DEFF Research Database (Denmark)
Hansen, Karina K; Hauser, Frank; Cazzamali, Giuseppe
2006-01-01
Cockroaches have long been used as insect models to investigate the actions of biologically active neuropeptides. Here, we describe the cloning and functional expression in Chinese hamster ovary cells of an adipokinetic hormone (AKH) G protein-coupled receptor from the cockroach Periplaneta...... americana. This receptor is only activated by various insect AKHs (we tested eight) and not by a library of 29 other insect or invertebrate neuropeptides and nine biogenic amines. Periplaneta has two intrinsic AKHs, Pea-AKH-1, and Pea-AKH-2. The Periplaneta AKH receptor is activated by low concentrations...... of both Pea-AKH-1 (EC50, 5 x 10(-9)M), and Pea-AKH-2 (EC50, 2 x 10(-9)M). Insects can be subdivided into two evolutionary lineages, holometabola (insects with a complete metamorphosis during development) and hemimetabola (incomplete metamorphosis). This paper describes the first AKH receptor from...
Karp, R D; Meade, C C
1993-01-01
The results from several previous studies have indicated that the American cockroach is able to respond to integumentary xenografts, but doubt remained as to whether cockroaches could effectively discriminate between self and allogeneic differences. This was emphasized by the fact that while one study reported that Periplaneta americana responded to grafts donated by the closely related genus Blatta orientalis, the data reported elsewhere, using a different assay system, found no such reactivity. Since we have subsequently reported, using a direct histological assay, that Periplaneta can in fact recognize and destroy integumentary allografts, we initiated a study to hopefully sort out the enigma presented by previous data using Blatta as a transplant donor. Integument from Blatta orientalis was transplanted orthotopically onto Periplaneta americana, and at various time points post-transplant, scored histologically for the survival of the subcuticular epidermal layer. The results clearly demonstrated that Periplaneta reacted to the Blatta tissue, because approximately 82% of the grafts had the epidermal layer destroyed by day 7 posttransplant. The kinetics of the response to Blatta was more in line with our allograft data, which would be in agreement with other work indicating that the closer the donor and recipient are on the phylogenetic tree, the less intense the reactivity to the foreign transplant.
Tinker, Kara A; Ottesen, Elizabeth A
2016-11-15
The omnivorous cockroach Periplaneta americana hosts a diverse hindgut microbiota encompassing hundreds of microbial species. In this study, we used 16S rRNA gene sequencing to examine the effect of diet on the composition of the P. americana hindgut microbial community. Results show that the hindgut microbiota of P. americana exhibit a highly stable core microbial community with low variance in compositions between individuals and minimal community change in response to dietary shifts. This core hindgut microbiome is shared between laboratory-hosted and wild-caught individuals, although wild-caught specimens exhibited a higher diversity of low-abundance microbes that were lost following extended cultivation under laboratory conditions. This taxonomic stability strongly contrasts with observations of the gut microbiota of mammals, which have been shown to be highly responsive to dietary change. A comparison of P. americana hindgut samples with human fecal samples indicated that the cockroach hindgut community exhibited higher alpha diversity but a substantially lower beta diversity than the human gut microbiome. This suggests that cockroaches have evolved unique mechanisms for establishing and maintaining a diverse and stable core microbiome. The gut microbiome plays an important role in the overall health of its host. A healthy gut microbiota typically assists with defense against pathogens and the digestion and absorption of nutrients from food, while dysbiosis of the gut microbiota has been associated with reduced health. In this study, we examined the composition and stability of the gut microbiota from the omnivorous cockroach Periplaneta americana. We found that P. americana hosts a diverse core gut microbiome that remains stable after drastic long-term changes in diet. While other insects, notably ant and bee species, have evolved mechanisms for maintaining a stable association with specific gut microbiota, these insects typically host low-diversity gut
amylase from cockroach, Periplaneta americana
African Journals Online (AJOL)
STORAGESEVER
2008-08-04
Aug 4, 2008 ... The enzyme was stable up to 55°C and its pH stability was in range of 5.6 - 6.6. .... acrylamide gel and by gel filtration chromatography. Gel filtration .... Activity at 55 °C. Figure 8. Thermic inactivation at 37°C and 55°C of Periplaneta americana α-amylase. Thermal stability of the enzyme was followed for 1 h.
Ayayee, Paul A; Larsen, Thomas; Sabree, Zakee
2016-01-01
Insect gut microbes have been shown to provide nutrients such as essential amino acids (EAAs) to their hosts. How this symbiotic nutrient provisioning tracks with the host's demand is not well understood. In this study, we investigated microbial essential amino acid (EAA) provisioning in omnivorous American cockroaches (Periplaneta americana), fed low-quality (LQD) and comparatively higher-quality dog food (DF) diets using carbon stable isotope ratios of EAAs (δ (13)CEAA). We assessed non-dietary EAA input, quantified as isotopic offsets (Δ(13)C) between cockroach (δ (13)CCockroach EAA) and dietary (δ (13)CDietary EAA) EAAs, and subsequently determined biosynthetic origins of non-dietary EAAs in cockroaches using (13)C-fingerprinting with dietary and representative bacterial and fungal δ (13)CEAA. Investigation of biosynthetic origins of de novo non-dietary EAAs indicated bacterial origins of EAA in cockroach appendage samples, and a mixture of fungal and bacterial EAA origins in gut filtrate samples for both LQD and DF-fed groups. We attribute the bacteria-derived EAAs in cockroach appendages to provisioning by the fat body residing obligate endosymbiont, Blattabacterium and gut-residing bacteria. The mixed signatures of gut filtrate samples are attributed to the presence of unassimilated dietary, as well as gut microbial (bacterial and fungal) EAAs. This study highlights the potential impacts of dietary quality on symbiotic EAA provisioning and the need for further studies investigating the interplay between host EAA demands, host dietary quality and symbiotic EAA provisioning in response to dietary sufficiency or deficiency.
Rotte, C; Krach, C; Balfanz, S; Baumann, A; Walz, B; Blenau, W
2009-09-15
The phenolamines octopamine and tyramine control, regulate, and modulate many physiological and behavioral processes in invertebrates. Vertebrates possess only small amounts of both substances, and thus, octopamine and tyramine, together with other biogenic amines, are referred to as "trace amines." Biogenic amines evoke cellular responses by activating G-protein-coupled receptors. We have isolated a complementary DNA (cDNA) that encodes a biogenic amine receptor from the American cockroach Periplaneta americana, viz., Peatyr1, which shares high sequence similarity to members of the invertebrate tyramine-receptor family. The PeaTYR1 receptor was stably expressed in human embryonic kidney (HEK) 293 cells, and its ligand response has been examined. Receptor activation with tyramine reduces adenylyl cyclase activity in a dose-dependent manner (EC(50) approximately 350 nM). The inhibitory effect of tyramine is abolished by co-incubation with either yohimbine or chlorpromazine. Receptor expression has been investigated by reverse transcription polymerase chain reaction and immunocytochemistry. The mRNA is present in various tissues including brain, salivary glands, midgut, Malpighian tubules, and leg muscles. The effect of tyramine on salivary gland acinar cells has been investigated by intracellular recordings, which have revealed excitatory presynaptic actions of tyramine. This study marks the first comprehensive molecular, pharmacological, and functional characterization of a tyramine receptor in the cockroach.
Pathogenicity of Aspergillus westerdijkiae to females and oothecae of Periplaneta Americana
Directory of Open Access Journals (Sweden)
Mariah Valente Baggio
2016-01-01
Full Text Available ABSTRACT: Cockroach control is performed by the application of chemical insecticides which exert high selective pressure on populations and introduces synthetic substances in the environment, motivating the search for other methods of control such as entomopathogenic fungi. The objectives of this study were to investigate the pathogenicity of the JAB 42 Aspergillus westerdijkiae to females and oothecae of Periplaneta americana and to demonstrate its mechanism of action on oothecae. Suspensions containing 106 to 108 conidia/ml were used to infect females and oothecae. Mortality and other variables such as scanning electron microscopy were used to demonstrate the mechanism of action of the fungus. The isolated JAB 42 A. westerdijkiae is pathogenic to oothecae of P. americana, with low capacity to kill females. Adhesion, germination, penetration and extrusion of the fungus on the cockroach oothecae were observed.
Blenau, Wolfgang; Balfanz, Sabine; Baumann, Arnd
2017-10-30
The catecholamines norepinephrine and epinephrine regulate important physiological functions in vertebrates. In insects; these neuroactive substances are functionally replaced by the phenolamines octopamine and tyramine. Phenolamines activate specific guanine nucleotide-binding (G) protein-coupled receptors (GPCRs). Type 1 tyramine receptors are better activated by tyramine than by octopamine. In contrast; type 2 tyramine receptors are almost exclusively activated by tyramine. Functionally; activation of type 1 tyramine receptors leads to a decrease in the intracellular concentration of cAMP ([cAMP] i ) whereas type 2 tyramine receptors can mediate Ca 2+ signals or both Ca 2+ signals and effects on [cAMP] i . Here; we report that the American cockroach ( Periplaneta americana ) expresses a second type 1 tyramine receptor (PeaTAR1B) in addition to PeaTAR1A (previously called PeaTYR1). When heterologously expressed in flpTM cells; activation of PeaTAR1B by tyramine leads to a concentration-dependent decrease in [cAMP] i . Its activity can be blocked by a series of established antagonists. The functional characterization of two type 1 tyramine receptors from P. americana ; PeaTAR1A and PeaTAR1B; which respond to tyramine by changing cAMP levels; is a major step towards understanding the actions of tyramine in cockroach physiology and behavior; particularly in comparison to the effects of octopamine.
Directory of Open Access Journals (Sweden)
Wolfgang Blenau
2017-10-01
Full Text Available The catecholamines norepinephrine and epinephrine regulate important physiological functions in vertebrates. In insects; these neuroactive substances are functionally replaced by the phenolamines octopamine and tyramine. Phenolamines activate specific guanine nucleotide-binding (G protein-coupled receptors (GPCRs. Type 1 tyramine receptors are better activated by tyramine than by octopamine. In contrast; type 2 tyramine receptors are almost exclusively activated by tyramine. Functionally; activation of type 1 tyramine receptors leads to a decrease in the intracellular concentration of cAMP ([cAMP]i whereas type 2 tyramine receptors can mediate Ca2+ signals or both Ca2+ signals and effects on [cAMP]i. Here; we report that the American cockroach (Periplaneta americana expresses a second type 1 tyramine receptor (PeaTAR1B in addition to PeaTAR1A (previously called PeaTYR1. When heterologously expressed in flpTM cells; activation of PeaTAR1B by tyramine leads to a concentration-dependent decrease in [cAMP]i. Its activity can be blocked by a series of established antagonists. The functional characterization of two type 1 tyramine receptors from P. americana; PeaTAR1A and PeaTAR1B; which respond to tyramine by changing cAMP levels; is a major step towards understanding the actions of tyramine in cockroach physiology and behavior; particularly in comparison to the effects of octopamine.
Akbari, Sanaz; Oshaghi, Mohammad Ali; Hashemi-Aghdam, Saedeh Sadat; Hajikhani, Sara; Oshaghi, Ghazaleh; Shirazi, Mohammad Hasan
2015-06-01
Cockroaches mechanically spread pathogenic agents, however, little is known about their gut microbiota. Identification of midgut microbial community helps targeting novel biological control strategies such as paratransgenesis. Here the bacterial microbiota of Periplaneta americana midgut, were identified and evaluated for finding proper paratransgenesis candidate. Midgut of specimens were dissected and cultivated in different media. The bacterial isolates were then identified using the phenotypic and 16S-rRNA sequencing methods. The analytical profile index (API) kit showed presence of 11 bacterial species including: Escherichia coli, Shigella flexineri, Citrobacter freundii, E. vulneris, Enterobacter cloacae, Yersinia pseudotuberculosis, Y. intermedia, Leclericia adecarboxylata, Klebsiella oxytoca, K. planticola, and Rahnella aquatilis in the cockroach midguts. The first three species are potentially symbiotic whereas others are transient. The conventional plating method revealed presence of only four isolates of Salmonella, E. coli, and Proteus which in three cases mismatched with API and 16S-rRNA genotyping. The API correctly identified the four isolates as Shigella flexneri, Citrobacter freundii, and E. coli (n= 2). 16S-rRNA sequence analysis confirmed the API results; however the C. freundii sequence was identical with C. murliniae indicating lack of genetic variation in the gene between these two closely related species. A low number of potentially symbiotic bacteria were found in the American cockroach midguts. Among them Enterobacter cloacae is a potential candidate for paratransgenesis approach whereas other bacteria are pathogens and are not useful for the approach. Data analysis showed that identification levels increase from the conventional to API and to genotyping respectively.
Directory of Open Access Journals (Sweden)
Sanaz Akbari
2015-10-01
Full Text Available Background: Cockroaches mechanically spread pathogenic agents, however, little is known about their gut microbiota. Identification of midgut microbial community helps targeting novel biological control strategies such as paratransgenesis. Here the bacterial microbiota of Periplaneta americana midgut, were identified and evaluated for finding proper paratransgenesis candidate.Methods: Midgut of specimens were dissected and cultivated in different media. The bacterial isolates were then identified using the phenotypic and 16S-rRNA sequencing methods.Results: The analytical profile index (API kit showed presence of 11 bacterial species including: Escherichia coli, Shigella flexineri, Citrobacter freundii, E. vulneris, Enterobacter cloacae, Yersinia pseudotuberculosis, Y.intermedia, Leclericia adecarboxylata, Klebsiella oxytoca, K. planticola, and Rahnella aquatilis in the cockroach midguts. The first three species are potentially symbiotic whereas others are transient. The conventional platingmethod revealed presence of only four isolates of Salmonella, E. coli, and Proteus which in three cases mismatched with API and 16S-rRNA genotyping. The API correctly identified the four isolates as Shigella flexneri, Citrobacter freundii, and E. coli (n= 2. 16S-rRNA sequence analysis confirmed the API results; however the C. freundii sequencewas identical with C. murliniae indicating lack of genetic variation in the gene between these two closely related species.Conclusion: A low number of potentially symbiotic bacteria were found in the American cockroach midguts. Among them Enterobacter cloacae is a potential candidate for paratransgenesis approach whereas other bacteria are pathogens and are not useful for the approach. Data analysis showed that identification levels increase from the conventional to API and to genotyping respectively.
Evaluation of Piper aduncum Linn. Essential Oil (Fam:Piperaceae against Periplaneta americana(L.
Directory of Open Access Journals (Sweden)
I Ling A
2009-12-01
Full Text Available Background: The efficacy of Piper aduncum essential oil was evaluated against Periplaneta americana adults and nymphs in the laboratory."nMethods: The plant essential oil at varying concentrations ranging between 10,000 to 80,000 ppm were placed inside glass beakers, rolled horizontally to ensure the essential oil covers all sides of the beakers and exposed to adults and nymphs of P. americana. Resigen (R 1ppm was used as positive control and distilled water as negative control. The LT50 and LT90 was obtained using Log Probit programme."nResults: Exposure of essential oil to females P. americana at concentrations between 10,000 to 80,000 ppm indicated the LT50 and LT90 values between 5.31 h-189.19 h and 14.90 h-2105.31 h, respectively. Treatment with the same concentrations against males P. americana ,the LT50 and LT90 were 2.08 h-181.73 h and 5.4 h-8460.51 h, respectively. Treatment against the nymphal stage with the same range of concentrations indicated the LT50 and LT 90 of 4.68 h-381.02 h and 28.71 h-5313.36 h, respectively.The nymphs and males were more susceptible than the females cockroaches. Treatment with Resigen (R at 1ppm indicated much lower LT 50 and LT 90 values of 2.54 h-9.47 h for the females, 1.47 h-4.22 h for the males and 4.69 h-8.92 h for the nymphs.The negative control indicated no mortality for all stages of the cockroach."nConclusion: Piper aduncum essential oil can be used as an alternative natural product for controlling the cockroach Peripatetic americana. "nKeywords: Piper aduncum essential oil, Periplaneta americana, Adults, Nymphs
Comparative study of specific IgE for cockroach between asthma and allergic rhinitis patients
International Nuclear Information System (INIS)
Guo Yinshi; Xu Yiping; Zhu Lijun; Wang Limin; Cao Lingxian; Yao Suhang
2005-01-01
To compare the degrees of allergic reaction and the cross-reactive allergens for three strains of cockroach (Periplanceta fuliginosa , Periplaneta americana and Blattella germanica) between patients with asthma and allergic rhinitis, the specific IgE(sIgE) in asthma and allergic rhinitis for these three strains of cockroach were determined with ELISA. The results showed that the sIgE positive rates for Periplaneta americana, Periplaneta fuliginosa and Blattella germanica in patients with asthma were 23.5%, 16.0% and 14.8%, respectively. The reactive coincidence rate between Periplaneta americana and Periplaneta fuliginoas was 74.0%, between Periplaneta americana and Blattella germanica was 73.5%, and between Periplaneta fuliginosa and Blattella germanica was 85.0% in asthma patients. The IgE positive rates for Periplaneta americana, Periplaneta fuliginosa and Blattella gerraanica in allergic rhinitis patients were 24.8%, 17.6% and 15.8%, respectively. The reactive coincidence rate between Periplaneta americana and Periplaneta fuliginosa was 73.9%, between Periplaneta americana and Blattella germanica was 75.2%, and between Periplaneta fuliginosa and Blattella germanica was 86.1% in allergic rhinitis patients. There was no significant difference between asthma and allergic rhinitis patients although the sIgE positive rates of allergic rhinitis patients were higher than those of asthma patients for these three strains of cock- roach. All these results indicated that the degrees of allergic reaction are similar between asthma and allergic rhinitis patients and there are some cross-reactive allergic components among these three strains of cockroach. (authors)
Directory of Open Access Journals (Sweden)
Tom Weihmann
Full Text Available Knowing the functionality and capabilities of masticatory apparatuses is essential for the ecological classification of jawed organisms. Nevertheless insects, especially with their outstanding high species number providing an overwhelming morphological diversity, are notoriously underexplored with respect to maximum bite forces and their dependency on the mandible opening angles. Aiming for a general understanding of insect biting, we examined the generalist feeding cockroach Periplaneta americana, characterized by its primitive chewing mouth parts. We measured active isometric bite forces and passive forces caused by joint resistance over the entire mandibular range with a custom-built 2D force transducer. The opening angle of the mandibles was quantified by using a video system. With respect to the effective mechanical advantage of the mandibles and the cross-section areas, we calculated the forces exerted by the mandible closer muscles and the corresponding muscle stress values. Comparisons with the scarce data available revealed close similarities of the cockroaches' mandible closer stress values (58 N/cm2 to that of smaller specialist carnivorous ground beetles, but strikingly higher values than in larger stag beetles. In contrast to available datasets our results imply the activity of faster and slower muscle fibres, with the latter becoming active only when the animals chew on tough material which requires repetitive, hard biting. Under such circumstances the coactivity of fast and slow fibres provides a force boost which is not available during short-term activities, since long latencies prevent a specific effective employment of the slow fibres in this case.
Evaluation of Piper aduncum Linn. Essential Oil (Fam:Piperaceae) against Periplaneta americana (L.).
Ling A, I; Sulaiman, S; Othman, H
2009-01-01
The efficacy of Piper aduncum essential oil was evaluated against Periplaneta americana adults and nymphs in the laboratory. The plant essential oil at varying concentrations ranging between 10,000 to 80,000 ppm were placed inside glass beakers, rolled horizontally to ensure the essential oil covers all sides of the beakers and exposed to adults and nymphs of P. americana. Resigen (R) 1ppm was used as positive control and distilled water as negative control. The LT50 and LT90 was obtained using Log Probit programme. Exposure of essential oil to females P. americana at concentrations between 10,000 to 80,000 ppm indicated the LT50 and LT90 values between 5.31 h-189.19 h and 14.90 h-2105.31 h, respectively. Treatment with the same concentrations against males P. americana ,the LT50 and LT90 were 2.08 h-181.73 h and 5.4 h-8460.51 h, respectively. Treatment against the nymphal stage with the same range of concentrations indicated the LT50 and LT 90 of 4.68 h-381.02 h and 28.71 h-5313.36 h, respectively.The nymphs and males were more susceptible than the females cockroaches. Treatment with Resigen (R) at 1ppm indicated much lower LT 50 and LT 90 values of 2.54 h-9.47 h for the females, 1.47 h-4.22 h for the males and 4.69 h-8.92 h for the nymphs.The negative control indicated no mortality for all stages of the cockroach. Piper aduncum essential oil can be used as an alternative natural product for controlling the cockroach Peripatetic americana.
Directory of Open Access Journals (Sweden)
Kamenan A.
2005-01-01
Full Text Available Enzymatic synthesis of neoglucoconjugates by purified α-glucosidase from cockroach Periplaneta americana (Linnaeus. Cockroach Periplaneta americana (Linnaeus contains in his digestive tract an acid (pH 5,0 and mesophile (50°C α-glucosidase. This enzyme, purified to homogeneity, hydrolyses highly maltose, sucrose and p-nitrophenyl-α-Dglucopyranoside. The ability of α-glucosidase from cockroach purified to homogeneity to catalyse transglucosylation reactions was tested using maltose and saccharose as glucosyl donors and 2-phenylethanol and phenol as acceptors. The experimental conditions were optimized in relation to the time course of the reaction, pH and concentrations of glucosyl donors and acceptors. The yields in transglucosylation reactions at 37 °C were very high and could attain 67% and 48% with 2-phenylethanol and phenol respectively as glucosyl acceptors. This α-glucosidase hydrolyzed the products formed. It seems that the products formed were the phenylethyl-α-D-glucoside and phenyl-α-D-glucoside. These results suggest that α- glucosidase from cockroach is an exoglucosidase which catalyse the splitting of the α-glucosyl residue from the non reducing terminal of the substrate to liberate α-glucose. This comportment indicates that this enzyme operated by a mechanism involving the retention of the anomeric configuration. On the basis of this work, α-glucosidase from P. americana appears to be a valuable tool for the preparation of α-neoglucoconjugates.
Synanthropic Cockroaches (Blattidae: Periplaneta spp.) Harbor Pathogenic Leptospira in Colombia.
Gonzalez-Astudillo, Viviana; Bustamante-Rengifo, Javier A; Bonilla, Álvaro; Lehmicke, Anna Joy J; Castillo, Andrés; Astudillo-Hernández, Miryam
2016-01-01
Leptospirosis cases in Colombia are typically linked to peridomestic rodents; however, empirical data suggest that Leptospira-infected patients with no apparent exposure to these reservoirs are common. Cockroaches (Periplaneta spp.) have equal or greater interaction with humans than rodents, yet their potential role as carriers of Leptospira has not been assessed. We determined if pathogenic Leptospira is harbored by Periplaneta spp. in Cali (Colombia) and the variables influencing this relationship. Fifty-nine cockroaches were captured from seven sites and DNA was extracted from the body surface and digestive tract for a multiplex polymerase chain reaction, targeting genes secY and flaB. Logistic regression models and proportion tests showed a higher likelihood for Leptospira to be isolated from body surfaces (P > 0.001) and from individuals inside houses (six times more likely). These findings are the first to demonstrate an association between Periplaneta spp. and Leptospira, suggesting the need to investigate the potential for cockroaches to serve as reservoirs or transport hosts for Leptospira. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Hamid Reza Basseri
2016-10-01
Full Text Available Background: Antimicrobial peptides play a role as effectors substances in the immunity of vertebrate and invertebrate hosts. In the current study, antimicrobial peptide was isolated from the haemolymph of the American cockroach, Periplaneta americana.Methods: Micrococcus luteus as Gram-positive bacteria and Escherichia coli as Gram-negative bacteria were candidate for injection. Induction was done by injecting both bacteria into the abdominal cavity of two groups of cockroaches separately. The haemolymphs were collected 24 hours after post injection and initially tested against both bacteria. Subsequently, the immune induced haemolymph was purified by high performance liquid chromatography (HPLC to separate the proteins responsible for the antibacterial activity.Results: The non-induced haemolymph did not show any activity against both bacteria whereas induced haemolymph exhibited high activity against M. luteus but did less against E. coli. Two fractions showed antibacterial activity against M. luteus. Finally the molecular weight of the isolated antibacterial proteins were determined as 72 kDa and 62 kDa using SDS-PAGE.Conclusion: Induced haemolymph of American cockroaches has the ability to produce peptides to combat against Gram-positive bacteria when an immune challenge is mounted. Further work has to be done to sequence of the protein, which it would be advantageous.
Directory of Open Access Journals (Sweden)
D Leshan Wannigama
2014-06-01
Full Text Available Cockroaches are among the medically important pests found within the human habitations that cause serious public health problems. They may harbor a number of pathogenic bacteria on the external surface with antibiotic resistance. Hence, they are regarded as major microbial vectors. This study investigates the prevalence and antibiotic resistance of Gram-negative pathogenic bacteria species isolated from Periplaneta americana and Blattella germanica in Varanasi, India.Totally, 203 adult cockroaches were collected form 44 households and 52 food-handling establishments by trapping. Bacteriological examination of external surfaces of Pe. americana and Bl. germanica were carried out using standard method and antibiotics susceptibility profiles of the isolates were determined using Kirby-Bauer disc diffusion methods.Among the places, we found that 54% had cockroache infestation in households and 77% in food- handling establishments. There was no significant different between the overall bacteria load of the external surface in Pe. americana (64.04% and Bl. germanica (35.96%. However the predominant bacteria on cockroaches were Klebsiella pneumonia, Escherichia coli, Enterobacter aerogenes, and Pseudomonas aeruginosa. However, Kl. pneumoniae and Ps. aeruginosa were the most prevalent, drug-resistant strains were isolated from the cockroaches with 100% resistance to sulfamethoxazole/trimethoprim and ampicillin. For individual strains of bacteria, Escherichia coli was found to have multi-resistance to four antibiotic tested, Citrobacter freundii four, Enterobacter aerogenes and Proteus mirabilis to three.Cockroaches are uniformly distributed in domestic environment, which can be a possible vector for transmission of drug-resistant bacteria and food-borne diseases.
Evaluation of Piper aduncum Linn. Essential Oil (Fam:Piperaceae against Periplaneta americana(L.
Directory of Open Access Journals (Sweden)
I Ling A
2009-12-01
Full Text Available Background: The efficacy of Piper aduncum essential oil was evaluated against Periplaneta americana adults and nymphs in the laboratory.Methods: The plant essential oil at varying concentrations ranging between 10,000 to 80,000 ppm were placed inside glass beakers, rolled horizontally to ensure the essential oil covers all sides of the beakers and exposed to adults and nymphs of P. americana. Resigen (R 1ppm was used as positive control and distilled water as negative control. The LT50 and LT90 was obtained using Log Probit programme.Results: Exposure of essential oil to females P. americana at concentrations between 10,000 to 80,000 ppm indicated the LT50 and LT90 values between 5.31 h-189.19 h and 14.90 h-2105.31 h, respectively. Treatment with the same concentrations against males P. americana ,the LT50 and LT90 were 2.08 h-181.73 h and 5.4 h-8460.51 h, respectively. Treatment against the nymphal stage with the same range of concentrations indicated the LT50 and LT 90 of 4.68 h-381.02 h and 28.71 h-5313.36 h, respectively.The nymphs and males were more susceptible than the females cockroaches. Treatment with Resigen (R at 1ppm indicated much lower LT 50 and LT 90 values of 2.54 h-9.47 h for the females, 1.47 h-4.22 h for the males and 4.69 h-8.92 h for the nymphs.The negative control indicated no mortality for all stages of the cockroach.Conclusion: Piper aduncum essential oil can be used as an alternative natural product for controlling the cockroach Peripatetic americana.
Memory Consolidation and Gene Expression in "Periplaneta Americana"
Strausfeld, Nicholas J.; Pinter, Marianna; Lent, David D.
2005-01-01
A unique behavioral paradigm has been developed for "Periplaneta americana" that assesses the timing and success of memory consolidation leading to long-term memory of visual-olfactory associations. The brains of trained and control animals, removed at the critical consolidation period, were screened by two-directional suppression subtractive…
Troppmann, Britta; Balfanz, Sabine; Krach, Christian; Baumann, Arnd; Blenau, Wolfgang
2014-01-06
We have isolated a cDNA coding for a putative invertebrate-type dopamine receptor (Peadop2) from P. americana brain by using a PCR-based strategy. The mRNA is present in samples from brain and salivary glands. We analyzed the distribution of the PeaDOP2 receptor protein with specific affinity-purified polyclonal antibodies. On Western blots, PeaDOP2 was detected in protein samples from brain, subesophageal ganglion, thoracic ganglia, and salivary glands. In immunocytochemical experiments, we detected PeaDOP2 in neurons with their somata being located at the anterior edge of the medulla bilaterally innervating the optic lobes and projecting to the ventro-lateral protocerebrum. In order to determine the functional and pharmacological properties of the cloned receptor, we generated a cell line constitutively expressing PeaDOP2. Activation of PeaDOP2-expressing cells with dopamine induced an increase in intracellular cAMP. In contrast, a C-terminally truncated splice variant of this receptor did not exhibit any functional property by itself. The molecular and pharmacological characterization of the first dopamine receptor from P. americana provides the basis for forthcoming studies focusing on the significance of the dopaminergic system in cockroach behavior and physiology.
Modelling active antennal movements of the American cockroach
DEFF Research Database (Denmark)
Pequeno-Zurro, Alejandro; Nitschke, Jahn; Szyszka, Paul
2017-01-01
lacking. Here we report on an integrated experimental and computational approach to investigate how sensory information affects antennal movements. We present a modelling approach to characterise the relationship between antennal searching movement of the American cockroach Periplaneta americana......Cockroach antennae are multimodal sensory appendages engaging in active olfactory and tactile sensing. They are involved in unisensory behaviours such as chemotaxis, thigmotaxis, obstacle negotiation and tactile orientation. Studies of multisensory capabilities mediated by the antennae are however...
Sookrung, Nitat; Khetsuphan, Thanyathon; Chaisri, Urai; Indrawattana, Nitaya; Reamtong, Onrapak; Chaicumpa, Wanpen; Tungtrongchitr, Anchalee
2014-07-01
Cockroach (CR) is a common source of indoor allergens, and Per a 1 is a major American CR (Periplaneta americana) allergen; however, several attributes of this protein remain unknown. This study identifies a novel specific B cell epitope and anatomical locations of Per a 1.0105. Recombinant Per a 1.0105 (rPer a 1.0105) was used as BALB/c mouse immunogen for the production of monoclonal antibodies (MAb). The MAb specific B cell epitope was identified by determining phage mimotopic peptides and pair-wise alignment of the peptides with the rPer a 1.0105 amino acid sequence. Locations of the Per a 1.0105 in P. americana were investigated by immunohistochemical staining. The rPer a 1.0105 (~13 kDa) had 100%, 98% and ≥90% identity to Per a 1.0105, Per a 1.0101, and Cr-PII, respectively. The B-cell epitope of the Per a 1.0105 specific-MAb was located at residues(99) QDLLLQLRDKGV(110) contained in all 5 Per a 1.01 isoforms and Per a 1.02. The epitope was analogous to the Bla g 1.02 epitope; however, this B-cell epitope was not an IgE inducer. Per a 1.0105 was found in the midgut and intestinal content of American CR but not in the other organs. The amount of the Per a 1 was ~544 ℃g per gram of feces. The novel Per a 1 B-cell epitope described in this study is a useful target for allergen quantification in samples; however, the specific MAb can be used as an allergen detection reagent. The MAb based-affinity resin can be made for allergen purification, and the so-purified protein can serve as a standard and diagnostic allergen as well as a therapeutic vaccine component. The finding that the Per a 1 is contained in the midgut and feces is useful to increase yield and purity when preparing this allergen.
Directory of Open Access Journals (Sweden)
Britta Troppmann
2014-01-01
Full Text Available We have isolated a cDNA coding for a putative invertebrate-type dopamine receptor (Peadop2 from P. americana brain by using a PCR-based strategy. The mRNA is present in samples from brain and salivary glands. We analyzed the distribution of the PeaDOP2 receptor protein with specific affinity-purified polyclonal antibodies. On Western blots, PeaDOP2 was detected in protein samples from brain, subesophageal ganglion, thoracic ganglia, and salivary glands. In immunocytochemical experiments, we detected PeaDOP2 in neurons with their somata being located at the anterior edge of the medulla bilaterally innervating the optic lobes and projecting to the ventro-lateral protocerebrum. In order to determine the functional and pharmacological properties of the cloned receptor, we generated a cell line constitutively expressing PeaDOP2. Activation of PeaDOP2-expressing cells with dopamine induced an increase in intracellular cAMP. In contrast, a C-terminally truncated splice variant of this receptor did not exhibit any functional property by itself. The molecular and pharmacological characterization of the first dopamine receptor from P. americana provides the basis for forthcoming studies focusing on the significance of the dopaminergic system in cockroach behavior and physiology.
Cockroaches ’ bacterial infections in wards of hospitals, Hamedan city, west of Iran
Directory of Open Access Journals (Sweden)
Nejati Jalil
2012-10-01
Full Text Available Objective: To identify the relationship between different species of cockroaches with their bacterial infection in different wards of Hamedan county hospitals, western Iran. Methods: Using sticky trap, hand collection and glass trap, 250 cockroaches were collected from 14 wards of 5 hospitals. After having their identification determined by detection key, all of them were used to isolate bacteria from cuticle and alimentary tract. Results: From four identified species, Blatella germanica were the most common in all of the wards (88.8% and next was the Periplaneta Americana (8%. 20 bacteria species isolated from cockroaches' surface and 21 from digestive organ. Escherichia coli were the most predominant bacteria isolated from external surface (26.5 % as well as alimentary tract (30.8%. The frequency of investigated bacteria on cockroaches' body surface was not significantly different between Periplaneta Americana and Blattella germanica except for Kllebsiella oxytoca (P<0.001 and Providensia Spp (P=0.035. Also, frequency of detected bacteria in cockroaches' digestive organ was not significantly different between these two species. Furthermore, the frequency of bacteria isolated from the cockroaches' external surface was not significantly different from that of digestive organ except for shigella disantery (P<0.001, Pseudomonas aeroginosa (P<0.001 and Klebsiella oxytoca (P=0.01 3. Conclusions: Since cockroaches can carry pathogenic bacteria, so their existence in the hospitals could be a serious public health problem. It is suggested to compile programs in order to control cockroaches especially in the hospitals.
Grooming behavior in American cockroach is affected by novelty and odor.
Zhukovskaya, Marianna I
2014-01-01
The main features of grooming behavior are amazingly similar among arthropods and land vertebrates and serve the same needs. A particular pattern of cleaning movements in cockroaches shows cephalo-caudal progression. Grooming sequences become longer after adaptation to the new setting. Novelty related changes in grooming are recognized as a form of displacement behavior. Statistical analysis of behavior revealed that antennal grooming in American cockroach, Periplaneta americana L., was significantly enhanced in the presence of odor.
Static electric fields modify the locomotory behaviour of cockroaches.
Jackson, Christopher W; Hunt, Edmund; Sharkh, Suleiman; Newland, Philip L
2011-06-15
Static electric fields are found throughout the environment and there is growing interest in how electric fields influence insect behaviour. Here we have analysed the locomotory behaviour of cockroaches (Periplaneta americana) in response to static electric fields at levels equal to and above those found in the natural environment. Walking behaviour (including velocity, distance moved, turn angle and time spent walking) were analysed as cockroaches approached an electric field boundary in an open arena, and also when continuously exposed to an electric field. On approaching an electric field boundary, the greater the electric field strength the more likely a cockroach would be to turn away from, or be repulsed by, the electric field. Cockroaches completely exposed to electric fields showed significant changes in locomotion by covering less distance, walking slowly and turning more often. This study highlights the importance of electric fields on the normal locomotory behaviour of insects.
[Asymmetry of antennal grooming in the cockroach (Periplaneta americana)].
2014-07-01
The present study was conducted to determine the key features of antennal grooming of male American cockroaches in neutral circumstances. It was shown for the first time that the right antenna was cleaned significantly more often than the left one, which indicates the presence of functional asymmetry of antennal grooming in this insect species. At the same time, no statistically significant asymmetry was found for grooming of antennal bases and legs. Morphological asymmetries of antennae and legs and/or brain lateralization are the plausible sources of observed behavioral asymmetry in antennal grooming.
Quality of housing and allergy to cockroaches in the Dominican Republic.
Barnes, K C; Brenner, R J
1996-01-01
Fifty-one atopic asthmatic and/or allergic rhinitic children and 23 nonatopic control from Santo Domingo, the Dominican Republic, were skin tested with an extract mix of three cockroach species (Blattella germanica, Blatta orientalis, and Periplaneta americana). Sixteen percent of the atopics and none of the nonatopics demonstrated positive immediate skin reactions to the cockroach mix (chi 2 = 4.05, p = 0.04). Hypersensitivity was correlated with the quality of the homes; 22% (8/36) of the atopics who lived in a concrete home were skin test positive to the cockroach mix, while none (0/15) of the atopics who lived in a wood home were skin test positive (chi 2 = 4.86, p = 0.03). Although the incidence of cockroach allergy in this study is lower than that found elsewhere, these data support the notion that, in this tropical environment, sensitization to cockroaches is associated with housing quality.
Directory of Open Access Journals (Sweden)
John E. Chesebro
2012-12-01
Sequential addition of segments in the posteriorly growing end of the embryo is a developmental mechanism common to many bilaterians. However, posterior growth and patterning in most animals also entails the establishment of a ‘posterior organiser’ that expresses the Caudal and Wnt proteins and has been proposed to be an ancestral feature of animal development. We have studied the functional relationships between the Wnt-driven organiser and the segmentation mechanisms in a basal insect, the cockroach Periplaneta americana. Here, posteriorly-expressed Wnt1 promotes caudal and Delta expression early in development to generate a growth zone from which segments will later bud off. caudal maintains the undifferentiated growth zone by dampening Delta expression, and hence Notch-mediated segmentation occurs just outside the caudal domain. In turn, Delta expression maintains Wnt1, maintaining this posterior gene network until all segments have formed. This feedback between caudal, Wnt and Notch-signalling in regulating growth and segmentation seems conserved in other arthropods, with some aspects found even in vertebrates. Thus our findings not only support an ancestral Wnt posterior organiser, but also impinge on the proposals for a common origin of segmentation in arthropods, annelids and vertebrates.
Directory of Open Access Journals (Sweden)
Paul A. Ayayee
2018-05-01
Full Text Available Insect gut microbiota contribute significantly to host nutritional ecology. Disrupting insect gut microbial assemblages impacts nutrient provisioning functions, and can potentially affect host standard metabolic rate (SMR, a measure of host energy balance. In this study, we evaluated the effect of disrupting gut microbial assemblages on the SMR of female Periplaneta americana cockroaches fed dog food (DF, high protein/carbohydrate (p/c ratio, and cellulose-amended dog food (CADF, 30% dog food, 70% cellulose, low p/c ratio diets, supplemented with none, low, or high antibiotic doses. Bacterial loads decreased significantly between diet types (P = 0.04 and across antibiotic doses (P = 0.04. There was a significant diet type x antibiotic dose interaction on SMR of females on both diets (P = 0.05 by the end of the seven-day experimental period. In CADF-fed females, SMR decreased linearly with decreasing bacterial load. However, SMR of DF-fed females on the low dose was significantly higher than those in the control and high dose groups. This is interpreted as a diet-dependent response by low dose DF-fed females to the loss of nutritional services provided by gut bacteria. Severe reductions in bacterial load at high doses reduced SMR of females on both diet types. This study provides insights into the potential role of gut bacteria as modulators of host energy expenditure under varying dietary conditions.
DEFF Research Database (Denmark)
Verhaert, P; Grimmelikhuijzen, C J; De Loof, A
1985-01-01
One bovine pancreatic polypeptide (BPP) antiserum and two FMRFamide antisera were applied in the peroxidase-antiperoxidase (PAP) immunohistochemical technique on a complete series of sections of brains, suboesophageal ganglia (SOG), corpora cardiaca (CC) and corpora allata of Periplaneta americana...... L. Double immunohistochemical staining demonstrated that the same perikarya and processes were stained by both the BPP and FMRFamide antisera. This was caused by cross-reaction of the BPP and FMRFamide antisera with common antigenic determinants as was shown by a number of solid-phase absorptions....... Application of a third FMRFamide antiserum, which was especially selected for its inability to react with bovine and avian pancreatic polypeptide, showed that more than half of the structures that were stained with the 'unspecific' BPP and FMRFamide antisera, contained material which was genuinely FMRFamide...
Genetic diversity of Entamoeba: Novel ribosomal lineages from cockroaches.
Directory of Open Access Journals (Sweden)
Tetsuro Kawano
Full Text Available Our current taxonomic perspective on Entamoeba is largely based on small-subunit ribosomal RNA genes (SSU rDNA from Entamoeba species identified in vertebrate hosts with minor exceptions such as E. moshkovskii from sewage water and E. marina from marine sediment. Other Entamoeba species have also been morphologically identified and described from non-vertebrate species such as insects; however, their genetic diversity remains unknown. In order to further disclose the diversity of the genus, we investigated Entamoeba spp. in the intestines of three cockroach species: Periplaneta americana, Blaptica dubia, and Gromphadorhina oblongonota. We obtained 134 Entamoeba SSU rDNA sequences from 186 cockroaches by direct nested PCR using the DNA extracts of intestines from cockroaches, followed by scrutinized BLASTn screening and phylogenetic analyses. All the sequences identified in this study were distinct from those reported from known Entamoeba species, and considered as novel Entamoeba ribosomal lineages. Furthermore, they were positioned at the base of the clade of known Entamoeba species and displayed remarkable degree of genetic diversity comprising nine major groups in the three cockroach species. This is the first report of the diversity of SSU rDNA sequences from Entamoeba in non-vertebrate host species, and should help to understand the genetic diversity of the genus Entamoeba.
Benzidane, Yassine; Touinsi, Sarra; Motte, Emilie; Jadas-Hécart, Alain; Communal, Pierre-Yves; Leduc, Lionel; Thany, Steeve H
2010-12-01
In the present study, the effect of thiamethoxam and clothianidin on the locomotor activity of American cockroach, Periplaneta americana (L.), was evaluated. Because it has been proposed that thiamethoxam is metabolised to clothianidin, high-performance liquid chromatography coupled with mass spectrometry was used to evaluate the amount of clothianidin on thiamethoxam-treated cockroaches. One hour after neonicotinoid treatment, the time spent in the open-field-like apparatus significantly increased, suggesting a decrease in locomotor activity. The percentage of cockroaches displaying locomotor activity was significantly reduced 1 h after haemolymph application of 1 nmol g(-1) neonicotinoid, while no significant effect was found after topical and oral administration. However, at 24 and 48 h, all neonicotinoids were able to reduce locomotor activity, depending on their concentrations and the way they were applied. Interestingly, it was found that thiamethoxam was converted to clothianidin 1 h after application, but the amount of clothianidin did not rise proportionately to thiamethoxam, especially after oral administration. The data suggest that the effect of thiamethoxam on cockroach locomotor activity is due in part to clothianidin action because (1) thiamethoxam levels remained persistent 48 h after application and (2) the amount of clothianidin in cockroach tissues was consistent with the toxicity of thiamethoxam. Copyright © 2010 Society of Chemical Industry.
Martínez-Girón, Rafael; Martínez-Torre, Cristina; van Woerden, Hugo Cornelis
2017-11-01
The German cockroach (Blattella germanica) is a common domestic pest, which produces allergens that have been associated with broncho-pulmonary disease. Various protozoan species have been identified in the intestine of this cockroach and it has been hypothesised that these protozoa, or their proteases, may contribute to the burden of cockroach-associated allergens and adjuvants present in domestic dust. The aim of this study was therefore to determine the prevalence of protozoan species in the intestine of Blattella germanica. German cockroaches were anesthetised and dissected and gut contents are used to produce wet slides for microscopy. Both, Giemsa and Papanicolaou stains were used to confirm correct identification of Lophomonas blattarum. Representatives of four genera of protozoa were identified in 110 cockroaches: Nyctoterus sp. was observed in 91.8% of cases, Gregarina sp. in 64.5%, Amoeba sp. in 25.4% and Lophomonas blattarum in 13.6%. Nyctoterus and Gregarina were statistically significantly more likely to be found in diseased cockroaches compared to Amoeba or Lophomonas. The prevalence of Lophomonas blattarum was similar to that in published studies of a different species of cockroach, Periplaneta americana. Further work is needed to assess the interplay between protozoa, cockroaches and broncho-pulmonary diseases.
