ke, Zhi-Jian; Liu, Wen-Bo; Li, Xiao-Yu

    2018-04-01

    Colletotrichum gloeosporioides is the causal agent of rubber anthracnose, which is also one of the important biological factors threatening the development of natural rubber industry in the world. Regulators of G-protein signaling (RGS) are key negative regulators of G-proteins, which play important roles in growth, development and pathogenic processes of plant pathogens. In this study, a RGS gene CgRGS1 was functionally characterized in C. gloeosporioides. Compared to the wild type, the CgRGS1 deletion mutant had slow vegetative growth, reduced conidia with multi-end germination, low appressorium formation rate, high resistance to oxidative stress and SDS. Moreover, the mutant was sensitive to osmotic pressure and showed decreased virulence. In conclusion, CgRGS1 is involved in regulation of vegetative growth, conidiation, germination, appressorium formation, oxidative stress, osmotic pressure response and pathogenicity in C. gloeosporioides.

  8. Growth inhibitory effects of miR-221 and miR-222 in non-small cell lung cancer cells

    International Nuclear Information System (INIS)

    Yamashita, Ryo; Sato, Mitsuo; Kakumu, Tomohiko; Hase, Tetsunari; Yogo, Naoyuki; Maruyama, Eiichi; Sekido, Yoshitaka; Kondo, Masashi; Hasegawa, Yoshinori

    2015-01-01

    Both pro- and anti-oncogenic roles of miR-221 and miR-222 microRNAs are reported in several types of human cancers. A previous study suggested their oncogenic role in invasiveness in lung cancer, albeit only one cell line (H460) was used. To further evaluate involvement of miR-221 and miR-222 in lung cancer, we investigated the effects of miR-221 and miR-222 overexpression on six lung cancer cell lines, including H460, as well as one immortalized normal human bronchial epithelial cell line, HBEC4. miR-221 and miR-222 induced epithelial-to-mesenchymal transition (EMT)-like changes in a minority of HBEC4 cells but, unexpectedly, both the microRNAs rather suppressed their invasiveness. Consistent with the prior report, miR-221 and miR-222 promoted growth in H460; however, miR-221 suppressed growth in four other cell lines with no effects in one, and miR-222 suppressed growth in three cell lines but promoted growth in two. These are the first results to show tumor-suppressive effects of miR-221 and miR-222 in lung cancer cells, and we focused on clarifying the mechanisms. Cell cycle and apoptosis analyses revealed that growth suppression by miR-221 and miR-222 occurred through intra-S-phase arrest and/or apoptosis. Finally, lung cancer cell lines transfected with miR-221 or miR-222 became more sensitive to the S-phase targeting drugs, possibly due to an increased S-phase population. In conclusion, our data are the first to show tumor-suppressive effects of miR-221 and miR-222 on lung cancer, warranting testing their potential as therapeutics for the disease

  9. An intronic mutation c.6430-3C>G in the F8 gene causes splicing efficiency and premature termination in hemophilia A.

    Science.gov (United States)

    Xia, Zunjing; Lin, Jie; Lu, Lingping; Kim, Chol; Yu, Ping; Qi, Ming

    2018-06-01

    : Hemophilia A is a bleeding disorder caused by coagulation factor VIII protein deficiency or dysfunction, which is classified into severe, moderate, and mild according to factor clotting activity. An overwhelming majority of missense and nonsense mutations occur in exons of F8 gene, whereas mutations in introns can also be pathogenic. This study aimed to investigate the effect of an intronic mutation, c.6430-3C>G (IVS22-3C>G), on pre-mRNA splicing of the F8 gene. We applied DNA and cDNA sequencing in a Chinese boy with hemophilia A to search if any pathogenic mutation in the F8 gene. Functional analysis was performed to investigate the effect of an intronic mutation at the transcriptional level. Human Splicing Finder and PyMol were also used to predict its effect. We found the mutation c.6430-3C>G (IVS22-3C>G) in the F8 gene in the affected boy, with his mother being a carrier. cDNA from the mother and pSPL3 splicing assay showed that the mutation IVS22-3C>G results in a two-nucleotide AG inclusion at the 3' end of intron 22 and leads to a truncated coagulation factor VIII protein, with partial loss of the C1 domain and complete loss of the C2 domain. The in-silico tool predicted that the mutation induces altered pre-mRNA splicing by using a cryptic acceptor site in intron 22. The IVS22-3C>G mutation was confirmed to affect pre-mRNA splicing and produce a truncated protein, which reduces the stability of binding between the F8 protein and von Willebrand factor carrier protein due to the loss of an interaction domain.

  10. Exosomes from adriamycin-resistant breast cancer cells transmit drug resistance partly by delivering miR-222.

    Science.gov (United States)

    Yu, Dan-Dan; Wu, Ying; Zhang, Xiao-Hui; Lv, Meng-Meng; Chen, Wei-Xian; Chen, Xiu; Yang, Su-Jin; Shen, Hongyu; Zhong, Shan-Liang; Tang, Jin-Hai; Zhao, Jian-Hua

    2016-03-01

    Breast cancer (BCa) is one of the major deadly cancers in women. However, treatment of BCa is still hindered by the acquired-drug resistance. It is increasingly reported that exosomes take part in the development, metastasis, and drug resistance of BCa. However, the specific role of exosomes in drug resistance of BCa is poorly understood. In this study, we investigate whether exosomes transmit drug resistance through delivering miR-222. We established an adriamycin-resistant variant of Michigan Cancer Foundation-7 (MCF-7) breast cancer cell line (MCF-7/Adr) from a drug-sensitive variant (MCF-7/S). Exosomes were isolated from cell supernatant by ultracentrifugation. Cell viability was assessed by MTT assay and apoptosis assay. Individual miR-222 molecules in BCa cells were detected by fluorescence in situ hybridization (FISH). Then, FISH was combined with locked nucleic acid probes and enzyme-labeled fluorescence (LNA-ELF-FISH). Individual miR-222 could be detected as bright photostable fluorescent spots and then the quantity of miR-222 per cell could be counted. Stained exosomes were taken in by the receipt cells. MCF-7/S acquired drug resistance after co-culture with exosomes from MCF-7/Adr (A/exo) but did not after co-culture with exosomes from MCF-7/S (S/exo). The quantity of miR-222 in A/exo-treated MCF-7/S was significantly greater than in S/exo-treated MCF-7/S. MCF-7/S transfected with miR-222 mimics acquired adriamycin resistance while MCF-7/S transfected with miR-222 inhibitors lost resistance. In conclusion, exosomes are effective in transmitting drug resistance and the delivery of miR-222 via exosomes may be a mechanism.

  11. A sub-nationwide survey of outdoor and indoor 222Rn concentrations in China by passive method

    International Nuclear Information System (INIS)

    Jin Yihe; Ikebe, Y.; Iida, T.

    1996-01-01

    From Nov. 1988 to Mar. 1993, cooperated by China and Japan, a survey of outdoor and indoor 222 Rn concentrations in 10 cities which were highly populated in China was carried out by means of passive method. the annual mean of outdoor 222 Rn concentration in 10 cities was 8.8 Bq·m -3 . The highest of 13.5 Bq·m -3 was in Wuhan, the lowest of 3.3 Bq·m -3 was in Chongming Island of Shanghai; and there were no significant differences among the different years in the same areas. During the northwest wind seasons, about 50% of outdoor 222 Rn concentration in Taiwan was contributed by the airflow from the mainland. Typical apartment houses and offices built of brick and concrete were also surveyed for indoor 222 Rn concentration. The annual mean of indoor 222 Rn concentration in the 10 cities was 19.5 Bq·m - 3. The highest of 33.9 Bq·m -3 was observed in Guiyang, the lowest of 9.0 Bq·m -3 was observed in Chongming Island of Shanghai. The outdoor and indoor 222 Rn concentrations showed a clear seasonal pattern with the minimum in summer and the maximum in winter. And they also showed a clear geographic distribution tendency; they were higher in inland than in seashores, and higher in the south than in the north. The ratios of indoor to outdoor 222 Rn concentrations were from 1.1 to 4.6. The annual effective dose equivalents resulting from outdoor and indoor 222 Rn concentrations amounted to about 0.64 mSv·a -1 . The highest was in Guiyang, and the lowest was in Nantong, being 1.12 and 0.39 mSv·a -1 , respectively

  12. Resistance to classical scrapie in experimentally challenged goats carrying mutation K222 of the prion protein gene

    Directory of Open Access Journals (Sweden)

    Acutis Pier Luigi

    2012-02-01

    Full Text Available Abstract Susceptibility of sheep to scrapie, a transmissible spongiform encephalopathy of small ruminants, is strongly influenced by polymorphisms of the prion protein gene (PRNP. Breeding programs have been implemented to increase scrapie resistance in sheep populations; though desirable, a similar approach has not yet been applied in goats. European studies have now suggested that several polymorphisms can modulate scrapie susceptibility in goats: in particular, PRNP variant K222 has been associated with resistance in case-control studies in Italy, France and Greece. In this study we investigated the resistance conferred by this variant using a natural Italian goat scrapie isolate to intracerebrally challenge five goats carrying genotype Q/Q 222 (wild type and five goats carrying genotype Q/K 222. By the end of the study, all five Q/Q 222 goats had died of scrapie after a mean incubation period of 19 months; one of the five Q/K 222 goats died after 24 months, while the other four were alive and apparently healthy up to the end of the study at 4.5 years post-challenge. All five of these animals were found to be scrapie negative. Statistical analysis showed that the probability of survival of the Q/K 222 goats versus the Q/Q 222 goats was significantly higher (p = 0.002. Our study shows that PRNP gene mutation K222 is strongly associated with resistance to classical scrapie also in experimental conditions, making it a potentially positive target for selection in the frame of breeding programs for resistance to classical scrapie in goats.

  13. Measurements of 222Rn and 226Ra Levels in environmental samples by using liquid scintillation counter

    International Nuclear Information System (INIS)

    Moustafa, A.S.

    2004-01-01

    The advantageous of liquid scintillation counting technique for 6 Ra determination compared with other methods are the high counting efficiency and the easier sample preparation, with no need for sample pre-concentration. In this work, liquid scintillation counting system was used to measure 222 Rn and 226 Ra levels in environmental samples. The liquid scintillation cocktail was prepared in the laboratory and was found efficient for measuring 222 Rn. Soil, sediment and TENORM samples were dried, grind, sieved and added to hydrochloric acid, in a standard scintillation vial, preloaded with the liquid scintillation cocktail. By measuring 222 Rn levels in the prepared vials, at different intervals of time after preparation, 222 Rn and 226 Ra levels were determined

  14. HH 222: A GIANT HERBIG-HARO FLOW FROM THE QUADRUPLE SYSTEM V380 ORI

    Energy Technology Data Exchange (ETDEWEB)

    Reipurth, Bo; Aspin, Colin; Connelley, M. S. [Institute for Astronomy, University of Hawaii at Manoa, 640 North Aohoku Place, Hilo, HI 96720 (United States); Bally, John [Center for Astrophysics and Space Astronomy, University of Colorado, Boulder, CO 80309 (United States); Geballe, T. R. [Gemini Observatory, 670 North Aohoku Place, Hilo, HI 96720 (United States); Kraus, Stefan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-78, Cambridge, MA 02138 (United States); Appenzeller, Immo [Landessternwarte Heidelberg, Königstuhl 12, D-69117 Heidelberg (Germany); Burgasser, Adam, E-mail: reipurth@ifa.hawaii.edu, E-mail: caa@ifa.hawaii.edu, E-mail: msc@ifa.hawaii.edu, E-mail: John.Bally@colorado.edu, E-mail: tgeballe@gemini.edu, E-mail: stefan.kraus@cfa.harvard.edu, E-mail: iappenze@lsw.uni-heidelberg.de, E-mail: aburgasser@ucsd.edu [Center for Astrophysics and Space Science, University of California San Diego, La Jolla, CA 92093 (United States)

    2013-11-01

    HH 222 is a giant shocked region in the L1641 cloud, and is popularly known as the Orion Streamers or ''the waterfall'' on account of its unusual structure. At the center of these streamers are two infrared sources coincident with a nonthermal radio jet aligned along the principal streamer. The unique morphology of HH 222 has long been associated with this radio jet. However, new infrared images show that the two sources are distant elliptical galaxies, indicating that the radio jet is merely an improbable line-of-sight coincidence. Accurate proper motion measurements of HH 222 reveal that the shock structure is a giant bow shock moving directly away from the well-known, very young, Herbig Be star V380 Ori. The already known Herbig-Haro object HH 35 forms part of this flow. A new Herbig-Haro object, HH 1041, is found precisely in the opposite direction of HH 222 and is likely to form part of a counterflow. The total projected extent of this HH complex is 5.3 pc, making it among the largest HH flows known. A second outflow episode from V380 Ori is identified as a pair of HH objects, HH 1031 to the northwest and the already known HH 130 to the southeast, along an axis that deviates from that of HH 222/HH 1041 by only 3.°7. V380 Ori is a hierarchical quadruple system, including a faint companion of spectral type M5 or M6, which at an age of ∼1 Myr corresponds to an object straddling the stellar-to-brown dwarf boundary. We suggest that the HH 222 giant bow shock is a direct result of the dynamical interactions that led to the conversion from an initial non-hierarchical multiple system into a hierarchical configuration. This event occurred no more than 28,000 yr ago, as derived from the proper motions of the HH 222 giant bow shock.

  15. Spectrophotometric and electrochemical studies of the interaction of cryptand 222 with DDQ and I2 in ethanol solution

    Directory of Open Access Journals (Sweden)

    Abolfazl Semnani

    2006-12-01

    Full Text Available Spectrophotometric and electrochemical studies concerning the interaction of cryptand 222 with DDQ and I2 have been performed in ethanol solution. In the case of DDQ, the results are indicative of the formation of C222¬+ and DDQ- through an equilibrium reaction. The results of I2 indicate the formation of I2-ethanol complex and I3- in the absence of C222. In the presence of C222, the formation of C222I¬+ and I3- through a non-equilibrium reaction is confirmed. The equilibrium constant of the redox reaction between DDQ and C222 has been calculated from the absorbance mole ratio data, using the nonlinear least square program “KINFIT”. The electrochemical reversibility of I-/I2 couple and irreversibility of DDQ/DDQ- is indicated by amperometry. The behavior of DDQ and I2 has been compared. A comparison with aprotic solvents has also been made.

  16. Ochrona prawna pielęgniarki / położnej w razie agresywnych zachowań pacjentów w podmiotach leczniczych = Legal protection of the nurse / midwife in case of aggressive behavior of patients in therapeutic entities

    Directory of Open Access Journals (Sweden)

    Anna Augustynowicz

    2015-03-01

      Correspondence to Anna Augustynowicz PhD, Zakład Zdrowia Publicznego, Medical University of Warsaw, ul. Banacha 1a, 02-097 Warszawa, Poland Tel: + 48 22 599 21 80; fax. + 48 22 599 21 80; e-mail: aaugustynowicz@poczta.onet.p   Streszczenie   W artykule przedstawiono zasady ochrony prawnej przysługujące pielęgniarce i położnej w razie agresywnych zachowań pacjentów. Personel medyczny w razie agresywnych zachowań pacjentów może dochodzić roszczeń zarówno na drodze procesu karnego, jak i cywilnego. Z punktu widzenia ochrony karnej istotne znaczenie ma fakt, iż pielęgniarka i położna podczas i w związku z wykonywaniem czynności polegających na udzielaniu świadczeń zdrowotnych korzysta z ochrony przewidzianej dla funkcjonariuszy publicznych. W przypadku agresji słownej pacjent może ponieść odpowiedzialność karną za znieważenie funkcjonariusza publicznego (art. 226 k.k., ewentualnie za zniesławienie (art. 212 k.k.. Do grupy tej należy również dodać przestępstwo kierowania gróźb pod adresem pielęgniarki/położnej (art. 190 k.k.. Następstwem agresji fizycznej może być odpowiedzialność za naruszenie nietykalności cielesnej funkcjonariusza publicznego (art. 222 k.k., czynną napaść (223 k.k. a także za spowodowanie lekkiego, średniego lub ciężkiego uszczerbku na zdrowiu (art. 156 k.k., art. 157 § 1 k.k.. Poza sankcjami natury karnej, agresywnie zachowujący się pacjent może ponieść odpowiedzialność cywilną z tytułu naruszenia dóbr osobistych. Dobrem osobistym naruszanym działaniami pacjenta będzie cześć. Agresja fizyczna lub słowna powodować może powstanie szkody majątkowej w postaci straty poniesionej w wyniku zdarzenia szkodzącego, a także utraconych korzyści. W tym przypadku pielęgniarce, położnej przysługuje wobec pacjenta roszczenie z art. 415 k.c.   Abstract   This paper presents the principles of legal protection enjoyed by the nurse and midwife in the case of aggressive behavior of

  17. Design and construction of a system for determination of Radon-222 by a surface-barrier detector

    International Nuclear Information System (INIS)

    Bonifacio M, J.; Iturbe, J.L.