Blankenburg, S; Balfanz, S; Hayashi, Y; Shigenobu, S; Miura, T; Baumann, O; Baumann, A; Blenau, W
2015-01-01
γ-aminobutyric acid (GABA) is the predominant inhibitory neurotransmitter in the central nervous system (CNS). Its effects are mediated by either ionotropic GABAA receptors or metabotropic GABAB receptors. GABAB receptors regulate, via Gi/o G-proteins, ion channels, and adenylyl cyclases. In humans, GABAB receptor subtypes are involved in the etiology of neurologic and psychiatric disorders. In arthropods, however, these members of the G-protein-coupled receptor family are only inadequately characterized. Interestingly, physiological data have revealed important functions of GABAB receptors in the American cockroach, Periplaneta americana. We have cloned cDNAs coding for putative GABAB receptor subtypes 1 and 2 of P. americana (PeaGB1 and PeaGB2). When both receptor proteins are co-expressed in mammalian cells, activation of the receptor heteromer with GABA leads to a dose-dependent decrease in cAMP production. The pharmacological profile differs from that of mammalian and Drosophila GABAB receptors. Western blot analyses with polyclonal antibodies have revealed the expression of PeaGB1 and PeaGB2 in the CNS of the American cockroach. In addition to the widespread distribution in the brain, PeaGB1 is expressed in salivary glands and male accessory glands. Notably, PeaGB1-like immunoreactivity has been detected in the GABAergic salivary neuron 2, suggesting that GABAB receptors act as autoreceptors in this neuron. Copyright © 2014 Elsevier Ltd. All rights reserved.
There are more asthmatics in homes with high cockroach infestation
Directory of Open Access Journals (Sweden)
Sarinho E.
2004-01-01
Full Text Available Although asthma has been commonly associated with sensitivity to cockroaches, a clear causal relationship between asthma, allergy to cockroaches and exposure levels has not been extensively investigated. The objective of the present study was to determine whether asthma occurs more frequently in children living in homes with high cockroach infestation. The intensity of household infestation was assessed by the number of dead insects after professional pesticide application. Children living in these houses in the metropolitan area of Recife, PE, were diagnosed as having asthma by means of a questionnaire based on the ISAAC study. All children had physician-diagnosed asthma and at least one acute exacerbation in the past year. Children of both sexes aged 4 to 12 years who had been living in the households for more than 2 years participated in this transverse study and had a good socioeconomic status. In the 172 houses studied, 79 children were considered to have been exposed to cockroaches and 93 not to have been exposed. Children living in residences with more than 5 dead cockroaches after pesticide application were considered to be at high infestation exposure. Asthma was diagnosed by the questionnaire in 31.6% (25/79 of the exposed group and in 11.8% (11/93 of the non-exposed group (P = 0.001, with a prevalence ratio of 3.45 (95%CI, 1.48-8.20. The present results indicate that exposure to cockroaches was significantly associated with asthma among the children studied and can be considered a risk factor for the disease. Blattella germanica and Periplaneta americana were the species found in 96% of the infested houses.
Directory of Open Access Journals (Sweden)
Ruhma Syed
2014-06-01
Full Text Available The present study was designed to investigate the insecticidal efficacy of four different classes of insecticides: pyrethroids, organophosphates, phenyl-pyrazoles and neo-nicotenoids. One representative chemical from each class was selected to compare the toxicity: deltamethrin from pyrethroids, Dichlorovinyl Dimethyl Phosphate (DDVP from organophosphates, fipronil from phenyl-pyrazoles and imidacloprid from neo-nicotenoids. The objective of this study was to determine which of these insecticides were most effective against American cockroach.These insecticides were tested for their LC50 values against Periplaneta americana under topical bioassay method, using different concentrations for each chemical.Fipronil 2.5% EC was highly effective at all concentrations applied, while DDVP 50% EC was least toxic amongst all. One way analysis of variance confirmed significant differences between mortality of P. americana and different concentrations applied (P< 0.05.Locality differentiation is an important factor in determining the range of resistance between various localities, as all three localities behaved differently in terms of their levels of resistance.
2015-01-01
Artikkel "Fast and Powerful: Biomechanics and Bite Forces of the Mandibles in the American Cockroach Periplaneta americana" on ilmunud ajakirjas PLOS ONE November 11, 2015 DOI: 10.1371/journal.pone.0141226
Directory of Open Access Journals (Sweden)
Jucelio Peter Duarte
2015-05-01
Full Text Available Periplaneta americana is a species of great importance to public health, since it can act as a vector of many pathogens and it reaches large populations in urban environments. This is probably due to its ability to resist starvation and desiccation. This study aimed to evaluate the effects of absence of water and food on survival and weight change among adult P. americana individuals and check whether the initial weight of individuals influences on their survival. Four groups having twenty P. americana couples were formed and subject to: I no water or food; II no food; III no water; and IV control group. Insects were isolated according to the groups, which were weighed at the beginning and end of the stress conditions. They remained under these conditions until all individuals in each test group were dead. Stress conditions caused reduction in survival time when compared to the control group. Adults with higher body mass survived longer when deprived only of food, while among those lacking water, weight had no influence on survival. Total weight loss was greater among individuals deprived of water than those deprived only of food.
ORF Alignment: NT_033779 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available n-like protein CL3 [Periplaneta americana] ... Length = 128 ... Query: 1 ... MVLDNQEDKLLTTTFLKSMGLSFTQSWHH... NT_033779 gi|21357645 >1qddA 26 143 127 254 1e-07 ... dbj|BAA82266.1| Cockroach lecti
Potential of ultraviolet radiation for control of American cockroach populations
International Nuclear Information System (INIS)
Gingrich, J.B.; Pratt, J.J. Jr.; Mandels, G.R.
1977-01-01
Populations of Periplaneta americana (L.) were exposed for 8-20 week periods in specially designed rooms to 254 nm UV radiation at low intensity (50-115 ergs s -1 cm -2 ), high intensity (160-220 ergs s -1 cm -2 ), or to white light. The rooms contained tables and chairs to simulate occupied space, with food and water placed in positions exposed to UV radiation. 'General' irradiation (where the whole room was exposed to UV) at 115 ergs s -1 cm -2 and above was effective in producing high mortality in all stages except 8-10th instar nymphs and adults. 'Hot-spots' irradiation (where UV lamps were placed behind table and chair harborages) produced high mortality only in 1st-3rd instar nymphs which would result in slower elimination of a population. Crude aggregation pheromone was not successful in holding cockroaches close to radiation sources or substantially increasing mortality under the conditions of the experiments
Directory of Open Access Journals (Sweden)
Jucelio Peter Duarte
2015-03-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2015v28n2p103 Periplaneta americana is a species of great importance to public health, since it can act as a vector of many pathogens and it reaches large populations in urban environments. This is probably due to its ability to resist starvation and desiccation. This study aimed to evaluate the effects of absence of water and food on survival and weight change among adult P. americana individuals and check whether the initial weight of individuals influences on their survival. Four groups having twenty P. americana couples were formed and subject to: I no water or food; II no food; III no water; and IV control group. Insects were isolated according to the groups, which were weighed at the beginning and end of the stress conditions. They remained under these conditions until all individuals in each test group were dead. Stress conditions caused reduction in survival time when compared to the control group. Adults with higher body mass survived longer when deprived only of food, while among those lacking water, weight had no influence on survival. Total weight loss was greater among individuals deprived of water than those deprived only of food.
Nigerian Journal of Parasitology - Vol 32, No 2 (2011)
African Journals Online (AJOL)
The Role of Cockroaches (Blatta Orientalis and Periplaneta Americana) in Mechanical Transmission of Parasites in Households in Owerri, South East Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CMU Ajero, CN Ukaga, C Ebirim ...
African Journals Online (AJOL)
Figures indicate the percentage of each food eaten per day. Preference categories are as described in the text. Otomys irroratus. Rhabdomys pumilio. One. Two. Food species day days. Insects. Grasshoppers (Acrididae). 90. Termites (Hodotermes mossambicus). 50. Cockroaches (Periplaneta americana). 30. Mealworms ...
Population ecology and movement of the American cockroach (Dictyoptera: Blattidae) in sewers.
Tee, Hui-Siang; Saad, Ahmad Ramli; Lee, Chow-Yang
2011-07-01
The population size, age-class structure, and movement of the American cockroach, Periplaneta americana (L.) (Dictyoptera: Blattidae), were studied in three sewers in Penang, Malaysia, from September 2008 to October 2009. Eighteen to 20 glass-jar traps (two per manhole) were deployed for a 24-h period during each sampling occasion at each sewer. Adults and nymphs were active throughout the study period, with an average monthly trap catch of 57-97 adults and 79-99 nymphs. The mean proportions of adults and nymphs at the three sewers ranged from 0.47 to 0.57. Of the 2177 male and 2717 female cockroaches marked and released over the three sewers, recapture rates were 29.4-45.8 and 30.8-47.0%, respectively. The proportion of marked males and females did not differ significantly from the proportion of recaptured marked males and females. However, the mean number of times a marked female was recaptured was significantly greater than that of males. Of the 783 males and 1,030 females that were marked and recaptured, 19.4 and 24.7%, respectively, had moved between manholes, and significantly more females than males moved between manholes. Of the 406 recaptured marked adults that moved between manholes, 90.4% moved a distance of 2-20 m from their initial release site; one male moved 192 m, the longest distance recorded. Trap catch on each sampling occasion was positively correlated with daily mean temperature. The number of cockroach movements between manholes also was correlated with the mean daily minimum temperature.
Directory of Open Access Journals (Sweden)
Idin Zibaee
2015-12-01
Full Text Available The toxicity and knockdown effect of Eucalyptus globulus, Rosmarinus officinalis essential oils and their mixed formulation on Periplaneta Americana (L., Blattella germanica (L., Supella longipalpa, Culex pipiens, Anopheles stephensi and Musca domestica were evaluated in a series of laboratory experiments. In all bioassay five different doses (0.625, 1.25, 2.5, 5 and 10% were used by filter paper (cm2 and aerosol (cm3 bioassay methods, all essential oils was toxic to cockroaches, mosquitos and housefly species the lowest and the highest LC50 belong to mixed formulation on B. germanica (LC50 6.1 and E. globulus on P. americana (LC50 27.7 respectively. In continuous exposure experiments, Mortality (LT50 values for cockroaches ranged from 1403.3 min with 0.625% E. globulus (for P. americana to 2.2 min with 10% mixed formulation for A. stephensi. The KT50 values ranged from 0.1 to 1090.8 min for 10% and 0.625 for mixed formulation and R. officinalis respectively. The mortality after 24 h for mixed formulation was 100% but for single essential oils ranged from 81.5 to 98.3 for P. americana treated with R. officinalis and A. stephensi treated with E. globulus respectively. Studies on persistence of essential oils on impregnated paper revealed that it has more adulticidal activity for longer period at low storage temperature. Gas chromatographic-mass spectrometric analysis of essential oil showed 14 and 16 peaks for E. globules and R. officinalis respectively. α-Pinene (39.8%, 1, 8-Cineole (13.2%, Camphene (9.1% and Borneol (3.7% were present in major amounts for R. officinalis and 1,8-Cineole (31.4%, α-Pinene (15.3%, d-Limonene (9.7% and α-Terpinolen (5.3% were present in major amounts for E. globulus respectively. Our results showed that two surveyed essential oils has compatible with synergistic effect on various insect species, furthermore it is useful for applying as integrated pest management tool for studied insects management, especially in
Cockroaches as carriers of human intestinal parasites in two localities in Ethiopia.
Kinfu, Addisu; Erko, Berhanu
2008-11-01
A study was undertaken to assess the role of cockroaches as potential carriers of human intestinal parasites in Addis Ababa and Ziway, Ethiopia. A total of 6480 cockroaches were trapped from the two localities from October 2006 to March 2007. All the cockroaches trapped in Addis Ababa (n=2240) and almost 50% (2100/4240) of those trapped in Ziway were identified as Blattella germanica. The rest of the cockroaches trapped in Ziway were identified as Periplaneta brunnea (24.52%), Pycnoscelus surinamensis (16.03%) and Supella longipalpa (9.90%). Microscopic examination of the external body washes of pooled cockroaches and individual gut contents revealed that cockroaches are carriers of Entamoeba coli and Entamoeba histolytica/dispar cysts as well as Enterobius vermicularis, Trichuris trichiura, Taenia spp. and Ascaris lumbricoides ova. Besides their role as a nuisance, the present study further confirms that cockroaches serve as carriers of human intestinal parasites. The possible association of cockroaches with allergic conditions such as asthma is also discussed. Hence, appropriate control measures should be taken particularly to make hotels and residential areas free of cockroaches as they represent a health risk.
Directory of Open Access Journals (Sweden)
Andrew S French
2015-07-01
Full Text Available Our current understanding of insect phototransduction is based on a small number of species, but insects occupy many different visual environments. We created the retinal transcriptome of a nocturnal insect, the cockroach, Periplaneta americana to identify proteins involved in the earliest stages of compound eye phototransduction, and test the hypothesis that different visual environments are reflected in different molecular contributions to function. We assembled five novel mRNAs: two green opsins, one UV opsin, and one each TRP and TRPL ion channel homologs. One green opsin mRNA (pGO1 was 100-1000 times more abundant than the other opsins (pGO2 and pUVO, while pTRPL mRNA was 10 times more abundant than pTRP, estimated by transcriptome analysis or quantitative PCR (qPCR. Electroretinograms were used to record photoreceptor responses. Gene-specific in vivo RNA interference (RNAi was achieved by injecting long (596-708 bp double-stranded RNA into head hemolymph, and verified by qPCR. RNAi of the most abundant green opsin reduced both green opsins by more than 97% without affecting UV opsin, and gave a maximal reduction of 75% in ERG amplitude seven days after injection that persisted for at least 19 days. RNAi of pTRP and pTRPL genes each specifically reduced the corresponding mRNA by 90%. Electroretinogram reduction by pTRPL RNAi was slower than for opsin, reaching 75% attenuation by 21 days, without recovery at 29 days. pTRP RNAi attenuated ERG much less; only 30% after 21 days. Combined pTRP plus pTRPL RNAi gave only weak evidence of any cooperative interactions. We conclude that silencing retinal genes by in vivo RNAi using long dsRNA is effective, that visible light transduction in Periplaneta is dominated by pGO1, and that pTRPL plays a major role in cockroach phototransduction.
Cellular elements for seeing in the dark: voltage-dependent conductances in cockroach photoreceptors
Directory of Open Access Journals (Sweden)
Salmela Iikka
2012-08-01
Full Text Available Abstract Background The importance of voltage-dependent conductances in sensory information processing is well-established in insect photoreceptors. Here we present the characterization of electrical properties in photoreceptors of the cockroach (Periplaneta americana, a nocturnal insect with a visual system adapted for dim light. Results Whole-cell patch-clamped photoreceptors had high capacitances and input resistances, indicating large photosensitive rhabdomeres suitable for efficient photon capture and amplification of small photocurrents at low light levels. Two voltage-dependent potassium conductances were found in the photoreceptors: a delayed rectifier type (KDR and a fast transient inactivating type (KA. Activation of KDR occurred during physiological voltage responses induced by light stimulation, whereas KA was nearly fully inactivated already at the dark resting potential. In addition, hyperpolarization of photoreceptors activated a small-amplitude inward-rectifying (IR current mediated at least partially by chloride. Computer simulations showed that KDR shapes light responses by opposing the light-induced depolarization and speeding up the membrane time constant, whereas KA and IR have a negligible role in the majority of cells. However, larger KA conductances were found in smaller and rapidly adapting photoreceptors, where KA could have a functional role. Conclusions The relative expression of KA and KDR in cockroach photoreceptors was opposite to the previously hypothesized framework for dark-active insects, necessitating further comparative work on the conductances. In general, the varying deployment of stereotypical K+ conductances in insect photoreceptors highlights their functional flexibility in neural coding.
Directory of Open Access Journals (Sweden)
Andrew J. Clark
2014-07-01
Full Text Available The structural and material properties of insect cuticle remain largely unexplored, even though they comprise the majority (approximately 80% of animals. Insect cuticle serves many functions, including protection against predatory attacks, which is especially beneficial to species failing to employ effective running escape responses. Despite recent advances in our understanding of insect escape behaviors and the biomechanics of insect cuticle, there are limited studies on the protective qualities of cuticle to extreme mechanical stresses and strains imposed by predatory attacks, and how these qualities vary between species employing different escape responses. Blattarians (cockroaches provide an appropriate model system for such studies. Wind-evoked running escape responses are strong in Periplaneta americana, weak in Blaberus craniifer and absent in Gromphodorhina portentosa, putting the latter two species at greater risk of being struck by a predator. We hypothesized that the exoskeletons in these two larger species could provide more protection from predatory strikes relative to the exoskeleton of P. americana. We quantified the protective qualities of the exoskeletons by measuring the puncture resistance, tensile strength, strain energy storage, and peak strain in fresh samples of thoracic and abdominal cuticles from these three species. We found a continuum in puncture resistance, tensile strength, and strain energy storage between the three species, which were greatest in G. portentosa, moderate in B. craniifer, and smallest in P. americana. Histological measurements of total cuticle thickness followed this same pattern. However, peak strain followed a different trend between species. The comparisons in the material properties drawn between the cuticles of G. portentosa, B. craniifer, and P. americana demonstrate parallels between cuticular biomechanics and predator running escape responses.
Variation in the mechanical properties of tracheal tubes in the American cockroach
International Nuclear Information System (INIS)
Becker, Winston R; Webster, Matthew R; De Vita, Raffaella; Socha, John J
2014-01-01
The insect cuticle serves the protective role of skin and the supportive role of the skeleton while being lightweight and flexible to facilitate flight. The smart design of the cuticle confers camouflage, thermo-regulation, communication, self-cleaning, and anti-wetting properties to insects. The mechanical behavior of the internal cuticle of the insect in tracheae remains largely unexplored due to their small size. In order to characterize the material properties of insect tracheae and understand their role during insect respiration, we conducted tensile tests on ring sections of tracheal tubes of American cockroaches (Periplaneta americana). A total of 33 ring specimens collected from 14 tracheae from the upper thorax of the insects were successfully tested. The ultimate tensile strength (22.6 ± 13.3 MPa), ultimate strain (1.57 ± 0.68%), elastic modulus (1740 ± 840 MPa), and toughness (0.175 ± 0.156 MJ m −3 ) were measured. We examined the high variance in mechanical properties statistically and demonstrated that ring sections excised from the same trachea exhibit comparable mechanical properties. Our results will form the basis for future studies aimed at determining the structure–function relationship of insect tracheal tubes, ultimately inspiring the design of multi-functional materials and structures. (technical note)
Czech Academy of Sciences Publication Activity Database
Gladysz, M.; Guzik, J.; Sehadová, Hana; Baran, B.; Bembenek, J.; Dolezych, B.
2015-01-01
Roč. 112, č. 2 (2015), s. 235-244 ISSN 1210-5759 Institutional support: RVO:60077344 Keywords : Blattodea * Periplaneta americana * Gromphadorhina portentosa Subject RIV: ED - Physiology Impact factor: 0.975, year: 2014 http://www.eje.cz/corproof.php?tartkey=eje-000000-0111#.VRVB0PmG8mM
Jobet, E; Bougnoux, M E; Morand, S; Rivault, C; Cloarec, A; Hugot, J P
1998-03-01
Random amplified DNA markers (RAPD; Williams et al., 1990) were used to obtained specific RAPD fragments characterising different species of oxyuroids. We tested six species of worms parasitizing vertebrates or invertebrates: Passalurus ambiguus Rudolphi, 1819, parasite of Leporids; Syphacia obvelata (Rudolphi, 1802) Seurat, 1916, a parasite of rodents; Blatticola blattae (Graeffe, 1860) Chitwood, 1932 parasite of the cockroach Blattella germanica; Hammerschmidtiella diesingi (Hammerschmidt, 1838) Chitwood, 1932 and Thelastoma bulhoesi (Magalhaes, 1990) Travassos, 1929, parasites of the cockroach Periplaneta americana, and an undescribed parasite species of a passalid insect from New Caledonia. Among 15 oligonucleotides tested, nine produced several specific bands allowing the interspecific discrimination.
Directory of Open Access Journals (Sweden)
Kühnel Dana
2002-06-01
Full Text Available Abstract Background The cockroach salivary gland consists of secretory acini with peripheral ion-transporting cells and central protein-producing cells, an extensive duct system, and a pair of reservoirs. Salivation is controled by serotonergic and dopaminergic innervation. Serotonin stimulates the secretion of a protein-rich saliva, dopamine causes the production of a saliva without proteins. These findings suggest a model in which serotonin acts on the central cells and possibly other cell types, and dopamine acts selectively on the ion-transporting cells. To examine this model, we have analyzed the spatial relationship of dopaminergic and serotonergic nerve fibers to the various cell types. Results The acinar tissue is entangled in a meshwork of serotonergic and dopaminergic varicose fibers. Dopaminergic fibers reside only at the surface of the acini next to the peripheral cells. Serotonergic fibers invade the acini and form a dense network between central cells. Salivary duct segments close to the acini are locally associated with dopaminergic and serotonergic fibers, whereas duct segments further downstream have only dopaminergic fibers on their surface and within the epithelium. In addition, the reservoirs have both a dopaminergic and a serotonergic innervation. Conclusion Our results suggest that dopamine is released on the acinar surface, close to peripheral cells, and along the entire duct system. Serotonin is probably released close to peripheral and central cells, and at initial segments of the duct system. Moreover, the presence of serotonergic and dopaminergic fiber terminals on the reservoir indicates that the functions of this structure are also regulated by dopamine and serotonin.
Enterobactérias isoladas de baratas (Periplaneta americana capturadas em um hospital brasileiro
Directory of Open Access Journals (Sweden)
Marinésia A. Prado
2002-02-01
Full Text Available Objetivo. Isolar e identificar microrganismos em baratas capturadas em um hospital público e determinar o seu perfil de suscetibilidade antimicrobiana. Métodos. As baratas foram capturadas nos períodos matutino e noturno, colocadas em frascos desinfetados com álcool a 70%, transferidas para um frasco estéril e levadas ao laboratório. Consideraram-se as baratas íntegras e vivas, as quais foram colocadas em solução salina estéril (0,8% e homogeneizadas. Essa solução foi semeada nos meios de cultura ágar MacConkey, caldo nutriente, infusão de cérebro e coração (ágar BHI, ágar Sabouraud e ágar manitol. As culturas foram examinadas em um estereomicroscópio para a contagem das unidades formadoras de colônias. Para a determinação do perfil de suscetibilidade antimicrobiana utilizou-se o teste de difusão de disco. Resultados. Detectou-se prevalência de 56% de enterobactérias e de 18% de estafilococos coagulase negativos. Identificaram-se 15 espécies de enterobactérias. As mais freqüentes foram Klebsiella pneumoniae (17%; Enterobacter aerogenes (14%; Serratia marcescens (13%; Hafnia alvei (12%; Enterobacter gergoviae e Enterobacter cloacae (9%; e Serratia spp. (6%. Tanto as enterobactérias quanto os estafilococos coagulase negativos apresentaram uma resistência significativa aos antimicrobianos, inclusive à oxacilina. Conclusões. A prevalência de bactérias enteropatogênicas e de estafilococos coagulase negativos isolados de baratas Periplaneta americana no hospital estudado demonstra a fragilidade das condutas adotadas tanto para o controle de vetores quanto para o uso dos antimicrobianos. Os resultados demonstram a necessidade da implementação de um programa efetivo de saneamento ambiental e do uso racional dos antimicrobianos dentro das instituições de saúde.
Enterobactérias isoladas de baratas (Periplaneta americana capturadas em um hospital brasileiro
Directory of Open Access Journals (Sweden)
Prado Marinésia A.
2002-01-01
Full Text Available Objetivo. Isolar e identificar microrganismos em baratas capturadas em um hospital público e determinar o seu perfil de suscetibilidade antimicrobiana. Métodos. As baratas foram capturadas nos períodos matutino e noturno, colocadas em frascos desinfetados com álcool a 70%, transferidas para um frasco estéril e levadas ao laboratório. Consideraram-se as baratas íntegras e vivas, as quais foram colocadas em solução salina estéril (0,8% e homogeneizadas. Essa solução foi semeada nos meios de cultura ágar MacConkey, caldo nutriente, infusão de cérebro e coração (ágar BHI, ágar Sabouraud e ágar manitol. As culturas foram examinadas em um estereomicroscópio para a contagem das unidades formadoras de colônias. Para a determinação do perfil de suscetibilidade antimicrobiana utilizou-se o teste de difusão de disco. Resultados. Detectou-se prevalência de 56% de enterobactérias e de 18% de estafilococos coagulase negativos. Identificaram-se 15 espécies de enterobactérias. As mais freqüentes foram Klebsiella pneumoniae (17%; Enterobacter aerogenes (14%; Serratia marcescens (13%; Hafnia alvei (12%; Enterobacter gergoviae e Enterobacter cloacae (9%; e Serratia spp. (6%. Tanto as enterobactérias quanto os estafilococos coagulase negativos apresentaram uma resistência significativa aos antimicrobianos, inclusive à oxacilina. Conclusões. A prevalência de bactérias enteropatogênicas e de estafilococos coagulase negativos isolados de baratas Periplaneta americana no hospital estudado demonstra a fragilidade das condutas adotadas tanto para o controle de vetores quanto para o uso dos antimicrobianos. Os resultados demonstram a necessidade da implementação de um programa efetivo de saneamento ambiental e do uso racional dos antimicrobianos dentro das instituições de saúde.
Adipokinetic hormones control amylase activity in the cockroach (Periplaneta americana) gut
Czech Academy of Sciences Publication Activity Database
Bodláková, K.; Jedlička, Pavel; Kodrík, Dalibor
2017-01-01
Roč. 24, č. 2 (2017), s. 259-269 ISSN 1672-9609 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:61388963 ; RVO:60077344 Keywords : AKH * AKH receptor * amylase * enzyme * gene expression * midgut Subject RIV: ED - Physiology OBOR OECD: Entomology; Biochemistry and molecular biology (BC-A) Impact factor: 2.026, year: 2016
Directory of Open Access Journals (Sweden)
Xandrix Augusto Ruiz Cabezas
2015-06-01
Full Text Available Este estudio, determinó la presencia de Enterobacteriáceas en partes externas del estadío adulto de Periplaneta americana “cucaracha” capturadas en el mercado Modelo de la ciudad de Iquitos. Fueron colectados un total de 68 “cucarachas”, y luego cada una fue depositada en un frasco estéril y trasladadas vivas para el análisis respectivo al laboratorio de Investigación de la Facultad de Ciencias Biológicas; después del aislamiento, las colonias observadas fueron sometidas a pruebas de identificación bioquímica tales como: Prueba de oxidasa, utilización de glucosa, lactosa y sacarosa (agar TSI, pruebas VP-RM, indol, hidrólisis de la úrea. La prevalencia de Enterobacteriáceas se determinó utilizando el método estadístico de distribución de frecuencias y la prueba no paramétrica de Chi cuadrado para prueba de hipótesis. De las 68 cucarachas analizadas se aislaron 118 colonias caracterizadas como lactosa positiva y lactosa negativa, representando el 71 % y 29 % respectivamente de las muestras analizadas. Finalmente, se aisló e identificó 5 cepas bacterianas, categorizadas en 5 géneros: Providencia (25%, Edwardsiella (9%, Citrobacter (14%, Enterobacter (31% y Klebsiella (21%.
Directory of Open Access Journals (Sweden)
Hamid Kassiri
2018-03-01
Full Text Available Background: Cockroaches are the most prevalent domestic pests of a worldwide distribution. They were recognized as possible vectors of pathogenic bacteria, viruses, fungi and parasites in residential dwellings and hospital environments. The present study isolated and identified yeasts and filamentous fungi from digestive tract of American cockroaches, collected from three different residential regions of Iran.Methods: Seventy cockroaches were sampled using direct collection (hand catch, vacuum cleaner and sticky traps in Ahvaz, Iran in 2009–2010. Their medically important fungal microorganisms were isolated from digestive tract using standard mycological methods. Filamentous fungi were identified by macroscopic and microscopic examination. Yeasts were identified by API ID32C-32100 kit.Results: A high percentage of cockroaches (88.6% were detected to carry fungi of medical importance. Overall, 23 fungi species/genera were isolated from the American cockroaches' alimentary tract. The fungi isolated from cockroaches, from the residential regions were species of Aspergillus, Rhizopus, Penicillium, Mucorales, Alternaria, Cladosporium, Mycelia, Chrysosporium, Candida, Rhodotorula, Zygosaccharomyces, and Debaryomyces. Candida spp. (41.4%, Aspergillus spp. (37.1% and Rhodotorula spp (27.1% were the most common fungi recovered on cockroaches. Candida albicans and Candida glabrata were the commonest species of the genus Candida. In addition, Aspergillus niger and A. flavus were the most frequent species of the genus Aspergillus.Conclusion: American cockroaches may carry pathogenic fungi in the urban areas of Ahvaz.
Polsinelli, Gregory A; Singh, Sanjay K; Mishra, Rajesh K; Suranyi, Robert; Ragsdale, David W; Pang, Yuan-Ping; Brimijoin, Stephen
2010-09-06
Insecticides directed against acetylcholinesterase (AChE) are facing increased resistance among target species as well as increasing concerns for human toxicity. The result has been a resurgence of disease vectors, insects destructive to agriculture, and residential pests. We previously reported a free cysteine (Cys) residue at the entrance to the AChE active site in some insects but not higher vertebrates. We also reported Cys-targeting methanethiosulfonate molecules (AMTSn), which, under conditions that spared human AChE, caused total irreversible inhibition of aphid AChE, 95% inhibition of AChE from the malaria vector mosquito (Anopheles gambia), and >80% inhibition of activity from the yellow fever mosquito (Aedes aegypti) and northern house mosquito (Culex pipiens). We now find the same compounds inhibit AChE from cockroaches (Blattella germanica and Periplaneta americana), the flour beetle (Tribolium confusum), the multi-colored Asian ladybird beetle (Harmonia axyridis), the bed bug (Cimex lectularius), and a wasp (Vespula maculifrons), with IC(50) values of approximately 1-11muM. Our results support further study of Cys-targeting inhibitors as conceptually novel insecticides that may be free of resistance in a range of insect pests and disease vectors and, compared with current compounds, should demonstrate much lower toxicity to mammals, birds, and fish. Copyright (c) 2010 Elsevier Ireland Ltd. All rights reserved.
... the Allergist Search Health Professionals Partners Media Donate Allergies Cockroach Allergy Cockroaches are insects that live in many locations ... other children with asthma. What Is a Cockroach Allergy? Cockroaches contain a protein that is an allergen ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0816 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0816 ref|YP_003256804.1| cell cycle protein [Blattabacterium sp. (Periplanet...a americana) str. BPLAN] gb|ACX83661.1| cell cycle protein [Blattabacterium sp. (Periplaneta americana) str. BPLAN] YP_003256804.1 0.002 27% ...
Directory of Open Access Journals (Sweden)
Einat eFuchs
2011-01-01
Full Text Available Animals’ ability to demonstrate both stereotyped and adaptive locomotor behavior is largely dependent on the interplay between centrally-generated motor patterns and the sensory inputs that shape them. We utilized a combined experimental and theoretical approach to investigate the relative importance of CPG interconnections vs. intersegmental afferents in the cockroach: an animal that is renowned for rapid and stable locomotion. We simultaneously recorded coxal levator and depressor motor neurons (MN in the thoracic ganglia of Periplaneta americana, while sensory feedback was completely blocked or allowed only from one intact stepping leg. In the absence of sensory feedback, we observed a coordination pattern with consistent phase relationship that shares similarities with a double tripod gait, suggesting central, feedforward control. This intersegmental coordination pattern was then reinforced in the presence of sensory feedback from a single stepping leg. Specifically, we report on transient stabilization of phase differences between activity recorded in the middle and hind thoracic MN following individual front-leg steps, suggesting a role for afferent phasic information in the coordination of motor circuits at the different hemiganglia. Data were further analyzed using stochastic models of coupled oscillators and maximum likelihood techniques to estimate underlying physiological parameters, such as uncoupled endogenous frequencies of hemisegmental oscillators and coupling strengths and directions. We found that descending ipsilateral coupling is stronger than ascending coupling, while left-right coupling in both the meso- and meta-thoracic ganglia appear to be symmetrical. We discuss our results in comparison with recent findings in stick insects that share similar neural and body architectures, and argue that the two species may exemplify opposite extremes of a fast-slow locomotion continuum, mediated through different intersegmental
Ampulexins: A New Family of Peptides in Venom of the Emerald Jewel Wasp, Ampulex compressa.
Moore, Eugene L; Arvidson, Ryan; Banks, Christopher; Urenda, Jean Paul; Duong, Elizabeth; Mohammed, Haroun; Adams, Michael E
2018-03-27
The parasitoid wasp Ampulex compressa injects venom directly into the brain and subesophageal ganglion of the cockroach Periplaneta americana, inducing a 7 to 10 day lethargy termed hypokinesia. Hypokinesia presents as a significant reduction in both escape response and spontaneous walking. We examined aminergic and peptidergic components of milked venom with HPLC and MALDI-TOF mass spectrometry. HPLC coupled with electrochemical detection confirmed the presence of dopamine in milked venom, while mass spectrometry revealed that the venom gland and venom sac have distinct peptide profiles, with milked venom predominantly composed of venom sac peptides. We isolated and characterized novel α-helical, amphipathic venom sac peptides that constitute a new family of venom toxins termed ampulexins. Injection of the most abundant venom peptide, ampulexin 1, into the subesophageal ganglion of cockroaches resulted in a short-term increase in escape threshold. Neither milked venom nor venom peptides interfered with growth of Escherichia coli or Bacillus thuringiensis on agar plates, and exposure to ampulexins or milked venom did not induce cell death in Chinese hamster ovary cells (CHO-K1) or Hi5 cells ( Trichoplusia ni).
Directory of Open Access Journals (Sweden)
Katharina Weiss
Full Text Available Effective antimicrobial strategies are essential adaptations of insects to protect themselves, their offspring, and their foods from microbial pathogens and decomposers. Larvae of the emerald cockroach wasp, Ampulex compressa, sanitize their cockroach hosts, Periplaneta americana, with a cocktail of nine antimicrobials comprising mainly (R-(--mellein and micromolide. The blend of these antimicrobials has broad-spectrum antimicrobial activity. Here we explore the spatio-temporal pattern of deployment of antimicrobials during the development from egg to adult as well as their physico-chemical properties to assess how these aspects may contribute to the success of the antimicrobial strategy. Using gas chromatography/mass spectrometry (GC/MS we show that larvae start sanitizing their food as soon as they have entered their host to feed on its tissue. Subsequently, they impregnate the cockroach carcass with antimicrobials to create a hygienic substrate for cocoon spinning inside the host. Finally, the antimicrobials are incorporated into the cocoon. The antimicrobial profiles on cockroach and wasp cocoon differed markedly. While micromolide persisted on the cockroaches until emergence of the wasps, solid-phase microextraction sampling and GC/MS analysis revealed that (R-(--mellein vaporized from the cockroaches and accumulated in the enclosed nest. In microbial challenge assays (R-(--mellein in the headspace of parasitized cockroaches inhibited growth of entomopathogenic and opportunistic microbes (Serratia marcescens, Aspergillus sydowii, Metarhizium brunneum. We conclude that, in addition to food sanitation, A. compressa larvae enclose themselves in two defensive walls by impregnating the cocoon and the cockroach cuticle with antimicrobials. On top of that, they use vaporous (R-(--mellein to sanitize the nest by fumigation. This multifaceted antimicrobial defense strategy involving the spatially and temporally coordinated deployment of several
Life History of the Emerald Jewel Wasp Ampulex compressa
Directory of Open Access Journals (Sweden)
Ryan Arvidson
2018-04-01
Full Text Available The Emerald Jewel Wasp Ampulex compressa (Fabricius is an endoparasitoid of the American cockroach Periplaneta americana (Linnaeus. Its host subjugation strategy is unusual in that envenomation is directed into the host central nervous system, eliciting a long-term behavior modification termed hypokinesia, turning stung cockroaches into a lethargic and compliant, but not paralyzed, living food supply for wasp offspring. A. compressa manipulates hypokinesic cockroaches into a burrow, where it oviposits a single egg onto a mesothoracic leg, hatching three days later. Herein we describe the life history and developmental timing of A. compressa. Using head capsule measurements and observations of mandibular morphology, we found that the larvae develop through three instars, the first two ectoparasitoid, and the third exclusively endoparasitoid. The first two instars have mandibles sufficient for piercing and cutting the cuticle respectively, while the third instar has a larger and blunter mandibular structure. During ecdysis to the third instar, the larva enters the body cavity of the cockroach, consuming internal tissues selectively, including fat body and skeletal muscle, but sparing the gut and Malpighian tubules. The developmental timing to pupation is similar between males and females, but cocoon volume and mass, and pupation duration are sexually dimorphic. Further, we show that the difference in cocoon mass and volume can be used to predict sex before eclosion, which is valuable for studies in venom pharmacology, as only females produce venom.
Status of and future research on thermosensory processing
Directory of Open Access Journals (Sweden)
Makoto eMizunami
2016-04-01
Full Text Available Thermosensation is critically important for survival of all animals. In the cockroach Periplaneta americana, thermoreceptor neurons on antennae and thermosensory interneurons in the antennal lobe have been characterized electrophysiologically, and recent studies using advanced transgenic technologies in the fruit fly Drosophila melanogaster have added much to the knowledge of these neurons, enabling us to discuss common principles of thermosensory processing systems in insects. Cockroaches and many other insects possess only one type of thermoreceptor neurons on antennae that are excited by cooling and inhibited by warming. In contrast, the antennae of fruit flies and other dipterans possess oppositely responding warm and cold receptor neurons. Despite differences in their thermoreceptive equipment, central processing of temperature information is much the same in flies and cockroaches. Axons of thermoreceptor neurons project to the margin of the antennal lobe and form glomeruli, from which cold, warm and cold-warm projection neurons originate, the last neurons being excited by both cooling and warming. Axons of antennal lobe thermosensory projection neurons of the antennal lobe terminate in three distinct areas of the protocerebrum, the mushroom body, lateral horn and posterior lateral protocerebrum, the last area also receiving termination of hygrosensory projection neurons. Such multiple thermosensory pathways may serve to control multiple forms of thermosensory behavior. Electrophysiological studies on cockroaches and transgenic approaches in flies are encouraged to complement each other for further elucidating general principles of thermosensory processing in the insect brain.
Allergens involved in the cross-reactivity of Aedes aegypti with other arthropods.
Cantillo, Jose Fernando; Puerta, Leonardo; Lafosse-Marin, Sylvie; Subiza, Jose Luis; Caraballo, Luis; Fernandez-Caldas, Enrique
2017-06-01
Cross-reactivity between Aedes aegypti and mites, cockroaches, and shrimp has been previously suggested, but the involved molecular components have not been fully described. To evaluate the cross-reactivity between A aegypti and other arthropods. Thirty-four serum samples from patients with asthma and/or allergic rhinitis were selected, and specific IgE to A aegypti, Dermatophagoides pteronyssinus, Dermatophagoides farinae, Blomia tropicalis, Periplaneta americana. and Litopenaeus vannamei was measured by enzyme-linked immunosorbent assay. Cross-reactivity was investigated using pooled serum samples from allergic patients, allergenic extracts, and the recombinant tropomyosins (Aed a 10.0201, Der p 10, Blo t 10, Lit v 1, and Per a 7). Four IgE reactive bands were further characterized by matrix-assisted laser desorption/ionization tandem time of flight. Frequency of positive IgE reactivity was 82.35% to at least one mite species, 64.7% to A aegypti, 29.4% to P americana, and 23.5% to L vannamei. The highest IgE cross-reactivity was seen between A aegypti and D pteronyssinus (96.6%) followed by L vannamei (95.4%), B tropicalis (84.4%), and P americana (75.4%). Recombinant tropomyosins from mites, cockroach, or shrimp inhibited the IgE reactivity to the mosquito at a lower extent than the extracts from these arthropods. Several bands of A aegypti cross-reacted with arthropod extracts, and 4 of them were identified as odorant binding protein, mitochondrial cytochrome C, peptidyl-prolyl cis-trans isomerase, and protein with hypothetical magnesium ion binding function. We identified 4 novel cross-reactive allergens in A aegypti allergenic extract. These molecules could influence the manifestation of allergy to environmental allergens in the tropics. Copyright © 2017 American College of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.
Rietdorf, Katja
2003-07-01
AMP und / oder cGMP erhöht und anschließend den Proteingehalt im Endspeichel gemessen. Ein Anstieg der intrazellulären Ca2+-Konzentration aktiviert nur eine geringe Rate der Proteinsekretion. Dagegen kann die Steigerung der intrazellulären cAMP-Konzentration eine stärkere Proteinsekretion aktivieren, die sich nicht signifikant von der nach 5-HT-Stimulierung unterscheidet. Die cAMP-stimulierte Proteinsekretion kann durch gleichzeitige Erhöhung der intrazellulären Ca2+-Konzentration weiter gesteigert werden. Dagegen aktivierte eine Erhöhung der intrazellulären cGMP-Konzentration die Proteinsekretion nicht. Aufgrund dieser Ergebnisse postuliere ich die Existenz eines die Adenylatcyclase aktivierenden 5-HT-Rezeptors in der Basolateralmembran der C-Zellen. The aim of this PhD-work was to investigate major mechanisms of excitation-secretion coupling in the salivary gland of the cockroach Periplaneta americana (L.). This salivary gland is innervated by dopaminergic and serotonergic fibres (Baumann et al., 2002). The two transmitters stimulate different processes in the gland: Dopamine (DA) stimulates the p-cells of the acini and the salivary duct cells, whereas 5-HT (serotonin) activates the p- and the c-cells of the acini, but not the salivary duct cells. Final saliva is completely protein-free after dopamine stimulation. It contains proteins, which are secreted by the c-cells of the acini, after a 5-HT-stimulation (Just & Walz, 1996). In the first part of my work I measured the electrolytic composition of the final saliva by capillary electrophoretic analysis and measured the rates of fluid secretion, in order to answer the following questions: 1.) Which transporters affect the production of primary saliva and its modification? 2.) What is the function of the transport-active salivary duct cells for the modification of the primary saliva? Electrolytic composition of the DA- and 5-HT-stimulated final saliva is not significantly different from each other, and is
Analysis of Cockroach Fauna and Frequency in Human Residential Habitats of North of Isfahan, Iran
Directory of Open Access Journals (Sweden)
Dehghani R.1 PhD,
2016-08-01
Full Text Available Aims Considering the medical significance of cockroaches as insect vectors of food toxicities, and triggering allergy in respiratory system and skin, this survey was conducted to study the frequency of infestation and their effective factors in Shahin Shahr, Iran. Materials & Methods This cross-sectional descriptive study was carried out in 2010 in Shahin Shahr, Isfahan, Iran. Data gathering instrument was a researcher-made questionnaire regarding to the research aims. Data were analyzed by SPSS 11.5 software using Chi square and Fisher exact tests. Findings 675 of 1000 studied houses (67.5% were infested by all life stages of the cockroaches and 32.5% had no infestation. 46% of infested houses had few, 30% had medium and 24% had high infestation. the bathrooms and toilets were recognized as the most infested places (41%. There were significant relationships between infestation of houses and the age of building (p<0.001, the type of building (p=0.009 and the education level of the family (p<0.001. Significant difference was found between houses equipped their doors and windows by tulles and without tulles (p=0.03. Most infection was found in houses sheltering 5 and more people (72.3%. Significant correlation was found between the infection and the number of family members (p=0.0012. Conclusion Infestation rate of cockroaches in Shahin Shahr houses is high and is mostly of P. americana species.
Geographical Assessment of Sacred Groves in Bolpur Sub-division ...
African Journals Online (AJOL)
Dr Osondu
area). Methodology. A total 41 different Sacred Groves in Bolpur sub- division area were randomly ... as breeding sites for some animals and recreational facilities. Groves of Bolpur ..... Cockroach(Periplaneta anericane),Black bee. Reptiles.
Cockroaches probably cleaned up after dinosaurs.
Vršanský, Peter; van de Kamp, Thomas; Azar, Dany; Prokin, Alexander; Vidlička, L'ubomír; Vagovič, Patrik
2013-01-01
Dinosaurs undoubtedly produced huge quantities of excrements. But who cleaned up after them? Dung beetles and flies with rapid development were rare during most of the Mesozoic. Candidates for these duties are extinct cockroaches (Blattulidae), whose temporal range is associated with herbivorous dinosaurs. An opportunity to test this hypothesis arises from coprolites to some extent extruded from an immature cockroach preserved in the amber of Lebanon, studied using synchrotron X-ray microtomography. 1.06% of their volume is filled by particles of wood with smooth edges, in which size distribution directly supports their external pre-digestion. Because fungal pre-processing can be excluded based on the presence of large particles (combined with small total amount of wood) and absence of damages on wood, the likely source of wood are herbivore feces. Smaller particles were broken down biochemically in the cockroach hind gut, which indicates that the recent lignin-decomposing termite and cockroach endosymbionts might have been transferred to the cockroach gut upon feeding on dinosaur feces.
A novel neurotoxin from venom of the spider, Brachypelma albopilosum.
Directory of Open Access Journals (Sweden)
Yunhua Zhong
Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.
Sarinho, E C S; Mariano, J; Sarinho, S W; Medeiros, D; Rizzo, J A; Almerinda R, S; Solé, D
2009-01-01
To assess the kind and frequency of sensitisation to aeroallergens (skin prick test - SPT) of asthmatic and non-asthmatic adolescents (13-14 years old) living in the city of Caruaru, Northeast of Brazil, and to analyse their exposure to some environmental factors. A case-control study was conducted with asthmatic (50) and non-asthmatic (150) adolescents diagnosed by the International Study of Asthma and Allergies in Childhood (ISAAC) written questionnaire. All were submitted to SPT with aeroallergens (house dust mites, cat and dog epithelium, cockroaches, moulds and grass) and completed a questionnaire to evaluate their environmental exposure. There were no significant differences between groups regarding gender, age, number of siblings and environmental exposure. Asthmatic subjects exhibited a higher frequency of positive SPTs than non-asthmatic subjects (54.0% vs 33.3%, p=0.009) mainly due to Periplaneta americana (34.0% vs 12.7%, p=0.0007 respectively) and Canis familiaris (20.0% vs 8.7%, p=0.029). Although sensitisation to aeroallergens was high among non-asthmatic adolescents, asthma was associated with parental history of atopic disease and sensitisation to P. americana and Canis familiaris but not to D. pteronyssinus showing that local studies are mandatory for the tailoring of appropriate management of allergic diseases.
Cockroaches probably cleaned up after dinosaurs.
Directory of Open Access Journals (Sweden)
Peter Vršanský
Full Text Available Dinosaurs undoubtedly produced huge quantities of excrements. But who cleaned up after them? Dung beetles and flies with rapid development were rare during most of the Mesozoic. Candidates for these duties are extinct cockroaches (Blattulidae, whose temporal range is associated with herbivorous dinosaurs. An opportunity to test this hypothesis arises from coprolites to some extent extruded from an immature cockroach preserved in the amber of Lebanon, studied using synchrotron X-ray microtomography. 1.06% of their volume is filled by particles of wood with smooth edges, in which size distribution directly supports their external pre-digestion. Because fungal pre-processing can be excluded based on the presence of large particles (combined with small total amount of wood and absence of damages on wood, the likely source of wood are herbivore feces. Smaller particles were broken down biochemically in the cockroach hind gut, which indicates that the recent lignin-decomposing termite and cockroach endosymbionts might have been transferred to the cockroach gut upon feeding on dinosaur feces.
Microbial Carriage of Cockroaches at a Tertiary Care Hospital in Ghana
Directory of Open Access Journals (Sweden)
Patience B. Tetteh-Quarcoo
2013-01-01
Full Text Available Cockroaches are common in the environment of many hospitals in Ghana; however, little is known about their public health risks. To evaluate potential risks, we investigated the external and internal microbial flora of 61 cockroaches from a tertiary hospital in Ghana and evaluated the antibiotic resistance profiles of the common bacterial species. Standard methods were used in all the microbiological investigations and antibiotic susceptibility testing. A rotavirus carriage rate of 19.7% was observed among the cockroaches. Four types of intestinal parasites were carried externally by the cockroaches, and the most prevalent was Hookworm (4.9%. Eight nosocomial bacteria were isolated from the cockroaches, and the most prevalent was Klebsiella pneumoniae , which occurred internally in 29.5% of the cockroaches and 26.2% externally. Multiple drug resistance among common bacteria isolated from the cockroaches ranged from 13.8% ( Escherichia coli to 41.1% ( Klebsiella pneumoniae . Cockroaches constitute an important reservoir for pathogenic microorganisms, and may be important vectors of multiple resistant nosocomial pathogens in the studied hospital.
Vectorial Potential of Cockroaches in Transmitting Parasites of ...
African Journals Online (AJOL)
infectious pathogens, control measures instituted in toilets, kitchens; and targeting especially the females and both stages of ... Cockroaches are among the most notorious pests of premises, they ..... Bacterial of cockroaches in relation to urban.
Allergenic characterization of a novel allergen, homologous to chymotrypsin, from german cockroach.
Jeong, Kyoung Yong; Son, Mina; Lee, Jae Hyun; Hong, Chein Soo; Park, Jung Won
2015-05-01
Cockroach feces are known to be rich in IgE-reactive components. Various protease allergens were identified by proteomic analysis of German cockroach fecal extract in a previous study. In this study, we characterized a novel allergen, a chymotrypsin-like serine protease. A cDNA sequence homologous to chymotrypsin was obtained by analysis of German cockroach expressed sequence tag (EST) clones. The recombinant chymotrypsins from the German cockroach and house dust mite (Der f 6) were expressed in Escherichia coli using the pEXP5NT/TOPO vector system, and their allergenicity was investigated by ELISA. The deduced amino acid sequence of German cockroach chymotrypsin showed 32.7 to 43.1% identity with mite group 3 (trypsin) and group 6 (chymotrypsin) allergens. Sera from 8 of 28 German cockroach allergy subjects (28.6%) showed IgE binding to the recombinant protein. IgE binding to the recombinant cockroach chymotrypsin was inhibited by house dust mite chymotrypsin Der f 6, while it minimally inhibited the German cockroach whole body extract. A novel allergen homologous to chymotrypsin was identified from the German cockroach and was cross-reactive with Der f 6.
The Distribution and Movement of American Cockroaches in Urban Niches of New Orleans.
Carlson, John C; Rabito, Felicia A; Werthmann, Derek; Fox, Mark
2017-10-01
American cockroaches are an important source of household allergens in tropical and semitropical climates. To determine which outdoor niches produce American cockroaches, traps were placed at 40 homes in New Orleans to collect nymphs. Nymphs were collected from the sewers, yards, and within the homes themselves. To compare sewers and yards as sources of cockroaches entering homes, adult cockroaches were collected, marked, and released into yards and sewers. No sewer-released cockroaches were collected in homes. Cockroaches released into yards were collected in the homes, suggesting that yards, rather than sewers, are a more important source niche. A field trial applying boric acid granules to the yard was performed in an effort to reduce entry of cockroaches. There was a significant reduction in the cockroach antigen collected in intervention homes compared with controls.
Energy Technology Data Exchange (ETDEWEB)
Horn, Scott; Hanula, James, L.
2002-06-18
Wood cockroaches are an important prey of the red-cockaded woodpecker, Picoides borealis, an endangered species inhabiting pine forests in the southern United States. These woodpeckers forage on the boles of live pine trees, but their prey consists of a high proportion of wood cockroaches, Parcoblatta spp., that are more commonly associated with dead plant material. Cockroach population density samples were conducted on live pine trees, dead snags and coarse woody debris on the ground. The studies showed that snags and logs are also important habitats of wood cockroaches in pine forests.
Nasirian, H
2017-12-01
Fungal infections have emerged worldwide. Cockroaches have been proved vectors of medically fungi. A systematic meta-analysis review about cockroach fungal contamination was investigated. Relevant topics were collected between January 2016 and January 2017. After a preliminary review among 392 collected papers, 156 were selected to become part of the detailed systematic meta-analysis review. Cockroaches contaminated to 38 fungi species belonging to 19 families and 12 orders. About 38, 25 and 13 fungal species were recovered from the American, German and brown-banded cockroaches, respectively with a variety of medical importance. Except the fungi isolated from German and brown-banded cockroaches, 15 species have been isolated only from the American cockroaches. The global world mean and trend of cockroach fungal contamination were 84.1 and 50.6-100%, respectively in the human dwelling environments. There is a significant difference between cockroach fungal contamination in the urban and rural environments (P0.05). The external and internal cockroach fungal contamination is more dangerous than entire surfaces, while the internal is more dangerous than the external surface. The German and brown-banded cockroach fungal contamination are more dangerous than the American cockroaches in the hospital environments. The study indicates that globally cockroach fungal contamination has been increased recognizing as agents of human infections and associating with high morbidity and mortality in immune-compromised patients. These facts, along with insecticide resistance emergence and increasing globally cockroach infestation, reveal importance of cockroaches and need for their control more than ever. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Metabolic regulation and behavior: how hunger produces arousal - an insect study.
Wicher, Dieter
2007-12-01
The metabolic state affects the level of general activity of an organism. Satiety is related to relaxation while hunger is coupled to elevated activity which supports the chance to balance the energy deficiency. The unrestricted food availability in modern industrial nations along with no required locomotor activity are risk factors to develop disorders such as obesity. One of the strategies to find new targets for future treatment of metabolic disorders in men is to gain detailed knowledge of molecular and cellular mechanisms involved in the regulation of metabolic homeostasis in less complex, i.e. invertebrate systems. This review reports recent molecular studies in insects about how hunger signals may be linked to global activation. Adipokinetic peptide hormones (AKHs) are the insect counterpart to the mammalian glucagon. They are released upon lack of energy and mobilize internal fuel reserves. In addition, AKHs stimulate the locomotor activity which involves their activity within the central nervous system. In the cockroach Periplaneta americana various neurons express the AKH receptor. Some of these, the dorsal unpaired median (DUM) neurons belonging to a general arousal system, release the biogenic amine octopamine, the insect counterpart to mammalian adrenergic hormones. The two Periplaneta AKHs activate Gs proteins, and AKH I also potently activates Gq proteins. AKH I and - less effectively - AKH II accelerate spiking of DUM neurons via an increase of a pacemaking Ca2+ current. Systemically injected AKH I stimulates locomotion in contrast to AKH II. This behavioral difference corresponds to the different effectiveness of the AKHs on the level of G-proteins.
ORF Alignment: NT_033778 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available de-binding protein [Periplaneta americana] ... pir||JQ0708 lipopolysaccharide-binding protein precurs... NT_033778 gi|24762680 >1qddA 8 141 113 253 1e-15 ... dbj|BAA00616.1| lipopolysacchari
Medically Important Parasites Carried by Cockroaches in Melong Subdivision, Littoral, Cameroon
Directory of Open Access Journals (Sweden)
R. J. Atiokeng Tatang
2017-01-01
Full Text Available Cockroaches have been recognized as mechanical vectors of pathogens that can infest humans or animals. A total of 844 adult cockroaches (436 males and 408 females were caught. In the laboratory, cockroaches were first washed in saturated salt solution to remove ectoparasites and then rinsed with 70% alcohol, dried, and dissected for endoparasites. An overall transport rate of 47.39% was recorded. Six genera of parasites were identified. These were Ascaris (33.76%, Trichuris (11.97%, Capillaria (6.16%, Toxocara (4.86%, Hook Worm (4.86%, and Eimeria (2.73%. The parasites were more recorded on the external surface (54.27% of cockroaches than in the internal surface (GIT, 38.51%. The same tendency was obtained between sexes with female cockroaches having a higher transport rate (36.69%. Cockroaches caught in toilets carried more parasites (31.99% as compared to those from kitchens (22.63% and houses (11.14%. Almost all encountered parasites were recognized as responsible of zoonosis and they can be consequently released in nature by hosts and easily disseminated by cockroaches as mechanical vectors. Sanitary education, reenforcement of worms’ eradication programs, and the fight against these insects remain a necessity in the Mélong Subdivision.
Investigation on American cockroaches medically important bacteria in Khorramshahr hospital, Iran
Directory of Open Access Journals (Sweden)
Hamid Kassiri
2014-06-01
Full Text Available Objective: To investigate American cockroaches' infection to various bacteria in Khorramshahr Vali-e-Asr hospital, which was done in 2008. Methods: In this descriptive cross-sectional study, 20 American cockroaches were caught via direct collection. Medically important bacteria were extracted from their outer surface of bodies by standard procedures. Results: Culturing outer surface wash of cockroaches resulted in the separation of Klebsiella, Pseudomonas, Escherichia coli, Staphylococcus, Proteus and Streptococcus. The main common bacteria were Klebsiella (35% and Pseudomonas (30%. Also, results of culture media showed that about 90% of cockroaches infected to at least one bacterium. Conclusions: American cockroaches can transmit pathogenic and potential pathogenic bacteria, therefore their presence in hospitals may be a sanitation challenge. It is recommended to assess plans in purpose to combat these pests in the hospitals.
Food-borne human parasitic pathogens associated with household cockroaches and houseflies in Nigeria
Directory of Open Access Journals (Sweden)
Oyetunde T. Oyeyemi
2016-03-01
Full Text Available Cockroaches and houseflies pose significant public health threat owning to their ability to mechanically transmit human intestinal parasites and other disease-causing microorganisms. This study aims at assessing the vectoral capacity of cockroaches and houseflies in the transmission of human intestinal parasites. Intestinal parasite external surface contamination of 130 cockroaches and 150 houseflies caught within dwelling places in Ilishan-Remo town, Ogun State, Nigeria was determined. Cockroaches (six parasite species were more contaminated than houseflies (four parasite species. The most prevalent parasites were Trichuris trichiura (74.0% and hookworm (63.0% in houseflies and cockroaches respectively. There were significant differences in the prevalence of hookworm, T. trichiura and Taenia spp. isolated from cockroaches and houseflies (P < 0.05. There is high contamination of human intestinal parasites in cockroaches and houseflies in human dwelling places in the study area, thus they have the ability to transmit these parasites to unkempt food materials.
Cockroaches (Blattaria) of Ecuador-checklist and history of research.
Vidlička, Lubomír
2013-01-09
Cockroaches are an understudied group and the total number of described taxa increases every year. The last checklist of Ecuador species was published in 1926. The main aim of this study was to complete a new checklist of cockroach species recorded in Ecuador supplemented with a research history of cockroaches (Blattaria) on the territory of continental Ecuador. In addition, the checklist contains comments on Ecuadorian faunistic records, including the Galápagos Islands. A total of 114 species (105 in continental Ecuador and 18 in Galápagos Islands) belonging to 6 families and 44 genera are listed. Forty species (38.1 %) occur solely in continental Ecuador and five (27.8 %) are endemic on Galápagos Islands. The results indicate that further research on the cockroach fauna of Ecuador as well as determination of museum collections from this territory is needed.
Binary Cockroach Swarm Optimization for Combinatorial Optimization Problem
Directory of Open Access Journals (Sweden)
Ibidun Christiana Obagbuwa
2016-09-01
Full Text Available The Cockroach Swarm Optimization (CSO algorithm is inspired by cockroach social behavior. It is a simple and efficient meta-heuristic algorithm and has been applied to solve global optimization problems successfully. The original CSO algorithm and its variants operate mainly in continuous search space and cannot solve binary-coded optimization problems directly. Many optimization problems have their decision variables in binary. Binary Cockroach Swarm Optimization (BCSO is proposed in this paper to tackle such problems and was evaluated on the popular Traveling Salesman Problem (TSP, which is considered to be an NP-hard Combinatorial Optimization Problem (COP. A transfer function was employed to map a continuous search space CSO to binary search space. The performance of the proposed algorithm was tested firstly on benchmark functions through simulation studies and compared with the performance of existing binary particle swarm optimization and continuous space versions of CSO. The proposed BCSO was adapted to TSP and applied to a set of benchmark instances of symmetric TSP from the TSP library. The results of the proposed Binary Cockroach Swarm Optimization (BCSO algorithm on TSP were compared to other meta-heuristic algorithms.
Actions of insecticides on the insect GABA receptor complex
International Nuclear Information System (INIS)
Bermudez, I.; Hawkins, C.A.; Taylor, A.M.; Beadle, D.J.
1991-01-01
The actions of insecticides on the insect gamma-aminobutyric acid (GABA) receptor were investigated using [35S]t-butylbicyclophosphorothionate [( 35S]TBPS) binding and voltage-clamp techniques. Specific binding of [35S]TBPS to a membrane homogenate derived from the brain of Locusta migratoria locusts is characterised by a Kd value of 79.3 ± 2.9 nM and a Bmax value of 1770 ± 40 fmol/mg protein. [35S]TBPS binding is inhibited by mM concentrations of barbiturates and benzodiazepines. In contrast dieldrin, ivermectin, lindane, picrotoxin and TBPS are inhibitors of [35S]TBPS binding at the nanomolar range. Bicuculline, baclofen and pyrethroid insecticides have no effect on [35S]TBPS binding. These results are similar to those obtained in electrophysiological studies of the current elicited by GABA in both Locusta and Periplaneta americana central neurones. Noise analysis of the effects of lindane, TBPS, dieldrin and picrotoxin on the cockroach GABA responses reveals that these compounds decrease the variance of the GABA-induced current but have no effect on its mean open time. All these compounds, with the exception of dieldrin, significantly decrease the conductance of GABA-evoked single current
Rapid Elimination of German Cockroach, Blatella germanica, by Fipronil and Imidacloprid Gel Baits
Directory of Open Access Journals (Sweden)
H Nasirian
2008-08-01
Full Text Available Background: Baits have become popular and effective formulations against urban insect pests. Compared with residual sprays toxic gel baits are used more and more frequently to control urban cockroach populations. The aim of this study was to investigate the usage of two commercially available fipronil and imidacloprid gel bait formulations against Blattella germanica field infested in Iran. Methods: The study was carried out in an urban area at Tehran from March 2004 to September 2005. The 0.05% fipronil and 2.15% imidacloprid gel baits were placed continuously in 3 residential German cockroach infested units. Pre- and post-treatment cockroach density was assessed by visual count method. Results: Pre- and post-treatment visual count of cockroaches in treatment and control areas, and percentage reduction in cockroach density in treatment areas in comparison to control areas was showed that density reduction was increased with the 0.05% fipronil and 2.15% imidacloprid gel baits in treated areas from 1st to 9th week in comparison to control area. After 60 days, German cockroaches eliminated completely from these areas. Conclusion: These results show that fipronil and imidacloprid gel baits are highly effective in field German cockroach infested after insecticide spraying control failure German cockroach infested fields where spraying of pyrethroid insecticides failed to control the situation and confirm previous reports stating that avermectin and hydramethylnon are more effective than conventional insecticides in baits against cockroaches. Therefore, fipronil and imidacloprid gel baits are appropriate candidates for controlling German cockroach infested dwellings in Iran where control with other insectices failed because of resistance.
Rapid Elimination of German Cockroach, Blatella germanica, by Fipronil and Imidacloprid Gel Baits
Directory of Open Access Journals (Sweden)
H Nasirian
2008-06-01
Full Text Available Background: Baits have become popular and effective formulations against urban insect pests. Compared with residual sprays toxic gel baits are used more and more frequently to control urban cockroach populations. The aim of this study was to investigate the usage of two commercially available fipronil and imidacloprid gel bait formulations against Blattella germanica field infested in Iran.Methods: The study was carried out in an urban area at Tehran from March 2004 to September 2005. The 0.05% fipronil and 2.15% imidacloprid gel baits were placed continuously in 3 residential German cockroach infested units. Pre- and post-treatment cockroach density was assessed by visual count method.Results: Pre- and post-treatment visual count of cockroaches in treatment and control areas, and percentage reduction in cockroach density in treatment areas in comparison to control areas was showed that density reduction was increased with the 0.05% fipronil and 2.15% imidacloprid gel baits in treated areas from 1st to 9th week in comparison to control area. After 60 days, German cockroaches eliminated completely from these areas.Conclusion: These results show that fipronil and imidacloprid gel baits are highly effective in field German cockroach infested after insecticide spraying control failure German cockroach infested fields where spraying of pyrethroid insecticides failed to control the situation and confirm previous reports stating that avermectin and hydramethylnon are more effective than conventional insecticides in baits against cockroaches. Therefore, fipronil and imidacloprid gel baits are appropriate candidates for controlling German cockroach infested dwellings in Iran where control with other insectices failed because of resistance.
Lifescience Database Archive (English)
Full Text Available roduct. 70 6e-29 4 AF480920 |AF480920.1 Nyctotherus ovalis from Periplaneta americana var. Bayer ADP/ATP car...9_1( AF480919 |pid:none) Nyctotherus ovalis from Periplanet... 266 3e-70 AF480921_1( AF480921 |pid:none) Nyc
EST Table: FS849735 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available acetyltransferase [Periplaneta americana] 10/09/11 34 %/218 aa FBpp0169479|DmojGI20262-PA 10/08/29 n.h 10/09...FS849735 E_FL_fner_35N12_F_0 10/09/28 33 %/215 aa dbj|BAC87874.1| arylalkylamine N-
EST Table: BY915319 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BY915319 fbpv0592 10/09/28 52 %/103 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 49 %/102 aa FBpp0127246|DanaGF24054-PA 10/08/28 n.h 10/09/1
EST Table: BP124521 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP124521 epV32477 10/09/28 59 %/164 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP123885 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP125106 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1
EST Table: BP125521 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP125005 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125005 fbpv0197 10/09/28 58 %/185 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 58 %/173 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
Global Journal of Pure and Applied Sciences - Vol 14, No 1 (2008)
African Journals Online (AJOL)
Induction of model time-related airway inflammation in Wistar rats with crude extract of Periplaneta americana · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... Effect of enzyme hydrolysis on saccharification and consumer acceptability of banana fig \\"malt\\" drink · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Chow Down! Using Madagascar Hissing Cockroaches to Explore Basic Nutrition Concepts
Wagler, Ron
2009-01-01
The Madagascar hissing cockroach ("Gromphadorhina portentosa") is one of the most exciting and enjoyable animals to incorporate into your science curriculum. Madagascar hissing cockroaches (MHCs) do not bite, are easy to handle, produce little odor compared to many terrarium animals, have a fascinating social structure, are easy to breed, teach…
Repellency of Dettol, a Commercial Cleaning Product, Against Adult ...
African Journals Online (AJOL)
acer
ABSTRACT: Dettol, a commercial cleaning product was tested for its repellent action against adults of Periplaneta americana (L.). Experimental cage was constructed with pieces of polypropylene plastic material to have a finished form measuring 30×30×60cm. Two cardboard shelters (for each trial) were assembled each ...
Hamu, Haji; Debalke, Serkadis; Zemene, Endalew; Birlie, Belay; Mekonnen, Zeleke; Yewhalaw, Delenasaw
2014-01-01
Cockroaches are claimed to be mechanical transmitters of disease causing microorganisms such as intestinal parasites, bacteria, fungi, and viruses. This study assessed the potential of the German cockroach Blattella germanica in the mechanical transmission of intestinal parasites of public health importance. A total of 2010 cockroaches were collected from 404 households in Jimma Town, southwestern Ethiopia. All the collected cockroaches were identified to species as B. germanica. The contents...
Directory of Open Access Journals (Sweden)
H. de Souza Lopes
1943-01-01
Full Text Available The author publishes a comparative study of eleven species of Sarcophagid flies and gives a redescription of the larval stages of Musca domestica L. as a model. The work was made upon material obtained from Sarcophagidae reared in the Laboratory. Some of them were parasitic flies from Insects and other invertebrates. Protodexia was reared using the domestic cockroach (Periplaneta americana instead of the Orthroptera or Mantodea its true hosts. The larvae obtained by dissection of female abdomen was reared in flesh or agarhorse serum. The last proceeding is very good since the skins of all larval stages can be conserved for study and it is possible to observe the ecdyses. Some of the larvae prefer dead snails (Bulimulus and Fruticicola and is able to destroy larvae of other species found in the same molluscs. The first stage maggot can be obtained by dissections of dried female specimens and furnishes very good characters to determine the species and establish the philogenetical relationship of the genera in the family. Th pseudocephalon presents very curious ornaments or grooves in some species (Oxysarcodexia. Sometimes there is a pigmented capsule covering a great part of the pseudocephalon (Titanogrypa. The cephaloskeletal sclerietes have a peculiar shape and constitution for every species, mainly in the first stage maggot.
Directory of Open Access Journals (Sweden)
Mona Sharififard
2016-01-01
Full Text Available Background: Considering to the high distribution of cockroaches as urban pests, the efficacy of different formulations of Metarhizium anisopliae strain Iran 437C were assessed against the brown-banded cockroach, Supella longipalpa F. under laboratory and field conditions.Methods: Metarhizium anisopliae isolates were screened with immersing adults of the brown-banded cockroachs in aqueous suspension of 108 conidia ml-1 followed by surface or bait treated with different doses of the most virulent isolate against the nymphs. Then formulations of conidia oil-in-water were examined versus cockroach nymphs using different plant oils and paraffin. Then they were evaluated and compared with aqueous suspension and control group. On a large-scale, the sunflower oil-in-water formulation of conidia was sprayed at houses using a hand sprayer.Results: Metarhizium anisopliae IRAN 437C was the most virulent isolate against the brown-banded cockroach, causing 100% mortality in adults at seven days post-exposure. Inoculated bait with this isolate was not enough pathogenic against the cockroach even at two weeks after treatment. Treated surface with conidia as aqueous suspension or oil-in- water formulation was more effective than the bait formulation against the cockroach caused 39.4–97.2% mortality compared with 2.5% mortality in control group after two days. Spraying the conidia formulated with sunflower oil was an effective formulation causing 76.1% reduction in the cockroach density on the third day post treatment in the houses.Conclusion: The oil-in-water formulation of M. anisopliae IRAN 437C could be recommended as a promising alternative for cockroach control.
NAEEM, Afifa; JALEEL, Waqar; SAEED, Qamar; ZAKA, Syed Muhammad; SAEED, Shafqat; NAQQASH, Muhammad Nadir; BAKHTAWAR, Marryam; AYUB, Waleed Bin
2014-01-01
Cockroaches are the major household pests which prefer humid areas for habitation i.e. bathrooms, kitchens, sewerage systems etc., where warmth, moisture and food are satisfactory. Cockroaches are responsible for transmitting microorganisms like pathogenic bacteria, virus and fungi. Some examples of common bacterial diseases of human beings transmitted by cockroaches are Pasteurellapestisand bubonic plague; Shigellaalkalescensand dysentery; Staphylococcus aureusand boils and abscesses; Shigel...
Lee, Hyo-Rim; Kim, Gil-Hah; Choi, Won-Sil; Park, Il-Kwon
2017-04-01
We evaluated the repellent activity of 12 Apiaceae plant essential oils and their components against male and female adult German cockroaches, Blattella germanica L., to find new natural repellents. Of all the plant essential oils tested, ajowan (Trachyspermum ammi Sprague) and dill (Anethum graveolens L.) essential oils showed the most potent repellent activity against male and female adult German cockroaches. Repellent activities of chemicals already identified in active oils were also investigated. Of the compounds identified, carvacrol, thymol, and R-(-)-carvone showed >80% repellent activity against male and female adult German cockroaches at 2.5 µg/cm2. S-(+)-Carvone, (+)-dihydrocarvone, and terpinen-4-ol showed >70% repellent activity against male and female adult German cockroaches at 10 µg/cm2. Our results indicated that Apiaceae plant essential oils and their constituents have good potential as natural repellents against adult German cockroaches. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
The embodiment of cockroach aggregation behavior in a group of micro-robots.
Garnier, Simon; Jost, Christian; Gautrais, Jacques; Asadpour, Masoud; Caprari, Gilles; Jeanson, Raphaël; Grimal, Anne; Theraulaz, Guy
2008-01-01
We report the faithful reproduction of the self-organized aggregation behavior of the German cockroach Blattella germanica with a group of robots. We describe the implementation of the biological model provided by Jeanson et al. in Alice robots, and we compare the behaviors of the cockroaches and the robots using the same experimental and analytical methodology. We show that the aggregation behavior of the German cockroach was successfully transferred to the Alice robot despite strong differences between robots and animals at the perceptual, actuatorial, and computational levels. This article highlights some of the major constraints one may encounter during such a work and proposes general principles to ensure that the behavioral model is accurately transferred to the artificial agents.
Bourguignon, Thomas; Tang, Qian; Ho, Simon Y W; Juna, Frantisek; Wang, Zongqing; Arab, Daej A; Cameron, Stephen L; Walker, James; Rentz, David; Evans, Theodore A; Lo, Nathan
2017-04-01
Following the acceptance of plate tectonics theory in the latter half of the 20th century, vicariance became the dominant explanation for the distributions of many plant and animal groups. In recent years, however, molecular-clock analyses have challenged a number of well-accepted hypotheses of vicariance. As a widespread group of insects with a fossil record dating back 300 My, cockroaches provide an ideal model for testing hypotheses of vicariance through plate tectonics versus transoceanic dispersal. However, their evolutionary history remains poorly understood, in part due to unresolved relationships among the nine recognized families. Here, we present a phylogenetic estimate of all extant cockroach families, as well as a timescale for their evolution, based on the complete mitochondrial genomes of 119 cockroach species. Divergence dating analyses indicated that the last common ancestor of all extant cockroaches appeared ∼235 Ma, ∼95 My prior to the appearance of fossils that can be assigned to extant families, and before the breakup of Pangaea began. We reconstructed the geographic ranges of ancestral cockroaches and found tentative support for vicariance through plate tectonics within and between several major lineages. We also found evidence of transoceanic dispersal in lineages found across the Australian, Indo-Malayan, African, and Madagascan regions. Our analyses provide evidence that both vicariance and dispersal have played important roles in shaping the distribution and diversity of these insects.
Nest sanitation through defecation: antifungal properties of wood cockroach feces
Rosengaus, Rebeca B.; Mead, Kerry; Du Comb, William S.; Benson, Ryan W.; Godoy, Veronica G.
2013-11-01
The wood cockroach Cryptocercus punctulatus nests as family units inside decayed wood, a substrate known for its high microbial load. We tested the hypothesis that defecation within their nests, a common occurrence in this species, reduces the probability of fungal development. Conidia of the entomopathogenic fungus, Metarhizium anisopliae, were incubated with crushed feces and subsequently plated on potato dextrose agar. Relative to controls, the viability of fungal conidia was significantly reduced following incubation with feces and was negatively correlated with incubation time. Although the cockroach's hindgut contained abundant β-1,3-glucanase activity, its feces had no detectable enzymatic function. Hence, these enzymes are unlikely the source of the fungistasis. Instead, the antifungal compound(s) of the feces involved heat-sensitive factor(s) of potential microbial origin. When feces were boiled or when they were subjected to ultraviolet radiation and subsequently incubated with conidia, viability was "rescued" and germination rates were similar to those of controls. Filtration experiments indicate that the fungistatic activity of feces results from chemical interference. Because Cryptocercidae cockroaches have been considered appropriate models to make inferences about the factors fostering the evolution of termite sociality, we suggest that nesting in microbe-rich environments likely selected for the coupling of intranest defecation and feces fungistasis in the common ancestor of wood cockroaches and termites. This might in turn have served as a preadaptation that prevented mycosis as these phylogenetically related taxa diverged and evolved respectively into subsocial and eusocial organizations.
Diet shapes the gut microbiota of the omnivorous cockroach Blattella germanica.
Pérez-Cobas, Ana Elena; Maiques, Elisa; Angelova, Alexandra; Carrasco, Purificación; Moya, Andrés; Latorre, Amparo
2015-04-01
The gut microbiota of insects contributes positively to the physiology of its host mainly by participating in food digestion, protecting against pathogens, or provisioning vitamins or amino acids, but the dynamics of this complex ecosystem is not well understood so far. In this study, we have characterized the gut microbiota of the omnivorous cockroach Blattella germanica by pyrosequencing the hypervariable regions V1-V3 of the 16S rRNA gene of the whole bacterial community. Three diets differing in the protein content (0, 24 and 50%) were tested at two time points in lab-reared individuals. In addition, the gut microbiota of wild adult cockroaches was also analyzed. In contrast to the high microbial richness described on the studied samples, only few species are shared by wild and lab-reared cockroaches, constituting the bacterial core in the gut of B. germanica. Overall, we found that the gut microbiota of B. germanica is highly dynamic as the bacterial composition was reassembled in a diet-specific manner over a short time span, with no-protein diet promoting high diversity, although the highest diversity was found in the wild cockroaches analyzed. We discuss how the flexibility of the gut microbiota is probably due to its omnivorous life style and varied diets. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Students' Knowledge about the Internal Structure of Mice and Cockroaches in Their Environment
Kilic, Selda
2013-01-01
The aim of this study is to determine 9th class students knowledge about the internal structures of mice and cockroaches using drawings. Drawings of 122 students from the 9th class of a high school in the center of Konya about the internal structures of mice and cockroaches have been analyzed. Drawings were analyzed independently by two…
Reversible brain inactivation induces discontinuous gas exchange in cockroaches.
Matthews, Philip G D; White, Craig R
2013-06-01
Many insects at rest breathe discontinuously, alternating between brief bouts of gas exchange and extended periods of breath-holding. The association between discontinuous gas exchange cycles (DGCs) and inactivity has long been recognised, leading to speculation that DGCs lie at one end of a continuum of gas exchange patterns, from continuous to discontinuous, linked to metabolic rate (MR). However, the neural hypothesis posits that it is the downregulation of brain activity and a change in the neural control of gas exchange, rather than low MR per se, which is responsible for the emergence of DGCs during inactivity. To test this, Nauphoeta cinerea cockroaches had their brains inactivated by applying a Peltier-chilled cold probe to the head. Once brain temperature fell to 8°C, cockroaches switched from a continuous to a discontinuous breathing pattern. Re-warming the brain abolished the DGC and re-established a continuous breathing pattern. Chilling the brain did not significantly reduce the cockroaches' MR and there was no association between the gas exchange pattern displayed by the insect and its MR. This demonstrates that DGCs can arise due to a decrease in brain activity and a change in the underlying regulation of gas exchange, and are not necessarily a simple consequence of low respiratory demand.
Hamu, Haji; Debalke, Serkadis; Zemene, Endalew; Birlie, Belay; Mekonnen, Zeleke; Yewhalaw, Delenasaw
2014-01-01
Cockroaches are claimed to be mechanical transmitters of disease causing microorganisms such as intestinal parasites, bacteria, fungi, and viruses. This study assessed the potential of the German cockroach Blattella germanica in the mechanical transmission of intestinal parasites of public health importance. A total of 2010 cockroaches were collected from 404 households in Jimma Town, southwestern Ethiopia. All the collected cockroaches were identified to species as B. germanica. The contents of their gut and external body parts were examined for the presence of intestinal parasites. Overall, 152 (75.6%) of the 210 batches were found to harbor at least one species of human intestinal parasite. Ascaris lumbricoides, Trichuris trichiura, Taenia spp, Strongyloides-like parasite, Entamoeba histolytica/dispar/moshkovski, Giardia duodenalis and Balantidium coli were detected from gut contents. Moreover, parasites were also isolated from the external surface in 22 (10.95%) of the batches. There was significant difference in parasite carriage rate of the cockroaches among the study sites (P = 0.013). In conclusion, B. germanica was found to harbor intestinal parasites of public health importance. Hence, awareness on the potential role of cockroaches in the mechanical transmission of human intestinal parasites needs to be created. Moreover, further identification of the Strongyloides-like worm is required using molecular diagnostics.
Directory of Open Access Journals (Sweden)
Haji Hamu
2014-01-01
Full Text Available Cockroaches are claimed to be mechanical transmitters of disease causing microorganisms such as intestinal parasites, bacteria, fungi, and viruses. This study assessed the potential of the German cockroach Blattella germanica in the mechanical transmission of intestinal parasites of public health importance. A total of 2010 cockroaches were collected from 404 households in Jimma Town, southwestern Ethiopia. All the collected cockroaches were identified to species as B. germanica. The contents of their gut and external body parts were examined for the presence of intestinal parasites. Overall, 152 (75.6% of the 210 batches were found to harbor at least one species of human intestinal parasite. Ascaris lumbricoides, Trichuris trichiura, Taenia spp, Strongyloides-like parasite, Entamoeba histolytica/dispar/moshkovski, Giardia duodenalis and Balantidium coli were detected from gut contents. Moreover, parasites were also isolated from the external surface in 22 (10.95% of the batches. There was significant difference in parasite carriage rate of the cockroaches among the study sites (P=0.013. In conclusion, B. germanica was found to harbor intestinal parasites of public health importance. Hence, awareness on the potential role of cockroaches in the mechanical transmission of human intestinal parasites needs to be created. Moreover, further identification of the Strongyloides-like worm is required using molecular diagnostics.
Grier, Thomas J; Hall, Dawn M; Duncan, Elizabeth A; Coyne, Terrance C
2015-03-01
Recent studies have shown that Alternaria and German cockroach allergens can be degraded by endogenous proteases from other insect and fungal extracts when combined for immunotherapy, but data supporting the compatibilities of other high-protease products in comparable mixtures have not been reported. To assess the stabilities and compatibilities of Aspergillus fumigatus and American cockroach allergens after mixing with protease-rich extracts from other insects or fungi at concentrations similar to those recommended for subcutaneous immunotherapy. Mixtures containing A fumigatus, American cockroach, and other fungal or insect extracts were evaluated by quantitative (enzyme-linked immunosorbent assays) and qualitative (immunoblotting) methods. Test mixtures and control samples at 10% to 50% glycerin concentrations were analyzed after storage for up to 12 months at 2°C to 8°C. Moderate to high recoveries of Aspergillus extract activities were retained in control samples and extract mixtures under all conditions examined. American cockroach extract controls were partly degraded at 10% to 25% glycerin, and cockroach allergen compatibilities were decreased significantly in mixtures with several fungal extracts at 25% glycerin. Mixing with other insects did not compromise the stability of American cockroach allergens at 25% to 50% glycerin. Aspergillus extracts exhibited favorable stabilities after mixing with other high-protease products. American cockroach extract potencies were unstable in less than 50% glycerin, even in the absence of other protease-containing allergens, and were destabilized in mixtures with several fungal extracts. Addition of fungal and insect extracts to separate treatment vials or preparation of fungal-insect mixtures at elevated glycerin concentrations might be necessary to produce compatible patient formulations for allergen immunotherapy injections. Copyright © 2015 American College of Allergy, Asthma & Immunology. Published by Elsevier
Directory of Open Access Journals (Sweden)
Giuseppe Dionisio
2016-10-01
Full Text Available Beauveria bassiana is an entomopathogenic fungus that grows both in vivo and in vitro. In vivo it can colonize live insect hosts, and tissue digestion occurs by secreted hydrolytic exoenzymes. It can also colonize dead insect tissue provided this is free from competing microorganisms. Depending on whether the host is alive or dead the expression (quality/quantity of the exoenzymes may vary. We have grown several isolates of B. bassiana in shaking flasks for 120 h at 25 °C in order to evaluate the maximal exoenzyme production using two diet regimes. As sole carbon, nitrogen, and phosphate sources we used 1% shrimp chitin and either 0.5% w/v of dead intact American cockroach (Periplaneta americana or their isolated cuticles. This is the first report of a differential proteomics of B. bassiana exoenzymes performed by label-free nano-LC MS/MS. Total proteolytic enzyme activity was mainly due to Pr1A or Pr1B depending on the isolate and the diet regime. The most differentially secreted enzymes were: the cuticle-degrading subtilisin Pr1A, GH13 alpha-glycosidase, glucan endo-1,3-beta-glucosidase, subtilisin-like proteinase Spm1, lipase 1, beta-1,3 exoglucanase, and endo-1,3-beta-glucosidase. Among the B. bassiana isolates analyzed, Bb 678 and Bb BG were the most active in Pr1A secretion.
Dionisio, Giuseppe; Kryger, Per; Steenberg, Tove
2016-10-14
Beauveria bassiana is an entomopathogenic fungus that grows both in vivo and in vitro. In vivo it can colonize live insect hosts, and tissue digestion occurs by secreted hydrolytic exoenzymes. It can also colonize dead insect tissue provided this is free from competing microorganisms. Depending on whether the host is alive or dead the expression (quality/quantity) of the exoenzymes may vary. We have grown several isolates of B. bassiana in shaking flasks for 120 h at 25 °C in order to evaluate the maximal exoenzyme production using two diet regimes. As sole carbon, nitrogen, and phosphate sources we used 1% shrimp chitin and either 0.5% w / v of dead intact American cockroach ( Periplaneta americana ) or their isolated cuticles. This is the first report of a differential proteomics of B. bassiana exoenzymes performed by label-free nano-LC MS/MS. Total proteolytic enzyme activity was mainly due to Pr1A or Pr1B depending on the isolate and the diet regime. The most differentially secreted enzymes were: the cuticle-degrading subtilisin Pr1A, GH13 alpha-glycosidase, glucan endo-1,3-beta-glucosidase, subtilisin-like proteinase Spm1, lipase 1, beta-1,3 exoglucanase, and endo-1,3-beta-glucosidase. Among the B. bassiana isolates analyzed, Bb 678 and Bb BG were the most active in Pr1A secretion.
Buczkowski, Grzegorz; Scherer, Clay W; Bennett, Gary W
2008-06-01
Horizontal transfer of indoxacarb in the German cockroach, Blattella germanica (L.), was examined under laboratory conditions. Results show that a single bait-fed adult cockroach (i.e., the donor) transferred indoxacarb to numerous primary recipients (secondary mortality),which then became secondary donors. These recipients subsequently became donors to other cockroaches and caused significant mortality in other members of the aggregation, resulting in tertiary kill. Indoxacarb was effectively transferred among adult cockroaches and resulted in significant secondary mortality. When adult males served as donors and vectored the insecticide to adult males, the donor:recipient ratio affected the mortality of the recipients and the rate of secondary mortality increased with increasing the ratio of donors to recipients. Furthermore, secondary mortality in the untreated cockroaches was significantly affected by the freshness of excretions from the donors, the presence of alternative food, and the duration of contact between the donors and the recipients. Ingested indoxacarb was most effectively translocated when the recipients interacted with freshly symptomatic donors in the absence of alternative food. The transfer of indoxacarb continued beyond secondary mortality and resulted in significant tertiary mortality. Excretions from a single bait-fed adult killed 38/50 (76%) nymphs within 72 h. The dead nymphs then vectored indoxacarb to 20 adult males and killed 16/20 (81%) recipients within 72 h. Behavioral mechanisms involved in the horizontal transfer of indoxacarb may include: contact with excretions, necrophagy, emetophagy, and ingestion of other excretions that originate from the donors.
Directory of Open Access Journals (Sweden)
M Shahi
2008-06-01
Full Text Available Background: The German cockroach, Blattella germanica L., is a serious household and public health pest worldwide. Control of this species has been very difficult to achieve. Toxicity of cypermethrin EC10%, deltamethrin EC5%, diazinon EC0.5%, lambda-cyhalothrin EC5% and Negon® (permethrin+propoxur oil liquid1% commercial formulations were investigated against adult males of German cockroaches collected from four hospitals of Bandar Abbas City, southern Iran, during 2006. These insecticides have been used for cockroach control in this city.Methods: The tests were carried out only on males by the glass jar contact method recommended by the WHO.Results: Maximum mortality rates of 20, 35, 90, and 100% were obtained after one hour contact to label-recommended doses of cypermethrin, deltamethrin, lambad-cyhalothrin, diazinon and permethrin+propoxur insecticides, respectively. KT50 results were different from 5.68 min for permethrin+propoxur mixture to 240.37 min for cypermethrin. German cockroach showed < 80 per cent mortality using three pyrethroid insecticides.Conclusion: It seems that the label-recommended concentrations of these insecticides were wrong and lower than WHO advised for cockroach control. For monitoring of resistance it is recommended to do more tests using the pure active ingredient of these insecticides.
Blanco, María V; Lax, Paola; Dueñas, Juan C Rondan; Gardenal, Cristina N; Doucet, Marcelo E
2012-09-01
A population of Hammerschmidtiella diesingi was detected in specimens of Periplaneta americana collected in Córdoba city (Argentina) was studied. Nematodes were characterized based on morphological, morphometric and genetic (D2-D3 expansion segment) analyses. New data are provided, especially on particular morphological characters that were a matter of controversy in previous studies. H. diesingi is reported in Argentina for the first time.