    1993-01-01

    In the present work the design and construction of a system for the determination of 222 Rn is described, which utilizes silicon surface-barrier detectors. The 222 Rn gas was obtained a source of 226 Ra electrodeposited on stainless-steel discs. The well separated energies with this system makes possible the measurement and identification of alpha particles of 222 Rn, and its daughters 210 Po, 218 Po and 214 Po. (Author) 3 figs, 19 refs

  18. Average daily and annual courses of 222Rn concentration in some natural medium

    International Nuclear Information System (INIS)

    Holy, K.; Bohm, R.; Polaskova, A.; Stelina, J.; Sykora, I.; Hola, O.

    1996-01-01

    Simultaneous measurements of the 222 Rn concentration in the outdoor atmosphere of Bratislava and in the soil air over one year period have been made. Daily and seasonal variations of the 222 Rn concentration in both media were found. Some attributes of these variations as well as methods of measurements are presented in this work. (author). 17 refs., 6 figs

  19. Transfer of radon-222 from rocks of the Pocos de Caldas plateau to the waters

    International Nuclear Information System (INIS)

    Bonotto, Daniel Marcos; Lima, Jorge Luis Nepomuceno de

    1997-01-01

    The analytical procedures developed at the Sector of Unstable Isotopes of the Laboratory of Geochemistry, which belongs to the Department of Petrology and Metallogeny located at the Institute of Geosciences and Exact Sciences - Universidade Estadual Paulista Julio de Mesquita Filho (UNESP) to measure the release of 222 Rn from rocks to the waters is described. The methodology established was used to evaluate the emanation coefficient of 222 Rn from experiments of water-rock interaction under controlled conditions in the laboratory, which is an important parameter necessary to interpret the radioactivity related to dissolved 222 Rn content in waters. Four typical rocks from Pocos de Caldas Plateau were sampled for the experiments: phonolite, nepheline syenite, pseudoleucite tinguaite and silicified sandstone. The 226 Ra content of these rocks was evaluated by gamma-ray spectrometry using a Nal(TI) scintillation detector, a method that has been currently utilized in nuclear geophysics or isotope geochemistry to measure the equivalent uranium (e U). The 226 Ra content in the studied rocks and the 222 Rn transferred to the waters due to its generation by its 226 Ra progenitor allowed an estimation of the emanation coefficient of 222 Rn. A preliminary investigation on the influence of the mass of the rock in contact with water, of the surface area of the rock in contact with water and of the 226 Ra content in rocks on the amount of 222 Rn released to the water was also performed. (Author)

  20. Anesthesia of juvenile Pacific Lampreys with MS-222, BENZOAK, AQUI-S 20E, and Aquacalm

    Science.gov (United States)

    Christiansen, Helena E.; Gee, Lisa P.; Mesa, Matthew G.

    2013-01-01

    Effective anesthetics are a critical component of safe and humane fish handling procedures. We tested three concentrations each of four anesthetics—Finquel (tricaine methanesulfonate, herein referred to as MS-222), BENZOAK (20% benzocaine), AQUI-S 20E (10% eugenol), and Aquacalm (metomidate hydrochloride)—for efficacy and safety in metamorphosed, outmigrating juvenile Pacific Lampreys Entosphenus tridentatus. The anesthetics MS-222 (100 mg/L) and BENZOAK (60 mg/L) were the most effective for anesthetizing juvenile Pacific Lampreys to a handleable state with minimal irritation to the fish. Fish anesthetized with BENZOAK also had lower rates of fungal infection than those exposed to MS-222, AQUI-S 20E, or no anesthetic. Exposure to AQUI-S 20E irritated juvenile Pacific Lampreys, causing them to leap or climb out of the anesthetic solution, and Aquacalm anesthetized fish to a handleable state too slowly and incompletely for effective use with routine handling procedures. Our results indicate that MS-222 and BENZOAK are effective anesthetics for juvenile Pacific Lampreys, but field studies are needed to determine whether exposure to MS-222 increases risk of fungal infection in juvenile Pacific Lampreys released to the wild.

  1. A randomized controlled dose-response pilot study of addition of hCG to recombinant FSH during controlled ovarian stimulation for in vitro fertilization

    DEFF Research Database (Denmark)

    Loft, A; Egeberg, Anne Noes; Smitz, J

    2012-01-01

    Is it possible to define an optimal dose of hCG in combination with rFSH from the first day of stimulation in the GnRH agonist protocol applied to IVF? SUMMARY ANSWER: Supplementation with hCG from the first day of stimulation may increase the number of top-quality embryos per patient. Daily doses...... has been previously reported. We suggest a large clinical trial to be proceeded with a group given 100 IU hCG daily versus a control group. WHAT IS KNOWN AND WHAT THIS PAPER ADDS: Prospective multicentre studies have indicated increased live birth rates and increased number of top-quality embryos when...

  2. Gas exchange in the Pee Dee River based on 222Rn evasion

    International Nuclear Information System (INIS)

    Moore, W.S.; Elsinger, R.J.

    1983-01-01

    Excess 222 Rn concentrations decrease downstream in the fresh water section of the Pee Dee River. Ground water is the primary source of the excess 222 Rn to the River. Using the radon concentration gradients determined during four sampling periods, gas exchange rates based on the stagnant film model are calculated. Stagnant film thicknesses range from 19 μm to 48 μm and mass transfer coefficients range from 2.1 m/d to 4.1 m/d

  3. 34 CFR 222.8 - What action must an applicant take upon a change in its boundary, classification, control...

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false What action must an applicant take upon a change in its boundary, classification, control, governing authority, or identity? 222.8 Section 222.8 Education..., DEPARTMENT OF EDUCATION IMPACT AID PROGRAMS General § 222.8 What action must an applicant take upon a change...

  4. 20 CFR 222.17 - “Child in care” when child of the employee is living with the claimant.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false âChild in careâ when child of the employee is living with the claimant. 222.17 Section 222.17 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222...

  5. 50 CFR 222.103 - Federal/state cooperation in the conservation of endangered and threatened species.

    Science.gov (United States)

    2010-10-01

    ... Federal regulations for grant administration and cost accounting principles. (3)(i) The payment of the... conservation of endangered and threatened species. 222.103 Section 222.103 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE...

  6. Concentration of {sup 222}Rn in drinking water of the Zacatecas City, measured by liquid scintillation and associated dose; Concentracion de {sup 222}Rn en agua potable de la Ciudad de Zacatecas, medida por centelleo liquido y dosis asociada

    Energy Technology Data Exchange (ETDEWEB)

    Arevalo B, C. A.; Lopez del R, H.; Davila R, J. I.; Mireles G, F.; Pinedo V, J. L.; Rios M, C.; Saucedo A, S. A., E-mail: cesar_arevalob@outlook.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico)

    2017-09-15

    A study was carried out to determine the concentration of {sup 222}Rn in samples of drinking water collected from different homes in the Zacatecas city, Mexico, whose main source of supply is groundwater. The {sup 222}Rn radioactive gas is a product of the decay series of {sup 238}U and is considered one of the main sources of natural radiation, since it contributes almost half of the radiation dose that a person will receive throughout his life. The {sup 222}Rn originates in the rocks of the aquifers and dissolves in the water, which is later integrated into the distribution network of the public supply that supplies the entire population. Exposure to ionizing radiation that {sup 222}Rn and its offspring emit can damage the DNA molecule, inducing the possible appearance of cancer. Has been demonstrated by various epidemiological studies carried out in uranium mines workers in different parts of the world, that this exposure increases the incidence of lung cancer, placing {sup 222}Rn and their offspring as the second main cause of this type of cancer, after smoking habit. Using the technique of solvent extraction of {sup 222}Rn in water and liquid scintillation spectrometry, water collected from 14 different households was sampled and analyzed. The average of the measured activity of {sup 222}Rn was 2.09 Bq/L and the annual effective dose per water intake attributable to that concentration of 6.07 mSv/a. The concentration of {sup 222}Rn in water and the annual effective dose are below 11 Bq/L and 50 mSv/a, such concentrations are the maximum limits established by the Unites States Environmental Protection Agency (US EPA) and the ICRP, respectively. The concentration of {sup 222}Rn that is transferred from the water to the air inside a house was also calculated and the radiation dose that this concentration causes by inhalation, being 0.209 Bq/m{sup 3} and 1,463 μ Sv a, respectively. (Author)

  7. 222Rn concentration in the outdoor atmosphere and its relation to the atmospheric stability

    International Nuclear Information System (INIS)

    Holy, K.; Boehm, R.; Bosa, I.; Polaskova, A.; Hola, O.

    1998-01-01

    The radon in the outdoor atmosphere has been monitored continuously since 1991. On the basis of the measured data mainly the average daily and the average annual courses of the 222 Rn concentrations have been studied. The annual courses of 222 Rn concentration are similar for all years. They present the annual variations. The average course of the 222 Rn concentration calculated on the basis of all continual measurements in the years 1991-1997 reaches the maximum value in October and the minimum value in April. The average daily courses of the 222 Rn concentration for the individual months of the year. The average daily courses have a form of waves with a maximum in the morning hours and with a minimum in the afternoon. The maximal amplitudes of daily waves have been reached in the summer months, from June till August. The amplitudes of daily waves are very small at the end of an autumn and during the winter months. The analysis of the daily waves and annual courses of 222 Rn showed that the amplitudes of the daily waves are in proportion to the global solar radiation irradiating the Earth's surface. The day duration influence on the phase of the daily wave and the wind velocity influence mainly on the level of the radon concentration. For the study of the relation of the radon concentration in the outdoor atmosphere to the stability the data of the atmosphere were obtained and they were correlated with the radon concentration. The results indicate that the 222 Rn concentrations int he outdoor atmosphere could be used for determination of the vertical atmospheric stability and these ones could reflect the atmospheric stability more completely than the different classifications based on the knowledge pertinent to the meteorological parameters. (authors)

  8. Evaluation of 222Rn concentration of the internal and external environments of residences at Monte Alegre municipality, Para, Brazil

    International Nuclear Information System (INIS)

    Melo, Vicente de Paula

    1999-01-01

    The human being is constantly exposed to the natural radioactivity in the environment where he lives. This radioactivity comes mainly from materials present in the terrestrial crust that possess in their constitution chemical elements belonging to the radioactive families of uranium and thorium. The use of such materials for the construction of houses constitutes an important exposure form to the natural radiation, above all to the radioactive gas 222 Rn, that it is exhaled from them. The Brazilian soil is composed, among other, of minerals that contain appreciable concentrations of these elements. The inhabitants of Monte Alegre town in Para, located at 2 deg 00' 24,9 'S ; 54 deg 04 ' 13,5 W , used in the construction of their houses stones obtained from an area 20 km distant of Monte Alegre, denominated Ingles de Souza, located at 01 deg 56' 4 0,1 S; 54 deg 12 149,7 W, where a small residential village, denominated National Agricultural Colony of Para (CANP), is located. The objective of this work was to evaluate the indoor concentration of 222 Rn in the residences of Monte Alegre and CANP. Determinations of the 238 U and 226 Ra concentrations, measurements of the radon flux in samples of stones and soils of the two regions, as well as measurements to the gamma dose close of the soil and inside the residences, were also carried out. The average results of the radon concentration in the air of the investigated residences did not exceed the limits of 200 Bq. m 3 (action level) and 600 Bq. m 3 (intervention level) recommended by the International Commission on Radiological Protection (ICRP). The concentrations of natural radionuclides and the radon flux determined at the village showed values 17 times higher than those found at the urban area of Monte Alegre, while the average indoor gamma dose rate in the village residences was 0.86 mSv/a. (author)

  9. Daily low-dose hCG stimulation during the luteal phase combined with GnRHa triggered IVF cycles without exogenous progesterone

    DEFF Research Database (Denmark)

    Andersen, Claus Yding; Elbaek, Helle Olesen; Alsbjerg, Birgit

    2015-01-01

    antagonist protocol. Two study arms were included both having 125 IU hCG daily for luteal phase support without exogenous progesterone after using a GnRHa trigger for ovulation induction. In both study arms exogenous FSH was stopped on stimulation day 6 and replaced by exogenous hCG that was initiated...... on either stimulation day 2 or day 6. Blood samples were obtained on the day of ovulation induction, on the day of oocyte pickup (OPU) and day OPU + 7. MAIN RESULTS AND THE ROLE OF CHANCE: The mean serum levels of hCG did not exceeded the normal physiological range of LH activity in any samples. Mid...... were seen between groups. LIMITATIONS, REASONS FOR CAUTION: The number of patients included is limited and conclusions need to be verified in a larger RCT. WIDER IMPLICATIONS OF THE FINDINGS: Endogenous production of progesterone may become more attractive as the luteal phase support with levels of LH...

  10. Direct determination of 222Rn gas using the electret to remove daughters at formation

    International Nuclear Information System (INIS)

    Harley, N.H.

    1981-01-01

    Five compact, portable, continuous 222 Rn monitors have been constructed inhouse. Printed data can be obtained from intervals ranging from 10 minutes to 990 minutes. One hour count interval provides a lower limit of detection of 0.03 pCi 222 Rn/l -1 which is sufficient for measurement of any environmental level encountered. Calibration of the units was accomplished in the EML radon calibration room and the typical calibration factor is 165 counts per hour per pCi 222 Rn/l. The units are now being field tested. Two indoor/outdoor pairs are located in a single family dwelling and in a high rise apartment. One unit is being used for special studies

  11. Sera of patients with recurrent miscarriages containing anti-trophoblast antibodies (ATAB) reduce hCG and progesterone production in trophoblast cells in vitro.

    Science.gov (United States)

    von Schönfeldt, Viktoria; Rogenhofer, Nina; Ruf, Katharina; Thaler, Christian J; Jeschke, Udo

    2016-09-01

    Reproductive failure including RM has been suggested to correlate with antibodies that cross react with HLA-negative syncytiotrophoblasts and we have reported that 17% of women with 2 or more miscarriages and 34% of women with 3 or more miscarriages express anti-trophoblast antibodies (ATAB). Until now, the mechanism, how ATAB interfere with pregnancy success is not known. HCG and progesterone both play fundamental roles in supporting human pregnancy. Therefore we investigated the effects of sera of RM patients containing ATAB on the hCG and progesterone production of cells of the choriocarcinoma cell line JEG-3. In vitro study to investigate effects of patient sera with and without ATAB on hCG and progesterone secretion of JEG-3 cells. The presence of ATAB was detected as described earlier. Effects of sera from ATAB positive and ATAB negative RM patients on hCG and progesterone secretion by JEG-3 cells were analysed 12 and 24h after plating. Sera of women without pregnancy pathologies served as controls. Sera of ATAB-positive RM patients significantly inhibit hCG secretion of JEG-3 cells for 12h after plating compared to sera of healthy controls (p=0.019) and significantly reduce progesterone production for 12h (p=0.046) and 24h (p=0.027) of co-culture. Sera of ATAB-negative RM patient show no significant effect on progesterone secretion. Inhibition of hCG and progesterone production might point to a mechanism, how ATAB interfere with early pregnancies. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  12. Commercial Hy-Line W-36 pullet and laying hen venous blood gas and chemistry profiles utilizing the portable i-STAT?1 analyzer

    OpenAIRE

    Schaal, T. P.; Arango, J.; Wolc, A.; Brady, J. V.; Fulton, J. E.; Rubinoff, I.; Ehr, I. J.; Persia, M. E.; O'Sullivan, N. P.

    2015-01-01

    Venous blood gas and chemistry reference ranges were determined for commercial Hy-Line W-36 pullets and laying hens utilizing the portable i-STAT?1 analyzer and CG8+ cartridges. A total of 632 samples were analyzed from birds between 4 and 110 wk of age. Reference ranges were established for pullets (4 to 15 wk), first cycle laying hens (20 to 68 wk), and second cycle (post molt) laying hens (70 to 110 wk) for the following traits: sodium (Na mmol/L), potassium (K mmol/L), ionized calcium (iC...

  13. 48 CFR 52.222-18 - Certification Regarding Knowledge of Child Labor for Listed End Products.