Directory of Open Access Journals (Sweden)
Callum Richards
Full Text Available The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within this "bioreactor", and as a key factor for the divergence of the termite gut microbiota from the omnivorous cockroach ancestor. The gut microbiota in most termites supports primarily the breakdown of lignocellulose, but the fungus-farming sub-family of higher termites has become similar in gut microbiota to the ancestral omnivorous cockroaches. To assess the importance of a fungus diet as a driver of community structure, we compare community compositions in the guts of experimentally manipulated Pycnoscelus surinamensis cockroaches fed on fungus cultivated by fungus-farming termites. MiSeq amplicon analysis of gut microbiotas from 49 gut samples showed a step-wise gradient pattern in community similarity that correlated with an increase in the proportion of fungal material provided to the cockroaches. Comparison of the taxonomic composition of manipulated communities to that of gut communities of a fungus-feeding termite species showed that although some bacteria OTUs shared by P. surinamensis and the farming termites increased in the guts of cockroaches on a fungal diet, cockroach communities remained distinct from those of termites. These results demonstrate that a fungal diet can play a role in structuring gut community composition, but at the same time exemplifies how original community compositions constrain the magnitude of such change.
1981-03-01
release of sterile males into natural populations of the German cockroach. Submitted to Entomologia exp. & Appl. Feb., 1981. A first draft was...populations of the German cockroach. Subm. Entomologia Exp. & Appl. Feb., 1981. aEight other publications of earlier research on this Contract have
Ewingella Americana: An Emerging True Pathogen
Directory of Open Access Journals (Sweden)
Syed Hassan
2012-01-01
Full Text Available Infections caused by Ewingella americana have been rarely reported in the literature. Most of the cases that have been reported were among the immunocompromised patients. We report a case of E. americana causing osteomyelitis and septic arthritis of the shoulder joint in a previous intravenous drug abuser. The causative pathogen was identified by synovial fluid analysis and culture.
Cockroaches traverse crevices, crawl rapidly in confined spaces, and inspire a soft, legged robot
Jayaram, Kaushik; Full, Robert J.
2016-01-01
Jointed exoskeletons permit rapid appendage-driven locomotion but retain the soft-bodied, shape-changing ability to explore confined environments. We challenged cockroaches with horizontal crevices smaller than a quarter of their standing body height. Cockroaches rapidly traversed crevices in 300–800 ms by compressing their body 40–60%. High-speed videography revealed crevice negotiation to be a complex, discontinuous maneuver. After traversing horizontal crevices to enter a vertically confined space, cockroaches crawled at velocities approaching 60 cm⋅s−1, despite body compression and postural changes. Running velocity, stride length, and stride period only decreased at the smallest crevice height (4 mm), whereas slipping and the probability of zigzag paths increased. To explain confined-space running performance limits, we altered ceiling and ground friction. Increased ceiling friction decreased velocity by decreasing stride length and increasing slipping. Increased ground friction resulted in velocity and stride length attaining a maximum at intermediate friction levels. These data support a model of an unexplored mode of locomotion—“body-friction legged crawling” with body drag, friction-dominated leg thrust, but no media flow as in air, water, or sand. To define the limits of body compression in confined spaces, we conducted dynamic compressive cycle tests on living animals. Exoskeletal strength allowed cockroaches to withstand forces 300 times body weight when traversing the smallest crevices and up to nearly 900 times body weight without injury. Cockroach exoskeletons provided biological inspiration for the manufacture of an origami-style, soft, legged robot that can locomote rapidly in both open and confined spaces. PMID:26858443
Multi-drug resistant Ewingella Americana
International Nuclear Information System (INIS)
Bukhari, Syed Z.; Ashshi, Ahmad M.; Hussain, Waleed M.; Fatani, Mohammad I.
2008-01-01
We report a case of pneumonia due to multi-drug resistant Ewingella Americana in a young patient admitted in the Intensive Care Unit of Hera General Hospital, Makkah, Saudi Arabia with severe head injury in a road traffic accident. He was an Indonesian pilgrim who had traveled to the Kingdom of Saudi Arabia to perform Hajj in December 2007. Ewingella Americana was identified to be the pathogen of pneumonia with clinical signs and symptoms along with positive radiological findings. (author)
Directory of Open Access Journals (Sweden)
Ashish Hulle
2015-02-01
Full Text Available The growing environmental problems, the problem of waste disposal and the depletion of non-renewable resources have stimulated the use of green materials compatible with the environment to reduce environmental impacts. Therefore, there is a need to design products by using natural resources. Natural fibers seem to be a good alternative since they are abundantly available and there are a number of possibilities to use all the components of a fiber-yielding crop; one such fiber-yielding plant is Agave Americana. The leaves of this plant yield fibers and all the parts of this plant can be utilized in many applications. The “zero-waste” utilization of the plant would enable its production and processing to be translated into a viable and sustainable industry. Agave Americana fibers are characterized by low density, high tenacity and high moisture absorbency in comparison with other leaf fibers. These fibers are long and biodegradable. Therefore, we can look this fiber as a sustainable resource for manufacturing and technical applications. Detailed discussion is carried out on extraction, characterization and applications of Agave Americana fiber in this paper.
Directory of Open Access Journals (Sweden)
Mohammad Reza Fakoorziba
2014-09-01
Full Text Available Objective: To identify the cockroach species, their bacterial flora and antibiotics susceptibility patterns of these bacteria in Shiraz. Methods: In the present descriptive study, only two species of cockroaches were recognized. The washing solutions from the digestion systems and surfaces of 156 American and German cockroaches were cultured. The latter was found to be the commonest (89.7% in all places. Results: Overall, 18 species of bacteria were isolated and identified by standard culture methods. The most frequent bacterium isolated from both species of cockroaches in all places was Pseudomonas (41.7%. The second and third commonest bacteria were Enterobacter (39.7% and Klebsiella (32.7%, respectively. Conclusions: The antibiogram profiles showed full (100% resistance of Klebsiella, Citrobacter, Acinetobacter and Proteus to amoxicillin and ampicillin at both hospitals, while Pseudomonas showed resistance (95.7% to cephalothin. Thus it is concluded that German and American cockroaches carry multidrug resistant bacteria in two hospitals which raises alarm for stricter control measures.
DEFF Research Database (Denmark)
Nielsen, Søren Achim; Jensen, Karl-Martin Vagn; Kristensen, Michael
2006-01-01
The energetic cost of a sublethal treatment with chlorpyrifos was estimated by use of direct microcalorimetry to measure metabolic heat in susceptible and resistant strains of the German cockroach Blattella germanica L. Moreover, one of the detoxifcation enzyme systems known to be involved...... in detoxifcation of chlorpyrifos, glutathione-S-transferase, was measured. Individual cockroaches were exposed for 20 min on a glass-surfaces treated with 1.14 ... g/cm2 of chlorpyrifos. There was no difference in glutathione-S-transferase activity of susceptible or resistant strains after the treatment. The heat...
Directory of Open Access Journals (Sweden)
Fiandra Fatharany
2017-01-01
Full Text Available Augmented reality (AR technology is useful for treating several psychological problems, including phobias such as fear of flying, agoraphobia, claustrophobia, and phobia to insects and small animals. However, the currently existing applications for therapy of cockroach phobia that uses AR technology are still very dependent towards the presence of markers, which might lessen the feeling of being in an actual scenario from everyday lives. In this paper, we created a system that is able to use everyday things as a replacement for markers for phobia therapy for cockroach. There are five main processes: getting the live streaming feed from camera, preprocessing, extracting the center point of the objects, tracking the marker-substitute objects, and lastly, instantiating cockroaches randomly after user lifts the objects according to the number and mode of the cockroaches, whether it is moving or not, that are predetermined by the user. The evaluation in this paper includes eight participants that are carefully selected based on their Fear of Spiders Questionnaire (FSQ score that is translated into Indonesian and modified to accommodate cockroaches instead of spiders. The results is that the system can induce anxiety level on participants with the highest score of 10, which is the highest score in Standard Unit of Discomfort scale (SUDs. While the presence and reality judgment of this paper has the highest score of 7 which is also the highest score in Slater-Usoh-Steed Questionnaire (SUS.
Pyrethroid resistance and cross-resistance in the German cockroach, Blattella germanica (L).
Wei, Y; Appel, A G; Moar, W J; Liu, N
2001-11-01
A German cockroach (Blatella germanica (L)) strain, Apyr-R, was collected from Opelika, Alabama after control failures with pyrethroid insecticides. Levels of resistance to permethrin and deltamethrin in Apyr-R (97- and 480-fold, respectively, compared with a susceptible strain, ACY) were partially or mostly suppressed by piperonyl butoxide (PBO) and S,S,S,-tributylphosphorotrithioate (DEF), suggesting that P450 monooxygenases and hydrolases are involved in resistance to these two pyrethroids in Apyr-R. However, incomplete suppression of pyrethroid resistance with PBO and DEF implies that one or more additional mechanisms are involved in resistance. Injection, compared with topical application, resulted in 43- and 48-fold increases in toxicity of permethrin in ACY and Apyr-R, respectively. Similarly, injection increased the toxicity of deltamethrin 27-fold in ACY and 28-fold in Apyr-R. These data indicate that cuticular penetration is one of the obstacles for the effectiveness of pyrethroids against German cockroaches. However, injection did not change the levels of resistance to either permethrin or deltamethrin, suggesting that a decrease in the rate of cuticular penetration may not play an important role in pyrethroid resistance in Apyr-R. Apyr-R showed cross-resistance to imidacloprid, with a resistance ratio of 10. PBO treatment resulted in no significant change in the toxicity of imidacloprid, implying that P450 monooxygenase-mediated detoxication is not the mechanism responsible for cross-resistance. Apyr-R showed no cross-resistance to spinosad, although spinosad had relatively low toxicity to German cockroaches compared with other insecticides tested in this study. This result further confirmed that the mode of action of spinosad to insects is unique. Fipronil, a relatively new insecticide, was highly toxic to German cockroaches, and the multi-resistance mechanisms in Apyr-R did not confer significant cross-resistance to this compound. Thus, we propose
Selected food-borne parasites associated with cockroaches and ...
African Journals Online (AJOL)
Of these, 20 (62.5%) were protozoa and 12 (37.5%) were helminthes from the houseflies while 19 (54.3%) were protozoa and 16 (45.7%) were helminthes from the cockroaches. The protozoa that were identified include; cysts of Balantidium coli, cysts of Entamoeba coli, Entamoeba Histolytica and Endolimax nana. Also ...
Li, Guangye; Zhang, Dingguo
2016-01-01
An all-chain-wireless brain-to-brain system (BTBS), which enabled motion control of a cyborg cockroach via human brain, was developed in this work. Steady-state visual evoked potential (SSVEP) based brain-computer interface (BCI) was used in this system for recognizing human motion intention and an optimization algorithm was proposed in SSVEP to improve online performance of the BCI. The cyborg cockroach was developed by surgically integrating a portable microstimulator that could generate invasive electrical nerve stimulation. Through Bluetooth communication, specific electrical pulse trains could be triggered from the microstimulator by BCI commands and were sent through the antenna nerve to stimulate the brain of cockroach. Serial experiments were designed and conducted to test overall performance of the BTBS with six human subjects and three cockroaches. The experimental results showed that the online classification accuracy of three-mode BCI increased from 72.86% to 78.56% by 5.70% using the optimization algorithm and the mean response accuracy of the cyborgs using this system reached 89.5%. Moreover, the results also showed that the cyborg could be navigated by the human brain to complete walking along an S-shape track with the success rate of about 20%, suggesting the proposed BTBS established a feasible functional information transfer pathway from the human brain to the cockroach brain.
Nazari, Mansour; Motlagh, Behrouz Alipourian; Nasirian, Hassan
German cockroach has relatively short life cycle and reproduce rapidly. It is the most common medically and public health pest. As a result, it is essential to combat this pest. Cypermethrin and chlorpyrifos are used by private companies in Hamadan to control Blattella germanica. It seems necessary to determine its susceptibility levels to these insecticides. The aim of this study was to determine the susceptibility levels of B. germanica strains to cypermethrin and chlorpyrifos in Hamadan. In this study, the German cockroach strains were collected from two hospitals (Fatemiyeh and Atiyeh) in Hamadan and transfered to the insectarium. The cockroach strains were reared under the same laboratory condition. Then their sensitivity levels were considered to 1, 2, 4, 8 and 16 mg m -2 for cypermethrin and 0.82, 1.65, 3.31, 6.63, 9.945 and 13.26 mg m -2 for chlorpyrifos using surface contact method. Results based on insecticide treated doses, B. germanica strains showed different percent mortality to the insecticides ranged from 13.3-100. The LD 50 and LD 90 and regression lines of the treated insecticides against German cockroach strains indicate that Fatemiyeh Hospital strain is more susceptible to the treated insecticides than Atiyeh Hospital strain. The LD 50 and LD 90 of chlorpyrifos are also lower than cypermethrin, indicated that chlorpyrifos is more effective than cypermethrin against German cockroach. As the slopes of the regression lines are observed mild in this study indicate that the population of the cockroach strains is very heterogeneous. It can be a symbol of insecticides resistance to cypermethrin and chlorpyrifos. As chlorpyrifos and cypermethrin insecticides are also used for residual spraying by private companies and the doses which provide more than 90% mortality are below the WHO recommended insecticide doses. Therefore, chlorpyrifos and cypermethrin insecticides can be used for B. germanica control in Hamadan within regular monitoring and preventive
Kass, Daniel; McKelvey, Wendy; Carlton, Elizabeth; Hernandez, Marta; Chew, Ginger; Nagle, Sean; Garfinkel, Robin; Clarke, Brian; Tiven, Julius; Espino, Christian; Evans, David
2009-08-01
Cockroaches and mice, which are common in urban homes, are sources of allergens capable of triggering asthma symptoms. Traditional pest control involves the use of scheduled applications of pesticides by professionals as well as pesticide use by residents. In contrast, integrated pest management (IPM) involves sanitation, building maintenance, and limited use of least toxic pesticides. We implemented and evaluated IPM compared with traditional practice for its impact on pests, allergens, pesticide use, and resident satisfaction in a large urban public housing authority. We assigned IPM or control status to 13 buildings in five housing developments, and evaluated conditions at baseline, 3 months, and 6 months in 280 apartments in Brooklyn and Manhattan, in New York City (New York). We measured cockroach and mouse populations, collected cockroach and mouse urinary protein allergens in dust, and interviewed residents. All statistical models controlled for baseline levels of pests or allergens. Compared with controls, apartments receiving IPM had significantly lower counts of cockroaches at 3 months and greater success in reducing or sustaining low counts of cockroaches at both 3 and 6 months. IPM was associated with lower cockroach allergen levels in kitchens at 3 months and in beds and kitchens at 6 months. Pesticide use was reduced in IPM relative to control apartments. Residents of IPM apartments also rated building services more positively. In contrast to previous IPM studies, which involved extensive cleaning, repeat visits, and often extensive resident education, we found that an easily replicable single IPM visit was more effective than the regular application of pesticides alone in managing pests and their consequences.
Yeom, Hwa-Jeong; Jung, Chan-Sik; Kang, Jaesoon; Kim, Junheon; Lee, Jae-Hyeon; Kim, Dong-Soo; Kim, Hyun-Seok; Park, Pil-Sun; Kang, Kyu-Suk; Park, Il-Kwon
2015-03-04
The fumigant and contact toxicities of 16 Asteraceae plant essential oils and their constituents against adult male and female Blattella germanica were examined. In a fumigant toxicity test, tarragon oil exhibited 100% and 90% fumigant toxicity against adult male German cockroaches at 5 and 2.5 mg/filter paper, respectively. Fumigant toxicities of Artemisia arborescens and santolina oils against adult male German cockroaches were 100% at 20 mg/filter paper, but were reduced to 60% and 22.5% at 10 mg/filter paper, respectively. In contact toxicity tests, tarragon and santolina oils showed potent insecticidal activity against adult male German cockroaches. Components of active oils were analyzed using gas chromatography, gas chromatography-mass spectrometry, or nuclear magnetic resonance spectrometer. Among the identified compounds from active essential oils, estragole demonstrated potent fumigant and contact toxicity against adult German cockroaches. β-Phellandrene exhibited inhibition of male and female German cockroach acetylcholinesterase activity with IC50 values of 0.30 and 0.28 mg/mL, respectively.
Directory of Open Access Journals (Sweden)
Babak Vazirianzadeh
2014-06-01
Full Text Available The brown-banded cockroach, Supella longipalpa is known as a carrier of pathogenic bacteria in urban environments, but its role is not well documented regarding the carriage of antibiotic-resistant pathogenic bacteria in Iran. The aim of this study was to determine the resistance bacteria isolated from the brown-banded cockroach in Ahvaz, south west of Iran.Totally 39 cockroaches were collected from kitchen area of houses and identified. All specimens were cultured to isolate the bacterial agents on blood agar and MacConky agar media. The microorganisms were identified using necessary differential and biochemical tests. Antimicrobial susceptibility tests were performed for isolated organisms by Kirby-Bauer's disk diffusion according to NCLI guideline, using 18 antibiotics.From the 39 collected S. langipalpa, 179 bacterial agents were isolated, 92 of alimentary ducts and 87 of external body surfaces. Isolated bacteria from cockroaches were identified as Enterobacter spp., Klebsiella spp., Citrobacter spp., Escherichia coli, Salmonella spp., Proteus spp., coagulase negative staphylococci, Serratia marcescens, Staphylococcus aureus, and Bacillus species. The pattern resistance rates were determined for gram negative bacilli and gram positive cocci regarding 18 antibiotics.The brown-banded cockroach can be involved in the spread of drug resistant bacteria and increases the possibility of contacting human environment to drug resistant bacteria. Therefore, the potential of removing this insect should be improved. This is the first original report of drug resistant bacteria isolated from the brown-banded cockroach of Iran.
Iridoids from leaf extract of Genipa americana
Directory of Open Access Journals (Sweden)
Jovelina S.F. Alves
Full Text Available Abstract Genipa americana L., Rubiaceae, is a plant native from Brazil popularly known as “jenipapo”. Two iridoids, 1-hydroxy-7-(hydroxymethyl-1,4aH,5H,7aH-cyclopenta[c]pyran-4-carbaldehyde (1, and iridoid 7-(hydroxymethyl-1-methoxy-1H,4aH,5H,7aH-cyclopenta[c]pyran-4-carbaldehyde (2 were isolated and identified in the leaf extract of G. americana. Compounds 1 and 2 were identified for the first time in G. americana, and 1 has not been yet described in literature. These substances were analyzed by spectroscopic techniques such as infrared, high resolution mass spectrometry, 1H and 13C 1D; as well as 2D nuclear magnetic resonance. Moreover, the presence of flavonoids was detected by a preliminary analysis by Thin Layer Chromatography.
Genipa americana L.: technological prospecting
Directory of Open Access Journals (Sweden)
Selma Maria Santos Moura
2016-10-01
Full Text Available Genipap is a tall tree (10 to 15 meters, found in humid tropical regions, common in brazilian northeastern. Its scientific name is Genipa americana L., jenipapo comes from the Tupi-Guarani jandipap, which means fruit that serves to paint. It features straight stem, dark green leaves, golden-yellow flowers and fruit in the form of ovoid berry, has light brown pulp surrounding seeds in the center. In food, its fruit is edible natural and in the preparation of sweets, soft drinks and wine. It is rich in iron, vitamins B1, B2, B5 and C, calcium and carbohydrates. In popular culture have medicinal indications for the treatment of diseases. When green, the fruit provides a blue juice widely used as a colorant, transparent at first, which becomes black when oxidized, has consistency of ink and body in contact with the skin, it leaves stains that disappear after a week or more spontaneously. The objective of this research was to carry out technology foresight regarding Genipa americana L., to present an overview of the technologies developed related to the theme. For that held a patent search on the basis of the European Patent Office, World Intellectual Property Organization, United States Patent and Trademark Office and the National Institute of Industrial Property. Using the Genipa americana L. keyword were registered 88 patents, when added the word dye 5 patent were found and no request when the search was conducted using Genipa americana L. and cell. Brazil recorded a lower number of patents found in the USA and Japan, with the years 2010, 2011 and 2015, which showed a higher number. Integrated actions should be taken to encourage development institutions to research in order to enable an environment conducive to the generation of innovations, making Brazil a more competitive country in the technological point of view.
Agatoxin-like peptides in the neuroendocrine system of the honey bee and other insects.
Sturm, Sebastian; Ramesh, Divya; Brockmann, Axel; Neupert, Susanne; Predel, Reinhard
2016-01-30
We investigated the peptide inventory of the corpora cardiaca (CC) of the honey bee, Apis mellifera, by direct tissue profiling using MALDI-TOF MS combined with proteomic approaches focusing on cysteine-containing peptides. An agatoxin-like peptide (ALP) was identified as a component of the glandular part of the CC and was associated with the presence of the adipokinetic hormone in mass spectra. Although abundant in the CC, ALP does not belong to the toxins observed in the venom gland of A. mellifera. Homologs of ALP are highly conserved in major groups of arthropods and in line with this we detected ALP in the CC of non-venomous insects such as cockroaches and silverfish. In the American cockroach, Periplaneta americana, ALP was also identified in the CNS and stomatogastric nervous system. This is the first report that establishes the presence of ALPs in the neuroendocrine tissues of insects and further studies are necessary to reveal common functions of these peptides, e.g. as antimicrobial agents, ion channel modulators or classical neuropeptides. Among the messenger molecules of the nervous system, neuropeptides represent the structurally most diverse class and basically participate in the regulation of all physiological processes. The set of neuropeptides, their functions and spatial distribution are particularly well-studied in insects. Until now, however, several potential neuropeptide receptors remained orphan, which indicates the existence of so far unknown ligands. In our study, we used proteomic methods such as cysteine modification, enzymatic digestion and peptide derivatization, combined with direct tissue profiling by MALDI-TOF mass spectrometry, for the discovery of novel putative messenger molecules in the neuroendocrine system. The described presence of agatoxin-like peptides in the nervous system of the honey bee and other insects was overseen so far and is thus a remarkable addition to the very well studied neuropeptidome of insects. It is not
DEFF Research Database (Denmark)
Richards, Callum; Otani, Saria; Mikaelyan, Aram
2017-01-01
The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within......-feeding termite species showed that although some bacteria OTUs shared by P. surinamensis and the farming termites increased in the guts of cockroaches on a fungal diet, cockroach communities remained distinct from those of termites. These results demonstrate that a fungal diet can play a role in structuring gut...
Holbrook, Glenn L; Roebuck, Jamie; Moore, Clyde B; Waldvogel, Michael G; Schal, Coby
2003-10-01
Fipronil, a phenylpyrazole insecticide, was made available in 1999 in bait formulations for use against the German cockroach, Blattella germanica (L.). We have investigated resistance to fipronil in the descendants of cockroaches collected just before, or contemporaneously with, the introduction of fipronil baits. Cockroaches were obtained in two types of settings: homes that either had or had not been serviced by a pest management professional while occupied by their current residents. Thorough inspections by us turned up no evidence that fipronil had been used in any of the homes, and in addition, no residents claimed to have used baits containing fipronil. Resistance to fipronil was detected by topically dosing adult males with the LC99 of fipronil, the value of which was determined in a dose-response assay with males of an insecticide-susceptible strain. Fewer than 99 of 100 males of all field-collected strains died within 72 h of being treated. Moreover, substantial numbers of males survived doses three and 10-fold greater than the LC99. Regression analysis showed that 67% of the variation in the percentage of males that died after being treated with fipronil was explained by a linear relationship with the percentage that died after being treated with dieldrin. Therefore, it appears that resistance to fipronil in German cockroaches--whose ancestors had never been exposed to it--is attributable to enduring resistance to the cyclodienes, which were formerly used for cockroach control and have a similar mode of action as fipronil. Lastly, we found that insects resistant to topically administered fipronil were likewise resistant, and to a similar degree, to ingested fipronil.
Vršanský, Peter; Bechly, Günter
2015-04-01
We describe a new extinct lineage Manipulatoridae (new family) of cockroaches from the Upper Cretaceous (Cenomanian) amber of Myanmar. Manipulator modificaputis gen. et sp. n. is a morphologically unique extinct cockroach that represents the first (of a total of 29 known worldwide) cockroach family reported exclusively from the Myanmar amber. This family represents an early side branch of the stem group of Mantodea (most probably a sister group of Eadiidae within Blattaria/Corydioidea) because it has some synapomorphies with the Mantodea (including the stem group and Eadiidae). This family also retains symplesiomorphies that exclude a position in the crown group, and furthermore has unique autapomorphies that exclude a position as a direct ancestor of Mantodea. The unique adaptations such as strongly elongated extremities and freely movable head on a long neck suggest that these animals were pursuit predators. Five additional specimens (including two immatures) reported from the Myanmar amber suggest that this group was relatively rare but belonged to the indigenous and autochthonous inhabitants of the ancient amber forest of the Myanmar region.
Feinberg, L.; Jorgensen, J.; Haselton, A.; Pitt, A.; Rudner, R.; Margulis, L.
1999-01-01
The filamentous spore-forming bacterium Arthromitus, discovered in termites, millipedes, sow bugs and other soil-dwelling arthropods by Leidy (1850), is the intestinal stage of Bacillus cereus. We extend the range of Arthromitus habitats to include the hindgut of Blaberus giganteus, the large tropical American cockroach. The occurrence and morphology of the intestinal form of the bacillus were compared in individual cockroaches (n=24) placed on four different diet regimes: diurnally maintained insects fed (1) dog food, (2) soy protein only, (3)purified cellulose only, and (4) a dog food-fed group maintained in continuous darkness. Food quality exerted strong influence on population densities and developmental stages of the filamentous bacterium and on fecal pellet composition. The most dramatic rise in Arthromitus populations, defined as the spore-forming filament intestinal stage, occurred in adult cockroaches kept in the dark on a dog food diet. Limited intake of cellulose or protein alone reduced both the frequency of Arthromitus filaments and the rate of weight gain of the insects. Spores isolated from termites, sow bugs, cockroaches and moths, grown on various hard surfaces display a branching mobility and resistance to antibiotics characteristic to group I Bacilli whose members include B. cereus, B. circulans, B. alvei and B. macerans. DNA isolated from pure cultures of these bacilli taken from the guts of Blaberus giganteus (cockroach), Junonia coenia (moth), Porcellio scaber (sow bug) and Cryptotermes brevis (termite) and subjected to Southern hybridization with a 23S-5S B. subtilis ribosomal sequence probe verified that they are indistinguishable from laboratory strains of Bacillus cereus.
Kass, Daniel; McKelvey, Wendy; Carlton, Elizabeth; Hernandez, Marta; Chew, Ginger; Nagle, Sean; Garfinkel, Robin; Clarke, Brian; Tiven, Julius; Espino, Christian; Evans, David
2009-01-01
Background Cockroaches and mice, which are common in urban homes, are sources of allergens capable of triggering asthma symptoms. Traditional pest control involves the use of scheduled applications of pesticides by professionals as well as pesticide use by residents. In contrast, integrated pest management (IPM) involves sanitation, building maintenance, and limited use of least toxic pesticides. Objectives We implemented and evaluated IPM compared with traditional practice for its impact on pests, allergens, pesticide use, and resident satisfaction in a large urban public housing authority. Methods We assigned IPM or control status to 13 buildings in five housing developments, and evaluated conditions at baseline, 3 months, and 6 months in 280 apartments in Brooklyn and Manhattan, in New York City (New York). We measured cockroach and mouse populations, collected cockroach and mouse urinary protein allergens in dust, and interviewed residents. All statistical models controlled for baseline levels of pests or allergens. Results Compared with controls, apartments receiving IPM had significantly lower counts of cockroaches at 3 months and greater success in reducing or sustaining low counts of cockroaches at both 3 and 6 months. IPM was associated with lower cockroach allergen levels in kitchens at 3 months and in beds and kitchens at 6 months. Pesticide use was reduced in IPM relative to control apartments. Residents of IPM apartments also rated building services more positively. Conclusions In contrast to previous IPM studies, which involved extensive cleaning, repeat visits, and often extensive resident education, we found that an easily replicable single IPM visit was more effective than the regular application of pesticides alone in managing pests and their consequences. PMID:19672400
Gaire, Sudip; O'Connell, Mary; Holguin, Francisco O; Amatya, Anup; Bundy, Scott; Romero, Alvaro
2017-04-01
The Turkestan cockroach, Blatta lateralis (Walker), has become the most important peridomestic species in urban areas of the Southwestern United States. The aim of this study was to evaluate the use of botanical compounds to control this urban pest. We tested the acute toxicity and repellency of six botanical constituents and three essential oils on Turkestan cockroach nymphs. Chemical composition of the essential oils was also determined. Topical and fumigant assays with nymphs showed that thymol was the most toxic essential oil constituent, with a LD50 of 0.34 mg/nymph and a LC50 of 27.6 mg/liter air, respectively. Contact toxicity was also observed in assays with trans-Cinnamaldehyde, eugenol, geraniol, methyl eugenol, and p-Cymene. Methyl eugenol and geraniol had limited fumigant toxicity. The essential oils from red thyme, clove bud, and Java citronella exhibited toxicity against nymphs. Cockroaches avoided fresh dry residues of thymol and essential oils. Chemical analysis of the essential oils confirmed high contents of effective essential oil constituents. Our results demonstrated that essential oils and some of their constituents have potential as eco-friendly insecticides for the management of Turkestan cockroaches. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Lee, Mey Fann; Chang, Chia Wei; Song, Pei Pong; Hwang, Guang Yuh; Lin, Shyh Jye; Chen, Yi Hsing
2015-07-01
Cockroaches are the second leading allergen in Taiwan. Sensitization to Per a 2, the major American cockroach allergen, correlates with clinical severity among patients with airway allergy, but there is limited information on IgE epitopes and tissue localization of Per a 2. This study aimed to identify Per a 2 linear IgE-binding epitopes and its distribution in the body of a cockroach. The cDNA of Per a 2 was used as a template and combined with oligonucleotide primers specific to the target areas with appropriate restriction enzyme sites. Eleven overlapping fragments of Per a 2 covering the whole allergen molecule, except 20 residues of signal peptide, were generated by PCR. Mature Per a 2 and overlapping deletion mutants were affinity-purified and assayed for IgE reactivity by immunoblotting. Three synthetic peptides comprising the B cell epitopes were evaluated by direct binding ELISA. Rabbit anti-Per a 2 antibody was used for immunohistochemistry. Human linear IgE-binding epitopes of Per a 2 were located at the amino acid sequences 57-86, 200-211, and 299-309. There was positive IgE binding to 10 tested Per a 2-allergic sera in 3 synthetic peptides, but none in the controls. Immunostaining revealed that Per a 2 was localized partly in the mouth and midgut of the cockroach, with the most intense staining observed in the hindgut, suggesting that the Per a 2 allergen might be excreted through the feces. Information on the IgE-binding epitope of Per a 2 may be used for designing more specific diagnostic and therapeutic approaches to cockroach allergy.
Phoem, Atchara N; Chanthachum, Suphitchaya; Voravuthikunchai, Supayang P
2015-01-01
Microencapsulation using extrusion and emulsion techniques was prepared for Bifidobacterium longum protection against sequential exposure to simulated gastric and intestinal juices, refrigeration storage and heat treatment. Eleutherine americana was used as the co-encapsulating agent. Hydrolysis of E. americana by gastric and intestinal juices was also determined. E. americana and its oligosaccharide extract demonstrated their resistance to low pH and partial tolerance to human α-amylase. Microencapsulated B. longum with E. americana and oligosaccharide extract prepared by the extrusion technique survived better than that by the emulsion technique under adverse conditions. Survival of microencapsulated cells after exposure to the juices and refrigeration storage was higher than free cells at Weeks 2 and 4. In addition, the viability of microencapsulated cells was better than free cells at 65 °C for 15 min. This work suggested that microencapsulated B. longum with E. americana offers the effective delivery of probiotics to colon and maintains their survival in food products. PMID:25629556
COCKROACHES, PESTICIDE USE, AND CHILDREN'S PULMONARY FUNCTION IN AN ARID COMMUNITY
Cockroaches, pesticide use, and children's pulmonary function in an arid communityErik Svendsen1, Mary Ross1, Melissa Gonzales2, Debra Walsh1, Scott Rhoney1, Gina Terrill1, Lucas Neas11US EPA, Chapel Hill, NC; 2University of New MexicoThe El Paso Children's He...
Davari, B; Limoee, M; Khodavaisy, S; Zamini, G; Izadi, S
2015-09-01
The German cockroach, Blattella germanica (L.) has been recognized as a serious health problem throughout the world. Control failures due to insecticide resistance and chemical contamination of environment have led some researchers focus on the other alternative strategy controls. Microbial insecticides such as those containing entomo pathogenic fungi could be of high significance. Lecanicillium muscarium and Beauveria bassiana grow naturally in soils throughout the world and act as a parasite on various arthropod species, causing white muscardine disease. Thus, these two species could be considered as entomopathogenic fungi. The current study conducted to evaluate the toxicity of Beauveria bassiana and Lecanicillium muscarium against German cockroach, Blattella germanica. Conidial formulations of L. muscarium (PTCC 5184) and B. bassiana (PTCC5197) were prepared in aqueous suspensions with Tween 20. Bioassays were performed using two methods including submersion of cockroaches in conidial suspension and baiting. Data were analyzed by Probit program and LC50 and LC90 were estimated. The obtained results indicated that both fungi species were toxic against German cockroach however; Beauveria bassiana was significantly 4.8 fold more toxic than L. muscarium against German cockroach using submersion method.
Effects of neck and circumoesophageal connective lesions on posture and locomotion in the cockroach.
Ridgel, Angela L; Ritzmann, Roy E
2005-06-01
Few studies in arthropods have documented to what extent local control centers in the thorax can support locomotion in absence of inputs from head ganglia. Posture, walking, and leg motor activity was examined in cockroaches with lesions of neck or circumoesophageal connectives. Early in recovery, cockroaches with neck lesions had hyper-extended postures and did not walk. After recovery, posture was less hyper-extended and animals initiated slow leg movements for multiple cycles. Neck lesioned individuals showed an increase in walking after injection of either octopamine or pilocarpine. The phase of leg movement between segments was reduced in neck lesioned cockroaches from that seen in intact animals, while phases in the same segment remained constant. Neither octopamine nor pilocarpine initiated changes in coordination between segments in neck lesioned individuals. Animals with lesions of the circumoesophageal connectives had postures similar to intact individuals but walked in a tripod gait for extended periods of time. Changes in activity of slow tibial extensor and coxal depressor motor neurons and concomitant changes in leg joint angles were present after the lesions. This suggests that thoracic circuits are sufficient to produce leg movements but coordinated walking with normal motor patterns requires descending input from head ganglia.
Clopton, Richard E
2015-02-01
Tomaculocystis corpulenta n. gen., n. sp. (Apicomplexa: Eugregarinorida: Septatorina: Gregarinidae) is described from populations of the little yellow cockroach, Cariblatta lutea (Blattodea: Ectobiidae), established in laboratory culture from samples collected in Alabama and Florida. Tomaculocystis n. gen. are differentiated from other members of Gregarina by a markedly elliptoid gametocyst inside a persistent, lomentiform hyaline epicyst; developmental organization and growth of the spore tubes from gametocyst surface tumidi; and dehiscence by extrusion of non-chain forming oocysts through spore tubes that barely extend beyond the epicyst wall. Gregarina cylindrosa, Gregarina discocephala, and Gregarina mukundai are recognized as members of Tomaculocystis, and G. cylindrosa is recognized as the senior synonym of G. discocephala. Thus, Tomaculocystis cylindrosa n. comb. and Tomaculocystis mukundai n. comb. are formed. Species of Tomaculocystis are distinguished based on gamont deutomerite and oocyst shape and size. The oocysts of T. corpulenta are broadly dolioform, lack 4 polar knobs, and possess distinct, unique polar plates. Oocysts of all other known species in the genus are more oblong in shape, possess 4 polar knobs, and lack the distinct polar plates observed in the oocysts of T. corpulenta. Host utilization and geographic distribution among gregarine genera parasitizing the cockroach family Ectobiidae reveal a pattern of host-parasite specificity linking gregarine genera with ectobiidid subfamilies. Overall patterns suggest a hypothesis of European endemicy for Gamocystis, but hypotheses for the origin and radiation of Tomaculocystis or species of Gregarina infecting cockroaches are confounded by the cosmopolitan spread of pest cockroach species among humans.
Heterobilharzia americana infection and congestive heart failure in a llama (Lama glama).
Corapi, W V; Eden, K B; Edwards, J F; Snowden, K F
2015-05-01
The schistosome Heterobilharzia americana infects several mammalian species in the southeastern United States, including horses, but infections have not been reported in camelids. This is a report of H. americana infection in a 6-year-old llama with extensive cardiac pathology and congestive heart failure. Parasite-induced granulomas were widely disseminated and included overwhelming involvement of the lungs and liver. Microscopic lesions in the heart included myofiber degeneration and necrosis, with extensive replacement fibrosis. Polymerase chain reaction amplification and sequencing confirmed the presence of H. americana in the lungs. © The Author(s) 2014.
Sinnott, Devinn; Carreno, Ramon A; Herrera, Henri
2015-08-01
The thelastomatoid pinworm fauna (Nematoda: Oxyurida: Thelastomatoidea) was surveyed in 3 endemic species and 6 introduced species of cockroach hosts (Insecta: Blattaria) in the Galápagos Islands, Ecuador. A total of 658 host specimens were examined from preserved collections that had been collected between 1966 and 2003 from 7 islands in the archipelago. Eight species of pinworms were identified from these cockroach hosts, including the dominant species Cephalobellus ovumglutinosus and a Severianoia sp. as well as Leidynema appendiculata, Hammerschmidtiella diesingi, an unidentified Cephalobellus species resembling Cephalobellus magalhaesi, an unidentified Protrellus species closely resembling Protrellus shamimi, and an undescribed Blattophila sp. Five new host records are identified for C. ovumglutinosus including the endemic Galápagos cockroaches Chorisoneura carpenteri, Ischnoptera snodgrassii, and Ischnoptera santacruzensis. These endemics were also infected with an undescribed Blatticola sp. Other species recorded resemble known pinworms from other hosts around the world. Prevalence between islands and between host species was variable, but total prevalence for individual pinworm species was consistently low (<10%). A single host specimen examined was infected with more than 1 pinworm species; otherwise only a single species was observed in each infected host. At least 1 introduced pinworm species carried to the islands via invasive cockroach hosts was present in endemic host species, but several globally widespread introduced pinworm species were absent from endemic cockroaches. Santa Cruz was inhabited by the greatest number of pinworm species, likely due to a higher rate of invasive host introduction. This survey, the first from this region, showed that the distribution and transmission of pinworms in the Galápagos Islands is complex and may provide future models of invertebrate dispersal and speciation in an ecosystem already rich with examples of
Marzullo, Timothy C.
2016-01-01
Background Many insects can regenerate limbs, but less is known about the regrowth process with regard to limb injury type. As part of our neurophysiology education experiments involving the removal of a cockroach leg, 1) the ability of Blaberus discoidalis cockroaches to regenerate a metathoracic leg was examined following autotomy at the femur/trochanter joint versus severance via a transverse coxa-cut, and 2) the neurophysiology of the detached legs with regard to leg removal type was studied by measuring spike firing rate and microstimulation movement thresholds. Leg Regrowth Results First appearance of leg regrowth was after 5 weeks in the autotomy group and 12 weeks in the coxa-cut group. Moreover, regenerated legs in the autotomy group were 72% of full size on first appearance, significantly larger (pbarbs, and a 10% higher electrical microstimulation threshold for movement. Summary It is recommended that neurophysiology experiments on cockroach legs remove the limb at autotomy joints instead of coxa cuts, as the leg regenerates significantly faster when autotomized and does not detract from the neurophysiology educational content. PMID:26824931
Identification of rosmarinic acid as the major active constituent in Cordia americana.
Geller, F; Schmidt, C; Göttert, M; Fronza, M; Schattel, V; Heinzmann, B; Werz, O; Flores, E M M; Merfort, I; Laufer, S
2010-04-21
Preparation from leaves of Cordia americana have been widely used in traditional medicine in South Brazil to treat wounds and various inflammations. The objective of this work was to identify the effective compounds in the ethanolic extract prepared from the leaves of Cordia americana, which is used in traditional South Brazilian medicine as anti-inflammatory and wound healing remedy. Isolation and structure elucidation techniques were performed in order to identify the compounds of Cordia americana and HPLC analysis was used for the quantification. The major constituent and the ethanolic extract were investigated for inhibition of 5-lipoxygenase, p38alpha MAPK, TNFalpha release and NF-kappaB as well as in the fibroblast scratch assay. Rosmarinic acid (1) was identified as the major compound with an amount of 8.44% in the ethanolic extract of the leaves of Cordia americana. The ethanolic extract as well as (1) exhibited the highest inhibitory effects on 5-lipoxygenase (IC(50)=0.69 and 0.97microg/mL, resp., IC50 of BWA4C as reference: 0.3microM) and p38alpha (IC50=3.25 and 1.16microg/mL, resp., IC50 of SB203580 as reference: 0.046microM) and moderate inhibitory effects on TNFalpha release. Slight effects were observed in the fibroblast scratch assay. This study increases our knowledge on the effective compound in Cordia americana and supports its use in traditional medicine. We demonstrated for the first time pharmacological effects of Cordia americana and we provide evidences for a crucial role of rosmarinic acid as the major key player. Copyright 2010 Elsevier Ireland Ltd. All rights reserved.
Zha, Chen; Wang, Changlu; Buckley, Brian; Yang, Ill; Wang, Desen; Eiden, Amanda L; Cooper, Richard
2018-04-02
Pest infestations in residential buildings are common, but community-wide pest survey data are lacking. Frequent insecticide applications for controlling indoor pests leave insecticide residues and pose potential health risks to residents. In this study, a community-wide pest survey was carried out in a housing complex consisting of 258 units in 40 buildings in New Brunswick, New Jersey. It was immediately followed by implementation of an integrated pest management (IPM) program in all the cockroach-infested apartments and two bed bug apartments with the goal of eliminating pest infestations, reducing pyrethroid residues, and increasing resident satisfaction with pest control services. The IPM-treated apartments were revisited and treated biweekly or monthly for 7 mo. Initial inspection found the top three pests and their infestation rates to be as follows: German cockroaches (Blattella germanica L. [Blattodea: Blattellidae]), 28%; rodents, 11%; and bed bugs (Cimex lectularius L. [Hemiptera: Cimicidae]), 8%. Floor wipe samples were collected in the kitchens and bedrooms of 20 apartments for pyrethroid residue analysis before the IPM implementation; 17 of the 20 apartments were resampled again at 7 mo. The IPM program reduced cockroach counts per apartment by 88% at 7 wk after initial treatment. At 7 mo, 85% of the cockroach infestations found in the initial survey were eliminated. The average number of pyrethroids detected decreased significantly from 6 ± 1 (mean ± SEM) and 5 ± 1 to 2 ± 1 and 3 ± 1 in the kitchens and bedrooms, respectively. The average concentrations of targeted pyrethroids residue also decreased significantly in the kitchens and bedrooms.
Some Guides to Discovery About Elm Trees, Owls, Cockroaches, Earthworms, Cement and Concrete.
Busch, Phyllis S.
The introduction emphasizes the need for environmental and conservation education, and advocates an inquiry approach. Outdoor resources available to every school are listed. Detailed suggestions are made for investigating cement and concrete, cockroaches, earthworms, elm trees, and owls. In each case general background information and a list of…
Directory of Open Access Journals (Sweden)
Alejandra Herrera Herrera
2014-01-01
Full Text Available The development of periodontal disease and dental caries is influenced by several factors, such as microorganisms of bacterial biofilm or commensal bacteria in the mouth. These microorganisms trigger inflammatory and immune responses in the host. Currently, medicinal plants are treatment options for these oral diseases. Mammea americana extracts have reported antimicrobial effects against several microorganisms. Nevertheless, this effect is unknown against oral bacteria. Therefore, the aim of this study was to evaluate the antibacterial effect of M. americana extract against Porphyromonas gingivalis and Streptococcus mutans. For this, an experimental study was conducted. Ethanolic extract was obtained from seeds of M. americana (one oil phase and one ethanolic phase. The strains of Porphyromonas gingivalis ATCC 33277 and Streptococcus mutans ATCC 25175 were exposed to this extract to evaluate its antibacterial effect. Antibacterial activity was observed with the two phases of M. americana extract on P. gingivalis and S. mutans with lower MICs (minimum inhibitory concentration. Also, bactericidal and bacteriostatic activity was detected against S. mutans, depending on the concentration of the extract, while on M. americana extract presented only bacteriostatic activity against P. gingivalis. These findings provide important and promising information allowing for further exploration in the future.