    Science.gov (United States)

    2010-10-01

    ... for Listed End Products. As prescribed in 22.1505(a), insert the following provision: Certification... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Certification Regarding Knowledge of Child Labor for Listed End Products. 52.222-18 Section 52.222-18 Federal Acquisition...

  14. Prediction of late failure after medical abortion from serial beta-hCG measurements and ultrasonography

    DEFF Research Database (Denmark)

    Rørbye, C; Nørgaard, M; Nilas, Lisbeth

    2004-01-01

    BACKGROUND: Surgical treatment of failed medical abortion may be performed several weeks after initiation of the abortion. There are no recognized methods for early identification of these late failures. We assessed the prognostic values of beta-hCG and ultrasonography in predicting late failure ...

  15. GETDB: 103594 [GETDB

    Lifescience Database Archive (English)

    Full Text Available ink to DGRC Genome Viewer: 103594 CG11086 CG1851 351 2 FlyBase Insertion: P{GawB}NP0351 w-contaminating. Rebalance...er 351 Chr. 2 Comments FlyBase Insertion: P{GawB}NP0351 w-contaminating. Rebalance

  16. Specificity of the Spectrophotometry for Detecting Aminopolyether K2.2.2 in 18F-FDG

    Directory of Open Access Journals (Sweden)

    ZHANG Jin-ming

    2015-11-01

    Full Text Available 氨基聚醚(K2.2.2含量是18F-FDG质控中的关键指标,比较了两种常用测量K2.2.2方法的专属性。分别采用分光光度计和半定量TLC 碘显色法测量了14个样品,其中9个阴性样品、2个阳性样品和3个供试品,并与LC-MS/MS测量对比。结果显示:9个阴性样品经分光光度计法测量均为阳性,K2.2.2的测量结果在6.7~470.0 μg/mL;2个阳性样品结果偏高(53,73 μg/mL),3个供试品的K2.2.2含量在14.3~19.2 μg/mL;半定量TLC 碘显色法测量9个阴性样品结果为阴性,2个阳性样品半定量结果与实际一致,3个供试品的K2.2.2含量低于10 μg/mL;LC-MS/MS法测量的14个样品的结果与半定量TLC 碘显色法的结果一致。以上结果表明,半定量TLC 碘显色法测量K2.2.2的专属性较好,适用于测量18F-FDG溶液中K2.2.2含量。

  17. Evaluation of the anesthetic effects of MS222 in the adult Mexican axolotl (Ambystoma mexicanum

    Directory of Open Access Journals (Sweden)

    Zullian C

    2016-01-01

    Full Text Available Chiara Zullian,1 Aurore Dodelet-Devillers,1 Stéphane Roy,2 Pascal Vachon1 1Département de Biomédecine Vétérinaire, Faculté de Médecine Vétérinaire, Université de Montréal, Saint-Hyacinthe, 2Département de Stomatologie, Faculté de Médecine Dentaire, Montréal, Québec, Canada Abstract: The Mexican axolotl (Ambystoma mexicanum is a unique research model in several fields of medicine, where surgical and invasive procedures may be required. As yet, little is known about the efficacy of MS222 (tricaine methanesulfonate, which is the most commonly used anesthetic agent in amphibians. The main objectives of this study were to evaluate the anesthetic effects and physiological changes in adult axolotls following a 20-minute immersion bath, containing progressive MS222 concentrations starting at 0.1%. Depth of anesthesia and physiological changes were evaluated every 15 minutes post-MS222 exposure with the following parameters: righting behavior, withdrawal reflex, acetic acid test response, heart rate, and blood oxygen saturation, as well as cloacal and body surface temperatures. A 20-minute exposure in a 0.1% MS222 immersion bath (n=6 animals had no anesthetic effects on adult axolotls after 20 minutes of exposure. With a 0.2% MS222 solution, all axolotls (n=9 were deeply anesthetized at 15 minutes, and 80% were still unresponsive at 30 minutes postexposure. Blood oxygen saturation and heart rate were slightly, but significantly, increased when compared with the baseline value and remained stable up to recovery. There was no significant increase in surface and cloaca temperatures, compared with baseline. With the 0.4% MS222 solution, the duration of anesthesia lasted for 90 minutes to at least 120 minutes (n=3 animals and this concentration was deemed too high. In conclusion, a 20-minute immersion bath with 0.2% MS222 may be used for short procedures (15–30 minutes requiring anesthesia of adult axolotls. Keywords: Ambystoma mexicanum

  18. Radiometric survey of Radon-222 in Instituto de Engenharia Nuclear - IEN/CNEN-Brazil; Levantamento de radonio-222 no Instituto de Engenharia Nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gouvea, Vandir de Azevedo; Cardoso, Domingos d' Oliveira; Pedro, Carlos Roberto [Instituto de Engenharia Nuclear (IEN), Rio de Janeiro, RJ (Brazil). Div. de Seguranca e Radioprotecao]. E-mail: vandir@cnen.gov.br; Castro, Carlos Alberto Carvalho [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil). Dept. de Engenharia Nuclear

    2001-07-01

    The radioecological concentrations of Radon-222 indoor and outdoor nuclear facility of IEN, have been determined.The present study has established a radon investigation methodology in occupational areas, besides to suggest solutions for gas concentration minimization, in others work environment like to IEN.

  19. Investigation of beam transmission in A 9SDH-2 3.0 MV NEC pelletron tandem accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Deoli, Naresh T.; Kummari, Venkata C.; Pacheco, Jose L.; Duggan, Jerome L.; Glass, Gary A.; McDaniel, Floyd D.; Reinert, Tilo; Rout, Bibhudutta; Weathers, Duncan L. [Ion Beam Modification And Analysis Laboratory, Department of Physics, University of North Texas, Denton, Texas 76203 (United States)

    2013-04-19

    Electrostatic tandem accelerators are widely used to accelerate ions for experiments in materials science such as high energy ion implantation, materials modification, and analyses. Many applications require high beam current as well as high beam brightness at the target; thus, maximizing the beam transmission through such electrostatic accelerators becomes important. The Ion Beam Modification and Analysis Laboratory (IBMAL) at University of North Texas is equipped with four accelerators, one of which is a 9SDH-2 3.0 MV National Electrostatic Corporation (NEC) Pelletron Registered-Sign tandem accelerator. The tandem accelerator is equipped with three ion sources: one radio frequency-He ion source (Alphatross) and two ion sources of Cs-sputter type, the SNICS II (Source of Negative Ions by Cesium Sputtering) and a Cs-sputter source for trace-element accelerator based mass spectrometry. This work presents a detailed study of the beam transmission of hydrogen, silicon, and silver ions through the accelerator using the SNICS ion source with injection energies ranging from 20 keV to 70 keV. The beam transmission is quantified for three different terminal voltages: 1.5 MV, 2.0 MV and 2.5 MV. For a given terminal voltage, it has been found that beam transmission is strongly dependent on the ion source injector potential. Details of experiments and data analysis are presented.

  20. Soil gas 222Rn and volcanic activity at El Hierro (Canary Islands) before and after the 2011 submarine eruption

    Science.gov (United States)

    Padilla, G.; Hernández, P. A.; Padrón, E.; Barrancos, J.; Melián, G.; Dionis, S.; Rodríguez, F.; Nolasco, D.; Calvo, D.; Hernández, I.; Pereza, M. D.; Pérez, N. M.

    2012-04-01

    El Hierro (278 km2) is the southwesternmost island of the Canarian archipelago. From June 19, 2011 to January 2012, more than 11,950 seismic events have been detected by the seismic network of IGN. On 10 October 2011 the earthquake swarm changed its behaviour and produced a harmonic tremor due to magma movement, indicating that a submarine eruption located at 2 km south of La Restinga had started which is still in progress. Since 2003, the ITER Environmental Research Division now integrated in the Instituto Volcanológico de Canarias, INVOLCAN, has regularly performed soil gas surveys at El Hierro as a geochemical tool for volcanic surveillance. Among the investigated gases, soil gas radon (222Rn) and thoron (220Rn) have played a special attention. Both gases are characterized to ascend towards the surface mainly through cracks or faults via diffusion or advection, mechanisms dependent of both soil porosity and permeability, which in turn vary as a function of the stress/strain changes at depth. Years before the starts of the volcanic-seismic crisis on July 17, 2011, a volcanic multidisciplinary surveillance program was implemented at El Hierro including discrete and continuous measurements of 222Rn and 220Rn. Two soil gas 222Rn surveys had been carried out at El Hierro in 2003 and 2011, and four continuous geochemical monitoring stations for 222Rn and 220Rn measurements had been installed (HIE02, HIE03, HIE04 and HIE08). Soil gas 222Rn surveys were carried out at the surface environment of El Hierro after selecting 600 sampling observation sites (about 40 cm depth). Geochemical stations measure 222Rn and 220Rn activities by pumping the gas from a PVC pipe inserted 1m in the ground and thermally isolated. The results of the 2003 and 2011 soil gas 222Rn surveys show clearly a relatively higher observed 222Rn activities in the surface environment on 2011 than those observed on 2003 when no anomalous seismicity were taking place beneath El Hierro. The observed

  1. Successful Pregnancy Outcome in Women with Recurrent IVF Failure and Anti-hCG Autoimmunity: A Report of Three Cases

    Directory of Open Access Journals (Sweden)

    Valeria Muller

    2016-01-01

    Full Text Available We report three cases of effective management of infertility in women with a history of repeated unsuccessful IVF attempts, who have developed antibodies to hCG. A novel approach to conservative treatment of immunologic reproductive failure, suggested for selected patients, included membrane plasmapheresis, combined prednisolone, and intravenous immunoglobulin therapy. No adverse side effects were observed; all cases resulted in pregnancy and subsequent life births. In order to be given an adequate efficient treatment, women with recurrent implantation failure should be suspected for autoimmune factor of infertility and its possible association with anti-hCG autoimmunity.

  2. State waste discharge permit application: 200 Area Treated Effluent Disposal Facility (Project W-049H)

    Energy Technology Data Exchange (ETDEWEB)

    1994-08-01

    As part of the original Hanford Federal Facility Agreement and Concent Order negotiations, US DOE, US EPA and the Washington State Department of Ecology agreed that liquid effluent discharges to the ground to the Hanford Site are subject to permitting in the State Waste Discharge Permit Program (SWDP). This document constitutes the SWDP Application for the 200 Area TEDF stream which includes the following streams discharged into the area: Plutonium Finishing Plant waste water; 222-S laboratory Complex waste water; T Plant waste water; 284-W Power Plant waste water; PUREX chemical Sewer; B Plant chemical sewer, process condensate, steam condensate; 242-A-81 Water Services waste water.

  3. State waste discharge permit application: 200 Area Treated Effluent Disposal Facility (Project W-049H)

    International Nuclear Information System (INIS)

    1994-08-01

    As part of the original Hanford Federal Facility Agreement and Concent Order negotiations, US DOE, US EPA and the Washington State Department of Ecology agreed that liquid effluent discharges to the ground to the Hanford Site are subject to permitting in the State Waste Discharge Permit Program (SWDP). This document constitutes the SWDP Application for the 200 Area TEDF stream which includes the following streams discharged into the area: Plutonium Finishing Plant waste water; 222-S laboratory Complex waste water; T Plant waste water; 284-W Power Plant waste water; PUREX chemical Sewer; B Plant chemical sewer, process condensate, steam condensate; 242-A-81 Water Services waste water

  4. Crystallization and preliminary X-ray crystallographic analysis of Thermotoga maritima CheA P3-P4-P5 domains in complex with CheW

    International Nuclear Information System (INIS)

    Park, SangYoun; Kim, Keon Young; Kim, Sunmin; Crane, Brian R.

    2012-01-01

    T. maritima CheA P3-P4-P5 domains were crystallized in complex with CheW. Low-resolution diffraction data were collected to ∼8 Å using synchrotron X-ray radiation. The CheA–CheW complex plays a key role in bacterial chemotaxis signal transduction by initiating phosphotransfer to response regulators via coupling to the chemoreceptors. CheA (P3-P4-P5 domains) and CheW from Thermotoga maritima were overexpressed in Escherichia coli and crystallized as a complex at 298 K using ammonium dihydrogen phosphate as a precipitant. X-ray diffraction data were collected to ∼8 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group I222 or I2 1 2 1 2 1 , with unit-cell parameters a = 184.2, b = 286.4, c = 327.7 Å. The asymmetric unit may contain six to ten CheA–CheW molecules

  5. Potable water as a source of airborne 222Rn in US dwellings: a review and assessment

    International Nuclear Information System (INIS)

    Nazaroff, W.W.; Doyle, S.M.; Nero, A.V.; Sextro, R.G.

    1987-01-01

    Using a long-term-average, single-cell model and available data for U.S. housing, the concentration of 222 Rn in indoor air due to the use of potable water is assessed. The ratio of the airborne 222 Rn concentration to the concentration in water is represented by a lognormal distribution with geometric mean and geometric standard deviation of 0.65 X 10(-4) and 2.88, respectively, in fair agreement with the previously reported results of direct measurements of the ratio in 13 houses. By combining this result with data on 222 Rn concentrations in U.S. water supplies, potable water is estimated to contribute an average of 24, 1.3, and 0.1 Bq m-3 to the airborne 222 Rn concentration in residences served by private wells, public ground water, and surface water supplies, respectively

  6. Estimation of the radiological risk related to the presence of radon 222 in a hydrotherapy centre in Tunisia

    International Nuclear Information System (INIS)

    Labidi, S; Essafi, F; Mahjoubi, H

    2006-01-01

    The 222 Rn concentration in air was measured in a thermal water spa used as a hydrotherapy centre in Tunisia. The associated health risk for employees and patients due to the inhalation of 222 Rn and its progeny was estimated. A protection scheme for the employees of the spas has been designed. Results show that the 222 Rn concentration varies in the range 33-589 Bq m -3 . The 222 Rn concentrations measured in the present study show lower values in comparison to those reported for thermal spas in other countries. The 222 Rn concentration in different rooms of the spa depends mainly on the ventilation rate. A model based on a dosimetric approach was adopted to estimate the radon risk considering the 222 Rn concentration, the time spent in the spa, and the radioactive equilibrium factor F. The annual effective dose was found to vary between 0.2 and 1.7 mSv for workers while the range for patients was from 2.8 x 10 -4 to 1.1 x 10 -4 mSv. These values are within the ICRP recommended values. (note)

  7. Estimation of the radiological risk related to the presence of radon 222 in a hydrotherapy centre in Tunisia

    Energy Technology Data Exchange (ETDEWEB)

    Labidi, S [Institut Superieur des Technologies Medicales de Tunis (Tunisia); Essafi, F [Faculte de Medecine de Tunis, Section de Biophysique, Tunis (Tunisia); Mahjoubi, H [Institut Superieur des Technologies Medicales de Tunis (Tunisia)

    2006-09-15

    The {sup 222}Rn concentration in air was measured in a thermal water spa used as a hydrotherapy centre in Tunisia. The associated health risk for employees and patients due to the inhalation of {sup 222}Rn and its progeny was estimated. A protection scheme for the employees of the spas has been designed. Results show that the {sup 222}Rn concentration varies in the range 33-589 Bq m{sup -3}. The {sup 222}Rn concentrations measured in the present study show lower values in comparison to those reported for thermal spas in other countries. The {sup 222}Rn concentration in different rooms of the spa depends mainly on the ventilation rate. A model based on a dosimetric approach was adopted to estimate the radon risk considering the {sup 222}Rn concentration, the time spent in the spa, and the radioactive equilibrium factor F. The annual effective dose was found to vary between 0.2 and 1.7 mSv for workers while the range for patients was from 2.8 x 10{sup -4} to 1.1 x 10{sup -4} mSv. These values are within the ICRP recommended values. (note)

  8. Practice of the Education for the Principle of Otto Cycle by the E-Learning CG-Content

    Science.gov (United States)

    Sato, Tomoaki; Nagaoka, Keizo; Oguchi, Kosei

    A CG-animation content which supports the learning of the Otto cycle was developed. This content has a piston assembly and the diagrams of PV, VS, TP and TS. The each diagram has a pointer which moves along the line of the graph and they are synchronized with the movement of the piston. The learners can operate this content directly on the e-learning system. While watching the movements of the piston assembly, the learners can confirm the state of the engine about temperature, pressure, volume, and entropy by the synchronized pointer on the diagrams. This content was used for the class of the machining practice exercise. The learning effect of the content was examined by the score of the short test. As the result of this examination, the CG-animation content was effective in the learning of the Otto cycle.