Evaluation of Treatments to Reduce Hardness of Agave americana Core
Directory of Open Access Journals (Sweden)
José A. Ramírez
2006-01-01
Full Text Available Agave americana contains inulin as storage carbohydrate. Therefore, agave is interesting to be used for the extraction of inulin by pressing. The yield of the process is low due to the high hardness of the core. The objective of this work was to evaluate pretreatments to reduce the hardness in the process of obtaining inulin by pressing. Treatments with water, sulphuric acid 1 % (by mass or sodium hydroxide 1 % (by mass were tested and optimized. The pretreatment of the core of A. americana with sulphuric acid 1 % allowed the reduction of hardness from 30 000 g to 2000 g of breaking force. The mathematical model obtained predicts an optimum processing at 84 °C during 75 min. The treatment with sulphuric acid 1 % also allows white core of A. americana to be obtained, while the other treatments provide yellow core. These results open a good alternative to obtain value added products from this resource.
Dispersal of invasive Phytolacca americana seeds by birds in an urban garden in China.
Li, Ning; Yang, Wen; Fang, Shubo; Li, Xinhai; Liu, Zhanchen; Leng, Xin; An, Shuqing
2017-01-01
Although seed dispersal is a key process determining the regeneration and spread of invasive plant populations, few studies have explicitly addressed the link between dispersal vector behavior and seedling recruitment to gain insight into the invasion process within an urban garden context. We evaluated the role of bird vectors in the dispersal of pokeweed (Phytolacca americana), a North American herb that is invasive in urban gardens in China. Fruiting P. americana attracted both generalist and specialist bird species that fed on and dispersed its seeds. The generalist species Pycnonotus sinensis and Urocissa erythrorhyncha were the most frequent dispersers. Seedling numbers of P. americana were strongly associated with the perching behavior of frugivorous birds. If newly recruited bird species use seedling-safe perching sites, the P. americana will regenerate faster, which would enhance its invasive potential. Based on our observations, we conclude that the 2 main bird vectors, P. sinensis and U. erythrorhyncha, provide potential effective dispersal agents for P. americana. Our results highlight the role of native birds in seed dispersal of invasive plants in urban gardens. © 2016 International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and John Wiley & Sons Australia, Ltd.
Endogenous rhythm and pattern-generating circuit interactions in cockroach motor centres
Directory of Open Access Journals (Sweden)
Izhak David
2016-09-01
Full Text Available Cockroaches are rapid and stable runners whose gaits emerge from the intricate, and not fully resolved, interplay between endogenous oscillatory pattern-generating networks and sensory feedback that shapes their rhythmic output. Here we studied the endogenous motor output of a brainless, deafferented preparation. We monitored the pilocarpine-induced rhythmic activity of levator and depressor motor neurons in the mesothoracic and metathoracic segments in order to reveal the oscillatory networks’ architecture and interactions. Data analyses included phase relations, latencies between and overlaps of rhythmic bursts, spike frequencies, and the dependence of these parameters on cycle frequency. We found that, overall, ipsilateral connections are stronger than contralateral ones. Our findings revealed asymmetries in connectivity among the different ganglia, in which meta-to-mesothoracic ascending coupling is stronger than meso-to-metathoracic descending coupling. Within-ganglion coupling between the metathoracic hemiganglia is stronger than that in the mesothoracic ganglion. We also report differences in the role and mode of operation of homologue network units (manifested by levator and depressor nerve activity. Many observed characteristics are similar to those exhibited by intact animals, suggesting a dominant role for feedforward control in cockroach locomotion. Based on these data we posit a connectivity scheme among components of the locomotion pattern generating system.
Pronghorn (Antilocapra americana) Reintroduction and Management Plan [DRAFT
Department of the Interior — Pronghorn (Antilocapra americana) have been a component of North America’s grasslands for millions of years and have thus created a niche for themselves in remaining...
A entrada de franquias americanas no Brasil: uma estratégia diferente
Gurtner, Werner Frank
2010-01-01
Escrita para o público americano, destaca peculiaridades administrativas e culturais do mercado brasileiro de fast food. Usa exemplos dos procedimentos de entrada de algumas franquias americanas e seus consequentes sucessos e fracassos. Concentra-se, particularnente, no desempenho administrativo destas franquias no Brasil. Discute estratégias alternativas para a expansão internacional futura das franquias americanas. Written for an American audience, highli...
Directory of Open Access Journals (Sweden)
Kaira E.S. da Silva-Leite
Full Text Available Abstract Ximenia americana L., Olacaceae, barks are utilized in folk medicine as analgesic and anti-inflammatory. The objective was to evaluate the toxicity and antinociceptive effect of polysaccharides rich fractions from X. americana barks. The fractions were obtained by extraction with NaOH, followed by precipitation with ethanol and fractionation by ion exchange chromatography. They were administered i.v. or p.o. before nociception tests (writhing, formalin, carragenan-induced hypernociception, hot plate, or during 14 days for toxicity assay. The total polysaccharides fraction (TPL-Xa: 8.1% yield presented 43% carbohydrate (21% uronic acid and resulted in two main fractions after chromatography (FI: 12%, FII: 22% yield. FII showed better homogeneity/purity, content of 44% carbohydrate, including 39% uronic acid, arabinose and galactose as major monosaccharides, and infrared spectra with peaks in carbohydrate range for COO- groups of uronic acid. TPL-Xa (10 mg/kg and FII (0.1 and 1 mg/kg presented inhibitory effect in behavior tests that evaluate nociception induced by chemical and mechanical, but not thermal stimuli. TPL-Xa did not alter parameters of systemic toxicity. In conclusion, polysaccharides rich fractions of X. americana barks inhibit peripheral inflammatory nociception, being well tolerated by animals.
Gutierrez, Alejandra C; Gołębiowski, Marek; Pennisi, Mariana; Peterson, Graciela; García, Juan J; Manfrino, Romina G; López Lastra, Claudia C
2015-04-01
Differences in free fatty acids (FFAs) chemical composition of insects may be responsible for susceptibility or resistance to fungal infection. Determination of FFAs found in cuticular lipids can effectively contribute to the knowledge concerning insect defense mechanisms. In this study, we have evaluated the susceptibility of three species of cockroaches to the entomopathogenic fungi Metarhizium anisopliae (Metschnikoff) Sorokin by topical application. Mortality due to M. anisopliae was highly significant on adults and nymphs of Blattella germanica L. (Blattodea: Blattellidae). However, mortality was faster in adults than in nymphs. Adults of Blatta orientalis L. (Blattodea: Blattidae) were not susceptible to the fungus, and nymphs of Blaptica dubia Serville (Blattodea: Blaberidae) were more susceptible to the fungus than adults. The composition of cuticular FFAs in the three species of cockroaches was also studied. The analysis indicated that all of the fatty acids were mostly straight-chain, long-chain, saturated or unsaturated. Cuticular lipids of three species of cockroaches contained 19 FFAs, ranging from C14:0 to C24:0. The predominant fatty acids found in the three studied species of cockroaches were oleic, linoleic, palmitic, and stearic acid. Only in adults of Bl. orientalis, myristoleic acid, γ-linolenic acid, arachidic acid, dihomolinoleic acid, and behenic acid were identified. Lignoceric acid was detected only in nymphs of Bl. orientalis. Heneicosylic acid and docosahexaenoic acid were identified in adults of Ba. dubia. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Eklund, Bridget E.; Mahdi, Osama; Huntley, Jason F.; Collins, Elliot; Martin, Caleb; Horzempa, Joseph; Fisher, Nathan A.
2018-01-01
Francisella tularensis is a zoonotic bacterial pathogen that causes severe disease in a wide range of host animals, including humans. Well-developed murine models of F. tularensis pathogenesis are available, but they do not meet the needs of all investigators. However, researchers are increasingly turning to insect host systems as a cost-effective alternative that allows greater increased experimental throughput without the regulatory requirements associated with the use of mammals in biomedical research. Unfortunately, the utility of previously-described insect hosts is limited because of temperature restriction, short lifespans, and concerns about the immunological status of insects mass-produced for other purposes. Here, we present a novel host species, the orange spotted (OS) cockroach (Blaptica dubia), that overcomes these limitations and is readily infected by F. tularensis. Intrahemocoel inoculation was accomplished using standard laboratory equipment and lethality was directly proportional to the number of bacteria injected. Progression of infection differed in insects housed at low and high temperatures and F. tularensis mutants lacking key virulence components were attenuated in OS cockroaches. Finally, antibiotics were delivered to infected OS cockroaches by systemic injection and controlled feeding; in the latter case, protection correlated with oral bioavailability in mammals. Collectively, these results demonstrate that this new host system provides investigators with a new tool capable of interrogating F. tularensis virulence and immune evasion in situations where mammalian models are not available or appropriate, such as undirected screens of large mutant libraries. PMID:29578544
da Silva, Cícera Simoni; de Cássia Gonçalves de Lima, Rita; Elekofehinti, Olusola Olalekan; Ogunbolude, Yetunde; Duarte, Antonia Eliene; Rocha, João Batista Teixeira; Alencar de Menezes, Irwin Rose; Barros, Luiz Marivando; Tsopmo, Appolinaire; Lukong, Kiven Erique; Kamdem, Jean Paul
2018-02-25
The effects of caffeine supplementation is well documented in conventional animal models, however, in the lobster cockroaches Nauphoeta cinerea, they have not been reported. Thus, the aim of this study was to investigate the locomotor behavior and biochemical endpoints in the head of the nymphs of N. cinerea following 60 days exposure to food supplemented with 0, 0.5, 1.0, 2.5, 5.0 and 10.0 mg of caffeine/g of diet. The analysis of the locomotor behavior using the video-tracking software, Any-maze, for 12 min revealed that caffeine supplementation caused significant behavioral improvement. There was increase in distance travelled, velocity, frequency of rotation and turn angle (stereotypical behavior such as circling movements), and this was supported by the representative track plots of the path travelled by cockroaches in the open-field arena. In addition, caffeine supplementation markedly increased total thiol and non-protein thiol glutathione (GSH) levels in the heads of cockroaches, and this was in parallel with significant reduction of lipid peroxidation and free Fe(II) content. Taking together, our results indicate that long-term caffeine supplementation may exert preventive effects against oxidative stress and support the use of N. cinerea as an efficient alternative model to assess the efficacy of food molecules. Copyright © 2018 Elsevier B.V. All rights reserved.
Physicochemical Properties of Avocado Pear (Persea americana ...
African Journals Online (AJOL)
The oil from edible avocado pear (Persea americana) was extracted using the Soxhlet extraction method and characterized for specific gravity, refractive index, free fatty acids, saponification value, iodine value, acid value and biofuel potential using standard methods. The percent oil content in the fruit pulp was determined.
DEFF Research Database (Denmark)
Graves, Gary R.
2015-01-01
I observed black-crowned night-herons (Nycticorax nycticorax) swimming and kleptoparasitizing American coots (Fulica americana) at an artificial lake in Pinal County, Arizona. This appears to be the first record of interspecific kleptoparasitism by a swimming ardeid.......I observed black-crowned night-herons (Nycticorax nycticorax) swimming and kleptoparasitizing American coots (Fulica americana) at an artificial lake in Pinal County, Arizona. This appears to be the first record of interspecific kleptoparasitism by a swimming ardeid....
Czech Academy of Sciences Publication Activity Database
Wu, H. H.; Lee, H. J.; Horng, S. B.; Berec, Luděk
2007-01-01
Roč. 249, - (2007), s. 473-486 ISSN 0022-5193 Institutional research plan: CEZ:AV0Z50070508 Keywords : German cockroach * Blattella germanica * Blatella bisignata Subject RIV: EH - Ecology, Behaviour Impact factor: 2.323, year: 2007
Directory of Open Access Journals (Sweden)
Maria J López-Sánchez
2009-11-01
Full Text Available Bacterial endosymbionts of insects play a central role in upgrading the diet of their hosts. In certain cases, such as aphids and tsetse flies, endosymbionts complement the metabolic capacity of hosts living on nutrient-deficient diets, while the bacteria harbored by omnivorous carpenter ants are involved in nitrogen recycling. In this study, we describe the genome sequence and inferred metabolism of Blattabacterium strain Bge, the primary Flavobacteria endosymbiont of the omnivorous German cockroach Blattella germanica. Through comparative genomics with other insect endosymbionts and free-living Flavobacteria we reveal that Blattabacterium strain Bge shares the same distribution of functional gene categories only with Blochmannia strains, the primary Gamma-Proteobacteria endosymbiont of carpenter ants. This is a remarkable example of evolutionary convergence during the symbiotic process, involving very distant phylogenetic bacterial taxa within hosts feeding on similar diets. Despite this similarity, different nitrogen economy strategies have emerged in each case. Both bacterial endosymbionts code for urease but display different metabolic functions: Blochmannia strains produce ammonia from dietary urea and then use it as a source of nitrogen, whereas Blattabacterium strain Bge codes for the complete urea cycle that, in combination with urease, produces ammonia as an end product. Not only does the cockroach endosymbiont play an essential role in nutrient supply to the host, but also in the catabolic use of amino acids and nitrogen excretion, as strongly suggested by the stoichiometric analysis of the inferred metabolic network. Here, we explain the metabolic reasons underlying the enigmatic return of cockroaches to the ancestral ammonotelic state.
Directory of Open Access Journals (Sweden)
Erin A Gontang
Full Text Available Investigations of gut microbiomes have shed light on the diversity and genetic content of these communities, and helped shape our understanding of how host-associated microorganisms influence host physiology, behavior, and health. Despite the importance of gut microbes to metazoans, our understanding of the changes in diversity and composition across the alimentary tract, and the source of the resident community are limited. Here, using community metagenomics and 16S rRNA gene sequencing, we assess microbial community diversity and coding potential in the foregut, midgut, and hindgut of a juvenile Panchlora cockroach, which resides in the refuse piles of the leaf-cutter ant species Atta colombica. We found a significant shift in the microbial community structure and coding potential throughout the three gut sections of Panchlora sp., and through comparison with previously generated metagenomes of the cockroach's food source and niche, we reveal that this shift in microbial community composition is influenced by the ecosystems in which Panchlora sp. occurs. While the foregut is composed of microbes that likely originate from the symbiotic fungus gardens of the ants, the midgut and hindgut are composed of a microbial community that is likely cockroach-specific. Analogous to mammalian systems, the midgut and hindgut appear to be dominated by Firmicutes and Bacteroidetes with the capacity for polysaccharide degradation, suggesting they may assist in the degradation of dietary plant material. Our work underscores the prominence of community changes throughout gut microbiomes and highlights ecological factors that underpin the structure and function of the symbiotic microbial communities of metazoans.
Gontang, Erin A; Aylward, Frank O; Carlos, Camila; Glavina Del Rio, Tijana; Chovatia, Mansi; Fern, Alison; Lo, Chien-Chi; Malfatti, Stephanie A; Tringe, Susannah G; Currie, Cameron R; Kolter, Roberto
2017-01-01
Investigations of gut microbiomes have shed light on the diversity and genetic content of these communities, and helped shape our understanding of how host-associated microorganisms influence host physiology, behavior, and health. Despite the importance of gut microbes to metazoans, our understanding of the changes in diversity and composition across the alimentary tract, and the source of the resident community are limited. Here, using community metagenomics and 16S rRNA gene sequencing, we assess microbial community diversity and coding potential in the foregut, midgut, and hindgut of a juvenile Panchlora cockroach, which resides in the refuse piles of the leaf-cutter ant species Atta colombica. We found a significant shift in the microbial community structure and coding potential throughout the three gut sections of Panchlora sp., and through comparison with previously generated metagenomes of the cockroach's food source and niche, we reveal that this shift in microbial community composition is influenced by the ecosystems in which Panchlora sp. occurs. While the foregut is composed of microbes that likely originate from the symbiotic fungus gardens of the ants, the midgut and hindgut are composed of a microbial community that is likely cockroach-specific. Analogous to mammalian systems, the midgut and hindgut appear to be dominated by Firmicutes and Bacteroidetes with the capacity for polysaccharide degradation, suggesting they may assist in the degradation of dietary plant material. Our work underscores the prominence of community changes throughout gut microbiomes and highlights ecological factors that underpin the structure and function of the symbiotic microbial communities of metazoans.
López-Sánchez, Maria J.; Neef, Alexander; Peretó, Juli; Patiño-Navarrete, Rafael; Pignatelli, Miguel; Latorre, Amparo; Moya, Andrés
2009-01-01
Bacterial endosymbionts of insects play a central role in upgrading the diet of their hosts. In certain cases, such as aphids and tsetse flies, endosymbionts complement the metabolic capacity of hosts living on nutrient-deficient diets, while the bacteria harbored by omnivorous carpenter ants are involved in nitrogen recycling. In this study, we describe the genome sequence and inferred metabolism of Blattabacterium strain Bge, the primary Flavobacteria endosymbiont of the omnivorous German cockroach Blattella germanica. Through comparative genomics with other insect endosymbionts and free-living Flavobacteria we reveal that Blattabacterium strain Bge shares the same distribution of functional gene categories only with Blochmannia strains, the primary Gamma-Proteobacteria endosymbiont of carpenter ants. This is a remarkable example of evolutionary convergence during the symbiotic process, involving very distant phylogenetic bacterial taxa within hosts feeding on similar diets. Despite this similarity, different nitrogen economy strategies have emerged in each case. Both bacterial endosymbionts code for urease but display different metabolic functions: Blochmannia strains produce ammonia from dietary urea and then use it as a source of nitrogen, whereas Blattabacterium strain Bge codes for the complete urea cycle that, in combination with urease, produces ammonia as an end product. Not only does the cockroach endosymbiont play an essential role in nutrient supply to the host, but also in the catabolic use of amino acids and nitrogen excretion, as strongly suggested by the stoichiometric analysis of the inferred metabolic network. Here, we explain the metabolic reasons underlying the enigmatic return of cockroaches to the ancestral ammonotelic state. PMID:19911043
Soares, M A M; Hartfelder, K; Tesserolli de Souza, J M; Stocker, A J
2015-10-01
Ecdysteroid titers, developmental landmarks and the presence of prominent amplifying regions (DNA puffs) have been compared during late larval to pupal development in four groups of Rhynchosciara americana larvae and in R. americana and Rhynchosciara milleri. Three prominent DNA puffs (B2, C3 and C8) expand and regress sequentially on the rising phase of the 20-hydroxyecdysone (20E) titer in R. americana as a firm, cellular cocoon is being constructed. A sharp rise in 20E coincides with the regression of these puffs. The shape of the 20E curve is similar in R. milleri, a species that does not construct a massive cocoon, but the behavior of certain DNA puffs and their temporal relationship to the curve differs. Regions corresponding to B2 and C3 can be identified in R. milleri by banding pattern similarity with R. americana chromosomes and, in the case of B2, by hybridization to an R. americana probe. A B2 puff appears in R. milleri as the 20E titer rises but remains small in all gland regions. A puff similar to the R. americana C3 puff occurs in posterior gland cells of R. milleri (C3(Rm)) after the B2 puff, but this site did not hybridize to R. americana C3 probes. C3(Rm) incorporated (3)H-thymidine above background, but showed less post-puff DNA accumulation than C3 of R. americana. R. americana C8 probes hybridized to a more distal region of the R. milleri C chromosome that did not appear to amplify or form a large puff. These differences can be related to developmental differences, in particular differences in cocoon construction between the two species.
Sweigart, Andrea L
2010-03-01
Postzygotic reproductive isolation evolves when hybrid incompatibilities accumulate between diverging populations. Here, I examine the genetic basis of hybrid male sterility between two species of Drosophila, Drosophila virilis and D. americana. From these analyses, I reach several conclusions. First, neither species carries any autosomal dominant hybrid male sterility alleles: reciprocal F(1) hybrid males are perfectly fertile. Second, later generation (backcross and F(2)) hybrid male sterility between D. virilis and D. americana is not polygenic. In fact, I identified only three genetically independent incompatibilities that cause hybrid male sterility. Remarkably, each of these incompatibilities involves the Y chromosome. In one direction of the cross, the D. americana Y is incompatible with recessive D. virilis alleles at loci on chromosomes 2 and 5. In the other direction, the D. virilis Y chromosome causes hybrid male sterility in combination with recessive D. americana alleles at a single QTL on chromosome 5. Finally, in contrast with findings from other Drosophila species pairs, the X chromosome has only a modest effect on hybrid male sterility between D. virilis and D. americana.
Home Sweet Home: How to Build a Madagascar Hissing Cockroach Habitat out of Recycled Materials
Wagler, Ron
2010-01-01
Madagascar hissing cockroaches (MHC) are amazing insects that can be an integral part of an effective science learning and teaching environment. MHCs have a fascinating social structure. They make excellent pets, teach students how to properly care for animals, and their large size adds to their "wow" factor. These characteristics make them unique…
BULT, R; MASTEBROEK, HAK
1993-01-01
Extracellular spike activity from three different types of visual interneurons found in the optic lobe of the giant cockroach Blaberus giganteus was recorded. The spike rate of all three types of neurons fluctuated in a circadian manner in constant darkness (DD). Two types, so-called ''on'' neurons
Effective Stimulus Parameters for Directed Locomotion in Madagascar Hissing Cockroach Biobot.
Directory of Open Access Journals (Sweden)
Jonathan C Erickson
Full Text Available Swarms of insects instrumented with wireless electronic backpacks have previously been proposed for potential use in search and rescue operations. Before deploying such biobot swarms, an effective long-term neural-electric stimulus interface must be established, and the locomotion response to various stimuli quantified. To this end, we studied a variety of pulse types (mono- vs. bipolar; voltage- vs. current-controlled and shapes (amplitude, frequency, duration to parameters that are most effective for evoking locomotion along a desired path in the Madagascar hissing cockroach (G. portentosa in response to antennal and cercal stimulation. We identified bipolar, 2 V, 50 Hz, 0.5 s voltage controlled pulses as being optimal for evoking forward motion and turns in the expected contraversive direction without habituation in ≈50% of test subjects, a substantial increase over ≈10% success rates previously reported. Larger amplitudes for voltage (1-4 V and current (50-150 μA pulses generally evoked larger forward walking (15.6-25.6 cm; 3.9-5.6 cm/s but smaller concomitant turning responses (149 to 80.0 deg; 62.8 to 41.2 deg/s. Thus, the radius of curvature of the initial turn-then-run locomotor response (≈10-25 cm could be controlled in a graded manner by varying the stimulus amplitude. These findings could be used to help optimize stimulus protocols for swarms of cockroach biobots navigating unknown terrain.
Directory of Open Access Journals (Sweden)
Guy Sedar Singor Njateng
2018-01-01
Full Text Available Objective: To determine inhibitory activity of methanolic leaf extract of Piper umbellatum and Persea americana (P. americana (traditionally used in Cameroon against diabetes on α -glucosidase, β -glucosidase, maltase-glucoamylase, aldose reductase and aldehyde reductase activities, enzymes involved in starch digestion or diabetic complications. Methods: The methanol extracts from Piper umbellatum and P. americana were prepared by maceration. To assess relative efficacy of these extracts, the determination of concentrations that were needed to inhibit 50% of enzyme activity was done, whereas, gas chromatography-mass spectrum was used to identify components from extracts that may be responsible for the activities. Results: The tested extracts strongly inhibited α -glucosidase, maltase-glucoamylase, aldose reductase and aldehyde reductase activities with IC50 ranging from (1.07 ± 0.03 to (31.77 ± 1.17 μg/mL. Among the tested extracts, P. americana was the most active against sensitive enzymes (IC50 of 1.07 ± 0.03 to 15.63 ± 1.23. But, none of the extracts showed interesting inhibitory effect against β -glucosidase as their percentage inhibitions were less than 16%. From gas chromatography-mass spectrum analysis, 10 and 8 compounds were identified in Piper umbellatum and P. americana extracts respectively, using NIST library 2014. Conclusions: Results of this study provide the scientific credential for a prospective usage of these plants to treat diabetes.
MALDI-TOF MS analysis of labile Lolium perenne major allergens in mixes.
Irañeta, S G; Acosta, D M; Duran, R; Apicella, C; Orlando, U D; Seoane, M A; Alonso, A; Duschak, V G
2008-08-01
It is well known that allergen extracts used for specific therapy of allergic disorders are commonly stored as mixtures, causing an alteration of its stability. The aim of this report is to identify pollen allergens susceptible to degradation during storage of mixtures containing different sources of proteases in the absence of glycerol as a preserving agent. Mixes containing Lolium perenne (Lol p) pollen extract with either Aspergillus fumigatus or Periplaneta americana extracts were prepared and co-incubated for 90 days at 4 degrees C. Samples were taken off at fixed times and comparatively tested by in vitro and in vivo assays with atopic patients. Selected pollinic allergens were subjected to MALDI-TOF MS analysis. ELISA inhibition evidenced the loss of potency from ryegrass extract, and immunoblotting assays showed the degradation of specific pollinic allergens during storage of mixtures containing protease-rich sources. An in vivo intradermal skin assay confirmed the gradual loss of the biological activity of L. perenne pollen extract co-incubated with non-related protease-rich extracts in comparison with that of the control pollen extract. MALDI-TOF MS analysis allowed us to determine that Lol p 1 and Lol p 5 are susceptible to proteolysis whereas Lol p 4 was found to be resistant to degradation during storage. Lol p 1 and Lol p 5 degradation is responsible for the loss of the biological activity of L. perenne pollen extract when co-incubated with protease-rich fungal and cockroach extracts in the same vial for months in the absence of glycerol as a preserving agent. The integrity of these major allergens must be preserved to increase the vaccine stability and to assure efficacy when mixes are used for immunotherapy.
Borah, Manash Pratim; Prasad, Surya Bali
2017-06-30
India has an immense faunal, floral, as well as cultural diversity with many ethnic communities who are primarily dependent on the traditional medicinal system for their primary health care. Documentation and evaluation of this indigenous remedial knowledge may be helpful to establish new drugs for human health. The present study is intended to look into different zootherapeutic medicinal uses in the traditional health care system among the native inhabitants adjacent to the Gibbon Wildlife Sanctuary, Assam, India. Field survey was carried out from March 2015 to August 2015 by personal interviews through semi-structured questionnaires. In some cases where participants were uncomfortable with the questionnaires, informal interviews and open group discussions were conducted with a total of 62 indigenous respondents (43 male and 19 female) who provided the information regarding various medicinal uses of animals and their products (local name of animal, mode of preparation, application etc). The study recorded a total of 44 different species, 44 genera and 36 families of animals which are used for the treatment of 40 different ailments. Insects occupied the highest uses (30.9%), followed by mammals (23.8%), fishes (16.7%), reptiles (11.9%), amphibians (7.1%), annelids (4.8%) and gastropods (4.8%). Further, some zootherapeutic animals i.e. cockroach (Periplaneta americana), praying mantis (Mantis religiosa) and earthworms (Metaphire houletti, Pheretima posthum) are used for the treatment of asthma, otorrhoea and cancer respectively. The findings suggest that the traditional zootherapeutic remedial measures followed by the native people adjacent to Gibbon Wildlife Sanctuary plays an important role in their primary health care. The documentation of this indigenous knowledge on animal based medicines should be very helpful in the formulation of strategies for sustainable management and conservation of bio-resources as well as providing potential for the novel drugs
Goel, C; Kalra, N; Dwarakanath, B S; Gaur, S N; Arora, N
2015-05-01
Serine protease activity of Per a 10 from Periplaneta americana modulates dendritic cell (DC) functions by a mechanism(s) that remains unclear. In the present study, Per a 10 protease activity on CD40 expression and downstream signalling was evaluated in DCs. Monocyte-derived DCs from cockroach-allergic patients were treated with proteolytically active/heat-inactivated Per a 10. Stimulation with active Per a 10 demonstrated low CD40 expression on DCs surface (P Per a 10, suggesting cleavage of CD40. Per a 10 activity reduced the interleukin (IL)-12 and interferon (IFN)-γ secretion by DCs (P Per a 10, indicating that low CD40 expression is associated with low levels of IL-12 secretion. Active Per a 10 stimulation caused low nuclear factor-kappa B (NF-κB) activation in DCs compared to heat-inactivated Per a 10. Inhibition of the NF-κB pathway suppressed the CD40 expression and IL-12 secretion by DCs, further indicating that NF-κB is required for CD40 up-regulation. CD40 expression activated the tumour necrosis factor (TNF) receptor-associated factor 6 (TRAF6), thereby suggesting its involvement in NF-κB activation. Protease activity of Per a 10 induced p38 mitogen-activated protein kinase (MAPK) activation that showed no significant effect on CD40 expression by DCs. However, inhibiting p38 MAPK or NF-κB suppressed the secretion of IL-12, IFN-γ, IL-6 and TNF-α by DCs. Such DCs further reduced the secretion of IL-4, IL-6, IL-12 and TNF-α by CD4(+) T cells. In conclusion, protease activity of Per a 10 reduces CD40 expression on DCs. CD40 down-regulation leads to low NF-κB levels, thereby modulating DC-mediated immune responses. © 2014 British Society for Immunology.
Utilization of cattail aquatic weed(Typha domingesis pers) for biogas energy production
International Nuclear Information System (INIS)
Mashandete, Anthony Manoni
2007-01-01
Cattail, Typha domingesis Pers, an aquatic emergent weed had seriously impacted the ecosystem of the lake Jipe in Northern Tanzania creating ecological-environmental and economic problems including shrinkage of the lake and reduction of fish yield. Two anaerobic digestion trial were carried out one based different parts and blends of cattail weed at 5, 15, 30 and 60% total solids (TS) in 0.5 L anaerobic batch bioreactors at ambient temperature of 33±1(deg)C. Gut contents from cockroaches (Periplaneta americana) was used as anaerobic inoculum (starter seed). The results showed that highest methane yields were obtained at 5% TS for both unmixed and mixed cattail weeds parts. In the first trial methane yield at 5% TS from five different cattail weed parts namely; spikes, leaves, stems rhizomes and roots ranged from 150-447 CH 4 mL /gVS added. The highest and the lowest methane yields were obtained from leaves and spikes, respectively. In the second trial, methane yields at 5% TS from three different blends of cattail weed viz; spikes, leaves and stems (33.3%:33.3%:33.3%), rhizomes and roots (50%:50%), and whole cattail (spikes, leaves, stems, rhizomes and roots each 20%) ranged between 246 to 288 CH 4 mL /gVS added. The highest and lowest methane yields were obtained from spikes, leaves, and stems and whole cattail blends, respectively. The overall average methane content in the biogas produced at 5 to 60% TS in two trials ranged from 68-83%. It was concluded, that anaerobic digestion of cattail weed is feasible and could serve the dual roles for producing biogas, a clean renewable energy and reducing the weed as part of its management as well as reduction of methane emission. (author)
Agrobacterium-mediated genetic transformation of Fraxinus americana hypocotyls
Kaitlin J. Palla; Paula M. Pijut
2015-01-01
An Agrobacterium tumefaciens-mediated genetic transformation system was successfully developed for white ash (Fraxinus americana) using hypocotyls as the initial explants. Hypocotyls isolated from mature embryos germinated on Murashige and Skoog (MS) medium supplemented with 22.2 µM 6-benzyladenine (BA) and 0.5 µM...
Drug interaction studies of Ximenia americana and Pavetta ...
African Journals Online (AJOL)
The therapeutic efficacy of single or multicomponent herbs is thought to reside in synergistic interactions between the bioactive constituents. The methanol extracts of X. americana and P. crassipes were initially screened against Gram positive and negative organisms as well as against Mycobacterium tuberculosis H37Rv ...
A Case of Ventilator-Associated Pneumonia Caused by Ewingella americana : First Report from Turkey
Directory of Open Access Journals (Sweden)
Kenan Ecemiş
2014-09-01
Full Text Available Ewingella americana is a very rare cause of serious infections, especially in immunocompromised patients. We report a case of ventilator-associated pneumonia (VAP in an intensive care unit patient, who was treated successfully with ceftriaxone. To the best of our knowledge, this is the first case of VAP due to Ewingella americana in the English literature.J Microbiol Infect Dis 2014; 4(3: 118-120
Mundo, Jorge; Villeda-Hernández, Juana; Herrera-Ruiz, Maribel; Gutiérrez, María Del Carmen; Arellano-García, Jesús; León-Rivera, Ismael; Perea-Arango, Irene
2017-10-01
Waltheria americana is a plant used in Mexican traditional medicine to treat some nervous system disorders. The aims of the present study were to isolate and determine the neuropharmacological and neurprotective activities of metabolites produced by a cell suspension culture of Waltheria americana. Submerged cultivation of W. americana cells provided biomass. A methanol-soluble extract (WAsc) was obtained from biomass. WAsc was fractionated yielding the chromatographic fractions 4WAsc-H 2 O and WAsc-CH 2 Cl 2 . For the determination of anticonvulsant activity in vivo, seizures were induced in mice by pentylenetetrazol (PTZ). Neuropharmacological activities (release of gamma amino butyric acid (GABA) and neuroprotection) of chromatographic fractions were determined by in vitro histological analysis of brain sections of mice post mortem. Fraction 4WAsc-H 2 O (containing saccharides) did not produce neuronal damage, neurodegeneration, interstitial tissue edema, astrocytic activation, nor cell death. Pretreatment of animals with 4WAsc-H 2 O and WAsc-CH 2 Cl 2 from W. americana cell suspensions induced an increase in: GABA release, seizure latency, survival time, neuroprotection, and a decrease in the degree of severity of tonic/tonic-clonic convulsions, preventing PTZ-induced death of up to 100% of animals of study. Bioactive compounds produced in suspension cell culture of W. americana produce neuroprotective and neuropharmacological activities associated with the GABAergic neurotransmission system. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Purohit, A.; Shao, J.; Degreef, J. M.; van Leeuwen, A.; van Ree, R.; Pauli, G.; de Blay, F.
2007-01-01
BACKGROUND: Tropomyosin has been described as cross-reacting allergen between mite, cockroach and shrimp. METHODS: In 13 patients with asthma and/or rhinitis sensitized to mite and/or German cockroach and presenting urticaria, oral allergy syndrome or angio-edema upon eating shrimp and/or crab, we
Genipa americana: prospecção tecnológica
Directory of Open Access Journals (Sweden)
Selma Maria Santos Moura
2016-10-01
Full Text Available O jenipapo é uma árvore alta (10 a 15 metros, encontrada em regiões de clima tropical úmido, comum no nordeste brasileiro. Seu nome científico é Genipa americana L., jenipapo vem do Tupi-guarani jandipap, que significa fruto que serve para pintar. Apresenta caule reto, folhas verde-escuras, flores amarelo-ouro e o fruto na forma de baga ovoide, possui polpa marrom clara que envolve sementes no centro. Na alimentação humana, seu fruto é comestível ao natural e no preparo de doces, refrescos e vinho. É rico em ferro, vitaminas B1, B2, B5 e C, cálcio e hidratos de carbono. Na cultura popular têm indicações medicinais para o tratamento de afecções. Quando verde, o fruto fornece um suco azul muito utilizado como corante, transparente a princípio, o qual torna-se preto quando oxida, apresenta consistência do nanquim e no corpo, em contato com a pele, deixa manchas que desaparecem após uma semana ou mais, espontaneamente. O objetivo desta pesquisa foi realizar a prospecção tecnológica com relação à Genipa americana L., para apresentar uma visão geral sobre as tecnologias desenvolvidas relacionadas ao tema. Para isso realizou-se uma busca de patentes nas bases do European Patent Office, World Intellectual Property Organization, United States Patent and Trademark Office e no Instituto Nacional de Propriedade Industrial. Utilizando a palavra-chave Genipa americana L. foram registradas 88 patentes, quando acrescido à especificação corante encontrou-se 5 e nenhuma quando utilizou-se Genipa americana L. e célula. O Brasil registrou um número de patentes inferior ao encontrado nos USA e no Japão, sendo os anos de 2010, 2011 e 2015 os que apresentaram maior número. Ações integradas devem ser realizadas para estimular as instituições de fomento à pesquisa no intuito de viabilizar um ambiente propício à geração de inovações, fazendo do Brasil um país mais competitivo do ponto de vista tecnológico.
Directory of Open Access Journals (Sweden)
Yufeng Zhou
2014-01-01
Full Text Available Background. Aryl hydrocarbon receptor (AhR, a multifunctional regulator that senses and responds to environmental stimuli, plays a role in normal cell development and immune regulation. Recent evidence supports a significant link between environmental exposure and AhR in the development of allergic diseases. We sought to investigate whether AhR plays a role in mediating cockroach allergen-induced allergic immune responses. Methods. AhR expression in human lung fibroblasts from asthmatic and healthy individuals and in cockroach extract (CRE treated human lung fibroblasts (WI-38 was examined. The role of AhR in modulating CRE induced TGFβ1 production was investigated by using AhR agonist, TCDD, antagonist CH122319, and knockdown of AhR. The role of latent TGFβ1 binding protein-1 (LTBP1 in mediating TCDD induced active TGFβ1 release was also examined. Results. AhR expression was higher in airway fibroblasts from asthmatic subjects as compared to healthy controls. AhR in fibroblasts was activated by TCDD with an increased expression of cyp1a1 and cyp1b1. Increased AhR expression was observed in CRE-treated fibroblasts. Importantly, CRE induced TGFβ1 production in fibroblasts was significantly enhanced by TCDD but inhibited by CH122319. Reduced TGFβ1 production was further confirmed in fibroblasts with AhR knockdown. Moreover, AhR knockdown inhibited CRE induced fibroblast differentiation. Furthermore, TCDD induced active TGFβ1 release was significantly inhibited by LTBP1 knockdown. Conclusion. These results provide evidence for the role of AhR in modulating cockroach allergen-induced immune responses through controlling the active TGFβ1 release, suggesting a possible synergistic effect between exposure to allergens and environmental chemicals on the development of allergic diseases.
Biogeography and Phylogeny of Wood-feeding Cockroaches in the Genus Cryptocercus
Directory of Open Access Journals (Sweden)
Kiyoto Maekawa
2011-07-01
Full Text Available Subsocial, xylophagous cockroaches of the genus Cryptocercus exhibit a disjunct distribution, with representatives in mature montane forests of North America, China, Korea and the Russian Far East. All described species are wingless and dependent on rotting wood for food and shelter at all stages of their life cycle; consequently, their distribution is tied to that of forests and strongly influenced by palaeogeographical events. Asian and American lineages form distinct monophyletic groups, comprised of populations with complex geographic substructuring. We review the phylogeny and distribution of Cryptocercus, and discuss splitting events inferred from molecular data.
Directory of Open Access Journals (Sweden)
Timothy C Marzullo
Full Text Available Many insects can regenerate limbs, but less is known about the regrowth process with regard to limb injury type. As part of our neurophysiology education experiments involving the removal of a cockroach leg, 1 the ability of Blaberus discoidalis cockroaches to regenerate a metathoracic leg was examined following autotomy at the femur/trochanter joint versus severance via a transverse coxa-cut, and 2 the neurophysiology of the detached legs with regard to leg removal type was studied by measuring spike firing rate and microstimulation movement thresholds.First appearance of leg regrowth was after 5 weeks in the autotomy group and 12 weeks in the coxa-cut group. Moreover, regenerated legs in the autotomy group were 72% of full size on first appearance, significantly larger (p<0.05 than coxa-cut legs (29% of full size at first appearance. Regenerated legs in both groups grew in size with each subsequent molt; the autotomy-removed legs grew to full size within 18 weeks, whereas coxa-cut legs took longer than 28 weeks to regrow. Removal of the metathoracic leg in both conditions did not have an effect on mortality compared to matched controls with unmolested legs.Autotomy-removed legs had lower spontaneous firing rates, similar marked increased firing rates upon tactile manipulation of tibial barbs, and a 10% higher electrical microstimulation threshold for movement.It is recommended that neurophysiology experiments on cockroach legs remove the limb at autotomy joints instead of coxa cuts, as the leg regenerates significantly faster when autotomized and does not detract from the neurophysiology educational content.
Jamroz, RC; Beintema, JJ; Stam, WT; Bradfield, JY
In an effort to identify several polypeptides that are strongly suppressed by juvenile hormone (JH) in fat body of adult female Blaberus discoidalis cockroaches, we have cloned a cDNA representing a polypeptide member of the hexamerin family of arthropod serum proteins. The deduced primary
A REPRESENTAÇÃO DA MULHER LATINO-AMERICANA: DA LITERATURA PARA O CINEMA
de Amorim, Maria Inês Freitas; Universidade do Estado do Rio de Janeiro
2015-01-01
As obras do escritor colombiano Gabriel García Márquez são reconhecidas pela presença de personagens femininas fortes e pela representação de elementos da cultura latino-americana. Já a indústria cinematográfica de Hollywood costuma representar a mulher latino-americana a partir de estereótipos, sobretudo relacionados à sensualidade e submissas às vontades da voz masculina. O romance de García Márquez El amor en los tiempos del cólera foi adaptado para o cinema pela industria estadunidense, ...
Pellens, Roseli; D'Haese, Cyrille A; Bellés, Xavier; Piulachs, Maria-Dolors; Legendre, Frédéric; Wheeler, Ward C; Grandcolas, Philippe
2007-05-01
Cockroaches have always been used to understand the first steps of social evolution in termites because they are close relatives with less complex and integrated social behaviour. Termites are all eusocial and ingroup comparative analysis would be useless to infer the origin of their social behaviour. The cockroach genus Cryptocercus was used as a so-called "prototermite" model because it shows key-attributes similar to the termites (except Termitidae): wood-feeding, intestinal flagellates and subsocial behaviour. In spite of these comparisons between this subsocial cockroach and eusocial termites, the early and remote origin of eusocial behaviour in termites is not well understood yet and the study of other relevant "prototermite" models is however needed. A molecular phylogenetic analysis was carried out to validate a new "prototermite" model, Parasphaeria boleiriana which shows a peculiar combination of these key-attributes. It shows that these attributes of Parasphaeria boleiriana have an independent origin from those of other wood-eating cockroaches and termites. The case of P. boleiriana suggests that a short brood care was selected for with life on an ephemeral wood resource, even with the need for transmission of flagellates. These new phylogenetic insights modify evolutionary hypotheses, contradicting the assumption made with Cryptocercus model that a long brood care is necessary for cooperation between broods in the "shift-in-dependent-care" hypothesis. An ephemeral wood resource is suggested to prompt generation overlap and the evolution of cooperation, even if brood care is shortened.
UN HELICTERES NUEVO DE MEXICO, NEXO ENTRE LAS ESPECIES ASIATICAS y AMERICANAS
Directory of Open Access Journals (Sweden)
Carmen L. Cristóbal
1987-01-01
Full Text Available Una nueva especie, Helicteres vegae (Sterculiaceae, de Sinaloa, México es descripta e ilustrada. Se encontró el número de cromosomas 2n = 18. H. vegae se compara con el resto de las especies mexicanas y se proporciona una clave. Su afinidad con la de Asia y las especies americanas es discutida. H. vegae junto con H. Rekoí y H.carthagenensis se consideran las más diferenciadas de las especies americanas. Se propone una posible área de origen de América para Helicteres , incluido en esta área se encuentran los otros dos nuevos géneros mundiales de la tribu Helictereae.
[Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico].
Ramos-Elorduy, Julieta; Landero-Torres, Ivonne; Murguía-González, Joaquín; Pino, José M M
2008-03-01
Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico. During two and a half years (2003-2005) we recorded the insect species used as food at Zongolica, Veracruz State, Mexico. Interviews were made among people (200) of this municipality to know which insects they consumed. The total of registered species was 57 (Orthoptera, Hemiptera, Homoptera, Megaloptera, Coleoptera, Lepidoptera and Hymenoptera). The Orthoptera was the most frequently ingested. Twenty-four of these species were new records for edible insects of Mexico. They are eaten in immature stages or as adults, generally only roasted. Consumption is seasonal. Some species are commercialized in the "tianguis" (little town markets) and/or in the larger Zongolica market. There is a "protoculture" of three species, one cockroach (Periplaneta australasiae Fabricius) and two moths (Latebraria amphipyroides Guenée and Arsenura armida armida Cramer). In Zongolica, anthropoentomophagy is an ancestral habit.