  9. Effects of air conditioning, dehumidification and natural ventilation on indoor concentrations of 222Rn and 220Rn

    International Nuclear Information System (INIS)

    Lee, Thomas K.C.; Yu, K.N.

    2000-01-01

    A bedroom was selected for detailed measurements on 220 Rn and 222 Rn concentrations and environmental parameters including CO 2 concentration, temperature and relative humidity. To simulate different sealing conditions, five conditions were artificially created in the sampling period of 25 consecutive days. It was concluded that natural ventilation is the most efficient way to lower the 222 Rn levels, while air conditioning is the next. Dehumidification provides only a marginal reduction of 222 Rn levels. The 220 Rn concentrations are not affected by natural ventilation, air conditioner or dehumidification, and were all around 10 Bq m -3 . There are no significant correlations between the 220 Rn and 222 Rn concentrations and environmental conditions such as CO 2 concentrations, temperature, relative humidity and pressure

  10. Biodiesel Test Plan

    Science.gov (United States)

    2014-07-01

    Biodiesel Test Plan Distribution Statement A: Approved for Public Release; distribution is unlimited. July 2014 Report No. CG-D-07-14...Appendix C) Biodiesel Test Plan ii UNCLAS//Public | CG-926 R&DC | G. W. Johnson, et al. Public | July 2014 N O T I C E This...Development Center 1 Chelsea Street New London, CT 06320 Biodiesel Test Plan iii UNCLAS//Public | CG-926 R&DC | G. W. Johnson, et al

  11. The dual role of Candida glabrata Drug:H+ Antiporter CgAqr1 (ORF CAGL0J09944g in antifungal drug and acetic acid resistance

    Directory of Open Access Journals (Sweden)

    Catarina eCosta

    2013-06-01

    Full Text Available Opportunistic Candida species often have to cope with inhibitory concentrations of acetic acid, in the acidic environment of the vaginal mucosa. Given that the ability of these yeast species to tolerate stress induced by weak acids and antifungal drugs appears to be a key factor in their persistence and virulence, it is crucial to understand the underlying mechanisms.In this study, the Drug:H+ Antiporter CgAqr1 (ORF CAGL0J09944g, from Candida glabrata, was identified as a determinant of resistance to acetic acid, and also to the antifungal agents flucytosine and, less significantly, clotrimazole. These antifungals were found to act synergistically with acetic acid against this pathogen. The action of CgAqr1 in this phenomenon was analyzed. Using a GFP fusion, CgAqr1 was found to localize to the plasma membrane and to membrane vesicles when expressed in C. glabrata or, heterologously, in Saccharomyces cerevisiae. Given its ability to complement the susceptibility phenotype of its S. cerevisiae homolog, ScAqr1, CgAqr1 was proposed to play a similar role in mediating the extrusion of chemical compounds. Significantly, the expression of this gene was found to reduce the intracellular accumulation of 3H-flucytosine and, to a moderate extent, of 3H-clotrimazole, consistent with a direct role in antifungal drug efflux. Interestingly, no effect of CgAQR1 deletion could be found on the intracellular accumulation of 14C-acetic acid, suggesting that its role in acetic acid resistance may be indirect, presumably through the transport of a still unidentified physiological substrate. Although neither of the tested chemicals induces changes in CgAQR1 expression, pre-exposure to flucytosine or clotrimazole was found to make C. glabrata cells more sensitive to acetic acid stress. Results from this study show that CgAqr1 is an antifungal drug resistance determinant and raise the hypothesis that it may play a role in C. glabrata persistent colonization and

  12. Miejsce muzeów w turystyce kulturowej w Polsce

    OpenAIRE

    Krakowiak, Beata

    2013-01-01

    The article presents the museums, their potential and their significance for cultural tourism in Poland. Its aims are achieved through a presentation of registered national museums, ‘monuments of history’, museum buildings and the cultural activities undertaken by these institutions Artykuł dotyczy potencjału muzealnego oraz jego znaczenia dla turystyki kulturowej w Polsce. Zamierzone cele pracy realizowane są poprzez prezentację muzeów rejestrowanych, narodowych, muzeów-pomników histor...

  13. Radon-222 signatures of natural ventilation regimes in an underground quarry.

    Science.gov (United States)

    Perrier, Frédéric; Richon, Patrick; Crouzeix, Catherine; Morat, Pierre; Le Mouël, Jean Louis

    2004-01-01

    Radon-222 activity concentration has been monitored since 1999 in an underground limestone quarry located in Vincennes, near Paris, France. It is homogeneous in summer, with an average value of 1700 Bq m(-3), and varies from 730 to 1450 Bq m(-3) in winter, indicating natural ventilation with a rate ranging from 0.5 to 2.4 x 10(-6) s(-1) (0.04-0.22 day(-1)). This hypothesis is supported by measurements in the vertical access pit where, in winter, a turbulent air current produces a stable radon profile, smoothly decreasing from 700 Bq m(-3) at 20 m depth to 300 Bq m(-3) at surface. In summer, a thermal stratification is maintained in the pit, but the radon-222 concentration jumps repeatedly between 100 and 2000 Bq m(-3). These jumps are due to atmospheric pressure pumping, which induces ventilation in the quarry at a rate of about 0.1 x 10(-6) s(-1) (0.009 day(-1)). Radon-222 monitoring thus provides a dynamical characterisation of ventilation regimes, which is important for the assessment of the long-term evolution of underground systems.

  14. Concentration of 222Rn in drinking water of the Zacatecas City, measured by liquid scintillation and associated dose

    International Nuclear Information System (INIS)

    Arevalo B, C. A.; Lopez del R, H.; Davila R, J. I.; Mireles G, F.; Pinedo V, J. L.; Rios M, C.; Saucedo A, S. A.

    2017-09-01

    A study was carried out to determine the concentration of 222 Rn in samples of drinking water collected from different homes in the Zacatecas city, Mexico, whose main source of supply is groundwater. The 222 Rn radioactive gas is a product of the decay series of 238 U and is considered one of the main sources of natural radiation, since it contributes almost half of the radiation dose that a person will receive throughout his life. The 222 Rn originates in the rocks of the aquifers and dissolves in the water, which is later integrated into the distribution network of the public supply that supplies the entire population. Exposure to ionizing radiation that 222 Rn and its offspring emit can damage the DNA molecule, inducing the possible appearance of cancer. Has been demonstrated by various epidemiological studies carried out in uranium mines workers in different parts of the world, that this exposure increases the incidence of lung cancer, placing 222 Rn and their offspring as the second main cause of this type of cancer, after smoking habit. Using the technique of solvent extraction of 222 Rn in water and liquid scintillation spectrometry, water collected from 14 different households was sampled and analyzed. The average of the measured activity of 222 Rn was 2.09 Bq/L and the annual effective dose per water intake attributable to that concentration of 6.07 mSv/a. The concentration of 222 Rn in water and the annual effective dose are below 11 Bq/L and 50 mSv/a, such concentrations are the maximum limits established by the Unites States Environmental Protection Agency (US EPA) and the ICRP, respectively. The concentration of 222 Rn that is transferred from the water to the air inside a house was also calculated and the radiation dose that this concentration causes by inhalation, being 0.209 Bq/m 3 and 1,463 μ Sv a, respectively. (Author)

  15. Evaluation of groundwater discharge into small lakes based on the temporal distribution of radon-222

    Science.gov (United States)

    Dimova, N.T.; Burnett, W.C.

    2011-01-01

    In order to evaluate groundwater discharge into small lakes we constructed a model that is based on the budget of 222Rn (radon t1/2 5 3.8 d) as a tracer. The main assumptions in our model are that the lake's waters are wellmixed horizontally and vertically; the only significant 222Rn source is via groundwater discharge; and the only losses are due to decay and atmospheric evasion. In order to evaluate the groundwater-derived 222Rn flux, we monitored the 222Rn concentration in lake water over periods long enough (usually 1-3 d) to observe changes likely caused by variations in atmospheric exchange (primarily a function of wind speed and temperature). We then attempt to reproduce the observed record by accounting for decay and atmospheric losses and by estimating the total 222Rn input flux using an iterative approach. Our methodology was tested in two lakes in central Florida: one of which is thought to have significant groundwater inputs (Lake Haines) and another that is known not to have any groundwater inflows but requires daily groundwater augmentation from a deep aquifer (Round Lake). Model results were consistent with independent seepage meter data at both Lake Haines (positive seepage of ??? 1.6 ?? 104 m3 d-1 in Mar 2008) and at Round Lake (no net groundwater seepage). ?? 2011, by the American Society of Limnology and Oceanography, Inc.

  16. Calibration factor determination for solid nuclear track detectors CR-39 type exposed to Rn-222

    International Nuclear Information System (INIS)

    Cazula, Camila Dias; Campos, Marcia Pires de; Mazzilli, Barbara Paci

    2014-01-01

    In the detection method with solid nuclear track detector, when a heavy particle rests on the detector surface, causes a breakdown in their molecular structure forming a trace. One of the typical applications of these detectors is the measurement of the concentration of Rn -222 in air, a noble radioactive gas, part of the U-238 series, emitting alpha particles and important in epidemiological studies to protect individuals from natural radiation. To determine the concentration of Rn -222 in the air in a room is necessary to know the density of lines (traces / cm 2 ) on the detector surface, the exposure time and the calibration factor. The determination of the calibration factor for CR-39 detectors was taken from the exposure of these to a known concentration of Rn-222. Therefore, the detectors were placed inside a cell of Lucas adapted and subsequently exposed to a concentration of Rn-222 15 kBq / m 3 , by means of the apparatus RN-150 Pylon Electronics Incorporation, which has a source of Ra-226 and releases known concentrations of Rn-222. Six calibration factor determinations were performed, the average value obtained was 0.0534 ±0.0021 (traces / cm 2 per Bq / m 3 day). The results are consistent with literature values for the same type of detector and showed good reproducibility

  17. Alpha radioactivity monitoring related to Radon-222 in water from wells in metropolitan area of Curitiba (PR), Brazil; Monitoramento da radioatividade alfa relacionada ao radonio-222 em aguas de pocos da regiao metropolitana de Curitiba (PR)

    Energy Technology Data Exchange (ETDEWEB)

    Correa, Janine Nicolosi; Paschuk, Sergei Anatolyevich; Kappke, Jaqueline; Claro, Flavia Del; Perna, Allan Felipe Nunes; Reque, Marilson, E-mail: janine_nicolosi@hotmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy; Schelin, Hugo Reuters [Instituto de Pesquisa Pele Pequeno Principe (IPPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita Oliveira [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2015-04-15

    This research objective was to assess the level of randon-222 concentration in well water of the metropolitan region of Curitiba, Parana. Current work presents the results of indoor {sup 222}Rn activity ground water samples from artesian wells from aquifers of the region. The studies of radon activity in water were performed using the radon detector AlphaGUARD. The calculations of initial radon activity in water were done considering the {sup 222}Rn decay correction as well as equilibrium level of {sup 222}Rn and {sup 226}Ra observed after 30 days of measurements. Obtained results show that about 70% of measured activity levels of {sup 222}Rn are higher than the recommended value of 11.1 Bq.L{sup -1}, which represent the risk for the human health associated with this radionuclide. The case study showed that previous measurements of radon are recommended for a construction project is implemented. In this case, it is observed that the radon concentrations decrease about 56% in the first water tank and 83% in the second water tank over the well. This fact shows that the actions for mitigation of radon are viable and do not require major modifications to the usual systems of construction. (author)

  18. Measurement of Rn-222 concentrations in building materials used in jordan

    Energy Technology Data Exchange (ETDEWEB)

    Ismail, A M; Abumyrad, K M; Kullab, M K; Albataina, B A [Physics Dept., Yarmouk University, 219-10 Irbid, (Jordan)

    1995-10-01

    In this work, the concentrations of the radiative inert gas Rn-222 emanated from the building materials that are commonly in jordan have been studied. For this purpose, samples of ten jordanian building materials of different masses were prepared in plastic cans sealed to passive integrated dosimeters containing CR-39 solid state nuclear track detectors which are very sensitive to alpha-particles. The Rn-222 concentrations in these samples range from 137 Bq/m{sup 3} to 267 Bq/m{sup 3} with an average of 189 Bq/m{sup 3}. These levels were found to be consistent with those measured by other workers in other countries. 4 figs., 2 tabs.

  19. Measurement of Rn-222 concentrations in building materials used in jordan

    International Nuclear Information System (INIS)

    Ismail, A.M.; Abumyrad, K.M.; Kullab, M.K.; Albataina, B.A.

    1995-01-01

    In this work, the concentrations of the radiative inert gas Rn-222 emanated from the building materials that are commonly in jordan have been studied. For this purpose, samples of ten jordanian building materials of different masses were prepared in plastic cans sealed to passive integrated dosimeters containing CR-39 solid state nuclear track detectors which are very sensitive to alpha-particles. The Rn-222 concentrations in these samples range from 137 Bq/m 3 to 267 Bq/m 3 with an average of 189 Bq/m 3 . These levels were found to be consistent with those measured by other workers in other countries. 4 figs., 2 tabs

  20. A preliminary investigation of 222Rn and 220Rn levels in non-uranium mines in China

    International Nuclear Information System (INIS)

    Shang Bing; Cui Hongxing; Wu Yunyun; Zhang Qingzhao; Su Xu

    2008-01-01

    Objective: To measure levels of 222 Rn and 220 Rn in typical non-uranium mines, China, and to estimate dose from the occupational radon exposure in the miners. Methods: Using typical sampling scheme, 44 mines were selected in 12 provinces, which can be classified into 4 categories and 17 types of mines. The radon-thoron discriminative detectors were used to measure 222 Rn and 220 Rn concentrations in mines. Result: The concentration of 222 Rn or 220 Rn was log-normally distributed. The arithmetic mean (AM) concentration and geometric mean (GM) concentration of 222 Rn and 220 Rn in 25 metal mines (n=147) were estimated to be (1211 ±2359) Bq/m 3 (AM) and (311 ± 5.5) Bq/m 3 (GM), and (269 ±700) Bq/m 3 (AM) and (71 ± 4.4)Bq/m 3 (GM), respectively. The mean concentrations of 222 Rn and 220 Rn in 18 non-metal mines (n=118) were (98 ± 207) Bq/m 3 (AM) and(55 ± 2.5) Bq/m 3 (GM), and (60 ± 76) Bq/m 3 (AM) and (38 ± 2.4) Bq/m 3 (GM) respectively. In total, we measured 222 Rn concentration in 44 underground mines, 6 of them, accounted for 15%, with the mean radon concentration exceeding 1000 Bqm -3 (limit of workplace in China). Approximately 7% of radon concentration in mines measured were higher than 3700 Bq/m 3 (current limit in uranium mine in China), some points even exceeded 10 000 Bq/m 3 . Based on this typical measurements, the equilibrium factor for 222 Rn was estimated to be 0.33 ± 0.15 in underground mines and 0.47 ±0.18 in nearby houses. Equilibrium factor for 220 Rn ranged from 0.001 to 0.032. Using the data obtained in this typical survey, the average annual effective dose of underground miners exposed to radon and thoron was estimated to be 8.15 mSv/a. Conclusions: High levels of 222 Rn exists in metal mines, such as copper, tin, lead and zinc, gold, and aluminum mines among others. More study and administrative measures are needed to address the radiation protection of workers occupationally exposed to high radon in mines. (authors)

  1. Low fraction of the 222K PrP variant in the protease-resistant moiety of PrPres in heterozygous scrapie positive goats.

    Science.gov (United States)

    Mazza, Maria; Guglielmetti, Chiara; Ingravalle, Francesco; Brusadore, Sonia; Langeveld, Jan P M; Ekateriniadou, Loukia V; Andréoletti, Olivier; Casalone, Cristina; Acutis, Pier Luigi

    2017-07-01

    The presence of lysine (K) at codon 222 has been associated with resistance to classical scrapie in goats, but few scrapie cases have been identified in 222Q/K animals. To investigate the contribution of the 222K variant to PrPres formation in natural and experimental Q/K scrapie cases, we applied an immunoblotting method based on the use of two different monoclonal antibodies, F99/97.6.1 and SAF84, chosen for their different affinities to 222K and 222Q PrP variants. Our finding that PrPres seems to be formed nearly totally by the 222Q variant provides evidence that the 222K PrP variant confers resistance to conversion to PrPres formation and reinforces the view that this mutation has a protective role against classical scrapie in goats.

  2. Targeted therapy of renal cell carcinoma: synergistic activity of cG250-TNF and IFNg.

    NARCIS (Netherlands)

    Bauer, S.; Oosterwijk-Wakka, J.C.; Adrian, N.; Oosterwijk, E.; Fischer, E.; Wuest, T.; Stenner, F.; Perani, A.; Cohen, L.; Knuth, A.; Divgi, C.; Jager, D.; Scott, A.M.; Ritter, G.; Old, L.J.; Renner, C.

    2009-01-01

    Immunotherapeutic targeting of G250/Carbonic anhydrase IX (CA-IX) represents a promising strategy for treatment of renal cell carcinoma (RCC). The well characterized human-mouse chimeric G250 (cG250) antibody has been shown in human studies to specifically enrich in CA-IX positive tumors and was

  3. Role of miR-222-3p in c-Src-Mediated Regulation of Osteoclastogenesis

    Directory of Open Access Journals (Sweden)

    Shinya Takigawa

    2016-02-01

    Full Text Available MicroRNAs (miRNAs are small non-coding RNAs that play a mostly post-transcriptional regulatory role in gene expression. Using RAW264.7 pre-osteoclast cells and genome-wide expression analysis, we identified a set of miRNAs that are involved in osteoclastogenesis. Based on in silico analysis, we specifically focused on miR-222-3p and evaluated its role in osteoclastogenesis. The results show that the inhibitor of miR-222-3p upregulated the mRNA levels of nuclear factor of activated T-cells, cytoplasmic 1 (NFATc1 and tartrate-resistant acid phosphatase (TRAP, while its mimicking agent downregulated their mRNA levels. Western blot analysis showed that its inhibitor increased the protein levels of TRAP and cathepsin K, while its mimicking agent decreased their levels. Genome-wide mRNA expression analysis in the presence and absence of receptor activator of nuclear factor κ-B ligand (RANKL predicted c-Src as a potential regulatory target of miR-222-3p. Live cell imaging using a fluorescence resonance energy transfer (FRET technique revealed that miR-222-3p acted as an inhibitor of c-Src activity, and a partial silencing of c-Src suppressed RANKL-induced expression of TRAP and cathepsin K, as well as the number of multi-nucleated osteoclasts and their pit formation. Collectively, the study herein demonstrates that miR-222-3p serves as an inhibitor of osteoclastogenesis and c-Src mediates its inhibition of cathepsin K and TRAP.

  4. 222Rn and 14CO2 concentrations in the surface layer of the atmosphere

    International Nuclear Information System (INIS)

    Holy, K.; Chudy, M.; Sivo, A.; Richtarikova, M.; Boehm, R.; Polaskova, A.; Vojtyla, P.; Bosa, I.; Hola, O.

    2002-01-01

    Long-term monitoring of the Δ 14 C in the atmospheric near-ground CO 2 has been realized in Bratislava and Zlkovce, situated near the nuclear power plant Jaslovske Bohunice. Until 1993, the monthly mean Δ 14 C values showed a high variability. The annual means of Δ 14 C were about 30 per mille higher at Zlkovce than in highly industrialised Bratislava. An important change in the behaviour of the 14 C data has occurred since 1993. The records from both stations show the similar course, mainly due to the fact that there do not occur deep winter minima in Bratislava. This behaviour corresponds to the lower values of the total fossil fuel CO 2 emissions in the years after 1993 when compared to the previous years. At present, both sets of data show that the 14 C concentration is about 10% above the natural level. Since 1987 also the 222 Rn concentration in the surface layer of the atmosphere has been measured in Bratislava. These measurements provided an extensive set of the 222 Rn data characteristic for the inland environment with high level of atmospheric pollution. The seasonal and daily variations of the 222 Rn concentration were observed. The investigation of the relation between the monthly mean diurnal courses of the 222 Rn concentration and the atmospheric stability proved a high correlation between them. The 222 Rn data were used to interpret the anomalous Δ 14 C values in the surface layer of the atmosphere. (author)

  5. Use of 222Rn-resistant techniques in new home construction

    International Nuclear Information System (INIS)

    Watson, J.E. Jr.; Cote, R.A.

    1999-01-01

    The objective of this project was to assess the status of the use of 222 Rn-resistant construction techniques in new home construction in the eight Zone 1 counties of North Carolina. Zone 1 counties have an average predicted indoor 222 Rn screening potential greater than 148 Bq m -3 (4 pCi L -1 ). To facilitate a response from builders, a brief survey form was designed and printed on the back of a self-addressed, postage-paid postcard. This survey form was mailed to 460 home builders in the Zone 1 counties. The response rate was 17%, which can be compared to the 4.9% response rate obtained in a national survey conducted by the National Association of Home Builders Research Center. In their survey, 62% of the responding builders reported that they had built some or many homes in 1996 using construction techniques to reduce the entry of radon into homes, but only 10% of the builders reported using these techniques for many homes. The National Association of Home Builders survey determined that, nationally, 30% of homes built in Zone 1 counties had 222 Rn venting features. There is the potential for bias in the results of their survey (as well as in the results of the National Association of Home Builders survey) since the response rates were low

  6. The Non–Symmetric s–Step Lanczos Algorithm: Derivation of Efficient Recurrences and Synchronization–Reducing Variants of BiCG and QMR

    Directory of Open Access Journals (Sweden)

    Feuerriegel Stefan

    2015-12-01

    Full Text Available The Lanczos algorithm is among the most frequently used iterative techniques for computing a few dominant eigenvalues of a large sparse non-symmetric matrix. At the same time, it serves as a building block within biconjugate gradient (BiCG and quasi-minimal residual (QMR methods for solving large sparse non-symmetric systems of linear equations. It is well known that, when implemented on distributed-memory computers with a huge number of processes, the synchronization time spent on computing dot products increasingly limits the parallel scalability. Therefore, we propose synchronization-reducing variants of the Lanczos, as well as BiCG and QMR methods, in an attempt to mitigate these negative performance effects. These so-called s-step algorithms are based on grouping dot products for joint execution and replacing time-consuming matrix operations by efficient vector recurrences. The purpose of this paper is to provide a rigorous derivation of the recurrences for the s-step Lanczos algorithm, introduce s-step BiCG and QMR variants, and compare the parallel performance of these new s-step versions with previous algorithms.

  7. Angiogeneza w reumatoidalnym zapaleniu stawów

    Directory of Open Access Journals (Sweden)

    Anna Kotulska

    2011-02-01

    Full Text Available Angiogeneza jest procesem powstawania nowych włosowatychnaczyń krwionośnych z uprzednio istniejących włośniczek. Angiogenezawystępuje w życiu pozapłodowym i jest regulowana przezzespół czynników proangiogennych i antyangiogennych (tab. I.Zwiększona angiogeneza towarzyszy kilku stanom chorobowym. Jestniezbędna dla wzrostu nowotworów złośliwych. Choroby nienowotworowe,w tym reumatoidalne zapalenie stawów, są także związanez nasiloną angiogenezą. Wykazano tworzenie nowych naczyńw zmienionej zapalnie błonie maziowej stawów, co jest najważniejszązmianą patologiczną u chorych na reumatoidalne zapalenie stawów.U chorych stwierdzono zaburzoną regulację czynników proangiogennychi hamujących ten proces. Leki hamujące zapalenie błonymaziowej bezpośrednio lub pośrednio ograniczają angiogenezę.Możliwe jest, że oddziaływanie na proces angiogenezy będzie stanowićjeden z mechanizmów terapeutycznych leków stosowanychu chorych na reumatoidalne zapalenie stawów.

  8. Dynamics of radon-222 near below ground surface

    International Nuclear Information System (INIS)

    Fukui, Masami; Katsurayama, Kousuke; Nishimura, Susumu.

    1986-01-01

    The concentrations and variation of 222 Rn were investigated both in unconfined groundwater and in the aerated zone to obtain information as to the behavior of Rn close to ground surface. The Rn concentrations in unconfined groundwater near the surface were depletive by the extent of about 50 % compared with that of lower part in a borehole, then the continuous extraction of groundwater causes pronounced increase of the concentration. The method, which monitors continuously the Rn concentration in such surroundings, was developed, where the unconfined groundwater extracted was injected into another borehole and sprayed gas was measured using an ionization chamber. The read-out values of this system well followed the variation of concentrations caused by the meteorological parameter, especially infiltrating water. The increase of 222 Rn concentration in the aerated zone above the water level was clearly observed following the ascendant of groundwater level caused by the infiltrating water, whereas the change of concentration in soil air just below the ground surface obeyed mainly to the wetness of soil and unconfined groundwater level rather than atmospheric pressure. (author)

  9. Practical difficulties in determining 222Rn flux density in underground uranium mines

    International Nuclear Information System (INIS)

    Bigu, J.

    1991-01-01

    Radon-222 flux density, J, has been determined in a number of locations in an underground U mine. Measurements were conducted using the Two-Point Measurement (2PM) method, consisting of measuring the 222Rn concentration at two different points a distance apart within a given section of the mine. Several mine models were used for determining J by the above method. The 2PM method is sensitive to sources and sinks of 222Rn other than mine walls, as well as mining operations and mining activities of a diverse nature, and to local variations in airflow conditions. Because of this, J obtained by the 2PM method represents an 'apparent' flux density. Significant differences were found in the flux density calculated according to different mine models. In addition, J measurements using the flux 'can' method were also carried out in mine walls and compared with the values obtained by the 2PM method. Wide discrepancies between the two methods were found. The practical and theoretical difficulties in determining J are discussed

  10. Low fraction of the 222K PrP variant in the protease-resistant moiety of PrPres in heterozygous scrapie positive goats

    OpenAIRE

    Mazza, Maria; Guglielmetti, Chiara; Ingravalle, Francesco; Brusadore, Sonia; Langeveld, Jan P. M.; Ekateriniadou, Loukia V.; Andréoletti, Olivier; Casalone, Cristina; Acutis, Pier Luigi

    2017-01-01

    The presence of lysine (K) at codon 222 has been associated with resistance to classical scrapie in goats, but few scrapie cases have been identified in 222Q/K animals. To investigate the contribution of the 222K variant to PrPres formation in natural and experimental Q/K scrapie cases, we applied an immunoblotting method based on the use of two different monoclonal antibodies, F99/97.6.1 and SAF84, chosen for their different affinities to 222K and 222Q PrP variants. Our finding that PrPres s...

  11. 48 CFR 52.222-50 - Combating Trafficking in Persons.

    Science.gov (United States)

    2010-10-01

    ....222-50 Combating Trafficking in Persons. As prescribed in 22.1705(a), insert the following clause...: ________ ________ ________ ________ ________ ________ [Contracting Officer shall insert title of directive/notice; indicate the document is attached or provide source (such as website link) for obtaining document; and, indicate the contract performance location...

  12. (222)Rn activity in groundwater of the St. Lawrence Lowlands, Quebec, eastern Canada: relation with local geology and health hazard.

    Science.gov (United States)

    Pinti, Daniele L; Retailleau, Sophie; Barnetche, Diogo; Moreira, Floriane; Moritz, Anja M; Larocque, Marie; Gélinas, Yves; Lefebvre, René; Hélie, Jean-François; Valadez, Arisai

    2014-10-01

    One hundred ninety-eight groundwater wells were sampled to measure the (222)Rn activity in the region between Montreal and Quebec City, eastern Canada. The aim of this study was to relate the spatial distribution of (222)Rn activity to the geology and the hydrogeology of the study area and to estimate the potential health risks associated with (222)Rn in the most populated area of the Province of Quebec. Most of the groundwater samples show low (222)Rn activities with a median value of 8.6 Bq/L. Ninety percent of samples show (222)Rn activity lower than 100 Bq/L, the exposure limit in groundwater recommended by the World Health Organization. A few higher (222)Rn activities (up to 310 Bq/L) have been measured in wells from the Appalachian Mountains and from the magmatic intrusion of Mont-Saint-Hilaire, known for its high level of indoor radon. The spatial distribution of (222)Rn activity seems to be related mainly to lithology differences between U-richer metasediments of the Appalachian Mountains and magmatic intrusions and the carbonaceous silty shales of the St. Lawrence Platform. Radon is slightly enriched in sodium-chlorine waters that evolved at contact with clay-rich formations. (226)Ra, the parent element of (222)Rn could be easily adsorbed on clays, creating a favorable environment for the production and release of (222)Rn into groundwater. The contribution of groundwater radon to indoor radon or by ingestion is minimal except for specific areas near Mont-Saint-Hilaire or in the Appalachian Mountains where this contribution could reach 45% of the total radioactive annual dose. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Ultrasensitive colorimetric immunoassay for hCG detection based on dual catalysis of Au@Pt core-shell nanoparticle functionalized by horseradish peroxidase

    Science.gov (United States)

    Wang, Weiguo; Zou, Yake; Yan, Jinwu; Liu, Jing; Chen, Huixiong; Li, Shan; Zhang, Lei

    2018-03-01

    In this paper, an ultrasensitive colorimetric biosensor for human chorionic gonadotrophin (hCG) detection was designed from bottom-up method based on the dual catalysis of the horseradish peroxidase (HRP) and Au@Pt nanoparticles (NPs) relative to H2O2-TEM system. HRP and monoclonal mouse anti-hCG antibody (β-submit, mAb1) were co-immobilized onto the Au@Pt NP surface to improve catalytic efficiency and specificity, which formed a dual functionalized Au@Pt-HRP probe with the mean size of 42.8 nm (D50). The colorimetric immunoassay was developed for the hCG detection, and the Au@Pt-HRP probe featured a higher sensitivity in the concentration range of 0.4-12.8 IU L- 1 with a low limit of detection (LOD) of 0.1 IU L- 1 compared with the LODs of 0.8 IU L- 1 for BA-ELISA and of 2.0 IU L- 1 for Au@Pt, which indicated that the Au@Pt-HRP probe possessed higher catalytic efficiency with 2.8-fold increase over Au@Pt and 33.8-fold increase over HRP. Also, the Au@Pt-HRP probe exhibited good precision and reproducibility, high specificity and acceptable accuracy with CV being less than 15%. The dual functionalized Au@Pt-HRP probe as a type of signal amplified method was firstly applied in the colorimetric immunoassay for the hCG detection.

  14. Determination of 222Rn in water samples from wells and springs in Tokyo by a modified integral counting method

    International Nuclear Information System (INIS)

    Homma, Y.; Murase, Y.; Handa, K.; Murakami, I.

    1997-01-01

    222 Rn in 2L-water samples was extracted with 30 mL toluene, and 21 mL of the toluene solution was transferred into a liquid scintillation vial, in which PPO - 2,5-diphenyloxazole was placed in advance. The total activity of 222 Rn in the water sample was calculated based on the Ostwald's coefficient of solubilities of 222 Rn in toluene and water at the temperature of the sample water and the volume of water and toluene. About 40% of 222 Rn dissolved in 2L-water sample can be collected. After allowing to stand for 3.5 h, the equilibrium mixture of 222 Rn and its daughters was measured with an Aloka liquid scintillation spectrometer using a modified integral counting method which extrapolates the integral counting curve not to the zero pulse-height, but to the zero detection threshold, an average energy required to produce a measurable pulse, of the liquid scintillation spectrometer. The general method which agitates water sample (usually about 10 mL) with a liquid scintillation cocktail is practical when the activity of 222 Rn is high. By adding 10 mL of water sample, however, it is possible also to add variable amounts of quencher. In some cases water sample is preserved with nitric acid. The slope of the integral counting rate curve increases as quench level of the sample increases. Therefore, it is clear that the modified integral counting method gives more accurate 222 Rn concentrations for water samples of strong quench than the conventional integral counting method. 222 Rn sample of 0.2 Bq/L can be determined within an overall uncertainty of 3.1%

  15. Measurement of 222Rn, 220Rn and their decay products in high background radiation area in Yangjiang

    International Nuclear Information System (INIS)

    Yuan Yongling

    2000-01-01

    The investigators have measured concentrations of Rn-222, rn-220 and their decay products in high background radiation area (HBRA) and the neighboring control area (CA), as well as the equilibrium factor F for Rn-222. The average concentrations of Rn-222 in the air indoors and outdoors in the HBRA are 42.6 and 17.3 Bq/m 3 respectively, and CA, 13.2 and 11.7 Bq/m 3 , respectively. The average α-potential energy concentrations for daughters of Rn-222 indoors and outdoors in HBRA are 0.109 and 0.051 μJ/m 3 , CA, 0.045 and 0.041 μJ/m 3 , respectively. The average α-potential energy values for daughters of Rn-220 indoor and outdoor in HBRA are 0.249 and 0.053 μJ/m 3 , CA, 0.051 and 0.025 μJ/m 3 , respectively. With regard to equilibrium factor F for Rn-222, the authors have also measured 52 points of 10 hamlets in HBRA (indoor 31, outdoor 21), 9 points of 2 hamlets in CA (indoor 5, outdoor 4), respectively. These figures are 0.46, 0.53, 0.62 and 0.64, respectively

  16. A 'delayed' counting method to determine indoor Rn-222 levels indirectly

    CERN Document Server

    Iannopollo, V; Trimarchi, M; Tripepi, M G; Vermiglio, G

    2001-01-01

    A new indirect and 'delayed' way is presented to determine indoor concentration of Rn-222 by best-fitting methods. If a rapid knowledge of Rn-222 levels is required and if a detection system is not available in situ, it is possible to obtain concentration of radioactive gas by determining of 'delayed' counts of Po-214. The 'delay' time consists of two or three hours. The method is based on the use of cellulose filters for particulate collection and on the analysis of samples by alpha spectroscopy. It is also possible to obtain concentrations of short-lived radon daughters Po-218, Pb-214, Bi-214, which are very important quantities in a medical framework.