Directory of Open Access Journals (Sweden)
Céline M Bourdin
Full Text Available Insect voltage-gated sodium (Nav channels are formed by a well-known pore-forming α-subunit encoded by para-like gene and ancillary subunits related to TipE from the mutation "temperature-induced-paralysis locus E." The role of these ancillary subunits in the modulation of biophysical and pharmacological properties of Na(+ currents are not enough documented. The unique neuronal ancillary subunit TipE-homologous protein 1 of Drosophila melanogaster (DmTEH1 strongly enhances the expression of insect Nav channels when heterologously expressed in Xenopus oocytes. Here we report the cloning and functional expression of two neuronal DmTEH1-homologs of the cockroach, Periplaneta americana, PaTEH1A and PaTEH1B, encoded by a single bicistronic gene. In PaTEH1B, the second exon encoding the last 11-amino-acid residues of PaTEH1A is shifted to 3'UTR by the retention of a 96-bp intron-containing coding-message, thus generating a new C-terminal end. We investigated the gating and pharmacological properties of the Drosophila Nav channel variant (DmNav1-1 co-expressed with DmTEH1, PaTEH1A, PaTEH1B or a truncated mutant PaTEH1Δ(270-280 in Xenopus oocytes. PaTEH1B caused a 2.2-fold current density decrease, concomitant with an equivalent α-subunit incorporation decrease in the plasma membrane, compared to PaTEH1A and PaTEH1Δ(270-280. PaTEH1B positively shifted the voltage-dependences of activation and slow inactivation of DmNav1-1 channels to more positive potentials compared to PaTEH1A, suggesting that the C-terminal end of both proteins may influence the function of the voltage-sensor and the pore of Nav channel. Interestingly, our findings showed that the sensitivity of DmNav1-1 channels to lidocaine and to the pyrazoline-type insecticide metabolite DCJW depends on associated TEH1-like subunits. In conclusion, our work demonstrates for the first time that density, gating and pharmacological properties of Nav channels expressed in Xenopus oocytes can be
Li, Xin-Ran; Wang, Li-Li; Wang, Zong-Qing
2018-04-17
The taxonomic records of Chinese perisphaerine cockroaches were scattered in literature, and therefore a dedicated study is desired to update our knowledge. This paper reviews the subfamilial diagnosis and Chinese species, mostly from southwestern China. We provide high-definition habitus photos and drawings, the latter emphasizes the genitalia of both sexes, which are generalized with diagrams, abstracted from specimens examined. A total of 18 species are recorded in four genera, including Perisphaerus, or pill cockroach, the type genus of the subfamily. Two new genera and three new species are proposed: Achatiblatta achates gen. sp. nov., Frumentiforma frumentiformis gen. sp. nov., and Pseudoglomeris montana sp. nov.. Pseudoglomeris has five new junior synonyms: Corydidarum, Trichoblatta, Kurokia, Glomerexis, and Glomeriblatta; the following combinations are thus revived or new: Ps. aerea comb. nov., Ps. angustifolia comb. nov., Ps. beybienkoi comb. nov., Ps. fallax comb. nov., Ps. magnifica comb. rev., Ps. montshadskii comb. nov., Ps. nigra comb. nov., Ps. sculpta comb. nov., Ps. semisulcata comb. rev., Ps. tibetana comb. nov., and Ps. valida moderata comb. nov.. The following species are revalidated and combinations revived: Pe. pygmaeus comb. rev., Ps. dubia comb. sp. rev., and Ps. planiuscla comb. sp. rev.
Genetic characterisation of avocado ( Persea americana Mill.) in two ...
African Journals Online (AJOL)
Avocado (Persea americana Mill.) is a nutritious and economic tree crop with cultivations scattered all over Ghana. Although, there have been some genetic diversity research on this crop in some parts of the world, rather limited research has been done on avocado in Ghana. A study was therefore conducted to assess its ...
American Narcissus: Lacanian Reflections on DeLillo’s Americana
Directory of Open Access Journals (Sweden)
Graley Herren
2016-05-01
Full Text Available Don DeLillo’s first novel, 'Americana' (1971, is assembled from a toolkit of psychological tropes. Critics have long recognized the novel’s debts to (and parodies of Sigmund Freud, leading one critic to dub protagonist David Bell as “the American Oedipus.” The present article reconsiders the novel from the perspective of Jacques Lacan’s psychoanalytic theories. Several of Lacan’s key concepts—including his seminal articulation of the Mirror Stage, his revisions to Freud’s Oedipus Complex, his emphasis on lack as the engine of desire, as well as his reflections on dreams, fantasies, and the gaze—help shed new light on DeLillo’s splintered portrait of postmodern subjectivity in 'Americana'. The article uses Lacan to explain how and why each of David Bell’s attempts at indulging his incestuous maternal desires ends in disappointment, with particular emphasis on his three failed attempts at restaging the primal scene. Lacanian psychology provides a conceptual framework and useful taxonomy for understanding the shifting desires, misrecognitions, obfuscations, deflections, projections, and self-reflections of the American Narcissus, David Bell.
Biologi Perbungaan Tanaman Avokad (Persea Americana Mill.)
SUKAMTO, L. AGUS
1985-01-01
L. AGUS SUKAMTO 1985.The flowering biology of avocado (Persea americana Mill.). Berita Biologi 3 (1) 8 - H.- A study on the flowering biology of avocado available at Bogor Botanic Garden was made.The observation was conducted in respects to the opening and closing of the flowers, the versality of the pollen grains which are then related to the fruit production.The climatic condition as well as pollination agents which may affect on the vertilization in avocado are also discussed.
Jensen, Kim; Schal, Coby; Silverman, Jules
2015-10-01
Insects have evolved fine-tuned gustatory and post-ingestive physiological mechanisms that enable them to self-select an optimal composition of macronutrients. Their ability to forage optimally among multiple food sources and maximize fitness parameters depends on their ability not only to taste and perceive the nutritional value of potential foods but also to avoid deleterious components; the strength of such avoidance should reflect the severity of the perceived hazard. In German cockroaches (Blattella germanica), glucose aversion has evolved in some populations in response to anthropogenic selection with glucose-containing insecticidal baits. In four feeding treatments, we gave newly eclosed glucose-averse female cockroaches free choice to feed from two artificial, nutritionally complementary foods varying in protein and carbohydrate composition, with glucose or fructose as the sole carbohydrate source in either food. After 6days of feeding, we measured diet consumption and the length of basal oocytes as an estimate of sexual maturation. The females did not compromise on their aversion to glucose in order to balance their protein and carbohydrate intake, and experienced lower sexual maturation rates as a consequence. Nutrient specific hunger via feedback mechanisms, and adjustments to gustatory sensitivity thus do not override the deterrence of glucose, likely due to strong selection against ingesting even small amounts of toxin associated with glucose in baits. In the absence of baits, glucose aversion would be expected to incur a fitness cost compared to wild-type individuals due to lower overall food availability but also to larger difficulty in attaining a nutritionally balanced diet. Copyright © 2015 Elsevier Ltd. All rights reserved.
CARACTERIZACIÓN Y ACTIVIDAD ANTIOXIDANTE DEL ACEITE DE LA SEMILLA DE PALTA Persea americana MILL.
Rengifo, Pedro G.; Carhuapoma, Mario; Artica, Luis; Castro, Américo J.; López, Sofía
2017-01-01
La semilla de palta es una parte del fruto descartada en la obtención industrial del aceite de pulpa y podría ser una fuente de ácidos grasos esenciales y otros fitoconstituyentes. El presente trabajo de investigación tuvo como objetivo caracterizar al aceite de la semilla de Persea americana Mill. Var. Hass Fuerte y su actividad antioxidante. Al aceite obtenido por el método de Soxhlet, se le hizo la caracterización fisicoquímica siguiendo las normas AOCS (Sociedad Americana de la Química de...
Analgesic effect of the aqueous seed extract of Persea Americana ...
African Journals Online (AJOL)
Persea americana, Mill (Lauraceae) is one of the medicinal plants used in Nigeria for pain relief. Based on its ethnomedicinal use in pain management, the seed of the plant was extracted with distilled water and screened for analgesic activity. The analgesic screening was done in mice using four models: acetic ...
Antioxidant neolignans from Cordia americana.
Fernández, Lucía R; Cirigliano, Adriana; Fabani, María P; Lima, Beatriz; Alberti, Sebastián; Kramer, Fernando; Tapia, Alejandro A; Cabrera, Gabriela; Palermo, Jorge A; Sánchez, Marianela
2013-12-01
Five new neolignans with a bicyclo[2.2.2]octene framework were isolated from an ethanolic extract of the bark of Cordia americana. The structures and relative configurations of the compounds were elucidated by a combination of spectroscopic methods. All the isolated compounds showed good antioxidant activities in the DPPH radical scavenging (0.5-100 µg/mL) and Ferric-reducing antioxidant power (FRAP, 1-100 µg/mL) assays. One of the compounds displayed mild fungistatic activity at 0.1 µmol/spot against Fusarium virguliforme while, at the same time, all compounds were inactive against several strains of Gram (+) and Gram (-) bacteria at all assayed concentrations (10-1,000 µg/mL). Georg Thieme Verlag KG Stuttgart · New York.
Site of water vapor absorption in the desert cockroach, Arenivaga investigata.
O'Donnell, M J
1977-01-01
The desert cockroach, Arenivaga investigata, can gain weight by absorption of water-vapor from unsaturated atmospheres above 82.5% relative humidity. Blocking the anus or the dorsal surface with wax does not prevent water vapor uptake, but interference with movements of the mouthparts or blocking the mouth with wax-prevents such uptake. Weight gains are associated with the protrusion from the mouth of two bladder-like extensions of the hypopharynx. During absorption these structures are warmer than the surrounding mouthparts, their surface temperature increasing with relative humidity. This suggests that the surfaces of the bladder-like structures function at least as sites for condensation of water vapor, but the precise location of its transfer into the hemolymph has not yet been identified. Images PMID:266217
Acute toxicity and genotoxic activity of avocado seed extract (Persea americana Mill., c.v. Hass).
Padilla-Camberos, Eduardo; Martínez-Velázquez, Moisés; Flores-Fernández, José Miguel; Villanueva-Rodríguez, Socorro
2013-01-01
The use of vegetal extracts requires toxicological and genotoxic evaluations to establish and verify safety before being added to human cosmetic, pharmaceutical medicine, or alimentary products. Persea americana seeds have been used in traditional medicine as treatment for several diseases. In this work, the ethanolic seed extract of Persea americana was evaluated with respect to its genotoxic potential through micronucleus assay in rodents. The frequency of micronuclei in groups of animals treated with avocado seed extract showed no differences compared to the negative control (vehicle); therefore, it is considered that the avocado seed extract showed no genotoxic activity in the micronucleus test.
Wagler, Ron
2011-01-01
Middle school students can develop and enhance their observation skills by participating in teacher-guided scientific inquiry (NRC 1996) activities where they observe animals that tend to act in known, predictable ways. Madagascar hissing cockroaches ("Gromphadorhina portentosa") are one such animal. This article presents beginning, intermediate,…
Manganese uptake and interactions with cadmium in the hyperaccumulator-Phytolacca Americana L
Energy Technology Data Exchange (ETDEWEB)
Peng Kejian [College of Life Sciences, Nanjing Agricultural University, Nanjing 210095 (China); Hunan Research Academy of Environmental Sciences Changsha 410004 (China); Luo Chunling [Department of Civil and Structural Engineering, Hong Kong Polytechnic University, Hung Hom, Kowloon (Hong Kong); You Wuxin [College of Life Sciences, Nanjing Agricultural University, Nanjing 210095 (China); Lian Chunlan [Asian Natural Environmental Science Center, University of Tokyo, 1-1-8 Midori-cho, Nishitokyo, Tokyo 188-0002 (Japan); Li Xiangdong [Department of Civil and Structural Engineering, Hong Kong Polytechnic University, Hung Hom, Kowloon (Hong Kong); Shen Zhenguo [College of Life Sciences, Nanjing Agricultural University, Nanjing 210095 (China)], E-mail: zgshen@njau.edu.cn
2008-06-15
In the present study, the accumulation of Mn and other metals by Phytolacca Americana L. from contaminated soils in Hunan Province, South China, was investigated. Results showed that the average concentrations of Mn in the leaves and roots reached 2198 and 80.4 mg kg{sup -1} (dry weight), respectively, with a maximum 13,400 mg kg{sup -1} in the leaves. A significant correlation was found between Mn concentrations in the plant leaves and those in the corresponding soils. Hydroponic experiments were also conducted to study the Cd uptake ability and interactions between Mn and Cd in the plant. It was found that P. americana hyperaccumulated not only Mn, but also Cd in the leaves. In the presence of Cd, adding Mn to the solution significantly improved the plant growth and reduced the concentrations of Cd in all organs of the plant.
Race, Interracial Admixture and Genetic Differentiation of Avocado (Persea americana Mill)
Avocado (Persea americana Mill.) is a major tropical fruit crop native to Mesoamerica and domesticated around 8000 to 7000 BC. It is a member of the Laureace family and currently classified into three subspecies or races: Guatemalan (G), Mexican (M) and West Indian (WI) according to their ecological...
Distribution and characterization of Heterobilharzia americana in dogs in Texas.
Rodriguez, J Y; Lewis, B C; Snowden, K F
2014-06-16
Heterobilharzia americana is a trematode parasite (family Schistosomatidae) that infects a wide range of wild mammalian hosts. Canine cases have been reported in the Gulf coast and south Atlantic states, Kansas, and Oklahoma. A total of 238 canine H. americana cases in Texas were retrospectively collected for a period of approximately 22 years from case records at the Texas Veterinary Medical Diagnostic Laboratory and the Veterinary Medical Teaching Hospital pathology service, diagnostic parasitology service, and Gastrointestinal Laboratory at Texas A&M University College of Veterinary Medicine. Of these cases, 26 patients had 1-2 repeat positive tests for a total of 268 positive tests (26 biopsies, 39 necropsies, 160 fecal examinations, and 43 PCR). Multiple dogs were infected in 12 households. Cases were distributed primarily in the eastern region of Texas in 42 of 254 counties. Cases were seen as far west as Kerr county and in counties bordering Oklahoma, Louisiana, Mexico, and the Gulf of Mexico. The median dog age was 5.6 years (2.7 months to 17.2 years) and the median weight was 20.5 kg (1-61.6 kg). All American Kennel Club (AKC) breed groups were represented (n=186): crossbred (20%), herding (17.8%), sporting (16.1%), toy (10.8%), hounds (10.8%), working (10.1%), terrier (8.5%), non-sporting (4.9%), and miscellaneous (1%). No seasonal pattern of diagnosis was apparent. Clinical signs reported (n=90) were diarrhea (67%), weight loss (38%), anorexia/hyporexia (27%), vomiting (22%), hematochezia (20%), lethargy (17%), polyuria/polydipsia (6%), and collapse (3%). In 39 necropsy cases, trematode eggs were identified by histopathology in the small intestine (84%), liver (84%), large intestine (39%), pancreas (35%), lung (9%), lymph node (8%), spleen (4%), and stomach (3%). Adult parasites were identified histologically in four cases. Granulomatous inflammation associated with the eggs was the most commonly reported histopathologic change. Other changes reported
Directory of Open Access Journals (Sweden)
Alexandre Magno SEBBENN
2004-06-01
Full Text Available A herança e a ligação foram estudadasem quatro locos polimórficos (6pghd-1, Pgi-2,Mdh-1 e Mdh-2 de três sistemas isoenzimáticos deGenipa americana, analisados por eletroforesehorizontal em gel de amido, usando tecidoscoletados de quinze progênies de polinização aberta,procedentes de Moji-Guaçu, Estado de São Paulo.Esses locos segregaram de dois a três alelos.A segregação nesses locos foi homogênea entreárvores. Contudo, existem desvios significativos dasegregação esperada 1:1 para algumas árvores emalguns locos. Desvios significativos da razão desegregação esperada 1:1 foram detectados noslocos Mdh-2 e 6pgdh-1. Não foram detectadasevidências de ligação entre nenhum dos pares delocos avaliados em G. americana e esses podemser utilizados sem restrição para estudos do sistemade reprodução, diversidade e estrutura genética depopulações da espécie.Inheritance and linkage for fourpolymorphic loci (6pghd-1, Pgi-2, Mdh-1 andMdh-2 from three enzyme systems in Genipaamericana were analyzed by horizontal starch gelelectrophoresis using tissues collected from fiftyopen-pollinated families in Moji-Guaçu, São PauloState. These allozyme loci have segregated fromtwo to four alleles per polymorphic locus. Genesegregation on those loci was homogeneous amongtrees. However, there were significant deviationsfrom the expected segregation ratios on some lociand some individual trees. In addition, Mdh-2 and6pgdh-1 loci have shown significant deviationsfrom the 1:1 expected segregation ratio. Linkagedisequilibrium evidences were not detected betweenany two pairs of loci from G. americana and thosecan be used with no restriction to study the matingsystem, genetic diversity, and genetic structure onthe species.
Acute Toxicity and Genotoxic Activity of Avocado Seed Extract (Persea americana Mill., c.v. Hass
Directory of Open Access Journals (Sweden)
Eduardo Padilla-Camberos
2013-01-01
Full Text Available The use of vegetal extracts requires toxicological and genotoxic evaluations to establish and verify safety before being added to human cosmetic, pharmaceutical medicine, or alimentary products. Persea americana seeds have been used in traditional medicine as treatment for several diseases. In this work, the ethanolic seed extract of Persea americana was evaluated with respect to its genotoxic potential through micronucleus assay in rodents. The frequency of micronuclei in groups of animals treated with avocado seed extract showed no differences compared to the negative control (vehicle; therefore, it is considered that the avocado seed extract showed no genotoxic activity in the micronucleus test.
Rodriguez, Jessica Y; Camp, Joseph W; Lenz, Stephen D; Kazacos, Kevin R; Snowden, Karen F
2016-04-01
A 1-year-old castrated male dog residing in Indiana was examined because of intermittent vomiting of 4 months' duration. The dog's condition did not resolve with medication. Diagnostic imaging revealed a possible partial obstruction at the ileocecal junction. An exploratory laparotomy was performed. The jejunum contained diffusely distributed, nodular, intramural lesions; 2 biopsy specimens were collected from representative lesions. The pancreas was grossly swollen, and pancreatitis was presumed present. No other abnormalities were observed in the abdomen. Histologic examination of the submitted biopsy specimens revealed infection with Heterobilharzia americana. After diagnosis, the dog was treated with fenbendazole suspension (48 mg/kg [21.8 mg/lb], PO, q 24 h) for 10 days. This treatment was subsequently repeated 11 and 80 days later. One week after the end of the last fenbendazole treatment, several H americana eggs were detected in a fecal sample via saline sedimentation, and the dog was given praziquantel (25 mg/kg [11.4 mg/lb], PO, q 8 h) for 2 days. No gastrointestinal signs were evident 4 months after that treatment. The dog described in this report was the first autochthonous canine case of H americana infection in Indiana, to the authors' knowledge; this case has confirmed that the distribution of this parasite in the Midwestern United States is broader than previously known. Increased awareness of the distribution of H americana should aid veterinarians in early, noninvasive diagnosis and appropriate treatment of affected animals. Repeated treatments and recheck fecal examinations may be necessary when managing these cases.
Directory of Open Access Journals (Sweden)
Bin Wu
2013-09-01
Full Text Available High-speed counter-current chromatography (HSCCC with a two-phase solvent system composed of n-hextane-ethyl acetate-methanol-water (1.5:1:1.5:1, v/v/v/v was applied to the isolation and purification of attractants from Chinese cockroach, Eupolyphaga sinensis Walker. Two new attractants with attractant activity towards the male insects were obtained from the extract sample in a one-step separation. Their purities were determined by HPLC. Subsequent MS, NMR and CD analyses have led to the characterization of (R-3-ethyl-6,8-dihydroxy-7-methyl-3,4-dihydroisochromen-1-one (1 and (R-6,8-dihydroxy-3,7-dimethyl-3,4-dihydroisochromen-1-one (2, two novel isocumarin type attractants. Based on these results, it is concluded that HSCCC is a viable separation method option for purifying insect attractants, while effectively maintaining the attracting activity of the isolates. This is the first attempt to apply counter-current chromatography technique to separate attractants from Chinese cockroach.
Effects of Persea americana leaf extracts on body weight and liver ...
African Journals Online (AJOL)
GREGO
2007-04-16
Apr 16, 2007 ... weight of either aqueous or methanolic extract of P. americana leaf daily for 8 weeks. There were no significant differences (p>0.05) in the overall body weight gain of the hyperlipidaemic rats compared to normal control. However, the administration of the aqueous and methanolic extracts provoked 14 and.
Energy Technology Data Exchange (ETDEWEB)
Koryak, M.; Reilly, R.J.
1984-06-01
Justicia americana is a stout-based colonial plant, abundant in most of the larger, low to moderate gradient streams of the upper Ohio River basin. The distribution of J. americana is related to acid drainage from bituminous coal mining operations in the upper Ohio River drainage basin. Possible fluvial and biological consequences of the colonization or absence of Justicia are considered. Luxuriant growths were noted on gravel bars and riffles of larger, unpolluted streams in the basin. Acid mine drainage severely depresses the growth of the plant, leaving gravel shoals and riffles in the acid streams either barren or dominated by other emergent species. Particular among these new species is Elecocharis acicularis. The elimination of J. americana from suitable habitat adversely affects channel morphology, substrate composition, general aesthetic quality and aquatic stream life in the region. 16 references, 2 figures, 3 tables.
Reflexões sobre as Independências Ibero-americanas
Directory of Open Access Journals (Sweden)
Manuel Chust
2008-12-01
Full Text Available O objetivo deste artigo é refletir acerca do tema das independências iberoamericanas do século XIX como objeto historiográfico, considerando-o em tempos e espaços amplos, gerais e de dimensões européias e americanas. Resgatando algumas das principais teses a respeito formuladas nas últimas quatro décadas, pretende-se examinar algumas posições em voga no momento, considerando-se a efervescência historiográfica anunciada pelas comemorações dos bicentenários no mundo ibérico.
Establishing of Agave Americana industry in South Africa
CSIR Research Space (South Africa)
Boguslavsky, A
2007-09-01
Full Text Available of the sisal decorticator was therefore modified to make it more suitable for the processing of Agave Americana leaves. Steel side plates were attached to the rotor to prevent the blockage of the machine. The feeding tray and beater bars were modified... to accommodate the side plates of the enlarged rotor. For added operator safety, a “tunnel” guard was also added the feeding tray through which the leaves are fed. The size of this was such that the Agave leaf could fit into it but without any space...
International Nuclear Information System (INIS)
Orr, G.L.; Gole, J.W.D.; Notman, H.J.; Downer, R.G.H.
1987-01-01
Dopamine increases cyclic AMP production in crude membrane preparations of cockroach brain with plateaus in cyclic AMP production occurring between 1-10 μM and 10 mM. Maximal production of cyclic AMP is 2.25 fold greater than that of control values. Octopamine also increases cyclic AMP production with a Ka of 1.4 μM and maximal production 3.5 fold greater than that of control. 5-Hydroxytryptamine does not increase cyclic AMP production. The effects of octopamine and dopamine are fully additive. The vertebrate dopamine agonists ADTN and epinine stimulate the dopamine-sensitive adenylate cyclase (AC) with Ka values of 4.5 and 0.6 μM respectively and with maximal effectiveness 1.7 fold greater than that of control. The selective D 2 -dopamine agonist LY-171555 stimulates cyclic AMP production to a similar extent with a Ka of 50 μM. Other dopamine agonists have no stimulatory effects. With the exception of mianserin, 3 H-piflutixol is displaced from brain membranes by dopamine antagonists with an order of potency similar to that observed for the inhibition of dopamine-sensitive AC. The results indicate that the octopamine- and dopamine-sensitive AC in cockroach brain can be distinguished pharmacologically and the dopamine receptors coupled to AC have pharmacological characteristics distinct from vertebrate D 1 - and D 2 -dopamine receptors. 33 references, 3 figures, 2 tables
International Nuclear Information System (INIS)
Kumar, Brajesh; Smita, Kumari; Cumbal, Luis; Camacho, Javier; Hernández-Gallegos, Elisabeth; Guadalupe Chávez-López, María de; Grijalva, Marcelo; Andrade, Kleber
2016-01-01
In this article, rapid one pot synthesis of gold nanoparticles (GNPs) using an eco-friendly extract of Genipa americana L. fruit is described. Electrospray ionization mass spectrometry (ESI-MS) and Fourier transform infrared (FTIR) spectroscopic studies demonstrated that small molecules such as genipin, genipaol, geniposide and ranolazine can act as reducer as well as stabilizers. The monodispersed, spherical GNPs were further characterized by UV–vis spectroscopy at λ max = 535 nm, transmission electron microscopy (TEM), dynamic light scattering (DLS) and X-ray diffraction (XRD) analysis. This synthetic approach offers a greener and alternate route to the preparation of GNPs free from toxic chemical components and stable for 6–7 months under room temperature. The green synthesized GNPs showed weak antioxidant efficacy against 1,1-diphenyl-2-picrylhydrazyl and no cytotoxicity against A-549 and HeLa human cancer cell lines, from lung and cervix. This study opens a new industrial scope of G. americana fruit in nanoscience and as surface modified GNPs can be developed into a successful drug carrier for future pharmaceutical products. - Highlights: • Gold nanoparticles can be synthesized by Genipa americana fruit extract. • TEM-DLS analysis confirmed that the average particle size is 30.4 ± 14.9 nm. • Nanoparticles showed weak antioxidant and no cytotoxicity activity.
Energy Technology Data Exchange (ETDEWEB)
Kumar, Brajesh, E-mail: krmbraj@gmail.com [Centro de Nanociencia y Nanotecnologia, Universidad de las Fuerzas Armadas ESPE, Av. Gral. Rumiñahui s/n, Sangolqui, P.O. BOX 171-5-231B (Ecuador); Smita, Kumari; Cumbal, Luis [Centro de Nanociencia y Nanotecnologia, Universidad de las Fuerzas Armadas ESPE, Av. Gral. Rumiñahui s/n, Sangolqui, P.O. BOX 171-5-231B (Ecuador); Camacho, Javier [Centro de Nanociencia y Nanotecnologia, Universidad de las Fuerzas Armadas ESPE, Av. Gral. Rumiñahui s/n, Sangolqui, P.O. BOX 171-5-231B (Ecuador); Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional, Departamento de Farmacología, C.P. 07360 Mexico City (Mexico); Hernández-Gallegos, Elisabeth; Guadalupe Chávez-López, María de [Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional, Departamento de Farmacología, C.P. 07360 Mexico City (Mexico); Grijalva, Marcelo; Andrade, Kleber [Centro de Nanociencia y Nanotecnologia, Universidad de las Fuerzas Armadas ESPE, Av. Gral. Rumiñahui s/n, Sangolqui, P.O. BOX 171-5-231B (Ecuador)
2016-05-01
In this article, rapid one pot synthesis of gold nanoparticles (GNPs) using an eco-friendly extract of Genipa americana L. fruit is described. Electrospray ionization mass spectrometry (ESI-MS) and Fourier transform infrared (FTIR) spectroscopic studies demonstrated that small molecules such as genipin, genipaol, geniposide and ranolazine can act as reducer as well as stabilizers. The monodispersed, spherical GNPs were further characterized by UV–vis spectroscopy at λ{sub max} = 535 nm, transmission electron microscopy (TEM), dynamic light scattering (DLS) and X-ray diffraction (XRD) analysis. This synthetic approach offers a greener and alternate route to the preparation of GNPs free from toxic chemical components and stable for 6–7 months under room temperature. The green synthesized GNPs showed weak antioxidant efficacy against 1,1-diphenyl-2-picrylhydrazyl and no cytotoxicity against A-549 and HeLa human cancer cell lines, from lung and cervix. This study opens a new industrial scope of G. americana fruit in nanoscience and as surface modified GNPs can be developed into a successful drug carrier for future pharmaceutical products. - Highlights: • Gold nanoparticles can be synthesized by Genipa americana fruit extract. • TEM-DLS analysis confirmed that the average particle size is 30.4 ± 14.9 nm. • Nanoparticles showed weak antioxidant and no cytotoxicity activity.
Raymond Chia, Teck Wah; Dykes, Gary A
2010-07-01
The epicarp and seed of Persea Americana Mill. var. Hass (Lauraceae), Persea Americana Mill. var. Shepard, and Persea americana Mill. var Fuerte cultivars of mature avocados (n = 3) were ground separately and extracted with both absolute ethanol and distilled water. Extracts were analyzed for antimicrobial activity using the microtiter broth microdilution assay against four Gram-positive bacteria, six Gram-negative bacteria, and one yeast. Antimicrobial activity against two molds was determined by the hole plate method. The ethanol extracts showed antimicrobial activity (104.2-416.7 microg/mL) toward both Gram-positive and Gram-negative bacteria (except Escherichia coli), while inhibition of the water extracts was only observed for Listeria monocytogenes (93.8-375.0 microg/mL) and Staphylococcus epidermidis (354.2 microg/mL). The minimum concentration required to inhibit Zygosaccharomyces bailii was 500 microg/mL for the ethanol extracts, while no inhibition was observed for the water extracts. No inhibition by either ethanol or water extracts was observed against Penicillium spp. and Aspergillus flavus.
Effect of plant growth-promoting bacteria on the growth and fructan production of Agave americana L.
Directory of Open Access Journals (Sweden)
Neyser De La Torre-Ruiz
Full Text Available ABSTRACT The effect of plant growth-promoting bacteria inoculation on plant growth and the sugar content in Agave americana was assessed. The bacterial strains ACO-34A, ACO-40, and ACO-140, isolated from the A. americana rhizosphere, were selected for this study to evaluate their phenotypic and genotypic characteristics. The three bacterial strains were evaluated via plant inoculation assays, and Azospirillum brasilense Cd served as a control strain. Phylogenetic analysis based on the 16S rRNA gene showed that strains ACO-34A, ACO-40 and ACO-140 were Rhizobium daejeonense, Acinetobacter calcoaceticus and Pseudomonas mosselii, respectively. All of the strains were able to synthesize indole-3-acetic acid (IAA, solubilize phosphate, and had nitrogenase activity. Inoculation using the plant growth-promoting bacteria strains had a significant effect (p < 0.05 on plant growth and the sugar content of A. americana, showing that these native plant growth-promoting bacteria are a practical, simple, and efficient alternative to promote the growth of agave plants with proper biological characteristics for agroindustrial and biotechnological use and to increase the sugar content in this agave species.
Directory of Open Access Journals (Sweden)
Juliana Brandstetter Vilar
2009-09-01
Full Text Available Curatella americana L., commonly known as "lixeira" in Brazil, has been used in folk medicine to treat ulcers and inflammations. The purpose of the present work was to evaluate the cytotoxic and genotoxic potential of the ethanolic extract of C. americana stem bark using the prophage λ induction test (SOS inductest. To evaluate the cytotoxicity of this plant, after treatment with different concentrations of the extract, Escherichia coli WP2s(λ cultures were diluted in M9 buffer, inoculated into LB plates, and incubated for 24 h at 37 °C. To assess genotoxicity, the lysogenic strain E. coli WP2s(λ was treated with different concentrations of the extract. Then, the lysogenic strain was added to the indicator strain (RJF013, LB(1/2(malt/amp, seeded into plates with the matches, and incubated for 24 h at 37 °C. After this period, the total number of colonies and the number of plaques were counted to evaluate C. americana cytotoxicity and genotoxicity, respectively. Our results showed that although the extract of "lixeira" did not modify the survival of bacteria (p > 0.05, it caused a significant increase in prophage λ induction, especially at the higher concentrations (pCuratella americana L., comumente conhecida como "lixeira" no Brasil, é utilizada em medicina popular para tratamento de úlceras e inflamações. O presente trabalho teve como objetivo avaliar o potencial citotóxico e genotóxico do extrato etanólico das cascas de C. americana utilizando o Induteste SOS. Para avaliar a citotoxicidade da planta, depois de tratadas com diferentes concentrações do extrato, culturas de E. coli WP2s(λ foram diluνdas em tampão M9 e semeadas em placas LB. Para avaliar a genotoxicidade da planta, a cepa lisogênica WP2s(λ de E. coli foi tratada com diferentes concentrações do extrato. Em seguida, esta foi adicionada à cepa indicadora (RJF013 e ambas foram semeadas em placas em meio LB(1/2(malt(amp. Todas as culturas foram incubadas por 24
Directory of Open Access Journals (Sweden)
Marianna Erbano
2010-12-01
Full Text Available Genipa americana L., conhecida como jenipapo, é uma Rubiaceae nativa do Brasil e as suas folhas são utilizadas pela população como antidiarreico e febrífugo, e o caule como anti-hemorrágico, contra luxações e contusões. Com o objetivo de caracterizar macro e microscopicamente folhas adultas e caules jovens para o controle de qualidade farmacognóstico, essa planta medicinal foi analisada segundo a metodologia clássica de morfoanatomia vegetal. Genipa americana apresenta folhas simples, opostas, de formato obovado a oblanceolado e pecíolos curtos. A epiderme foliar é uniestratificada e revestida por cutícula delgada e levemente estriada. Os estômatos são paracíticos e restritos à superfície abaxial. Há tricomas tectores uni e pluricelulares predominantemente na superfície abaxial. O mesofilo é dorsiventral. Em secção transversal, a nervura central é plano-convexa e o pecíolo é circular, ambos apresentando um feixe vascular colateral em disposição cilíndrica e outros menores. O caule possui felogênio localizado nas camadas subepidérmicas, colênquima anelar e um cilindro floemático externo ao de xilema, sendo ambos percorridos por raios parenquimáticos estreitos. Ocorrem idioblastos contendo compostos fenólicos, areia cristalina e drusas de oxalato de cálcio na folha e no caule.Genipa americana L., known as jenipapo, is a Rubiaceae species native to Brazil. Its leaves are used by the population as anti-diarrheic and febrifuge, and its stem as anti-hemorrhagic and for trauma injuries. Aiming to identify macro and microscopically mature leaves and young stems for the pharmacognostic quality control, this medicinal plant was investigated according to standard morpho-anatomical techniques. The leaves are simple, opposite, obovate-oblanceolate, presenting short petiole. The epidermis is uniseriate and coated with thin and slightly striate cuticle. The stomata are paracytic and restricted to the abaxial surface. It
Directory of Open Access Journals (Sweden)
Riselane de Lucena Alcântara Bruno
2011-07-01
Full Text Available Genipa americana L. is a tropical tree belonging to Rubiaceae family, providing fruit that are consumed in natura and is being increasingly explored as raw material to liquor, wine, soft drink and also the use of white wood for making various products. The seeds drying this species can be made using natural and or artificial methods. Thus, this study aimed to evaluate the effects of natural drying, in different periods and ambient, in the physiological quality of Genipa americana seeds. Seeds were submitted to the determination of moisture content after processing and drying of each period (0, 24, 48, 72, 96, 120, 144 and 168 hours. To evaluate the effects of ambient (laboratory and greenhouse and drying periods were performed the following tests: emergence in greenhouse, emergence speed index, seedling length and dry weight. Drying seed genipa can be done in a greenhouse (temperature of 33°C with relative humidity of 70% for 24 hours or laboratory environment (temperature of 28°C with relative humidity of 75% for 48 hours without compromising the physiological quality.Genipa americana L. é uma árvore tropical, pertencente à família Rubiaceae, fornece frutos que são consumidos in natura e vem sendo explorada cada vez mais como matéria-prima de licor, vinho, refresco e também o uso da madeira branca para confecção de vários produtos. A secagem de sementes dessa espécie pode ser feita pelo método natural e/ou artificial. Dessa forma, este trabalho teve por objetivo avaliar o efeito da secagem natural, em diferentes ambientes e períodos, na qualidade fisiológica das sementes de Genipa americana. As sementes foram submetidas à determinação do teor de água após o beneficiamento em cada período de secagem (0, 24, 48, 72, 96, 120, 144 e 168 horas. Para a avaliação do efeito dos ambientes (laboratório e ambiente telado e períodos de secagem foram realizados os seguintes testes: emergência em ambiente telado, índice de
[Cockroaches and co. The role of health pests as allergen source].
Raulf, M; Sander, I; Gonnissen, D; Zahradnik, E; Brüning, T
2014-05-01
In most of the cases health pests are carriers of pathogens or parasites which have a negative impact on human health or affect the health of other mammals. What is lesser known is that they can also act as allergens. Most of the health pests in this sense belong to the arthropods, such as cockroaches (Blattaria), mosquitos (Culiciformia), lice (Pediculus humanus corporis), fleas (Siphonaptera) and ticks (Argasidae). In the group of vertebrates rats (Rattus norvegicus and Rattus rattus), house mice (Mus musculus) and pigeons (Columba livia domestica) are also classified as health pests. Also storage pests which are not carriers of pathogens can induce secondary infestation with hygiene pests or molds and have an underestimated impact on human health. In this article selected examples of health pests and also storage pests as an allergen source are described, taking into account the sensitization prevalence and identified single allergens.
The Optic Lobes Regulate Circadian Rhythms of Olfactory Learning and Memory in the Cockroach.
Lubinski, Alexander J; Page, Terry L
2016-04-01
The cockroach, Leucophaea maderae, can be trained in an associative olfactory memory task by either classical or operant conditioning. When trained by classical conditioning, memory formation is regulated by a circadian clock, but once the memory is formed, it can be recalled at any circadian time. In contrast, when trained via operant conditioning, animals can learn the task at any circadian phase, but the ability to recall the long-term memory is tied to the phase of training. The optic lobes of the cockroach contain a circadian clock that drives circadian rhythms of locomotor activity, mating behavior, sensitivity of the compound eye to light, and the sensitivity of olfactory receptors in the antennae. To evaluate the role of the optic lobes in regulating learning and memory processes, the authors examined the effects of surgical ablation of the optic lobes on memory formation in classical conditioning and memory recall following operant conditioning. The effect of optic lobe ablation was to "rescue" the deficit in memory acquisition at a time the animals normally cannot learn and "rescue" the animal's ability to recall a memory formed by operant conditioning at a phase where memory was not normally expressed. The results suggested that the optic lobe pacemaker regulates these processes through inhibition at "inappropriate" times of day. As a pharmacological test of this hypothesis, the authors showed that injections of fipronil, an antagonist of GABA and glutamate-activated chloride channels, had the same effects as optic lobe ablation on memory formation and recall. The data suggest that the optic lobes contain the circadian clock(s) that regulate learning and memory processes via inhibition of neural processes in the brain. © 2015 The Author(s).
Nichelason, Amy E; Rejmanek, Dan; Dabritz, Haydee A; Melli, Ann C; Miller, Melissa; Conrad, Patricia A
2008-10-01
Three nematodes, Turgida turgida, Cruzia americana, and Didelphostrongylus hayesi, have been documented to cause morbidity and mortality in the Virginia opossum (Didelphis virginiana). The present study was designed to determine the frequency of infection of these nematodes in opossums at 2 study sites in California and to determine if there are risk factors associated with shedding of eggs or larvae in the feces. Turgida turgida and C. americana adults were found in 84.4% (stomach; n = 45) and 62.5% (intestinal wash and feces; n = 16) of sampled opossums. Eggs were present in opossum feces (n = 105) less frequently (40% T. turgida and 35.2% C. americana). Didelphostrongylus hayesi larvae were found in 79.0% of opossum feces examined (n = 105). Adult age and wet season (December through April) were significant predictive factors for the presence of T. turgida eggs, whereas the dry season (May through November) was significantly associated with the presence of C. americana eggs in feces. Adult opossums were more likely to have eggs and larvae from all 3 nematodes in the feces.
Vargo, Edward L.; Crissman, Jonathan R.; Booth, Warren; Santangelo, Richard G.; Mukha, Dmitry V.; Schal, Coby
2014-01-01
Understanding the population structure of species that disperse primarily by human transport is essential to predicting and controlling human-mediated spread of invasive species. The German cockroach (Blattella germanica) is a widespread urban invader that can actively disperse within buildings but is spread solely by human-mediated dispersal over longer distances; however, its population structure is poorly understood. Using microsatellite markers we investigated population structure at several spatial scales, from populations within single apartment buildings to populations from several cities across the U.S. and Eurasia. Both traditional measures of genetic differentiation and Bayesian clustering methods revealed increasing levels of genetic differentiation at greater geographic scales. Our results are consistent with active dispersal of cockroaches largely limited to movement within a building. Their low levels of genetic differentiation, yet limited active spread between buildings, suggests a greater likelihood of human-mediated dispersal at more local scales (within a city) than at larger spatial scales (within and between continents). About half the populations from across the U.S. clustered together with other U.S. populations, and isolation by distance was evident across the U.S. Levels of genetic differentiation among Eurasian cities were greater than those in the U.S. and greater than those between the U.S. and Eurasia, but no clear pattern of structure at the continent level was detected. MtDNA sequence variation was low and failed to reveal any geographical structure. The weak genetic structure detected here is likely due to a combination of historical admixture among populations and periodic population bottlenecks and founder events, but more extensive studies are needed to determine whether signatures of global movement may be present in this species. PMID:25020136
Alveolar Macrophages Play a Key Role in Cockroach-Induced Allergic Inflammation via TNF-α Pathway
Kim, Joo Young; Sohn, Jung Ho; Choi, Je-Min; Lee, Jae-Hyun; Hong, Chein-Soo; Lee, Joo-Shil; Park, Jung-Won
2012-01-01
The activity of the serine protease in the German cockroach allergen is important to the development of allergic disease. The protease-activated receptor (PAR)-2, which is expressed in numerous cell types in lung tissue, is known to mediate the cellular events caused by inhaled serine protease. Alveolar macrophages express PAR-2 and produce considerable amounts of tumor necrosis factor (TNF)-α. We determined whether the serine protease in German cockroach extract (GCE) enhances TNF-α production by alveolar macrophages through the PAR-2 pathway and whether the TNF-α production affects GCE-induced pulmonary inflammation. Effects of GCE on alveolar macrophages and TNF-α production were evaluated using in vitro MH-S and RAW264.6 cells and in vivo GCE-induced asthma models of BALB/c mice. GCE contained a large amount of serine protease. In the MH-S and RAW264.7 cells, GCE activated PAR-2 and thereby produced TNF-α. In the GCE-induced asthma model, intranasal administration of GCE increased airway hyperresponsiveness (AHR), inflammatory cell infiltration, productions of serum immunoglobulin E, interleukin (IL)-5, IL-13 and TNF-α production in alveolar macrophages. Blockade of serine proteases prevented the development of GCE induced allergic pathologies. TNF-α blockade also prevented the development of such asthma-like lesions. Depletion of alveolar macrophages reduced AHR and intracellular TNF-α level in pulmonary cell populations in the GCE-induced asthma model. These results suggest that serine protease from GCE affects asthma through an alveolar macrophage and TNF-α dependent manner, reflecting the close relation of innate and adaptive immune response in allergic asthma model. PMID:23094102
Gómez-Calderón, Cecilia; Mesa-Castro, Carol; Robledo, Sara; Gómez, Sergio; Bolivar-Avila, Santiago; Diaz-Castillo, Fredyc; Martínez-Gutierrez, Marlen
2017-01-18
The transmission of Dengue virus (DENV) and Chikungunya virus (CHIKV) has increased worldwide, due in part to the lack of a specific antiviral treatment. For this reason, the search for compounds with antiviral potential, either as licensed drugs or in natural products, is a research priority. The objective of this study was to identify some of the compounds that are present in Mammea americana (M. americana) and Tabernaemontana cymosa (T. cymosa) plants and, subsequently, to evaluate their cytotoxicity in VERO cells and their potential antiviral effects on DENV and CHIKV infections in those same cells. Dry ethanolic extracts of M. americana and T. cymosa seeds were subjected to open column chromatographic fractionation, leading to the identification of four compounds: two coumarins, derived from M. americana; and lupeol acetate and voacangine derived from T. cymosa.. The cytotoxicity of each compound was subsequently assessed by the MTT method (at concentrations from 400 to 6.25 μg/mL). Pre- and post-treatment antiviral assays were performed at non-toxic concentrations; the resulting DENV inhibition was evaluated by Real-Time PCR, and the CHIKV inhibition was tested by the plating method. The results were analyzed by means of statistical analysis. The compounds showed low toxicity at concentrations ≤ 200 μg/mL. The compounds coumarin A and coumarin B, which are derived from the M. americana plant, significantly inhibited infection with both viruses during the implementation of the two experimental strategies employed here (post-treatment with inhibition percentages greater than 50%, p treatment with percentages of inhibition greater than 40%, p treatment strategy (at inhibition percentages greater than 70%, p treating Dengue and Chikungunya fever. Additionally, lupeol acetate and voacangine efficiently inhibit infection with DENV, also turning them into promising antivirals for Dengue fever.