  17. Investigation of natural levels of radon-222 in groundwater in Maine for assessment of related health effects

    International Nuclear Information System (INIS)

    Hess, C.T.; Casparius, R.E.; Norton, S.A.; Brutsaert, W.F.

    1980-01-01

    We have used an inexpensive radon ( 222 Rn) measurement method using liquid scintillation counting to remeasure potable water from 10 sites near Raymond, Maine, to determine the accuracy and reproducibility of earlier measurements. Duplication or triplication of samples shows a high degree of reproducibility for the liquid scintillation method. A hypothesis emerged from analysis of the measured values of 222 Rn near Raymond, Maine, that high values (50,000 to 200,000 pCi/liter) are associated with granite. This was shown to be correct for several large areas of granite such as the Sebago, Lucern, Waldo, and Waldoboro granites. The presence of high 222 Rn concentrations in granite areas hundreds of kilometers from the Raymond area shows that the high 222 Rn levels in water are a statewide and perhaps a regional problem rather than a western Maine problem

  18. 20 CFR 222.36 - Relationship as grandchild or stepgrandchild.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as grandchild or stepgrandchild... RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.36 Relationship as grandchild or stepgrandchild. A claimant will have the relationship of grandchild or stepgrandchild of an employee, or the...

  19. 78 FR 63570 - Proposed Collection; Comment Request for Forms W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY

    Science.gov (United States)

    2013-10-24

    ... W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury..., the IRS is soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8BEN-E, Certificate of Status of Beneficial Owner for...

  20. Hemagglutinin 222D/G polymorphism facilitates fast intra-host evolution of pandemic (H1N1 2009 influenza A viruses.

    Directory of Open Access Journals (Sweden)

    Nora Seidel

    Full Text Available The amino acid substitution of aspartic acid to glycine in hemagglutinin (HA in position 222 (HA-D222G as well as HA-222D/G polymorphism of pandemic (H1N1 2009 influenza viruses (A(H1N1pdm09 were frequently reported in severe influenza in humans and mice. Their impact on viral pathogenicity and the course of influenza has been discussed controversially and the underlying mechanism remained unclarified. In the present study, BALB/c mice, infected with the once mouse lung- and cell-passaged A(H1N1pdm09 isolate A/Jena/5258/09 (mpJena/5258, developed severe pneumonia. From day 2 to 3 or 4 post infection (p.i. symptoms (body weight loss and clinical score continuously worsened. After a short disease stagnation or even recovery phase in most mice, severity of disease further increased on days 6 and 7 p.i. Thereafter, surviving mice recovered. A 45 times higher virus titer maximum in the lung than in the trachea on day 2 p.i. and significantly higher tracheal virus titers compared to lung on day 6 p.i. indicated changes in the organ tropism during infection. Sequence analysis revealed an HA-222D/G polymorphism. HA-D222 and HA-G222 variants co-circulated in lung and trachea. Whereas, HA-D222 variant predominated in the lung, HA-G222 became the major variant in the trachea after day 4 p.i. This was accompanied by lower neutralizing antibody titers and broader receptor recognition including terminal sialic acid α-2,3-linked galactose, which is abundant on mouse trachea epithelial cells. Plaque-purified HA-G222-mpJena/5258 virus induced severe influenza with maximum symptom on day 6 p.i. These results demonstrated for the first time that HA-222D/G quasispecies of A(H1N1pdm09 caused severe biphasic influenza because of fast viral intra-host evolution, which enabled partial antibody escape and minor changes in receptor binding.

  1. Radon 222 in drinking water resources of Iran: A systematic review, meta-analysis and probabilistic risk assessment (Monte Carlo simulation).

    Science.gov (United States)

    Keramati, Hassan; Ghorbani, Raheb; Fakhri, Yadolah; Mousavi Khaneghah, Amin; Conti, Gea Oliveri; Ferrante, Margherita; Ghaderpoori, Mansour; Taghavi, Mahmoud; Baninameh, Zahra; Bay, Abotaleb; Golaki, Mohammad; Moradi, Bigard

    2018-03-30

    The current study was performed to review the conducted studies regarding the concentration of radon 222 in the tap drinking water; furthermore, by estimation of ingestion and inhalation effective dose, the health risk assessment in the adults and children using MCS technique was assessed. All related studies published among January 1990 to October 2016; were screened in the available databases such as Web of Science, PubMed, Science Direct, Scopus, SID, and Irandoc. The total effective dose was estimated by calculating E ing (Effective dose of ingestion) and E inh (Effective dose of inhalation) by Monte Carlo simulation (MCS) method. The range of ND ─ 40.9 Bq/L for radon 222 in water resources was proposed after evaluation of data collected from 13 studies with 1079 samples. The overall concentration of radon 222 in drinking water in Iran was 3.98: 95%CI (3.79 ─ 4.17 Bq/L). Also, the effective ingestion dose of radon 222 in adults age groups was 1.35 times higher than children. The rank order of drinking water resources based on the concentration of radon 222 was Spring > Spring and Well > Well > Spring and Qanat > Tap water. The overall concentration of radon 222 in drinking water in Iran was lower than WHO and EPA standard limits. Also, the rank order regarding area studied based on the concentration of radon 222 was Gillan > Mashhad > Mazandaran > Kerman > Yazd > Tehran > Kermanshah > Golestan > Hormozgan. The effective ingestion dose of radon 222 to consumers in the Gillan, Mashhad, Mazandaran, and Kerman were higher than WHO guidance (0.1 mSv/y). Also except consumers in the Hormozgan, inhalation effective dose radon 222, in the other investigated areas were higher than WHO guidance (0.1 mSv/y). Therefore, it is recommended to conduct the required programs regarding control and elimination of radon 222 concentration in Iranian drinking water supply. Copyright © 2018 Elsevier Ltd. All rights reserved.

  2. Cloning and Expression of Plantaricin W Produced by Lactobacillus plantarum U10 Isolate from "Tempoyak" Indonesian Fermented Food as Immunity Protein in Lactococcus lactis.

    Science.gov (United States)

    Lages, Aksar Chair; Mustopa, Apon Zaenal; Sukmarini, Linda; Suharsono

    2015-10-01

    Plantaricins, one of bacteriocin produced by Lactobacillus plantarum, are already known to have activities against several pathogenic bacterium. L. plantarum U10 isolated from "tempoyak," an Indonesian fermented food, produced one kind of plantaricin designated as plantaricin W (plnW). The plnW is suggested as a putative membrane location of protein and has similar conserved motif which is important as immunity to bacteriocin itself. Thus, due to study about this plantaricin, several constructs have been cloned and protein was analyzed in Lactococcus lactis. In this study, plnW gene was successfully cloned into vector NICE system pNZ8148 and created the transformant named L. lactis NZ3900 pNZ8148-WU10. PlnW protein was 25.3 kDa in size. The concentration of expressed protein was significantly increased by 10 ng/mL nisin induction. Furthermore, PlnW exhibited protease activity with value of 2.22 ± 0.05 U/mL and specific activity about 1.65 ± 0.03 U/mg protein with 50 ng/mL nisin induction. Immunity study showed that the PlnW had immunity activity especially against plantaricin and rendered L. lactis recombinant an immunity broadly to other bacteriocins such as pediocin, fermentcin, and acidocin.

  3. Variations in radon-222 in soil and ground water at the Nevada Test Site

    International Nuclear Information System (INIS)

    Wollenberg, H.; Straume, T.; Smith, A.; King, C.Y.

    1977-01-01

    To help evaluate the applicability of variations of radon-222 in ground water and soil gas as a possible earthquake predictor, measurements were conducted in conjunction with underground explosions at the Nevada Test Site (NTS). Radon fluctuations in ground water have been observed during a sequence of aftershocks following the Oroville, California earthquake of 1 August 1975. The NTS measurements were designed to show if these fluctuations were in response to ground shaking; if not, they could be attributed to changes in earth strain prior to the aftershocks. Well waters were periodically sampled and soil-gas 222 Rn monitored prior to and following seven underground explosions of varying strength and distance from sampling and detector locations. Soil-gas 222 Rn contents were measured by the alpha-track method; well water 222 Rn by gamma-ray spectrometry. There was no clearly identifiable correlation between well-water radon fluctuations and individual underground tests. One prominent variation in soil-gas radon corresponded to ground shaking from a pair of underground tests in alluvium; otherwise, there was no apparent correlation between radon emanation and other explosions. Markedly lower soil-gas radon contents following the tests were probably caused by consolidation of alluvium in response to ground shaking

  4. [Assessment of progesterone levels on the day of the hCG administration as a predictor of success of antagonist stimulation protocols for IVF].

    Science.gov (United States)

    Kably-Ambe, Alberta; Roque-Sánchez, Armando Miguel; Soriano-Ortega, Karla Patricia; Carballo-Mondragón, Esperanza; Durán-Monterrosas, Leonor

    2015-03-01

    There are reports of deleterious effect when progesterone concentration is high during the follicular phase in cycles of in vitro fertilization. In our environment has not carried out a study to evaluate the pregnancy rate compared with progesterone concentration on the day of application of hCG. To evaluate the pregnancy rate and outcome of in vitro fertilization cycle according to serum progesterone concentration on the day of application of hCG. A retrospective, observational, cross-sectional study of 486 cycles of in vitro fertilization was done in the Centro Mexicano de Fertilidad of CEPAM (Hospital Angeles de las Lomas) from January 2009 to February 2014. We included all cases where it was used a stimulation protocol GnRH antagonist flexible scheme. When levels of progesterone are high, those of estradiol are also high and the number of retrieved oocytes and oocyte quality are lower. There was no difference in the percentage of fertilization, but at higher concentration of progesterone lower percentage of embryonic segmentation. Difference was recorded in the pregnancy rate only when progesterone concentration on the day of hCG application was > 4 ng/mL. Pregnancy rate decreases when the concentration of progesterone on the day of hCG application is ≥ 4 ng/mL.

  5. Oral Health, Temporomandibular Disorder, and Masticatory Performance in Patients with Charcot-Marie-Tooth Type 2

    Directory of Open Access Journals (Sweden)

    Rejane L. S. Rezende

    2013-01-01

    Full Text Available Background. The aim of this study was to evaluate the oral health status of temporomandibular disorders (TMD and bruxism, as well as to measure masticatory performance of subjects with Charcot-Marie-Tooth type 2 (CMT2. Methods and Results. The average number of decayed, missing, and filled teeth (DMFT for both groups, control (CG and CMT2, was considered low (CG = 2.46; CMT2 = 1.85, P=0.227. The OHIP-14 score was considered low (CG = 2.86, CMT2 = 5.83, P=0.899. The prevalence of self-reported TMD was 33.3% and 38.9% (P=0.718 in CG and CMT2 respectively and for self-reported bruxism was 4.8% (CG and 22.2% (CMT2, without significant difference between groups (P=0.162. The most common clinical sign of TMD was masseter (CG = 38.1%; CMT2 = 66.7% and temporalis (CG = 19.0%; GCMT2 = 33.3% muscle pain. The geometric mean diameter (GMD was not significantly different between groups (CG = 4369; CMT2 = 4627, P=0.157. Conclusion. We conclude that the CMT2 disease did not negatively have influence either on oral health status in the presence and severity of TMD and bruxism or on masticatory performance.

  6. Firmy rodzinne w Polsce w dobie globalizacji

    OpenAIRE

    Zalewska, Agnieszka

    2016-01-01

    Celem publikacji jest ukazanie dorobku naukowego, głównie polskich i ukraińskich uczonych, w zakresie uwarunkowań procesów i rezultatów internacjonalizacji przedsiębiorstw oraz jej wpływu na funkcjonowanie biznesu w dobie globalizacji. Opracowanie stanowi istotny wkład w zakresie teorii i praktyki w proces restrukturyzacji przedsiębiorstw w kierunku ich internacjonalizacji. Może posłużyć jako inspiracja do stworzenia strategii opartej na poszukiwaniach (prospector strategy), co będzie sprzyja...

  7. Lectures on W algebras and W gravity

    International Nuclear Information System (INIS)

    Pope, C.N.

    1992-01-01

    We give a review of the extended conformal algebras, known as W algebras, which contain currents of spins higher than 2 in addition to the energy-momentum tensor. These include the non-linear W N algebras; the linear W ∞ and W 1+∞ algebras; and their super-extensions. We discuss their applications to the construction of W-gravity and W-string theories. (author). 46 refs

  8. The GAS5/miR-222 Axis Regulates Proliferation of Gastric Cancer Cells Through the PTEN/Akt/mTOR Pathway.

    Science.gov (United States)

    Li, Yanhua; Gu, Junjiao; Lu, Hong

    2017-12-01

    Several lines of evidence have indicated that growth arrest-specific transcript 5 (GAS5) functions as a tumor suppressor and is aberrantly expressed in multiple cancers. GAS5 was found to be downregulated in gastric cancer (GC) tissues, and ectopic expression of GAS5 inhibited GC cell proliferation. The present study aimed to explore the underlying mechanisms of GAS5 involved in GC cell proliferation. GAS5 and miR-222 expressions in GC cell lines were estimated by quantitative real-time polymerase chain reaction. The effects of GAS5 and miR-222 on GC cell proliferation were assessed by MTT assay and 5-bromo-2-deoxyuridine (BrdU) incorporation assays. The interaction between GAS5 and miR-222 was confirmed by luciferase reporter assay and RNA immunoprecipitation assay. The protein levels of the phosphatase and tensin homolog (PTEN), phosphorylated protein kinase B (Akt) (p-Akt), Akt, phosphorylated mammalian target of rapamycin (mTOR) (p-mTOR), and mTOR were determined by western blot. GAS5 was downregulated and miR-222 was upregulated in GC cells. GAS5 directly targeted and suppressed miR-222 expression. GAS5 overexpression and miR-222 inhibition suppressed cell proliferation, increased PTEN protein level and decreased p-Akt and p-mTOR protein levels in GC cells while GAS5 knockdown and miR-222 overexpression exhibited the opposite effects. Moreover, mechanistic analyses revealed that GAS5 regulated GC cell proliferation through the PTEN/Akt/mTOR pathway by negatively regulating miR-222. GAS5/miR-222 axis regulated proliferation of GC cells through the PTEN/Akt/mTOR pathway, which facilitated the development of lncRNA-directed therapy against this deadly disease.

  9. Kinetics of ingested 222Rn in humans determined from measurements with 133Xe. Project summary report

    International Nuclear Information System (INIS)

    Correia, J.A.; Weise, S.B.; Callahan, R.J.; Strauss, H.W.

    1987-12-01

    The problem of naturally occurring 222-radon contamination has received a great deal of public and scientific attention over the past several years, and has become a major public health issue worldwide. The purpose of the work reported in this document was to provide information about the behavior of ingested 222-radon in the digestive system and other organs of the human body. 133-Xenon, an element which behaves in the same manner as 222-radon in tissue and differs only in tissue solubility, was used in studies on human subjects. The tissue solubility differences were accounted for by using the tissue/blood partition coefficients of the two gases

  10. Use of reduced doses of eCG applied by different routes in the TAI program in Santa Ines sheep

    Directory of Open Access Journals (Sweden)

    Karla Dias Antunes-Melo

    2015-06-01

    Full Text Available The aims of this study were to improve the cost-benefit ratio of the application of artificial insemination in fixed time (TAI by the transcervical route in sheep, to test the dosage reduction and the use of the vulvar submucosa (VSM route as an alternative for the application of equine chorionic gonadotropin (eCG on the efficiency of the synchronization protocol and fertility to artificial insemination (AI and to measure the level of cortisol in ewes as a result the application of this biotechnique. Blood samples were collected before AI, immediately after AI and seven days after AI. Six groups of twenty animals were used, and each group received doses of 200, 300 and 400 IU of eCG by the intramuscular route (IM and VSM. Estrus was detected, and 48 hours later, the inseminations were performed by the transcervical route. Among the 120 treated ewes, 87.5% came in estrus. The percentage of the intrauterine deposition of semen was 88.3%. The pregnancy rate ranged from 20 to 70% between treatments, with an average of 46.66%. The VSM route was viable for the application of eCG in doses of 300 and 400 IU. The reduction in the eCG dose to 200 IU by the IM route reduces costs while maintaining the efficiency of estrus synchronization protocols and TAI with frozen semen in Santa Ines ewes. The average levels of cortisol were significant, at 1.15, 2.86 and 0.52 ?g/dL according to the three collections, being higher after the animal was off the easel at the end of AI. The procedures for performing the transcervical AI technique indicate that stress in the animals produces satisfactory fertility results and a low cost in multiparous ewes of the Santa Ines breed.

  11. 29 CFR Appendix A to Subpart W to... - Figures W-14 through W-28

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 8 2010-07-01 2010-07-01 false Figures W-14 through W-28 A Appendix A to Subpart W to part 1926 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION...; Overhead Protection Pt. 1926, Subpt. W, App. A Appendix A to Subpart W to part 1926—Figures W-14 through W...

  12. Selected Abstracts of the 2nd Congress of joint European Neonatal Societies (jENS 2017; Venice (Italy; October 31-November 4, 2017; Session "Neonatal Gastrointestinal Physiology and NEC"

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2017-10-01

    Full Text Available Selected Abstracts of the 2nd Congress of joint European Neonatal Societies (jENS 2017; Venice (Italy; October 31-November 4, 201758th ESPR Annual Meeting, 7th International Congress of UENPS, 3rd International Congress of EFCNIORGANIZING INSTITUTIONSEuropean Society for Paediatric Research (ESPR, European Society for Neonatology (ESN, Union of European Neonatal & Perinatal Societies (UENPS, European Foundation for the Care of Newborn Infants (EFCNIORGANIZING COMMITTEELuc Zimmermann (President of ESPR, Morten Breindahl (President of ESN, Manuel Sánchez Luna (President of UENPS, Silke Mader (Chairwoman of the Executive Board and Co-Founder of EFCNISCIENTIFIC COMMITTEEVirgilio P. Carnielli (Congress President Chair, Pierre Gressens (Past Scientific President, Umberto Simeoni, Manon Benders, Neil Marlow, Ola D. Saugstad, Petra Hüppi, Agnes van den HoogenSession "Neonatal Gastrointestinal Physiology and NEC"ABS 1. DETRIMENTAL MUCOSAL EFFECT OF IBUPROFEN IN THE IMMATURE HUMAN INTESTINE • E. Tremblay, E. Ferretti, M.-P. Thibault, D. Grynspan, K.M. Burghardt, M. Bettolli, C. Babakissa, E. Levy, J.-F. Beaulieu; Research Consortium on Child Intestinal InflammationABS 2. CORRELATION BETWEEN CALPROTECTIN LEVELS IN MECONIUM AND VITAMIN D STATUS IN CORD BLOOD: ASSOCIATION WITH INTESTINAL DISTRESS DURING NEONATAL PERIOD • S.H. Park, W.H. Kim, Y.M. LeeABS 3. COMPARISON OF FECAL CALPROTECTIN LEVELS ACCORDING TO FEEDING KINDS IN VERY PRETERM INFANTS • J.H. Park, N.H. Lee, S.Y. Shin, C.S. Kim, S.L. Lee, W.M. LeeABS 4. NEONATAL MORBIDITY OF EXTREME PRETERM INFANTS BEFORE AND AFTER THE INTRODUCTION OF A DONOR HUMAN MILK BANK AT THE PERINATAL CENTER GROßHADERN • V. Lieftüchter, M. Kujawa, A. Schuze, A.W. Flemmer, S. Herber-JonatABS 5. IS NEAR INFRARED SPECTROSCOPY A RELIABLE TECHNIQUE TO MEASURE GUT PERFUSION IN PRETERM INFANTS? • J. Banerjee, T.S. Leung, N. AladangadyABS 6. EARLY BIOCHEMICAL MARKERS ASSOCIATED WITH DEVELOPMENT OF NECROTIZING

  13. An open-label clinical trial to investigate the efficacy and safety of corifollitropin alfa combined with hCG in adult men with hypogonadotropic hypogonadism.

    Science.gov (United States)

    Nieschlag, Eberhard; Bouloux, Pierre-Marc G; Stegmann, Barbara J; Shankar, R Ravi; Guan, Yanfen; Tzontcheva, Anjela; McCrary Sisk, Christine; Behre, Hermann M

    2017-03-07

    Hypogonadotropic hypogonadism (HH) in men results in insufficient testicular function and deficiencies in testosterone and spermatogenesis. Combinations of human chorionic gonadotropin (hCG) and recombinant follicle-stimulating hormone (recFSH) have been successful in the treatment of HH. Corifollitropin alfa is a long-acting FSH-analog with demonstrated action in women seeking infertility care. The aim of this study was to investigate the efficacy and safety of corifollitropin alfa combined with hCG to increase testicular volume and induce spermatogenesis in men with HH. This was a Phase III, multi-center, open-label, single-arm trial of corifollitropin alfa in azoospermic men aged 18 to 50 years with HH. After 16 weeks of pretreatment of 23 subjects with hCG alone, 18 subjects with normalized testosterone (T) levels who remained azoospermic entered the 52-week combined treatment phase with hCG twice-weekly and 150 μg corifollitropin alfa every other week. The increase in testicular volume (primary efficacy endpoint) and induction of spermatogenesis resulting in a sperm count ≥1 × 10 6 /mL (key secondary efficacy endpoint) during 52 weeks of combined treatment were assessed. Safety was evaluated by the presence of anti-corifollitropin alfa antibodies and the occurrence of adverse events (AEs). Mean (±SD) testicular volume increased from 8.6 (±6.09) mL to 17.8 (±8.93) mL (geometric mean fold increase, 2.30 [95% CI: 2.03, 2.62]); 14 (77.8%) subjects reached a sperm count ≥1 × 10 6 /mL. No subject developed confirmed anti-corifollitropin alfa antibodies during the trial. Treatment was generally well tolerated. Corifollitropin alfa 150 μg administrated every other week combined with twice-weekly hCG for 52 weeks increased testicular volume significantly, and induced spermatogenesis in >75% of men with HH who had remained azoospermic after hCG treatment alone. ClinicalTrials.gov: NCT01709331 .

  14. GETDB: 112612 [GETDB

    Lifescience Database Archive (English)

    Full Text Available 112612 Link to Original y[*] w[*]; P{GawB}NP1294 / TM6, P{UAS-lacZ.UW23-1}UW23-1 --...- Link to DGRC Genome Viewer: 112612 CG40182 CG40188 1294 3 NP line. Received from the National Institute of... sg, tr abdomen - - - - - - - Show 112612 DGRC Number 112612 Link to Original Gen...otype y[*] w[*]; P{GawB}NP1294 / TM6, P{UAS-lacZ.UW23-1}UW23-1 Insertion Site --- Map Viewer Link to DGRC Genome Viewer: 112612... Related Genes CG40182 CG40188 Original Number 1294 Chr. 3 Comments NP line. Received fro

  15. Hanford Facility Dangerous Waste Permit Application, 222-S Laboratory Complex

    International Nuclear Information System (INIS)

    WILLIAMS, J.F.

    2000-01-01

    The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, operating treatment, storage, and/or disposal units, such as the 222-S Laboratory Complex (this document, DOE/RL-91-27). Both the General Information and Unit-Specific portions of the Hanford Facility Dangerous Waste Permit Application address the content of the Part B permit application guidance prepared by the Washington State Department of Ecology (Ecology 1987 and 1996) and the U.S. Environmental Protection Agency (40 Code of Federal Regulations 270), with additional information needs defined by the Hazardous and Solid Waste Amendments and revisions of Washington Administrative Code 173-303. For ease of reference, the Washington State Department of Ecology alpha-numeric section identifiers from the permit application guidance documentation (Ecology 1996) follow, in brackets, the chapter headings and subheadings. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Wherever appropriate, the 222-S Laboratory Complex permit application documentation makes cross-reference to the General Information Portion, rather than duplicating text. Information provided in this 222-S Laboratory Complex permit application documentation is current as of August 2000

  16. Tracing submarine groundwater discharge in the NE Gulf of Mexico by 222Rn

    International Nuclear Information System (INIS)

    Young, J.E.; Burnett, W.C.; Chanton, J.P.; Cable, P.H.; Corbett, D.R.

    1993-01-01

    Inputs of freshwater and dissolved components to the ocean by submarine groundwater discharge (SGD) have been largely neglected as source functions for biogeochemical budgets. In order to locate and quantify groundwater inputs, a tracing technique has been developed using 222 Rn, a member of the natural 238 U decay-series. Because 222 Rn has a short half-life (t 1/2 = 3.84 days), is an inert gas, is relatively easy to measure at low concentrations, and has concentrations in groundwater several orders of magnitude greater than seawater, it should make an excellent tracer. Excess 222 Rn concentrations far above ''normal'' ocean values were found in the bottom waters of the northeastern Gulf of Mexico, which suggests this region has significant groundwater discharge. After measuring high water column inventories of excess 222 Rn in this region, an advection/diffusion model was applied to evaluate potential benthic sources of radon. The model is designed to account for sediment diffusion of radon and includes a groundwater term for advective flow into the overlying water. Flow rates and concentrations are adjusted in the model to balance the large difference in the measured water column inventories and the inventory predicted by sediment diffusion alone. The vertical diffusive/advective transport determines the shape of the concentration gradient and fluxes at the sediment-water interface are calculate based on these terms. The authors work shows that SGD could account for as much as 95% of the radon inventory in these offshore waters

  17. Calibration of a degassing-emanation line for 222Rn determination in seawater samples

    International Nuclear Information System (INIS)

    Farias, Luciana Aparecida

    2002-01-01

    The purpose of this study is to calibrate a degassing-emanation line and to determine 222 Rn and 226 Ra activity concentrations in seawater samples. This methodology, also called Lucas method, consists in the extraction of radon (originally dissolved in seawater), collection of the gas in a liquid nitrogen cold trap and transfer from the trap to an alpha scintillation cell. Total extraction efficiencies of the 4 degassing-emanation systems were determined by measuring 226 Ra reference solutions. The efficiencies obtained for these 4 systems varied from 21 % to 62%. This work also presents preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil: Flamengo Bay, Fortaleza Bay, Mar Virado Bay and Ubatuba Bay. Concentration of Rn in excess varied from 0,011 to 0,317 Bq/L for Flamengo Bay, from 0,009 to 0,130 Bq/L for Fortaleza Bay, from 0,018 to 0,050 Bq/L for Mar Virado Bay and from 0,004 to 0,120 Bq/L for Ubatuba Bay. The results obtained for the concentration of 222 Rn in excess in a transect at Flamengo Bay varied from 0,002 to 0,036 Bq/L. Higher concentrations of 222 Rn in excess were obtained in Flamengo Bay, Fortaleza Bay and Ubatuba bay. It was also observed that the concentration of 222 Rn in excess increases with depth, as expected. (author)

  18. The first photometric investigation and orbital period variation analysis of the W UMa type binary IK Bootis

    Science.gov (United States)

    Kriwattanawong, Wichean; Sanguansak, Nuanwan; Maungkorn, Sakdawoot

    2017-08-01

    With new CCD observations of the W UMa type binary IK Boo, we present the first investigation of photometric parameters and orbital period change. The BVRc light curve fit shows that IK Boo is a W-type contact system with a mass ratio of q = 1.146 and a shallow contact with a fill-out factor of f = 2.22%. The orbital period decrease was found to be a rate of -3.28 × 10-7 d yr-1, corresponding to a mass transfer from the more massive to the less massive component with a rate of -2.83 × 10-6 M⊙ yr-1. The inner and outer critical Roche lobes will contract and cause the contact degree to increase. Therefore, IK Boo may evolve into a deeper contact system. Furthermore, a possible cyclic variation was found with a period of 9.74 yr, which could be explained by the light-travel time effect due to the existence of a third companion in the system.

  19. Seasonal and spatial variations in Rn-222 and Rn-220 in soil gas, and implications for indoor radon levels

    International Nuclear Information System (INIS)

    Sharman, G.

    1992-01-01

    Rn-222 enters dwellings as a component of soil gas drawn from the soil by mass flow driven by the pressure difference between the house and soil beneath. In a site on Northampton Sand Ironstone (Aalenian), a preferred path of emanation (hotspot) was found. A difference of 63 Bq L -1 Rn-222 was recorded in July between this point and another 3 m away. Rn-222 in this hotspot shows 12% less variation annually than the surrounding rock. During winter, Rn-222 values within 1.6 m of the house were 44% lower than those at more than 4 m away. Rn-222 showed a 99.5% negative correlation with wind run, showing that on this soil wind pressure can significantly reduce radon in the soil at 500 mm depth. Rn-220 in soil gas correlated positively at the 99.5% level with grass and air temperatures. Rn-220 was not associated with the hotspot. (Author)

  20. Design and construction of a system to analyze Radon 222 by means of alpha spectroscopy

    International Nuclear Information System (INIS)

    Martinez, J.B.

    1991-01-01

    Design and construction of a system to measure gaseous Radon 222 which arise from a source of Radium 226 electrodeposited in a stainless disc is described. Such a system allows to differentiate the energies of radium where they come from, as well as energies of daughter products. In this way it is possible to have a more precise measure of the alpha activity of this isotope. The system was constructed in a stainless steel hermetic container made of the camera, a cape and a valve, the used sample was a standards of Radium 226 attained from carnotite ore. The Radon 222 alpha particles, as well as the alpha particles of its decay products namely Polonium 210. Polonium 218 and Polonium 214 were identified by a surface barrier detector. The results in this manner obtained shows clearly well definite peaks of Radon 222 and also peaks of the Radon 222 daughter products with energies of 5.43, 5.31, 6.0 and 7.69 Mev respectively. The system allows to separate and to indentify the energies of Radon and its daughter products coming directly from a standard solid sample of Radium 226 (Author)

  1. Hafty w sztambuchach Biblioteki Uniwersyteckiej w Poznaniu

    Directory of Open Access Journals (Sweden)

    Karolina Nowaczyk

    2011-01-01

    Full Text Available W artykule przedstawiono hafty znajdujące się w sztambuchach z XVIII i XIX wieku pochodzących ze zbiorów Biblioteki Uniwersyteckiej w Poznaniu. Omówione zostały zarówno technika wykonania haftów, jak i ich wartość artystyczna, a także znaczenie wskazanych przykładów dla historii hafciarstwa amatorskiego na ziemiach polskich. Artykuł jest jednocześnie próbą zwrócenia uwagi na istniejącą w tamtym okresie sztukę hafciarską o wyłącznie amatorskim charakterze oraz na kopiowanie i powtarzalność wzorów, co pozwala na określenie ich jako typowych dla danej epoki.

  2. Calibration of a degassing-emanation line for 222Rn determination in seawater samples; Calibracao de uma linha de emanacao para determinacao de {sup 222}Rn em amostras de agua do mar

    Energy Technology Data Exchange (ETDEWEB)

    Farias, Luciana Aparecida

    2002-07-01

    The purpose of this study is to calibrate a degassing-emanation line and to determine {sup 222}Rn and {sup 226}Ra activity concentrations in seawater samples. This methodology, also called Lucas method, consists in the extraction of radon (originally dissolved in seawater), collection of the gas in a liquid nitrogen cold trap and transfer from the trap to an alpha scintillation cell. Total extraction efficiencies of the 4 degassing-emanation systems were determined by measuring {sup 226}Ra reference solutions. The efficiencies obtained for these 4 systems varied from 21 % to 62%. This work also presents preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil: Flamengo Bay, Fortaleza Bay, Mar Virado Bay and Ubatuba Bay. Concentration of Rn in excess varied from 0,011 to 0,317 Bq/L for Flamengo Bay, from 0,009 to 0,130 Bq/L for Fortaleza Bay, from 0,018 to 0,050 Bq/L for Mar Virado Bay and from 0,004 to 0,120 Bq/L for Ubatuba Bay. The results obtained for the concentration of {sup 222}Rn in excess in a transect at Flamengo Bay varied from 0,002 to 0,036 Bq/L. Higher concentrations of {sup 222}Rn in excess were obtained in Flamengo Bay, Fortaleza Bay and Ubatuba bay. It was also observed that the concentration of {sup 222}Rn in excess increases with depth, as expected. (author)

  3. 20 CFR 222.54 - When a legally adopted child is dependent-grandchild or stepgrandchild adopted after entitlement.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-grandchild or stepgrandchild adopted after entitlement. 222.54 Section 222.54 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and...