Groenewald, Berlizé; Bazelet, Corinna S; Potter, C Paige; Terblanche, John S
2013-10-15
The importance of metabolic rate and/or spiracle modulation for saving respiratory water is contentious. One major explanation for gas exchange pattern variation in terrestrial insects is to effect a respiratory water loss (RWL) saving. To test this, we measured the rates of CO2 and H2O release ( and , respectively) in a previously unstudied, mesic cockroach, Aptera fusca, and compared gas exchange and water loss parameters among the major gas exchange patterns (continuous, cyclic, discontinuous gas exchange) at a range of temperatures. Mean , and per unit did not differ among the gas exchange patterns at all temperatures (P>0.09). There was no significant association between temperature and gas exchange pattern type (P=0.63). Percentage of RWL (relative to total water loss) was typically low (9.79±1.84%) and did not differ significantly among gas exchange patterns at 15°C (P=0.26). The method of estimation had a large impact on the percentage of RWL, and of the three techniques investigated (traditional, regression and hyperoxic switch), the traditional method generally performed best. In many respects, A. fusca has typical gas exchange for what might be expected from other insects studied to date (e.g. , , RWL and cuticular water loss). However, we found for A. fusca that expressed as a function of metabolic rate was significantly higher than the expected consensus relationship for insects, suggesting it is under considerable pressure to save water. Despite this, we found no consistent evidence supporting the conclusion that transitions in pattern type yield reductions in RWL in this mesic cockroach.
Koffi, Grokoré Yvonne; Remaud-Simeon, Magali; Due, Ahipo Edmond; Combes, Didier
2017-04-01
The estimation of glycoalkaloids in the flesh of different types of decayed potatoes was evaluated. The results showed that turned green and also sprouting or rotting potato flesh contain high amounts of toxic solanine and chaconine, exceeding by 2-5-fold the recommended limit, and ranging from 2578±86mg/kg to 5063±230mg/kg of dry weight potato flesh. For safety consideration, these decayed potatoes should be systematically set aside. To avoid a net economic loss and encourage the removal of this hazardous food, a recycling process was investigated to generate added-value compounds from the toxic glycoalkaloids. A simple chemo-enzymatic protocol comprising a partial acidic hydrolysis followed by an enzymatic treatment with the β-glycosidase from Periplaneta americana allowed the efficient conversion of α-chaconine to solanidine. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Atchara N. Phoem
2015-04-01
Full Text Available Bifidobacterium longum was microencapsulated by extrusion technique and added in fresh milk tofu and pineapple juice. Microencapsulation of B. longum with Eleutherine americana extract, oligosaccharides extract, and commercial fructo-oligosaccharides was assessed for the bacterial survival after sequential exposure to simulated gastric and intestinal juices, and refrigeration storage. Microencapsulated B. longum with the extract and oligosaccharides extract in the food products showed better survival than free cells under adverse conditions. Sensory analysis demonstrated that the products containing co-encapsulated bacterial cells were more acceptable by consumers than free cells. Pineapple juice prepared with co-encapsulated cells had lower values for over acidification, compared with the juice with free cells added. This work suggested that microencapsulated B. longum with E. americana could enhance functional properties of fresh milk tofu and pineapple juice.
Phoem, Atchara N.; Chanthachum, Suphitchaya; Voravuthikunchai, Supayang P.
2015-01-01
Bifidobacterium longum was microencapsulated by extrusion technique and added in fresh milk tofu and pineapple juice. Microencapsulation of B. longum with Eleutherine americana extract, oligosaccharides extract, and commercial fructo-oligosaccharides was assessed for the bacterial survival after sequential exposure to simulated gastric and intestinal juices, and refrigeration storage. Microencapsulated B. longum with the extract and oligosaccharides extract in the food products showed better survival than free cells under adverse conditions. Sensory analysis demonstrated that the products containing co-encapsulated bacterial cells were more acceptable by consumers than free cells. Pineapple juice prepared with co-encapsulated cells had lower values for over acidification, compared with the juice with free cells added. This work suggested that microencapsulated B. longum with E. americana could enhance functional properties of fresh milk tofu and pineapple juice. PMID:25854832
Vršanský, Peter; Vidlička, L'Ubomír; Barna, Peter; Bugdaeva, Eugenia; Markevich, Valentina
2013-01-01
Morphna paleo sp. n., the earliest winged representative of any living cockroach genus and the earliest representative of the family Blaberidae, is described from the Danian Arkhara-Boguchan coal mine in the Amur River region (Russian Far East). The branched Sc and A suggest Ectobiidae (=Blattellidae) probably is not the ancestral family because Blaberidae were derived directly from the extinct family Mesoblattindae. The associated Danian locality Belaya Gora yielded Ergaula stonebut sp. n., the earliest record of the family Corydiidae. Both species belong to genera codominant in the Messel locality, thus validating their dominance in early Cenozoic assemblages.
Bunning, Harriet; Bassett, Lee; Clowser, Christina; Rapkin, James; Jensen, Kim; House, Clarissa M; Archer, Catharine R; Hunt, John
2016-07-01
Sexual selection may cause dietary requirements for reproduction to diverge across the sexes and promote the evolution of different foraging strategies in males and females. However, our understanding of how the sexes regulate their nutrition and the effects that this has on sex-specific fitness is limited. We quantified how protein (P) and carbohydrate (C) intakes affect reproductive traits in male (pheromone expression) and female (clutch size and gestation time) cockroaches (Nauphoeta cinerea). We then determined how the sexes regulate their intake of nutrients when restricted to a single diet and when given dietary choice and how this affected expression of these important reproductive traits. Pheromone levels that improve male attractiveness, female clutch size and gestation time all peaked at a high daily intake of P:C in a 1:8 ratio. This is surprising because female insects typically require more P than males to maximize reproduction. The relatively low P requirement of females may reflect the action of cockroach endosymbionts that help recycle stored nitrogen for protein synthesis. When constrained to a single diet, both sexes prioritized regulating their daily intake of P over C, although this prioritization was stronger in females than males. When given the choice between diets, both sexes actively regulated their intake of nutrients at a 1:4.8 P:C ratio. The P:C ratio did not overlap exactly with the intake of nutrients that optimized reproductive trait expression. Despite this, cockroaches of both sexes that were given dietary choice generally improved the mean and reduced the variance in all reproductive traits we measured relative to animals fed a single diet from the diet choice pair. This pattern was not as strong when compared to the single best diet in our geometric array, suggesting that the relationship between nutrient balancing and reproduction is complex in this species.
Directory of Open Access Journals (Sweden)
P.W. Inglis
2000-09-01
Full Text Available We have isolated a gene encoding a chitinase (EC 3.2.1.14 from Ewingella americana, a recently described pathogen of the mushroom Agaricus bisporus. This gene, designated chiA (EMBL/Genbank/DDBJ accession number X90562, was cloned by expression screening of a plasmid-based E. americana HindIII genomic library in Escherichia coli using remazol brilliant violet-stained carboxymethylated chitin incorporated into selective medium. The chiA gene has a 918-bp ORF, terminated by a TAA codon, with a calculated polypeptide size of 33.2 kDa, likely corresponding to a previously purified and characterised 33-kDa endochitinase from E. americana. The deduced amino acid sequence shares 33% identity with chitinase II from Aeromonas sp. No. 10S-24 and 7.8% identity with a chitinase from Saccharopolyspora erythraeus. Homology to other chitinase sequences was otherwise low. The peptide sequence deduced from chiA lacks a typical N-terminal signal sequence and also lacks the chitin binding and type III fibronectin homology units common to many bacterial chitinases. The possibility that this chitinase is not primarily adapted for the environmental mineralisation of pre-formed chitin, but rather for the breakdown of nascent chitin, is discussed in the context of mushroom disease.O gene que codifica uma quitinase (EC 3.2.1.14 foi isolado de Ewingella americana, recentemente descrita como patógeno do cogumelo Agaricus bisporus. Este gene, denominado chiA (EMBL/Genebank/DDBJ número de acesso X9061, foi clonado e selecionado a partir de livraria genômica construída por digestão do DNA de E. americana com HindIII e ligação em plasmídio de expressão em E. coli, utilizando meio seletivo contendo quitina carboximetilada, corada com "remazol brilliant violet'' para seleção de clones. O gene chiA apresenta uma ORF de 918 bp, código terminador TAA, tendo o tamanho do polipeptídeo sido calculado como 33,2 kDa, o qual corresponde ao tamanho de 33 kDa da endoquitinase
Multi scale habitat relationships of Martes americana in northern Idaho, U.S.A.
Tzeidle N. Wasserman; Samuel A. Cushman; David O. Wallin; Jim Hayden
2012-01-01
We used bivariate scaling and logistic regression to investigate multiple-scale habitat selection by American marten (Martes americana). Bivariate scaling reveals dramatic differences in the apparent nature and strength of relationships between marten occupancy and a number of habitat variables across a range of spatial scales. These differences include reversals in...
Directory of Open Access Journals (Sweden)
Anajwala Chetan C.
2010-06-01
Full Text Available Research is focusing on the search for new types of natural chemotherapeutic agent that is plant based medicines which are proving to be excellent sources of new compounds. In present research study, an attempt was made to prove cytotoxicity activity of various parts of medicinal plants such as Agave americana, Strychnos nux-vomica and Areca catechu using MCF-7 and Vero cell line. Various parts of the medicinal plants were extracted by soxhlet apparatus using solvents likes methanol and water. By trypan blue dye exclusion method, Viability of MCF-7 and Vero cell lines were 85.50 and 81.13%, respectively. IC50 value of methanol extract of Agave americana leaves and aqueous extract of Areca catechu fruits were found to be 545.9 & 826.1 µg/ml by SRB assay and 775.1 & 1461µg/ml by MTT assay, respectively, against MCF-7 cell line. From cytotoxicity study data by SRB and MTT assay, it revealed that methanol extract of Agave americana and aqueous extract of Areca catechu are potent cytotoxic.
Directory of Open Access Journals (Sweden)
Cintia A. Rincón-Hernández
2011-06-01
Full Text Available Persea americana var. drymifolia (aguacate criollo mexicano se emplea como portainjerto en huertos de aguacate Hass y es fuente de genes de resistencia a plagas y patógenos para éste y otros cultivares. El aguacate criollo mexicano se está sustituyendo por cultivares comerciales o perdiendo por la destrucción de ecosistemas. Por eso, se estudiaron 250 árboles (52 accesiones de 14 estados de México; 247 de criollo mexicano y 3 híbridos de éste con P.shiedeana, P. americana var. americana y P. americana var. guatemalensis, plantados en los bancos de germoplasma en Michoacán. Se analizó la composición química mediante cromatografía de gases-masas. Hubo alta variabilidad química entre los árboles del banco de germoplasma con los 64 compuestos detectados. El análisis de cúmulos mostró 2 grandes grupos químicos con 100% disimilitud y 22 grupos a 10% de disimilitud. Los híbridos se agruparon de manera diferente a los árboles con características típicas de criollo y difieren en su altitud de origen. Corroboramos que los volátiles foliares sirven como marcadores para diferenciar los criollos típicos de sus híbridos y que mucha variación atribuida a la variedad criolla proviene de hibridaciones en zonas de contacto de esta variedad con otras variedades o especies de Persea.Persea americana var. drymifolia (mexican creole avocado is used as rootstock in Hass avocado orchards and it is a source of genes for resistance to pests and pathogens for this and other cultivars. The Mexican varieties are being replaced by commercial cultivars or lost by the destruction of ecosystems. Therefore, we studied 250 avocado trees of 52 accessions from 14 Mexican states; 247 mexican creole avocado and 3 hybrids of that tree with P. shiedeana, P. americana var. americana or P. americana var. guatemalensis, planted at germplasm banks, Michoacán. Foliar chemical composition was analyzed by GC-MS. High chemical variability among the trees was found
Directory of Open Access Journals (Sweden)
Kalliopi Georgiades
Full Text Available BACKGROUND: The evolution of the Alphaproteobacteria and origin of the mitochondria are topics of considerable debate. Most studies have placed the mitochondria ancestor within the Rickettsiales order. Ten years ago, the bacterium Odyssella thessalonicensis was isolated from Acanthamoeba spp., and the 16S rDNA phylogeny placed it within the Rickettsiales. Recently, the whole genome of O. thessalonicensis has been sequenced, and 16S rDNA phylogeny and more robust and accurate phylogenomic analyses have been performed with 65 highly conserved proteins. METHODOLOGY/PRINCIPAL FINDINGS: The results suggested that the O. thessalonicensis emerged between the Rickettsiales and other Alphaproteobacteria. The mitochondrial proteins of the Reclinomonas americana have been used to locate the phylogenetic position of the mitochondrion ancestor within the Alphaproteobacteria tree. Using the K tree score method, nine mitochondrion-encoded proteins, whose phylogenies were congruent with the Alphaproteobacteria phylogenomic tree, have been selected and concatenated for Bayesian and Maximum Likelihood phylogenies. The Reclinomonas americana mitochondrion is a sister taxon to the free-living bacteria Candidatus Pelagibacter ubique, and together, they form a clade that is deeply rooted in the Rickettsiales clade. CONCLUSIONS/SIGNIFICANCE: The Reclinomonas americana mitochondrion phylogenomic study confirmed that mitochondria emerged deeply in the Rickettsiales clade and that they are closely related to Candidatus Pelagibacter ubique.
Pro-apoptotic effect of Persea americana var. Hass (avocado) on Jurkat lymphoblastic leukemia cells.
Bonilla-Porras, Angelica R; Salazar-Ospina, Andrea; Jimenez-Del-Rio, Marlene; Pereañez-Jimenez, Andres; Velez-Pardo, Carlos
2013-11-05
Abstract Context: Therapy for leukemia has a limited efficacy. There is a need to search for alternative anti-leukemia therapies. Persea americana Mill var. Hass (Lauraceae) is a tropical fruit (avocado) that might be used against cancer. Objective: To investigate whether P. americana induces death in Jurkat lymphoblastic leukemia cells. Materials and methods: Four ethanol extracts (0.1, 0.5, 1, 2 and 5 mg/mL) from avocado fruit (endocarp, whole seed, seed and leaves) were analyzed against Jurkat cells. Hydrogen peroxide generation by oxidation of 2',7'-dichlorodihydrofluorescein diacetate to the fluorescent compound 2',7'-dichlorfluorescein assay, acridine orange/ethidium bromide staining, flow cytometry analysis of annexin-V/7-amino-actinomycin, mitochondrial membrane potential and immunocytochemistry detection of transcription factor p53, caspase-3 and apoptosis-inducing factor (AIF) were evaluated. Results: Endocarp, seed, whole seed, and leaf (0.1 mg/mL) extracts induced significant apoptosis in Jurkat cells (p avocado and its therapeutic action on leukemia.
ECOPHYSIOLOGICAL ANALYSIS OF GENIPA AMERICANA L. SEEDS IN AN INDUCED SOIL SEED BANK
Directory of Open Access Journals (Sweden)
Francesca Salla
2016-03-01
Full Text Available This work studied the behavior of G. americana L. (Rubiaceae seeds in an induced soil seed bank. This study was conducted in Lavras-MG in a seasonal semideciduous forest of the Federal University of Lavras. Seeds collected in the area were cleaned and analyzed (water content, viability and desiccation tolerance. Soil banks were installed in two distinct areas (top of hill and riparian forest located in the understory of the forest. Seeds were placed in nylon nets and covered with a thin litter layer that was previously removed for this purpose. Monthly assessment of germination, seedling emergence, seed and soil water content, and the characterization of the initial seedling growth was performed. It was observed that G. americana seeds forms a transitory seed bank, with maintenance of its viability until the fourth month after disposal in natural environment. In general, the seed bank located in the riparian forest area showed the best potential for seedling establishment in a natural environment, which supports the ecological behavior of this species.
American wild celery (Vallisneria americana): Ecological considerations for restoration
Korschgen, C.E.; Green, W.L.
1988-01-01
The success of vegetation management programs for waterfowl is dependent on knowing the physical and physiological requirements of target species. Lakes and riverine impoundments that contain an abundance of the American wildcelery (Vallisneria americana ) have traditionally been favored by canvasbacks (Aythya valisineria ) and other waterfowl as feeding areas during migration. Information on the ecology of American wildcelery is summarized to serve as a guide for potential wetland restoration projects. Techniques are described for transplanting winter buds. Management programs that employ these techniques should define objectives clearly and evaluate the water regime carefully before initiating major restoration.
Componentes volátiles de mamey (mammea americana L.
Directory of Open Access Journals (Sweden)
Alicia Lucía Morales
2010-07-01
Full Text Available Los componentes volátiles del aroma de mamey (Mammea americana L, fueron extraídos utilizando el método de destilación por arrastre con vapor-extracción simultánea con solvente orgánico. El extracto fue prefraccionado por cromatografía en columna en silica gel con gradiente discontinuo Pentano: Éter etílico para obtener tres fracciones que fueron analizadas por CGAR y CGAR-EM. Se detectaron 34 compuestos, de los cuales fueron identificados 22, siendo los componentes mayoritarios: Furfural (7281 ^ig/kg y E-Famesol (2145 ng/kg
International Nuclear Information System (INIS)
Kumar, Amith; Kumarachandra, Reshma; Rai, Rajalakshmi; Rao, Satish; Suchetha Kumari; Joshi, Manjunath
2013-01-01
Ionizing radiation produce deleterious effects in the living organisms. Rapid technological advancement has increased human exposure to ionizing radiations enormously. Several plants have been screened for their radio protective ability and the hunt for identifying many more safe, nontoxic and effective ones is in progress. The aim of the present study was to evaluate the antioxidant activity in hydro alcoholic leaf extract of Psidium guajava (guava) and Persea americana (avocado). The antioxidant assay such as 2,2-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS) free radical scavenging assay, 1,1-diphenyl-2-picrylhydrazyl (DPPH) free radical scavenging assay, chelation of iron by plant extract, hydroxyl radical scavenging assay, ferric reducing antioxidant potential (FRAP), and total antioxidant activity of extract was analyzed using spectrophotometer. Phytochemical screening and HPLC analysis of leaf extracts were also performed. The results indicated that the IC50 value of hydro alcoholic leaf extract of P.guajava and P. americana were 14 μg/ml and 15 μg/ml in ABTS free radical scavenging assay, 4 μg/ml and 2.5 μg/ml in DPPH free radical scavenging assay, 7.2 μg/ml and 8.4 μg/ml in chelation of iron by plant extract, 2 μg/ml and, 4.3 μg/ml in hydroxyl radical scavenging assay and effective concentration(EC50) was 57.80 μg/ml and 87.56 μg/ml in FRAP assay respectively. The results for total antioxidant activity indicated that 242.3 μg/ml of P.guajava and 432.7 μg/ml of P.americana extract was equivalent to 100 μg/ml of standard qurecetin respectively. Qualitative analysis of hydroalcoholic leaf extracts revealed the presence of flavonoids, tannins, saponions, terpenoids, and glycosides. HPLC analysis confirmed the presence of flavonoids qurecetin and rutin in leaf extracts on comparison with standard compounds. Our study showed that hydro alcoholic leaf extracts of Psidium guajava and Persea americana act as strong antioxidant and free
Effects of simulated acid rain on leaf anatomy and micromorphology of Genipa americana L. (Rubiaceae
Directory of Open Access Journals (Sweden)
Bruno Francisco Sant'Anna-Santos
2006-03-01
Full Text Available Experiments were conducted in order to characterize the injuries on leaf structure and micromorphology of G. americana and evaluate the degree of susceptibility of this species to simulated acid rain. Plants were exposed to acid rain (pH 3.0 for ten consecutive days. Control plants were submitted only to distilled water (pH 6.0. Leaf tissue was sampled and fixed for light and scanning electron microscopy. Necrotic interveinal spots on the leaf blade occurred. Epidermis and mesophyll cells collapse, hypertrophy of spongy parenchyma cells, accumulation of phenolic compounds and starch grains were observed in leaves exposed to acid rain. The micromorphological analysis showed, in necrotic areas, plasmolized guard cells and cuticle rupture. Epidermal and mesophyll cells alterations occurred before symptoms were visualized in the leaves. These results showed the importance of anatomical data for precocious diagnosis injury and to determine the sensitivity of G. americana to acid rain.Experimentos foram conduzidos para avaliar o grau de susceptibilidade e determinar as injúrias causadas pela chuva ácida simulada na anatomia e micromorfologia foliar de Genipa americana. Plantas foram expostas à chuva com pH 3,0 durante 10 dias consecutivos. No tratamento controle utilizou-se apenas água destilada (pH 6,0. Amostras foliares foram coletadas e fixadas para microscopia de luz e eletrônica de varredura. Foram observados nas folhas expostas à chuva ácida: necroses pontuais intervenais, colapso das células do mesofilo e da epiderme; hipertrofia do parênquima lacunoso e acúmulo de compostos fenólicos e grãos de amido. A análise micromorfológica evidenciou, nas áreas necrosadas, plasmólise das células-guarda e ruptura da cutícula e da crista estomática. Alterações anatômicas ocorreram antes que sintomas visuais fossem observados nas folhas. Estes resultados comprovam a importância de dados anatômicos na diagnose precoce da injúria e na
Morfoanatomia de folha e caule de Genipa americana L., Rubiaceae
Directory of Open Access Journals (Sweden)
Marianna Erbano
2010-10-01
Full Text Available Genipa americana L., conhecida como jenipapo, é uma Rubiaceae nativa do Brasil e as suas folhas são utilizadas pela população como antidiarreico e febrífugo, e o caule como anti-hemorrágico, contra luxações e contusões. Com o objetivo de caracterizar macro e microscopicamente folhas adultas e caules jovens para o controle de qualidade farmacognóstico, essa planta medicinal foi analisada segundo a metodologia clássica de morfoanatomia vegetal. Genipa americana apresenta folhas simples, opostas, de formato obovado a oblanceolado e pecíolos curtos. A epiderme foliar é uniestratificada e revestida por cutícula delgada e levemente estriada. Os estômatos são paracíticos e restritos à superfície abaxial. Há tricomas tectores uni e pluricelulares predominantemente na superfície abaxial. O mesofilo é dorsiventral. Em secção transversal, a nervura central é plano-convexa e o pecíolo é circular, ambos apresentando um feixe vascular colateral em disposição cilíndrica e outros menores. O caule possui felogênio localizado nas camadas subepidérmicas, colênquima anelar e um cilindro floemático externo ao de xilema, sendo ambos percorridos por raios parenquimáticos estreitos. Ocorrem idioblastos contendo compostos fenólicos, areia cristalina e drusas de oxalato de cálcio na folha e no caule.
Effect of Agave americana and Agave salmiana Ripeness on Saponin Content from Aguamiel (Agave Sap).
Leal-Díaz, Ana María; Santos-Zea, Liliana; Martínez-Escobedo, Hilda Cecilia; Guajardo-Flores, Daniel; Gutiérrez-Uribe, Janet Alejandra; Serna-Saldivar, Sergio Othón
2015-04-22
Steroidal saponins have shown beneficial health effects. Agave spp. leaves and rhizomes are sources of these compounds, but their presence has not been reported in the aguamiel. Aguamiel is the sweet edible sap from mature agave, and its quality is influenced by the plant ripening stage. The purpose of this research was to identify and quantitate saponins in aguamiel from Agave americana and Agave salmiana at two ripening stages. Saponins and sapogenins were identified with HPLC/ESI-MS/TOF and quantitated with HPLC/ELSD. Results proved the presence of saponins derived from kammogenin, manogenin, gentrogenin, and hecogenin. The saponin content in aguamiel from immature A. salmiana was 2-fold higher (478.3 protodioscin equivalents (PE) μg/g aguamiel (DM)) compared with A. americana (179.0 PE μg/g aguamiel (DM)). In both species, saponin content decreased when plants reached sexual maturity. This should be considered before evaluating the effects of Agave spp. as a source of bioactive saponins.
White ash (Fraxinus americana) decline and mortality: the role of site nutrition and stress history
Alejandro A. Royo; Kathleen S. Knight
2012-01-01
Over the past century, white ash (Fraxinus americana) populations throughout its range have deteriorated as a result of declining tree health and increased mortality rates. Although co-occurring factors including site nutritional deficiencies and punctuated stress events (e.g., defoliations, drought) are hypothesized to trigger white ash decline,...
Park, Su-Youn; Jung, Suk-Yul
2014-01-01
Phytolacca americana L. is a large semi-succulent herbaceous plant which reaches three meters in height. It is native to eastern North America, the Midwest, and the Gulf Coast, with more scattered populations in the far West. It is imported into Korea and has been frequently used as a traditional natural drug for diseases such as systemic edema and nephritis. Its berries, that is, fruits are shiny dark purple held in racemous clusters on pink pedicels with a pink peduncle. They are round with a flat indented top and bottom. Immature berries are green, maturing into white and then blackish purple. It is not well known how the berries are used for a natural staining yet. In this study, using Phytolacca americana L.-berries, a natural staining was analyzed. Moreover, due to the broad use of chemical mordants, five different mordants including copper acetate, aluminum potassium sulfate, sodium tartrate plus citric acid, Iron II sulfate and potassium dichromate were combined. Extracted dye from the berries stained silk fabrics with ivory. The original purple color from the berries disappeared and transformed into ivory. Although the silk fabrics were differentially stained by the berries that were combined with mordants of aluminum potassium sulfate, sodium tartrate plus citric acid and potassium dichromate, only differences in lightness and darkness were observed. Interestingly, the combination of the dye from the berries with a mordant of copper acetate and Iron II sulfate induced the staining of the silk fabrics into khaki and dark khaki, respectively. This study is the first systemic report on staining silk fabrics with Phytolacca americana L.-berries and chemical mordants and suggests application of natural products to the fiber industry.
Directory of Open Access Journals (Sweden)
Monsuru Adebayo Adeleke
2012-06-01
Full Text Available This study investigates the microbial load and antibiotic susceptibility pattern of pathogenic bacteria isolated from the faeces and body surfaces of cockroaches in Osogbo, Southwestern Nigeria. The cockroaches collected from residential areas and hospital vicinities were screened for microbial load and antibiotic susceptibility pattern using standard protocols. A total of twenty- three microorganisms namely Klebsiella aerogenes, Bacillius cereus, Proteus spp, Staphyloccocus aureus, S. saprophyticus, Enteroccocus faecalis, Staphylococus epididermis, E. coli, Listeria monoctogene, Proteus mirabilis, Citrobacter species, Pseudomonas aeruginosa, Psuedomonas species, Seretia mensence, Candida albicans, Candida spp., Aspergilius spp., A. flavus, A. fumigates, Mucor species and Penicilium species were isolated. The microbial load of the microorganisms was significantly higher in the isolates from hospital as compared with the residential area (p<0.05 with the exception of Canidida species, Mucor and Penicillium which had higher or equal microbial load at the residential areas. All the pathogenic bacteria isolated had multiple resistance to antibiotics most importantly, Ampicillin, Augumentin, Amoxicillin and Septrin (30μg. Efforts geared towards controlling the insects will be indispensable in curbing the wide spread of multi-drug resistant pathogens in the study area.
Patra, Jayanta Kumar; Kim, Eun Sil; Oh, Kyounghee; Kim, Hyeon-Jeong; Kim, Yangseon; Baek, Kwang-Hyun
2014-09-20
The oral cavity is the store house of different species of microorganisms that are continuously engaged in causing diseases in the mouth. The present study was conducted to evaluate the antibacterial potential of crude extracts of the aerial parts of Phytolacca americana and its natural compounds against two oral pathogens, Porphyromonas gingivalis and Streptococcus mutans, which are primarily responsible for periodontal inflammatory diseases and dental caries, as well as a nonpathogenic Escherichia coli. Crude extract and fractions from the aerial parts of P. americana (0.008-1.8 mg/mL) were evaluated for their potential antibacterial activity against two oral disease causing microorganisms by micro-assays. The standard natural compounds present in P. americana, kaempferol, quercetin, quercetin 3-glucoside, isoqueritrin and ferulic acid, were also tested for their antibacterial activity against the pathogens at 1-8 μg/mL. The crude extract was highly active against P. gingivalis (100% growth inhibition) and moderately active against S. mutans (44% growth inhibition) at 1.8 mg/mL. The chloroform and hexane fraction controlled the growth of P. gingivalis with 91% and 92% growth inhibition at a concentration of 0.2 mg/mL, respectively. Kaempferol exerted antibacterial activity against both the pathogens, whereas quercetin showed potent growth inhibition activity against only S. mutans in a concentration dependent manner. The crude extract, chloroform fraction, and hexane fraction of P. americana possesses active natural compounds that can inhibit the growth of oral disease causing bacteria. Thus, these extracts have the potential for use in the preparation of toothpaste and other drugs related to various oral diseases.
Olushola, Ayoola I; Aderibigbe, Komolafe O; Stephen, Saka O; Ayodeji, Odukoya S
2017-10-01
The cardioprotective effects of Persea americana extract was investigated on biochemical activities of high salt-fed adult Wistar rats in this study. Forty healthy Wistar rats of both sexes weighing 120 to 150 g were randomly assigned into 8 groups of 5 rats each (groups A, B, C, D, E, F, G, and H). Rats in groups A, F, G, and H were fed with standard laboratory pellets, while groups B, C, D, and E were fed on the high-salt diet for 4 weeks. Concomitantly, daily administration of 50, 100, and 150 mg/kg of the P americana extract were given orally to groups C and F, D and G, and E and H, respectively, while rats in groups A and B were administered distilled water. Blood samples were taken by cardiac puncture; concentration of sodium ion, potassium ion, nitric oxide, and activity of lactate dehydrogenase were determined. One-way analysis of variance was used to analyze data, followed by Student-Newman-Keuls (SNK) test for multiple comparison. Results revealed that concentration of potassium ion and nitric oxide was significantly lower ( P < .05) in high salt-fed groups. Sodium ion concentration and activity of lactate dehydrogenase were higher in high salt-fed group while P americana prevented biochemical perturbations in other experimental groups. In conclusion, high salt-diet induced biochemical alterations which were significantly protected by oral administration of P americana extract.
Directory of Open Access Journals (Sweden)
Tara C. Fehling-Fraser
2015-01-01
Full Text Available L a deforestación en México ha hecho que la restauración sea una necesidad urgente. Erythrina americana es un árbol multipropósito, útil para la restauración de bosques tropicales estacionalmente secos (BTES, pero es poco estudiado. La macropropagación de esta especie es ventajosa comparada con la reproducción sexual que requiere de semillas escarificadas para germinar. En este estudio se evaluaron los efectos de la aplicación exógena de la fitohormona ácido indol-3-butírico en esquejes y del fertilizante fosfatado de liberación lenta (FLL en el sustrato, sobre el crecimiento de E. americana en invernadero. El experimento tuvo un diseño de cuatro bloques al azar. Diez esquejes se cosecharon por tratamiento después de 36, 66, 96 y 126 días de crecimiento. La sobrevivencia, biomasa seca total (BST, tasa de crecimiento relativo (TCR y la asignación de recursos (AR se evaluaron. La sobrevivencia promedio de los esquejes fue alta (95 %. Los tratamientos no afectaron la BST, TCR y AR; sin embargo, la aplicación de FLL en el sustrato mostró valores significativamente (P < 0.05 mayores de biomasa seca radical. Los periodos de crecimiento afectaron la TCR y AR. La macropropagación de E. americana fue exitosa y no requirió cuidados intensivos, por lo que esta técnica puede ser una alternativa viable para proyectos de restauración, principalmente en comunidades con bajos recursos.
A produção da "cidade latino-americana" The production of "the Latin American city"
Directory of Open Access Journals (Sweden)
Adrián Gorelik
2005-06-01
Full Text Available Este trabalho propõe uma análise histórica da categoria "cidade latino-americana" como construção cultural. O argumento central é que, durante o período compreendido entre o segundo pós-guerra e a década de 1970, a idéia de "cidade latino-americana" funcionou como uma categoria do pensamento social, como uma figura do imaginário intelectual e político em amplas regiões do continente. Este texto procura reconstruir os principais itinerários conceituais e ideológicos da categoria, suas funções políticas e institucionais na conjuntura específica da região. Esse modo de entender a categoria "cidade latino-americana" em sua configuração histórica específica, sugere o autor, pode oferecer uma via produtiva para os estudos culturais latino-americanos.This paper suggests a historical analysis of the category "Latin American city" as a cultural construct. The central argument is that, during the period between the post-war and the 1970's, the idea of a Latin American city became a category of social thought, as part of the intellectual and political imagination in several regions of the continent. The text tries to rebuild the main conceptual and ideological turns, their political and institutional functions within the specific regional circumstances. The article suggests that this approach to the "Latin American city" category in its precise historical configuration may be a productive path for Latin-American cultural studies.
Coballase-Urrutia, Elvia; Cárdenas-Rodríguez, Noemí; González-García, María Carolina; Núñez-Ramírez, Eithan; Floriano-Sánchez, Esaú; González-Trujano, María Eva; Fernández-Rojas, Berenice; Pedraza-Chaverrí, José; Montesinos-Correa, Hortencia; Rivera-Espinosa, Liliana; Sampieri, Aristides Iii; Carmona-Aparicio, Liliana
2017-03-01
Around the world, species from the genus Tilia are commonly used because of their peripheral and central medicinal effects; they are prepared as teas and used as tranquilizing, anticonvulsant, and analgesic agents. In this study, we provide evidence of the protective effects of organic and aqueous extracts (100 mg/kg, i.p.) obtained from the leaves of Tilia americana var. mexicana on CCl 4 -induced liver and brain damage in the rat. Protection was observed in the liver and brain (cerebellum, cortex and cerebral hemispheres) by measuring the activity of antioxidant enzymes and levels of malondialdehyde (MDA) using spectrophotometric methods. Biochemical parameters were also assessed in serum samples from the CCl 4 -treated rats. The T. americana var. mexicana leaf extracts provided significant protection against CCl 4 -induced peripheral and central damage by increasing the activity of antioxidant enzymes, diminishing lipid peroxidation, and preventing alterations in biochemical serum parameters, such as the levels of aspartate aminotransferase (AST), alanine aminotransferase (ALT), alkaline phosphatase (ALP), γ-globulin (γ-GLOB), serum albumin (ALB), total bilirubin (BB), creatinine (CREA) and creatine kinase (CK), relative to the control group. Additionally, we correlated gene expression with antioxidant activity in the experimental groups treated with the organic and aqueous Tilia extracts and observed a non-statistically significant positive correlation. Our results provide evidence of the underlying biomedical properties of T. americana var. mexicana that confer its neuro- and hepatoprotective effects.
Um olhar sistêmico sobre a crise norte-americana
Directory of Open Access Journals (Sweden)
CHRISTIAN CARVALHO GANZERT
Full Text Available RESUMO No contexto contemporâneo, a economia global pode ser descrita como um sistema baseado em agentes que, quando associados, manifestam seus próprios meios e fins. A crise das hipotecas subprime nos Estados Unidos é um bom exemplo das implicações desse tipo de relacionamento. Ela está diretamente relacionada a poderosos laços de realimentação, compostos por uma série de variáveis que amplificaram o fato de as famílias americanas terem se endividado em ritmo maior do que a sua distribuição de riqueza, prejudicada pela externalização da produção. Há atualmente uma nova estrutura na economia internacional, em que as ex-nações subdesenvolvidas estão mais bem posicionadas no cenário macroeconômico e têm maior poder do que antes - uma consequência do necessário rearranjo sistêmico. Diante dessa complexa dinâmica, a função de inteligência que deveria controlar e garantir a estabilidade sistêmica falhou em perceber a dinâmica e os impactos da nova cultura atrelada ao comportamento do capital contemporâneo, para evitar a perda da hegemonia. Observando-se ex post facto, por meio de um enfoque sistêmico, a crise econômica americana pode ser definida como tendo suas raízes nas premissas de todo o arcabouço cultural da globalização que acabou por conduzir à externalização da produção. Assim, o contexto sistêmico desta análise aponta que a cultura, como importante gerador e amplificador, deve ser o principal foco dos intentos de análise do atual contexto socioeconômico global.
Assimilate partitioning in avocado, Persea americana
International Nuclear Information System (INIS)
Finazzo, S.; Davenport, T.L.
1986-01-01
Assimilate partitioning is being studied in avocado, Persea americana cv. Millborrow in relation to fruit set. Single leaves on girdled branches of 10 year old trees were radiolabeled for 1 hr with 13μCi of 14 CO 2 . The source leaves were sampled during the experiment to measure translocation rates. At harvest the sink tissues were dissected and the incorporated radioactivity was measured. The translocation of 14 C-labelled compounds to other leaves was minimal. Incorporation of label into fruitlets varied with the tissue and the stage of development. Sink (fruitlets) nearest to the labelled leaf and sharing the same phyllotaxy incorporated the most 14 C. Source leaves for single non-abscising fruitlets retained 3X more 14 C-labelled compounds than did source leaves for 2 or more fruitlets at 31 hrs. post-labelling. Export of label decreased appreciably when fruitlets abscised. If fruitlets abscised within 4 days of labeling then the translocation pattern was similar to the pattern for single fruitlets. If the fruitlet abscised later, the translocation pattern was intermediate between the single and double fruitlet pattern
Mound, Laurence A; Hoddle, Mark S
2016-02-12
Following recent molecular studies on avocado thrips, a new species is described from Costa Rica, Ecuador, and Colombia from the young leaves of avocado, Persea americana. Scirtothrips hansoni sp.n. is closely related to the Californian pest, S. perseae, and also to S. astrictus from Costa Rica that remains known from a single female. An illustrated key to these three species is provided.
A diverse number of Scolytinae (Coleoptera: Curculionidae) have been found inhabiting Persea borbonia and P. americana in Florida during 2009 and 2010. They include the exotic redbay ambrosia beetle, Xyleborus glabratus, vector of Raffaelea lauricola, X. volvulus, X. ferrugineus, Xylosandrus crassiu...
Tong, Xunliang; Guo, Miao; Jin, Min; Chen, Hao; Li, Yanming; Wei, Ji-Fu
2016-01-01
Cockroach (CR) allergies caused by the American cockroach hyave been recognized to be repsonsible for IgE-mediated type I hypersensitivity worldwide. Per a 10 is one of the recognized main allergens of the American CR. In a previous study, we examined another American CR allergen, Per a 9 in patients with CR allergies and examined epitope sequences in this allergen. In the present study, we aimed to examine epitope sequences in the Per a 10 allergen. for this purpose, the Per a 10 gene was cloned and expressed in Escherichia coli (E. coli) systems. Our results revealed that 9 out of 16 (56.3%) sera from patients with American CR allergies reacted to Per a10, as assessed by ELISA, confirming that Per a 10 is a major allergen of the American CR. Our results also revealed that the expression of CD63 and CCR3 on passively sensitized basophils (obtained sera of patients with American CR allergies) was increased by approximately 2.3-fold, indicating that recombinant Per a 10 is functionally active. In addition, 3 immunoinformatics tools, namely the DNAStar Protean system, the Bioinformatics Predicted Antigenic Peptides (BPAP) system and the BepiPred 1.0 server were used to predict the peptides and the results revealed 8 peptides (2–12, 55–67, 98–120, 125–133, 149–160, 170–182, 201–208 and 223–227) as potential B cell epitopes of the Per a 10 allergen. Moreover, Per a 10 was predicted to have 3 T cell epitope sequences, namely 83–92, 139–147 and 162–170. The findings of our study on the CR allergen may prove to be useful in the development of peptide-based vaccine for the prevention and/or treatment of CR allergies. PMID:27840898
Directory of Open Access Journals (Sweden)
Andi Nur Fitriani Abubakar
2014-07-01
Full Text Available Avocado seed (Persea americana is recognized as one of medicinal plants. It contains several secondary metabolites, which have toxic activity. However, efforts to identify active compounds from avocado seeds (Persea americana are still relatively rare. Therefore, isolation and toxicity assay have been conducted foward the active compound of avocado seed. Maceration one kilogram of seed dried powder by ethanol obtained 49,7464 gram extract. Separation of etanol extract by column chromatography generated 0,0698 grams of pure white needle crytal, which is positively triterpenoid based on Lieberman-Buchard test. In addition, infrared spectrum showed the existence of OH, C=C, C-C, C=O, -C-H, -CH3,-CH2 and C-O stretch, which support the presumed compound. The result of toxicity test on Artemia salina Leach showed that the extract, fraction and pure isolates of the etanol extract are toxic with LC50 values 13,274 g/mL; 9,528 g/mL and 8,128 g/mL, respectively.
An augmented reality system validation for the treatment of cockroach phobia.
Bretón-López, Juani; Quero, Soledad; Botella, Cristina; García-Palacios, Azucena; Baños, Rosa Maria; Alcañiz, Mariano
2010-12-01
Augmented reality (AR) is a new technology in which various virtual elements are incorporated into the user's perception of the real world. The most significant aspect of AR is that the virtual elements add relevant and helpful information to the real scene. AR shares some important characteristics with virtual reality as applied in clinical psychology. However, AR offers additional features that might be crucial for treating certain problems. An AR system designed to treat insect phobia has been used for treating phobia of small animals, and positive preliminary data about the global efficacy of the system have been obtained. However, it is necessary to determine the capacity of similar AR systems and their elements that are designed to evoke anxiety in participants; this is achieved by testing the correspondence between the inclusion of feared stimuli and the induction of anxiety. The objective of the present work is to validate whether the stimuli included in the AR-Insect Phobia system are capable of inducing anxiety in six participants diagnosed with cockroach phobia. Results support the adequacy of each element of the system in inducing anxiety in all participants.
American joint vetch, Aeschynomene Americana L. is a self-pollinated tropical pasture legume and the USDA, ARS, PGRCU curates 137 accessions from the United States, S. America, Mexico, Central America, and Zambia. Many accessions in this collection are photoperiod sensitive due to their typical flow...
Directory of Open Access Journals (Sweden)
Fernando Tapia-Pastrana
2011-09-01
Full Text Available Se analizaron citogenéticamente células provenientes de meristemos radiculares de 2 leguminosas, Cologania grandiflora y Erythrina americana, que en la actualidad están incluidas en la flora de la Reserva Ecológica del Pedregal de San Ángel, México, D. F., mediante una técnica de extendido en superficie y secado al aire para determinar los números cromosómicos somáticos. Por vez primera se obtuvieron la morfología cromosómica y otras características cuantitativas de los cariotipos en C. grandiflora (2n= 44= 26m +18sm y en E. americana (2n= 42= 36m + 4sm +2st sat, primeras también en ambos géneros. Cologania y Erythrina se reconocen como poliploides estabilizados y el hallazgo de un único par de cromosomas con satélites (dominancia nucleolar en las especies estudiadas aquí, favorece la opinión de un origen alopoliploide para estos taxa.Meristematic root cells from Cologania grandiflora and Erythrina americana from Reserva Ecológica del Pedregal de San Ángel, Distrito Federal, Mexico, were analyzed cytogenenetically using a surface-spreading and air-drying method. The somatic chromosome numbers were determined. Chromosome morphology and others quantitative features of the karyotypes obtained for first time in C. grandiflora (2n= 44= 26m + 18sm and E. americana (2n= 42= 36m + 4sm + 2st sat and also the first in both genera. Cologania and Erythrina are recognized as stabilized polyploids and the finding of just one pair of chromosomes with satellites (nucleolar dominance in the species analyzed here supports the view of allopolyploid origin of these taxa.
Murzagulov, G S; Saltykova, E S; Gaĭfullina, L R; Nikolenko, A G
2013-01-01
The work deals with effect of density of population on functional activity of components pf protective system of adult individuals and nymphs of the marble cockroach. The resistance of individuals has been noted to decrease both at individual maintenance and under conditions of overpopulation. Changes in activities of enzymes of antioxidative and phenoloxidase systems are studied ion the insect hemolymph and intestine. Possible consequences of isolation and overpopulation are discussed both for stability and for individual development.