  4. 48 CFR 52.222-8 - Payrolls and Basic Records.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Payrolls and Basic Records....222-8 Payrolls and Basic Records. As prescribed in 22.407(a), insert the following clause: Payment for Overtime Premiums (JUN 2010) (a) Payrolls and basic records relating thereto shall be maintained by the...

  5. Occurrence of 222Rn and progeny in natural gas processing plants in western Canada

    International Nuclear Information System (INIS)

    Drummond, I.; Boucher, P.; Bradford, B.; Evans, H.; McLean, J.; Reczek, E.; Thunem, H.

    1990-01-01

    In Western Canada, there are many plants that process natural gas to remove impurities (CO 2 , H 2 S, H 2 O) and recover natural gas liquids (propane, butane, etc.). Trace quantities of 222 Rn present in the inlet stream are concentrated in streams rich with propane. Potential hazards to plant operators include direct inhalation of 222 Rn and progeny; exposure to gamma radiation from short-lived progeny deposited inside equipment; or inhalation of 210 Pb when contaminated equipment is opened for repair. Twenty-four plants operated by seven companies cooperated to assess these potential hazards. The findings indicate a substantial flux of 222 Rn and progeny passing through the plants, but little accumulation of radionuclides. In no case was there evidence of significant exposure of plant operators or maintenance personnel to ionizing radiation. Further investigation of pipeline operations, and chemical operations using natural gas liquids as feed stock, is recommended

  6. A multi-detector continuous monitor for assessment of 222Rn in the coastal ocean

    International Nuclear Information System (INIS)

    Dulaiova, H.; Peterson, R.; Burnett, W.C.

    2005-01-01

    Radon-222 is a good natural tracer of groundwater discharge and other physical processes in the coastal ocean. Unfortunately, its usefulness is limited by the time consuming nature of collecting individual samples and traditional analysis schemes. An automated multi-detector system is demonstrated that can be used in a continuous survey basis to assess radon activities in coastal ocean waters. The system analyses 222 Rn from a constant stream of water delivered by a submersible pump to an air-water exchanger where radon in the water phase equilibrates with radon in a closed air loop. The air stream is fed to 3 commercial radon-in-air monitors connected in parallel to determine the activity of 222 Rn. By running the detectors out of phase, it is possible to obtain as many as 6 readings per hour with a precision of approximately ±5-15% for typical coastal seawater concentrations. (author)

  7. 222-S Laboratory Quality Assurance Plan. Revision 1

    International Nuclear Information System (INIS)

    Meznarich, H.K.

    1995-01-01

    This Quality Assurance Plan provides,quality assurance (QA) guidance, regulatory QA requirements (e.g., 10 CFR 830.120), and quality control (QC) specifications for analytical service. This document follows the U.S Department of Energy (DOE) issued Hanford Analytical Services Quality Assurance Plan (HASQAP). In addition, this document meets the objectives of the Quality Assurance Program provided in the WHC-CM-4-2, Section 2.1. Quality assurance elements required in the Guidelines and Specifications for Preparing Quality Assurance Program Plans (QAMS-004) and Interim Guidelines and Specifications for Preparing Quality Assurance Project Plans (QAMS-005) from the US Environmental Protection Agency (EPA) are covered throughout this document. A quality assurance index is provided in the Appendix A. This document also provides and/or identifies the procedural information that governs laboratory operations. The personnel of the 222-S Laboratory and the Standards Laboratory including managers, analysts, QA/QC staff, auditors, and support staff shall use this document as guidance and instructions for their operational and quality assurance activities. Other organizations that conduct activities described in this document for the 222-S Laboratory shall follow this QA/QC document

  8. Thoron (RN-220) interference in the determination of RN-222 exhalation rate of soils

    Energy Technology Data Exchange (ETDEWEB)

    Amaral, Déric S.; Farias, Emerson E.G.; Santos, Mariana L.O.; Silva, Karolayne E.M.; Hazin, Clovis A.; França, Elvis J., E-mail: emersonemiliano@yahoo.com [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Souza Neto, João A., E-mail: adauto@ufpe.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Geologia

    2017-07-01

    The transport of Rn-222 from the soil to the atmosphere known as exhalation is influenced by meteorological conditions and soil geophysical parameters. In closed and poorly ventilated rooms, this radioactive gas can reach high activity concentrations, in which the energy of alpha particles released by this radionuclide and its progeny is the second leading cause of lung cancer. Soil exhalation rate is an important parameter for assessing human health risks associated with radon. For radon determination using an exhalation chamber, an ionization chamber detector is used to count the electrical pulses generated by the interaction between the alpha particles produced by Rn-222 and its progeny and the air inside the chamber. In this work, the interference of thoron (Rn-220) in the determination of soil exhalation rate of Rn-222 was studied. For this, the RadonBOX exhalation chamber and the AlphaGuard ionization chamber detector were utilized for analyzing the same soil during two hours on different days under similar meteorological conditions. From zero up to approximately 2,400 s, the radon activity concentrations decreased. After 40 minutes, the radon concentrations started to increase, thereby allowing the calculation of soil exhalation rate. This initial decreasing could be explained by a high Rn-220 than Rn-222 presence in the soil, in which, because of its short half-life, after 40 minutes, most thoron present in the chamber has undergone so that the main alpha emitter become Rn-222. In order to confirm this, Rn-220 activity was estimated by the Ra-228 concentration in the soil determined after 30 days using High Resolution Gamma-Ray Spectrometry with HPGe detectors. Therefore, the thoron interference in the determination of soil radon exhalation rate was considered negligible after 40 minutes of measurement time for the analyzed soil. (author)

  9. Observation of W associated single top (tW) production and search for FCNC in tZ events in proton-proton collisions

    CERN Document Server

    Benelli, Gabriele

    2013-01-01

    The first observation of the associated production of a single top quark and a $W$ boson in proton-proton collisions at $\\sqrt{s}$ = 8 TeV with the CMS experiment at the LHC is presented. The data correspond to an integrated luminosity of 12.2 $\\mathrm{fb^{-1}}$. The measurement is performed using events with two leptons and a jet originated from a b quark. A multivariate analysis based on kinematic properties is used to separate the signal from the $t\\bar{t}$ background. The signal is observed with a 6.0 standard deviation excess above a background only hypothesis.A production cross section of $23.4^{+5.5}_{-5.4}$ pb is measured, in agreement with the standard model expectation of $22.2\\pm1.5$ pb.\\\\A study of top-quark anomalous couplings is performed through the search for a single top-quark produced in association with a $Z$ boson. The event selection requires the presence of three isolated leptons, electrons or muons, and of at least one jet. The signal extraction is done using kinematic variables and i...

  10. The steroid response to human chorionic gonadotropin (hCG) stimulation in men with Klinefelter syndrome does not change using immunoassay or mass spectrometry.

    Science.gov (United States)

    Roli, L; Santi, D; Belli, S; Tagliavini, S; Cavalieri, S; De Santis, M C; Baraldi, E; Fanelli, F; Mezzullo, M; Granata, A R; Pagotto, U; Pasquali, R; Rochira, V; Carani, C; Simoni, M; Trenti, T

    2017-08-01

    Liquid-chromatography tandem mass-spectrometry (LC-MS/MS) was developed in parallel to Immunoassays (IAs) and today is proposed as the "gold standard" for steroid assays. Leydig cells of men with Klinefelter syndrome (KS) are able to respond to human chorionic gonadotropin (hCG) stimulation, even if testosterone (T) production was impaired. The aim was to evaluate how results obtained by IAs and LC-MS/MS can differently impact on the outcome of a clinical research on gonadal steroidogenesis after hCG stimulation. A longitudinal, prospective, case-control clinical trial. (clinicaltrial.gov NCT02788136) was carried out, enrolling KS men and healthy age-matched controls, stimulated by hCG administration. Serum steroids were evaluated at baseline and for 5 days after intramuscular injection of 5000 IU hCG using both IAs and LC-MS/MS. 13 KS patients (36 ± 9 years) not receiving T replacement therapy and 14 controls (32 ± 8 years) were enrolled. T, progesterone, cortisol, 17-hydroxy-progesterone (17OHP) and androstenedione, were significantly higher using IAs than LC-MS/MS. IAs and LC-MS/MS showed direct correlation for all five steroids, although the constant overestimation detected by IAs. Either methodology found the same 17OHP and T increasing profile after hCG stimulation, with equal areas under the curves (AUCs). Although a linearity between IA and LC-MS/MS is demonstrated, LC-MS/MS is more sensitive and accurate, whereas IA shows a constant overestimation of sex steroid levels. This result suggests the need of reference intervals built on the specific assay. This fundamental difference between these two methodologies opens a deep reconsideration of what is needed to improve the accuracy of steroid hormone assays.

  11. 48 CFR 852.222-70 - Contract Work Hours and Safety Standards Act-nursing home care contract supplement.

    Science.gov (United States)

    2010-10-01

    ... Safety Standards Act-nursing home care contract supplement. 852.222-70 Section 852.222-70 Federal...—nursing home care contract supplement. As prescribed in 822.305, for nursing home care requirements, insert the following clause: Contract Work Hours and Safety Standards Act—Nursing Home Care Contract...

  12. The HELLP syndrome : Its association with unexplained elevation of MSAFP and MShCG in the second trimester

    NARCIS (Netherlands)

    Morssink, LP; Heringa, MP; Beekhuis, [No Value; DeWolf, BTHM; Mantingh, A

    In this study, we examined the relationship between concentrations of maternal serum alpha-fetoprotein (MSAFP) and maternal serum human chorionic gonadotropin (MShCG) in the second trimester and the 'haemolysis, elevated liver enzymes, low platelet count' (HELLP) syndrome. The concentrations of both

  13. Contribution of 222Rn-bearing water to indoor radon and indoor air quality assessment in hot spring hotels of Guangdong, China

    International Nuclear Information System (INIS)

    Song Gang; Wang Xinming; Chen Diyun; Chen Yongheng

    2011-01-01

    This study investigates the contribution of radon ( 222 Rn)-bearing water to indoor 222 Rn in thermal baths. The 222 Rn concentrations in air were monitored in the bathroom and the bedroom. Particulate matter (PM, both PM 10 and PM 2.5 ) and carbon dioxide (CO 2 ) were also monitored with portable analyzers. The bathrooms were supplied with hot spring water containing 66-260 kBq m -3 of 222 Rn. The results show that the spray of hot spring water from the bath spouts is the dominant mechanism by which 222 Rn is released into the air of the bathroom, and then it diffuses into the bedroom. Average 222 Rn level was 110-410% higher in the bedrooms and 510-1200% higher in the bathrooms compared to the corresponding average levels when there was no use of hot spring water. The indoor 222 Rn levels were influenced by the 222 Rn concentrations in the hot spring water and the bathing times. The average 222 Rn transfer coefficients from water to air were 6.2 x 10 -4 -4.1 x 10 -3 . The 24-h average levels of CO 2 and PM 10 in the hotel rooms were 89% and 22% higher than the present Indoor Air Quality (IAQ) standard of China. The main particle pollutant in the hotel rooms was PM 2.5 . Radon and PM 10 levels in some hotel rooms were at much higher concentrations than guideline levels, and thus the potential health risks to tourists and especially to the hotel workers should be of great concern, and measures should be taken to lower inhalation exposure to these air pollutants. - Highlights: → 222 Rn-bearing water is the main contributor to indoor radon in hot spring hotel. → The PM 2.5 and CO 2 are also the main indoor pollutants in the hotel rooms. → Higher radon and PM levels might have significant negative health effects to human. → The radon transfer coefficients are consistent with the published data.

  14. 12 CFR 222.28 - Effective date, compliance date, and prospective application.

    Science.gov (United States)

    2010-01-01

    ... GOVERNORS OF THE FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.28... using eligibility information that you receive from an affiliate to make solicitations to a consumer if...

  15. 48 CFR 52.222-16 - Approval of Wage Rates.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Approval of Wage Rates. 52....222-16 Approval of Wage Rates. As prescribed in 22.407(b), insert the following clause: Approval of Wage Rates (FEB 1988) All straight time wage rates, and overtime rates based thereon, for laborers and...

  16. 12 CFR 222.26 - Delivery of opt-out notices.

    Science.gov (United States)

    2010-01-01

    ... SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.26 Delivery of opt-out notices. (a... the affiliate providing the notice; or (4) Posts the notice on the Internet Web site at which the... affiliate providing the notice; or (3) Posts the notice on an Internet Web site without requiring the...

  17. Seasonal variations of 222Rn and SGD fluxes to Ubatuba embayments, Sao Paulo

    International Nuclear Information System (INIS)

    Oliveira, J.; Costa, P.; Braga, E.S.

    2006-01-01

    We describe here an application of excess 222 Rn to estimate submarine groundwater discharge in a series of small embayments of Ubatuba, Sao Paulo State, Brazil. Excess 222 Rn inventories obtained in 11 vertical profiles varied from (3.3±1.1) x 10 3 to (19±5) x 10 3 dpm x m -2 . The estimated total fluxes required to support the inventories varied from (0.6±0.2) x 10 3 to (3.4±0.9) x 10 3 dpm x m -2 x d -1 . Considering these results, the submarine groundwater discharge advective rates necessary to balance the sub-pycnocline fluxes calculated in Ubatuba embayments ranged from 0.06 to 1.9 cm x d -1 . During the period of this investigation (from March/03 to May/2004), the highest 222 Rn in excess inventories were observed late in the summer season (March). Taking into account all vertical profiles established, the relative variability was 67%. Although, if we consider only the fluxes determined in both Flamengo and Fortaleza embayments, the relative variation was 21%. (author)

  18. Time series analysis of soil Radon-222 recorded at Kutch region, Gujarat, India

    International Nuclear Information System (INIS)

    Madhusudan Rao, K.; Rastogi, B.K.; Barman, Chiranjib; Chaudhuri, Hirok

    2013-01-01

    Kutch region in Gujarat lies in a seismic vulnerable zone (seismic zone-v). After the devastating Bhuj earthquake (7.7M) of January 26, 2001 in the Kutch region several researcher focused their attention to monitor geophysical and geochemical precursors for earthquakes in the region. In order to find out the possible geochemical precursory signals for earthquake events, we monitored radioactive gas radon-222 in sub surface soil gas at Kutch region. We have analysed the recorded soil radon-222 time series by means of nonlinear techniques such as FFT power spectral analysis, empirical mode decomposition, multi-fractal analysis along with other linear statistical methods. Some fascinating and fruitful results originated out the nonlinear analysis of the said time series have been discussed in the present paper. The entire analytical method aided us to recognize the nature and pattern of soil radon-222 emanation process. Moreover the recording and statistical and non-linear analysis of soil radon data at Kutch region will assist us to understand the preparation phase of an imminent seismic event in the region. (author)

  19. Transcobalamin 776C-->G polymorphism is associated with peripheral neuropathy in elderly with high folate intake

    Science.gov (United States)

    Background: The 776C-->G polymorphism of the vitamin B-12 transport protein transcobalamin gene (TCN2) (rs1801198; Pro259Arg) is associated with a lower holotranscobalamin concentration in plasma. This effect may reduce the availability of vitamin B-12 to tissues even when vitamin B-12 intake is ade...

  20. Ekspansja muzeów w Europie Środkowej?

    Directory of Open Access Journals (Sweden)

    Jagodzińska, Katarzyna

    2015-06-01

    Full Text Available Przedmiotem artykułu są rozważania na temat specyfiki Europy Środkowej w zakresie kolekcji i muzeów sztuki współczesnej oraz możliwość stworzenia alternatywy regionalnej dla krajów zachodnich. Kontekstem dla tych rozważań jest ekspansjonistyczna polityka współczesnych muzeów, która w związku z licznymi nowymi inwestycjami – w szczególności Luwru, Fundacji Guggenheima, Ermitażu – budzi w świecie muzeologicznym różnorakie dylematy. Autorka omawia światowe "marki muzealne" inwestujące w Europie Środkowej, zastanawia się nad skutkami ekspansji tych "koncernów" dla kultury w regionie, wskazuje też na potencjał regionu, który można wykorzystać bez posiłkowania się nazwiskami światowych kolekcjonerów.