Energy Technology Data Exchange (ETDEWEB)
Platts-Mills, T.A.E.; Chapman, M.D.; Pollart, S.M.; Heymann, P.W.; Luczynska, C.M. (Univ. of Virginia, Charlottesville (United States))
1990-01-01
There is no doubt that a large number of individuals become allergic to foreign proteins that are predominantly or exclusively present indoors. In each case this immune response can be demonstrated either by immediate skin test responses or by measuring serum IgE antibodies. It has also been obvious for some time that patients presenting with asthma, perennial rhinitis and atopic dermatitis have an increased prevalence of IgE antibodies to these indoor allergens. More recently several epidemiological surveys have suggested that both mite exposure and IgE antibodies are important risk factors for asthma. The present situation is that assays have been developed capable of measuring the presence of mite, cockroach and cat allergens in house dust. Further clinical studies will be necessary to test the proposed standards for mite allergens and to define risk levels for other allergens.
Mengoni, Sofía L; Alzogaray, Raúl A
2018-04-02
The German cockroach, Blattella germanica (L.) (Blattodea: Blattellidae), is a serious worldwide pest with a considerable economical and sanitary impact. It is mainly controlled by the application of synthetic insecticides, but repeated use of these substances has promoted the appearance of resistance in cockroach populations throughout the world. The aim of this study was to compare the behavior of deltamethrin-susceptible (CIPEIN colony) and deltamethrin-resistant (JUBA and VGBA colonies) first instar nymphs exposed to the repellents N,N-diethyl-3-methylbenzamide (DEET) and ethyl 3-[acetyl(butyl)amino]propanoate (IR3535). Firstly, the behavior of the nymphs was assessed in an experimental arena in the absence of repellents. The parameters Distance Traveled, Velocity, Mobility Time, and Time Spent (in each half of the arena) were quantified using an image analyser, and showed that the behavior elicited by the three colonies was similar. After this, the behavior of the nymphs was quantified in an arena, half of which had been treated with repellent. The repellency of DEET increased as a linear function of log concentration for the three colonies. DEET elicited repellency as from a concentration of 97.49 µg/cm2 for the CIPEIN and JUBA colonies and 194.98 µg/cm2 for the VGBA colony. The repellency of IR3535 was weaker and started at a concentration of 389.96 µg/cm2 for the CIPEIN colony, 779.92 μg/cm2 for JUBA, and 1559.84 μg/cm2 for VGBA . Finally, nymphs were exposed to 3:1, 1:1, and 1:3 DEET:IR3535 mixtures, and a synergistic effect was observed only in the CIPEIN colony.
Assimilate partitioning in avocado, Persea americana
Energy Technology Data Exchange (ETDEWEB)
Finazzo, S.; Davenport, T.L.
1986-04-01
Assimilate partitioning is being studied in avocado, Persea americana cv. Millborrow in relation to fruit set. Single leaves on girdled branches of 10 year old trees were radiolabeled for 1 hr with 13..mu..Ci of /sup 14/CO/sub 2/. The source leaves were sampled during the experiment to measure translocation rates. At harvest the sink tissues were dissected and the incorporated radioactivity was measured. The translocation of /sup 14/C-labelled compounds to other leaves was minimal. Incorporation of label into fruitlets varied with the tissue and the stage of development. Sink (fruitlets) nearest to the labelled leaf and sharing the same phyllotaxy incorporated the most /sup 14/C. Source leaves for single non-abscising fruitlets retained 3X more /sup 14/C-labelled compounds than did source leaves for 2 or more fruitlets at 31 hrs. post-labelling. Export of label decreased appreciably when fruitlets abscised. If fruitlets abscised within 4 days of labeling then the translocation pattern was similar to the pattern for single fruitlets. If the fruitlet abscised later, the translocation pattern was intermediate between the single and double fruitlet pattern.
Lim, Sangho; Ho Sohn, Jung; Koo, Ja-Hyun; Park, Jung-Won; Choi, Je-Min
2017-08-04
German cockroaches are major household allergens that can trigger allergic airway inflammatory diseases with sensitive T-cell responses. Although the use of immune modulatory biologics, such as antibodies, to mediate allergic responses has recently been examined, only systemic administration is available because of the size limitations on intranasal administration. Here we utilized a cell-permeable peptide, dNP2, to deliver the cytoplasmic domain of cytotoxic T-lymphocyte antigen-4 (ctCTLA-4) through the airway epithelium to modulate Th2 responses in a German cockroach extract (GCE)-induced allergic airway inflammation model. The intranasal delivery efficiency of the dNP2-dTomato protein to the lungs was higher in GCE-induced asthmatic lung parenchymal cells compared to the sham cells. Intranasal administration of the dNP2-ctCTLA-4 protein inhibited airway hyper-responsiveness and reduced airway inflammation and remodeling, including goblet cell metaplasia and collagen deposition around the bronchi. The number of infiltrated cells, including eosinophils, and the levels of IL-4, IL-5, IL-13 and IFN-γ in the lungs were significantly reduced, presumably owing to inhibition of Th2 differentiation. However, intranasal administration of CTLA4-Ig did not inhibit airway inflammation. These results collectively suggest that dNP2-ctCTLA-4 is an efficient intranasally applicable candidate biologic for treating allergic asthma.
Directory of Open Access Journals (Sweden)
Ramón-Laca Menéndez de Luarca, Luis
1999-06-01
Full Text Available The Flemish botanist Charles de l'Écluse's works contain abundant references to American plants, for example the avocado (Persea americana Mill., the sweet potato [Ipomoea batatas (L. Lam.], the potato (Solanum tuberosum L. and the tobáceo (Nicotiana tabacum L.. Although some of these plants were observed by L'Écluse himself during his expedition to the Iberian Península between 1564 and 1565, the majority of the American plants quoted in his works are related with shipments received from several agents around Europe. In the case of Spain, L'Écluse obtained seeds from Seville thanks to the help of Simón de Tovar and Juan de Castañeda. The latter offers in his letters important innovations: Annona cherimola Mill., Indigofera añil LJI. tinctoria L., Annona muricata L., Mammea americana L.. Annona reticulata L., Dioscorea sp., Aloysia citrodora Palau or Manihot spj M. esculenta Crantz. In most of the cases the mention of these plants represente the first record of cultivation in the Old World. A percentage of this material was used by L'Écluse in his Exoticorum libri decem, published in Antwerp in l605.Las obras del botánico flamenco Charles de l'Écluse contienen infinidad de referencias a plantas americanas, destacando entre ellas el aguacate (Persea americana Mill., las batatas [Ipomoea batatas (L. Lam.], las patatas (Solanum tuberosum L. o el tabaco (Nicotiana tabacum L. . Algunas de ellas fueron observadas por L'Écluse durante la expedición llevada a cabo por la Península Ibérica entre 1564 y 1565. La mayor parte de plantas americanas citadas en sus obras están relacionadas sin embargo con envíos realizados por diversos corresponsales repartidos por Europa. En el caso de España, L'Écluse recibió semillas desde Sevilla gracias a Simón de Tovar y Juan de Castañeda. Este último ofrece en sus cartas importantes novedades, como el "anón" (Annona cherimola Mill., el "añil" (Indigofera añil L./I. tinctoria L., la "guan
Holman, G M; Cook, B J
1983-01-01
Proctolin and a second myotropic peptide were extracted from the hindgut of the cockroach Leucophaea maderae with methanol-water-acetic acid (90:9:1). The two peptides were easily separated by HPLC on a mu-Bondapak-phenyl column. Like proctolin, the second peptide was heat stable and was inactivated by the exopeptidases aminopeptidase M and carboxypeptidase Y. The response of the isolated hindgut to the new peptide was distinguishable from the response to proctolin by the following features: (a) a longer interval following application (1-4 min) to reach a maximum contraction, and (b) a much larger amplitude for single phasic contractions. Like proctolin, the new peptide could cause a protracted stimulation of the hindgut for more than 2 hr.
National Research Council Canada - National Science Library
Black, Patrick
2003-01-01
.... The modeling was directed toward an investigation of potential population increase of the submersed macrophyte Vallisneila americana as a consequence of the construction of a hypothetical levee...
Directory of Open Access Journals (Sweden)
Takumasa Kondo
2010-04-01
Full Text Available A new soft scale insect, Bombacoccus aguacatae Kondo, gen. n. and sp. n. (Hemiptera: Coccidae collected on the branches and twigs of avocado, Persea americana Mill. (Lauraceae in Colombia, is described and illustrated based on the adult female. An updated taxonomic key to closely related genera of the Toumeyella-group is provided.
Paula M. Pijut; Subash C. Domir; R. Daniel Lineberger; Lawrence R. Schreiber
1990-01-01
Callus cultures of elm (Ulmus americana L.) derived from Dutch elm disease susceptible, intermediate-resistant, and resistant genotypes were exposed to the culture filtrates of three pathogenic isolates of Ceratocystis ulmi, the causal agent of Dutch elm disease. Callus fresh weights, cell viability, and reactions of stem cuttings...
Hongos Fitopatógenos asociados a semillas de palto (Persea Americana mill.)
Leon Ttacca, Betsabe; Mattos Calderon, Leonor
2016-01-01
Una serie de enfermedades severas de origen fungoso son diseminadas por semillas de palto, y pueden causar una disminución de la producción en aproximadamente el 14 % y una reducción de calidad en un 10 %. El presente trabajo consistió en aislar e identificar hongos fitopatógenos presentes en las semillas de palto (Persea americana Mill.) raza mexicana utilizadas para patrón. A partir del embrión y cotiledón de 200 semillas de palto, se aislo los hongos fotopatogenos en medio de cultivo Papa ...
Volumetry of Genipa americana in homogeneous plantation in Southwest Bahia
Directory of Open Access Journals (Sweden)
Mislene Barbosa Rocha
2015-12-01
Full Text Available This research aim to evaluate the volumetric estimates obtaining for Genipa americana, commonly known as jenipapeiro, in pure plantation in the municipality of Vitória da Conquista, Bahia State, Brazil. To determine individual volume, 100 standing trees were rigorously cubed. Ten volumetric models were adjusted. The best models were selected based on the selection criteria of weighted value of statistical parameters scores and residues distribution. Volume estimates were obtained by form factor and by adjusted equations. To validate the estimates, the calculate volumes were compared to measured data. Among the used methods to predict wood volume, the adjusted volumetric equations are recommended. Spurr (Log model present the best performance to estimate total wood volume.
Evaluation of in vitro antioxidant and anti-inflmmatory activities of Ximenia americana extracts
Directory of Open Access Journals (Sweden)
Arun Kashivishwanath Shettar
2015-11-01
Full Text Available Objective: To evaluate in vitro antioxidant and anti-inflammatory activity of Ximenia americana extracts. Methods: Herbal extraction was done by Soxhlet extraction method with increasing polarity of solvents viz., chloroform, ethyl acetate, methanol, ethanol and water. Phytochemical analysis was done using different biochemical tests. Antioxidant potential of plant extracts were analyzed by ferric ion reducing antioxidant power, phosphomolybdenum and 2,2-diphenyl-1- picrylhydrazyl, and anti-inflammatory activity by using protein denaturation in vitro bioassay. Total phenolic content of each extract was also determined to assess their corresponding effect on antioxidant capacity of plant. Results: Phytochemical analysis showed that each solvent extract contained broad spectrum of secondary metabolites, phenolic compounds, flavonoids, tannins and glycosides, whereas compared to other solvent extracts, chloroform extract showed negative result for phenolic compounds whereas aqueous extract exhibited the highest phenolic content and the significant antioxidant capacity based on the test performed. Out of all extracts, methanol extract showed high anti-inflammatory activity. Conclusions: The present study revealed that different solvent extracts of Ximenia americana leaves contain broad spectrum of bioactive compounds. Results confirm that aqueous extract exhibited high antioxidant activity and methanol extract exhibited high antiinflammatory activity. Further study requires purification, characterization and structural elucidation of phenolic compounds in both extracts that may help in the development of new phytopharmaceuticals.
Czech Academy of Sciences Publication Activity Database
Rudenko, Natalia; Golovchenko, Maryna; Lin, T.; Gao, L.; Grubhoffer, Libor; Oliver, J. H., Jr.
2009-01-01
Roč. 47, č. 12 (2009), s. 3875-3880 ISSN 0095-1137 R&D Projects: GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : multilocus sequence analysis * B. burgdorferi sl complex * new borrelia species * Borrelia americana Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.162, year: 2009
Inverse agonist and neutral antagonist actions of synthetic compounds at an insect 5-HT1 receptor.
Troppmann, B; Balfanz, S; Baumann, A; Blenau, W
2010-04-01
5-Hydroxytryptamine (5-HT) has been shown to control and modulate many physiological and behavioural functions in insects. In this study, we report the cloning and pharmacological properties of a 5-HT(1) receptor of an insect model for neurobiology, physiology and pharmacology. A cDNA encoding for the Periplaneta americana 5-HT(1) receptor was amplified from brain cDNA. The receptor was stably expressed in HEK 293 cells, and the functional and pharmacological properties were determined in cAMP assays. Receptor distribution was investigated by RT-PCR and by immunocytochemistry using an affinity-purified polyclonal antiserum. The P. americana 5-HT(1) receptor (Pea5-HT(1)) shares pronounced sequence and functional similarity with mammalian 5-HT(1) receptors. Activation with 5-HT reduced adenylyl cyclase activity in a dose-dependent manner. Pea5-HT(1) was expressed as a constitutively active receptor with methiothepin acting as a neutral antagonist, and WAY 100635 as an inverse agonist. Receptor mRNA was present in various tissues including brain, salivary glands and midgut. Receptor-specific antibodies showed that the native protein was expressed in a glycosylated form in membrane samples of brain and salivary glands. This study marks the first pharmacological identification of an inverse agonist and a neutral antagonist at an insect 5-HT(1) receptor. The results presented here should facilitate further analyses of 5-HT(1) receptors in mediating central and peripheral effects of 5-HT in insects.
Directory of Open Access Journals (Sweden)
Moacyr Eurípedes Medri
1985-11-01
Full Text Available In the present work are presented anatomical differences in leaves situaded in different strata on the same tree ofPersea Americana. Analysis of linear regression and tests of coeficience of correlation demonstrate that in respect tb the relationships of the anatomical parameters studied, there is much interdependence. The histological point of view compares such parameters as number and size of stomata, volume of mesophyll, area of functional xylem, phloem, supportive tissue and epidermic tissue, and on the other han different microclimatic positions, domonstrates that Persea Americana is an extremely plastic species with much adaptability; as plastic as Hevea brasiliensis Muelli. Arg and much more plastic than Bertholletia excelsa Humb. & Benpl.No presente trabalho são apresentadas as diferenças anatômicas em folhas situadas em diferentes estratos de uma mesma árvore de Persea americana MUI, mostrando através de análise de regressão linear, coeficiente de correlação conclusivos a, respeito das relações diretas e significativas no tocante aos parâmetros anatômicos estudados, evidenciando interdependências dos mesmos. Do ponto de vista histológico, onde se tomou como parâmetro o número e tamanho de estômatos e volume do mesófilo, área xilemática útil, floema, tecido mecânico e epidérmico, e de outro lado, condições microclimáticas diferentes, P. americana evidencia ser uma espécie bastante plástica, havendo uma relação direta se correlacionada ao seu amplo comportamento adaptativo, sendo tão plástica quanto Hevea brasiliensis Muell. Arg. (Medri, 1977 e muito mais que Bertholletia excelsa Humb. & Benpl. (Medri, 1978.
EFICÁCIA DA FONOFORESE COM XIMENIA AMERICANA L. NA INFLAMAÇÃO DE TENDÃO DE RATOS
Directory of Open Access Journals (Sweden)
Seânia Santos Leal
Full Text Available RESUMO Introdução: Diversos recursos terapêuticos, como laser e ultrassom isolado, combinados com fármacos e fonoforese têm sido utilizados em casos de inflamação e reparo de tendão, sendo o ultrassom pulsado bastante eficaz em tendinites crônicas. Objetivo: Analisar a eficácia do uso da fonoforese com o extrato etanólico das cascas do caule da Ximenia americana L. na resolução do processo inflamatório crônico em Rattus norvegicus. Métodos: A amostra consistiu em 120 animais para análise da resposta inflamatória, utilizando-se como variáveis edema, força biomecânica, número de fibroblastos e análise histológica. Resultados: Nos 7° e no 14° dia, verificou-se diferença significativa entre o grupo ultrassom com gel do caule de Ximenia americana L. e o grupo ultrassom com placebo (p < 0,05 quanto à redução de edema, aumento da força máxima de ruptura, redução extremamente significativa da deformação máxima (p < 0,001, além de aumento dos fibroblastos. Na análise histológica, houve melhora do processo inflamatório inicial e aceleração do reparo tendíneo, com redução de células inflamatórias e com deposição de colágeno organizado com matriz extracelular densa. Conclusão: O ultrassom pulsado combinado com o gel do caule de Ximenia americana L. é uma forma terapêutica eficaz para a resolução do processo inflamatório crônico.
Historia de la Tripanosomiasis Americana en Colombia
Directory of Open Access Journals (Sweden)
Fernando Serpa Florez
2000-08-01
Full Text Available
La Academia Nacional de Medicina de Colombia rinde homenaje a Carlos Chagas, opónimo médico brasileño, nacido en Oliveira en 1879 y fallecido en Río de Janeiro en 1934, con motivo del nonagésimo aniversario del descubrimiento realizado por él del Trypanosoma cruzi, hazaña científica que bautizó en memoria de su maestro Osvaldo Cruz (1872 – 1917, fundador del Instituto de Manquinhos que hoy lleva el nombre de este sanitarista. (1
Carlos Chagas fue miembro correspondiente de nuestra Corporación, elegido hace ochenta años, durante la presidencia del profesor Miguel Rueda Acosta, lo que hace que celebremos el triunfo de quien, honrosamente, podemos considerar como uno de los nuestros. (2 Chagas encontró en 1909 la relación existente entre la Tripanosomiasis Americana y el agente de esta dolencia descubierto por él, que por ello hoy se llama Enfermedad de Chagas.
La tripanosomiasis americana o enfermedad de Chagas, es una entidad autóctona de nuestro continente que, como tantas otras, en un principio fue una zoonosis (enfermedad de los animales que se transmite al hombre tal cual la hidrofobia o rabia, la fiebre amarilla, la encefalitis equina, el carbón bacteridiano, la enfermedad de Lyme… para citar unas cuantas.
La dolencia se extendió a la especie humana cuando ésta irrumpió en la hábitat del huésped intermedio del mal y se ha hecho cada vez más aparente con el aumento de la población y el desequilibrio ecológico que se presenta con la deforestación.
Recordemos que sus reservorios (es decir los hospederos que le sirven de depósito, son algunos animales domésticos como el perro, el cerdo o el cobayo y peridomésticos y silvestres como las ratas, los murciélagos, los armadillos, monos y zarigüeyas. Al hombre, desde luego, podemos considerarlo como reservorio de esta dolencia. En Colombia los primeros informes científi-cos sobre animales domésticos y silvestres reservorios del Trypanosoma
A Rússia Americana The American Russia
Directory of Open Access Journals (Sweden)
João Marcelo Ehlert Maia
2005-08-01
Full Text Available Este artigo procura analisar interpretações do Brasil assentadas na idéia de que seríamos uma "Rússia Americana". Para tanto, analiso as contribuições de Gilberto Freyre, Otávio Velho e Vicente Licínio Cardoso, e apresento brevemente o caso russo, a partir das obras clássicas de Franco Venturi e Isaiah Berlin. Argumento ao longo do texto que essa percepção de que o Brasil teria uma geografia social "russa" implica a produção de um americanismo específico, que encontra sua maior expressão no pensamento de Vicente Licínio Cardoso e em suas idéias que conjugam fordismo e arielismo.This article seeks to analyse Brazil's interpretations founded on the idea that we would be an "American Russia". in order to do so, I analyse the contributions of Gilberto Freyre, Otávio Velho and Vicente Licínio Cardoso, and I briefly present the russian case, using the works of Franco Venturi and Isaiah Berlin. I suggest that this perception implies the production of an especific type of americanism, wich finds its greater expression on the unusual combination between fordism and arielism made by Vicente Licínio.
Directory of Open Access Journals (Sweden)
Irma Cabrera
2001-01-01
Full Text Available En Puerto Rico se han reportado varios insectos en las guanábanas (Annona muricata L. y los aguacates (Persea americana M, sin embargo los de mayor importancia son el barrenador de la semilla Bephratelloides cubensis (A. y Apate monacha (F. en A. muricata y Pseudacysta persea (F. en P. americana. El objetivo principal de esta investigación fue determinar la incidencia de B. cubensis y A. monacha en seis selecciones de guanábana y en siete variedades de aguacate. De las evaluaciones realizadas en A. muricata, se observó que las selecciones IV-10, VII-14 y VI-1 mostraron la mayor incidencia y la IV-16 mostró la menor incidencia de B. cubensis en relación al número de barrenos por fruta. En cuanto a la incidencia de A. monacha en A. muricata las selecciones IV-16, IV-2, IV-3, VII-14 presentaron la mayor incidencia de barrenos por árbol. En las evaluaciones realizadas en Persea americana se seleccionaron las variedades Ávila, Semil 34, Wilson Popenoe, Pollock, Candelaria, Semil 43 y Butler como las variedades comerciales más sembradas en Puerto Rico. Se observó que la variedad Avila obtuvo el mayor número de huevos, ninfas, hembras y machos de P. persea por hojas comparadas con las demás variedades. Respecto al número de hojas infestadas por árbol se encontró valores significativos (P≤0,01 en la variedad Avila. Resultando tener un 90% de las hojas dañadas. No se observó que las variedades evaluadas tuviese baja o ninguna preferencia a P. Persea
Treherne, J E; Willmer, P G
1975-08-01
An accelerated water-loss was observed in decapitated individuals, no equivalent increase being obtained following severance of the nervous connectives in the neck. Injection of brain and, to a lesser extent, corpus cardiacum extract resulted in a significant reduction in the rate of loss of water from decapitated individuals. The accelerated water-loss observed following decapitation appeared not to result from significant increase in excretory output or loss of water through the spiracles. It is suggested that integumentary transpiration may be affected by a blood-borne factor, or factors, which originate in the brain and corpus cardiacum.
Pistil Starch Reserves at Anthesis Correlate with Final Flower Fate in Avocado (Persea americana)
Alcaraz, Mar?a Librada; Hormaza, Jos? Ignacio; Rodrigo, Javier
2013-01-01
A common observation in different plant species is a massive abscission of flowers and fruitlets even after adequate pollination, but little is known as to the reason for this drop. Previous research has shown the importance of nutritive reserves accumulated in the flower on fertilization success and initial fruit development but direct evidence has been elusive. Avocado (Persea americana) is an extreme case of a species with a very low fruit to flower ratio. In this work, the implications of...
NCBI nr-aa BLAST: CBRC-OPRI-01-0507 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-0507 ref|YP_054491.1| NADH dehydrogenase subunit 4 [Periplaneta fuligi...nosa] dbj|BAD32637.1| NADH dehydrogenase subunit 4 [Periplaneta fuliginosa] YP_054491.1 0.19 34% ...
National Research Council Canada - National Science Library
Bradford, Jeffrey
2001-01-01
Political and media pundits have labeled the current period of post Cold-War world order the Pax Americana, reminiscent of the Pax Romana that occurred from 27 to 180 AD, during the zenith of the Roman Empire...
Consideraciones sobre el cultivo del aguacate Persea Americana Mill. en Atlixco, Puebla
Directory of Open Access Journals (Sweden)
Teresa Reyna Trujillo
1983-01-01
Full Text Available The production of avocado Persea americana Mill in our country has been intensified the last years, particularly in some states such as Michoacán, Puebla, Veracruz and others. Specifically in Puebla, there are some counties "municipios", Atlixco among others, where its exploitation represents an important economical fact. Because of this, it is being pretended to increase the surface occupied with that fruit tree. However, its growth and cultivation, has been exposed to a great number of problems, such as the ecologic ones (inadecuate soils, for example and fitopathologic ones mainly, reasons enough to consider the increase of its growth as inadecuate.
Directory of Open Access Journals (Sweden)
Líllian S.L. Moraes
2001-12-01
hypersensitivity skin tests were performed with puncture for the detection of the following allergens: house dust mite, animals, molds, and cockroaches with positive (histamine and negative controls (physiologic solution. A logistic regression model was used to calculate the odds ratio (OR and 95% confidence intervals (95%CI adjusted for risk factors and for confounding factors. RESULTS: Among the risk factors studied, sex, parents' low level of education, low income, length of the breast feeding period, and passive smoking were not associated with the presence of asthma. The domestic exposure to allergens was similar in both groups except for the higher frequency of pets at the homes of control patients (c²=16.9; P < 0.05. Paternal history of rhinitis was the only association with asthma (OR=3.33; 95%CI: 1.03-11.17; P < 0.05. The asthmatic children presented higher frequency of positive reactions to skin tests than the controls, mainly to house dust mites: Dermatophagoides pteronyssinus (69.5%, Dermatophagoides farinae (59.3% and Blomia tropicalis (59.3%; cockroaches: Periplaneta americana (59.3%, and cat: Felis domesticus (37.3%, with OR between 11.2-21.0; P < 0.05. Eosinophilia and serum levels of total IgE were more elevated in the group of asthmatic children (P < 0.05. The positivity of the specific IgE test for Dermatophagoides pteronyssinus and Blomia tropicalis was higher in the cases than in the controls (P < 0.05. The multivariate analysis showed that sensitization to the allergens produced by cockroaches (OR=9.26; 95%CI: 2.59-33.4, animals (OR=3.93; 95%CI: 1.05-14.67 and house dust mites (OR=3.74; 95%CI: 1.18-11.8 were the most important risk factors for asthma. CONCLUSIONS: The sensitization to indoor allergens, mainly to house dust mites, cockroaches, and cats showed a strong association with asthma in this study.
Sweigart, Andrea L.
2010-01-01
Postzygotic reproductive isolation evolves when hybrid incompatibilities accumulate between diverging populations. Here, I examine the genetic basis of hybrid male sterility between two species of Drosophila, Drosophila virilis and D. americana. From these analyses, I reach several conclusions. First, neither species carries any autosomal dominant hybrid male sterility alleles: reciprocal F1 hybrid males are perfectly fertile. Second, later generation (backcross and F2) hybrid male sterility ...
Paul Strand y las paradojas de la modernidad americana
Directory of Open Access Journals (Sweden)
Vicente Sánchez Biosca
2010-06-01
Full Text Available As contribuições de Strand para o cinema estão estreitamente relacionadas com seus trabalhos fotográficos da época e mesmo com um olhar que, apesar de suas múltiplas diferenças, possui muitos pontos em comum. Se em Manhatta (1920, Strand (em colaboração com Sheeler oferece uma síntese da natureza e da modernidade, em Redes (1934 o que predomina, em contrapartida, é a experiência da arte muralista mexicana e a influência de Eisenstein (em suas andanças por México são os fatores que determinam seus esforços na construção de uma épica dos operários. Mas sem dúvida, o projeto mais ambicioso de Strand (ao mando da produtora Frontier Films foi Native Land, o filme que atendeu às demandas do American Popular Front e as moldou nas palavras dos fundadores da pátria americana.
Directory of Open Access Journals (Sweden)
Somers, Patricia
2009-01-01
Full Text Available Este artigo discute a história das ações afirmativas na educação dos Estados Unidos, da filosofia das ações afirmativas e do mérito do discurso para a educação, bem como reflete sobre a experiência americana. Refere-se, também, ao acesso à Educação Superior de jovens provenientes de classes minoritárias, brasileira e americana, examinado a importância da conexão da educação e da qualidade de vida. Chama atenção, ainda, para as relações que podem ser feitas pela educação brasileira, considerando a experiência americana
Rossi, Fabiana Ribeiro; Universidade Federal de São Carlos – Departamento de Engenharia de Produção; Torkomian, Ana Lúcia Vitale; Universidade Federal de São Carlos – Departamento de Engenharia de Produção
2015-01-01
Desde a década de 80, o Brasil lidera a produção mundial de suco de laranja seguido, desde então, pelos Estados Unidos da América (EUA). Em torno de 90% da produção nacional de suco é exportada, enquanto a produção norte-americana é utilizada basicamente para consumo interno. O presente estudo teve como objetivo comparar a dinâmica de patenteamento das indústrias processadoras de suco de laranja brasileiras e norte-americanas. Para isso, foi feita uma busca por patentes utilizando a base de d...
Li, Xinran; Wang, Zongqing
2015-09-14
Four taxa of beetle cockroaches (Diploptera Saussure, 1864) from South China are described and illustrated, viz., two new species D. elliptica sp. n. and D. naevus sp. n., one new subspecies D. nigrescens guani subsp. n. and one widespread known species D. punctata (Eschscholtz, 1822). The genus and known species from around the world are discussed based on types and other specimens. D. pulchra Anisyutkin, 2007 is now regarded as a junior synonym of D. bicolor Hanitsch, 1925. Whether the populations of D. punctata represent or not different species needs to be studied in the future. A key, a distribution map, and photos of species are provided.
Directory of Open Access Journals (Sweden)
Ermina Pakki
2016-12-01
Full Text Available Ekstrak etanol Bawang dayak (Eleutherine americana (Aubl Merr. diketahui memiliki aktivitas antioksidan yang kuat sehingga berpotensi untuk dikembangkan menjadi sistem penghantaran nanopartikel. Penelitian ini bertujuan untuk mengetahui pengaruh variasi konsentrasi kitosan – tripolifosfat (TPP terhadap karakteristik fisik dari nanopartikel. Ekstrak bawang dayak diformulasi dalam bentuk nanopartikel dengan metode gelasi ionik dengan variasi konsentrasi polimer kitosan : tripolifosfat yaitu 0,5% : 0,5% (F1, 0,75% : 0,5% (F2, dan 1% : 0,5% (F3. Parameter pengujian meliputi penentuan ukuran dan indeks polidispersitas nanopartikel menggunakan particle size analyzer, pengamatan morfologi menggunakan scanning electron microscopy, pengukuran efisiensi penjerapan, dan disolusi in vitro. Hasil penelitian menunjukkan bahwa nanopartikel F1, F2, dan F3 memiliki ukuran masing-masing sebesar 256,30 nm, 376,28 nm dan 419,18 nm dengan distribusi ukuran yang relatif homogen dan efisiensi penjerapan masing-masing sebesar 69,54%, 77,51% dan 79,79%. Pengamatan morfologi dari nanopartikel menunjukkan bentuk partikel yang mendekati spheris (bulat dengan permukaan yang kasar. Profil pelepasan obat dari nanopartikel F1, F2, dan F3 pada jam ke-8 masing-masing sebesar 71,19 % (F1, 74,97% (F2 dan 80,55% (F3. Berdasarkan hasil penelitian yang telah dilakukan, dapat disimpulkan bahwa ekstrak bawang dayak dapat diformulasi dalam ukuran nanopartikel dengan karakteristik fisik yang bervariasi tergantung pada konsentrasi kitosan dan tripolifosfat yang digunakan. Kata Kunci: Bawang dayak (Eleutherine americana (Aubl Merr., antioksidan, nanopartikel, kitosan, tripolifosfat, gelasi ionik. ABSTRACT Bawang dayak (Eleutherine americana (Aubl Merr. ethanol extract had been known to have excellent antioxidant activity that has the potential to be developed into a nanoparticle delivery systems. This study aims to determine the effect of varying concentrations of chitosan
Imagen de América Latina en "La Ilustración Española y Americana", en el siglo XIX
Directory of Open Access Journals (Sweden)
Lic. Vivian Jara
1998-01-01
Full Text Available 'La Ilustración Española y Americana' es, probablemente, la más sobresaliente publicación semanal que se conserva de la época, una de las de mayor tirada y de mayor difusión, tanto en el Viejo como en el Nuevo Continente, y probablemente también una de las de mayor perdurabilidad en el tiempo. Se publicaba en Madrid y era distribuida a todos los países de habla hispana. Para realizar este trabajo la autora trabajó con los ejemplares de La Ilustración Española y Americana desde 1876 y hasta 1881, inclusive, y con los Almanaques de La Ilustración conservados en la Biblioteca de la Universidad de La Laguna. El trabajo consistió en el relevamiento de imágenes de y/o referidas a América Latina. Con tal fin y bajo la dirección y tutoría del profesor Adrián Alemán de Armas, se elaboró una ficha de investigación que condensó los aspectos esenciales de dichas imágenes. Asimismo, se realizaron simultáneamente observaciones acerca de algunos aspectos más sobresalientes, en los artículos referidos a América Latina. Estos son los primeros resultados de dichas observaciones. Por supuesto, aún queda mucho por releer, re-analizar y elaborar. En principio, hemos tratado de determinar, desde una perspectiva cuantitativa, el porcentual de espacio asignado a América Latina, en las páginas de La Ilustración Española y Americana.
M. Schaub; J.M. Skelly; J.W. Zhang; J.A. Ferdinand; J.E. Savage; R.E. Stevenson; D.D. Davis; K.C. Steiner
2005-01-01
The crowns of five canopy dominant black cherry ( Prunus serotina Ehrh.), five white ash ( Fraxinus americana L.), and six red maple ( Acer rubrum L.) trees on naturally differing environmental conditions were accessed with scaffold towers within a mixed hardwood forest stand in central Pennsylvania....
T. N. Wasserman; S. A. Cushman; A. S. Shirk; E. L. Landguth; J. S. Littell
2012-01-01
We utilize empirically derived estimates of landscape resistance to assess current landscape connectivity of American marten (Martes americana) in the northern Rocky Mountains, USA, and project how a warming climate may affect landscape resistance and population connectivity in the future. We evaluate the influences of five potential future temperature scenarios...
Preparation and Identification of Per a 5 as a Novel American Cockroach Allergen
Directory of Open Access Journals (Sweden)
Ji-Fu Wei
2014-01-01
Full Text Available Glutathione S-transferase (GST from various arthropods can elicit allergic reactions. In the present study, Per a 5, a GST, was cloned from American cockroach (CR and expressed in both baculovirus-infected insect cell (iPer a 5 and E. coli expression (bPer a 5 systems. The secondary structures were predicted to be 45.93 and 8.69% of α-helix β-sheets in iPer a 5 and 42.54 and 8.49% of α-helix and β-sheets in bPer a 5, respectively. It is found that 4 out of 16 (25% sera from American CR allergy patients reacted to both bPer a 9 and iPer a 9 as assessed by ELISA and Western blotting analysis, confirming that Per a 5 is not a major allergen of American CR. Induction of upregulated expression of CD63 and CCR3 on passively sensitized human basophils (sera from American CR allergy patients by approximately up to 4.5- and 3.2-fold indicates that iPer a 5 and bPer a 5 are functionally active. Recombinant Per a 5 (rPer a 5 should be a useful tool for studying and understanding the role of Per a 5 in CR allergy.
Thermal effects on growth and respiration rates of the mayfly, Dolania americana (ephemeroptera)
International Nuclear Information System (INIS)
Harvey, R.S.
1975-01-01
The mayfly Dolania Americana, common in the sand of Upper Three Runs Creek, Savannah River Plant, was studied to determine the effects of seasonal changes in temperature on population growth rates and to determine the effects of slight elevations in water temperature on respiration rates of this benthic species. Growth of the population increased with stream temperature until peak emergence of adults in June and July. There was a strong inverse correlation between body weight and respiration rates of immature nymphs. Respiration rates at 2.5, 5, and 10 0 C above ambient creekwater temperatures were not significantly higher than those measured at ambient creekwater temperatures. (auth)
Directory of Open Access Journals (Sweden)
Enrique Ignacio Sánchez-González
2018-02-01
Full Text Available RESUMEN En este estudio se desarrollaron e identificaron etiquetas de secuencias expresadas diferencialmente (ESTs de frutos inmaduros de Persea americana Mill. var. drymifolia del estado de Nuevo León, México. Diez genotipos con frutos de forma y tamaño diferentes fueron seleccionados para generar ESTs por la técnica de despliegue diferencial.Se obtuvieron en total 393 fragmentos diferenciales amplificados, 82 fragmentos diferenciales fueron secuenciados y editados para identificación y comparación en las bases de datos para nucleótidos y proteínas del NCBI. Cuarenta secuencias mostraron similitud significativa con secuencias de ARNm y/o secuencias de proteínas hipotéticas o predichas pertenecientes a P. americana y/o a otros géneros. Algunas secuencias estuvieron relacionadas a enzimas como flavanona-3-hidroxilasa (F3H, lecitina-colesterol aciltransferasa, glutatión-S-transferasamicrosomal y proteína pleiotrópica de resistencia a drogas. Con la información de la composición nucleotídica de las ESTs se podrán diseñar iniciadores para cuantificar niveles de expresión por RT-PCR en tiempo real de los genes, en diferentes etapas fenológicas del fruto y hacer comparaciones entre los genotipos que permitan determinar usos alternos de sus frutos.
International Nuclear Information System (INIS)
Potenza, Marcos Roberto; Gomes, Davinni Habral Passini; Silvestre, Denise de Fatima; Da Silva, Rita de Cassia; Arthur, Valter
2004-01-01
Most of the essential oils have insecticidal activity and are alternatives to plant protection and urban pest control. The gamma radiation has been used to control microorganisms and insects in dehydrate herbs, spices, medicinal plants and other materials. This work aimed to evaluate the effect of irradiated essential oils as contact poison on Stored grain, weevil, Sitophilus zeamais and as stomach poison in cockroach, Blattella germanica. The bioassay with B. germanica demonstrated efficiency between 22.0 and 30.0% and between 30.0 and 42.0% respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation promoted changes in essential oils Eucalyptus citriodora and E. globulus and showed increased effectiveness on B. germanica nymphs besides a significative reduction of repellency. Gamma radiation thus interfered on behavior of some essential oils by increasing or reducing activating or inactivating their efficiency to pest control. (author)
Zhang, Wen-Hui; Chen, Wei; He, Lin-Yan; Wang, Qi; Sheng, Xia-Fang
2015-10-01
Three hundred Mn-resistant endophytic bacteria were isolated from the Mn-hyperaccumulator, Phytolacca americana, grown at different levels of Mn (0, 1, and 10mM) stress. Under no Mn stress, 90%, 92%, and 11% of the bacteria produced indole acetic acid (IAA), siderophore, and 1-aminocyclopropane-1-carboxylate (ACC) deaminase, respectively. Under Mn stress, 68-94%, 91-92%, and 21-81% of the bacteria produced IAA, siderophore, and ACC deaminase, respectively. Greater percentages of ACC deaminase-producing bacteria were found in the Mn-treated P. americana. Furthermore, the ratios of IAA- and siderophore-producing bacteria were significantly higher in the Mn treated plant leaves, while the ratio of ACC deaminase-producing bacteria was significantly higher in the Mn treated-roots. Based on 16S rRNA gene sequence analysis, Mn-resistant bacteria were affiliated with 10 genera. In experiments involving hybrid penisetum grown in soils treated with 0 and 1000mgkg(-1) of Mn, inoculation with strain 1Y31 was found to increase the root (ranging from 6.4% to 18.3%) and above-ground tissue (ranging from 19.3% to 70.2%) mass and total Mn uptake of above-ground tissues (64%) compared to the control. Furthermore, inoculation with strain 1Y31 was found to increase the ratio of IAA-producing bacteria in the rhizosphere and bulk soils of hybrid penisetum grown in Mn-added soils. The results showed the effect of Mn stress on the ratio of the plant growth-promoting factor-producing endophytic bacteria of P. americana and highlighted the potential of endophytic bacterium as an inoculum for enhanced phytoremediation of Mn-polluted soils by hybrid penisetum plants. Copyright © 2015 Elsevier Inc. All rights reserved.
Sixteen black cherry (Prunus serotina, Ehrh.), 10 white ash (Fraxinus americana, L.) and 10 red maple (Acer rubrum, L.) 1-year old seedlings were planted per plot in 1997 on a former nursery bed within 12 open-top chambers and six open plots. Seedlings wer...
Physiological Costs of Repetitive Courtship Displays in Cockroaches Handicap Locomotor Performance
Mowles, Sophie L.; Jepson, Natalie M.
2015-01-01
Courtship displays are typically thought to have evolved via female choice, whereby females select mates based on the characteristics of a display that is expected to honestly reflect some aspect of the male’s quality. Honesty is typically enforced by mechanistic costs and constraints that limit the level at which a display can be performed. It is becoming increasingly apparent that these costs may be energetic costs involved in the production of dynamic, often repetitive displays. A female attending to such a display may thus be assessing the physical fitness of a male as an index of his quality. Such assessment would provide information on his current physical quality as well as his ability to carry out other demanding activities, qualities with which a choosy female should want to provision her offspring. In the current study we use courtship interactions in the Cuban burrowing cockroach, Byrsotria fumigata to directly test whether courtship is associated with a signaler’s performance capacity. Males that had produced courtship displays achieved significantly lower speeds and distances in locomotor trials than non-courting control males. We also found that females mated more readily with males that produced a more vigorous display. Thus, males of this species have developed a strategy where they produce a demanding courtship display, while females choose males based on their ability to produce this display. Courtship displays in many taxa often involve dynamic repetitive actions and as such, signals of stamina in courtship may be more widespread than previously thought. PMID:26606147
Distribution of 137Cs in the American Coot (Fulica americana)
International Nuclear Information System (INIS)
Potter, C.M.; Brisbin, I.L. Jr.; McDowell, S.G.; Whicker, F.W.
1989-01-01
Caesium-137 concentrations were determined for major tissue and organ components of Americal Coots (Fulica americana) wintering on two contaminated reactor cooling reservoirs on the US Department of Energy's Savannah River Plant. Concentrations reflected the relative contamination levels of the two reservoirs. A low ratio of 137 Cs in gut contents to that in muscle indicated that the coots used in the study were established winter residents and tissue 137 Cs had probably reached equilibrium with intake. The contributions of each component to the whole body weight and total 137 Cs body burden were calculated. Skeletal muscle exhibited the highest 137 Cs concentrations and comprised 35% of the total 137 Cs body burden. Gut contents represented 17% of the total body burden. Various other organs were intermediate and bone exhibited the lowest 137 Cs concentrations. Linear regressions were determined for 137 Cs concentrations in skeletal muscle, liver, kidney, gastrointestinal (GI) tract tissue and gut contents, as functions of whole-body concentrations. (author)
Otaigbe, J.O.E; Oriji, O.G; Ekerenam, G.E
2016-01-01
Avocado(Persea Americana) and African Pear (Dacryodes edulis) seed oils were investigated for their suitability as base materials for oil paint production. Soxhlet extraction of the oils from the powdered seeds using n-hexane gave 3.63% and 10.40% yields for Avocado and African Pear respectively. Proximate analysis and chemical characterization of the seed oils were carried out using standard procedures according to the American Oil Chemist Society (AOCS) and the American Society for Testing ...
Directory of Open Access Journals (Sweden)
Wilson Mayrink
2006-02-01
Full Text Available The first choice of treatment for American cutaneous leishmaniasis is the pentavalent antimonial drug. Although it has been shown that this treatment is mostly effective and indicated, some disadvantages should be taken into account such as side effects, long term treatment inconveniences and counter-indication for patients suffering from cardiopathy, nephropathy; yet, aging, pregnancy and other conditions. With the advent of the vaccine anti-American cutaneous leishmaniasis as a prophylactic measure, studies on therapy using the vaccine associated or not with other drugs have been performed by many investigators and it is currently among the alternative treatments and prevention measures for American cutaneous leishmaniasis. In conclusion, the association between antimony and vaccine (immunochemotherapy showed the same cure rate when compared with the standard treatment (100% and it was also able to reduce the salt volume in 17.9% and treatment length from 87 to 62 days, decreasing side effects.O tratamento de primeira escolha para leishmaniose tegumentar americana é o antimonial pentavalente. Embora este tratamento seja na maioria das vezes efetivo e indicado, devem ser consideradas as desvantagens tais como efeitos colaterais, longa duração do tratamento e contra-indicação para cardiopatas, nefropatas, idosos, grávidas e outras condições. Com o advento da vacina antileishmaniose tegumentar americana para fins profiláticos e terapêuticos, associando-a ou não a outros fármacos, muitas pesquisas têm sido desenvolvidas, sendo a vacina a principal entre os atuais recursos no tratamento e prevenção da leishmaniose tegumentar americana. Em conclusão, a associação do antimônio com a vacina (imunoquimioterapia apresentou o mesmo índice de cura em relação ao tratamento padrão (100%, e ainda reduziu o volume do sal em 17,9% e o tempo de cura significativamente, de 87 para 62 dias; conseqüentemente, reduzindo os efeitos colaterais.
Effects of ripening on rheological properties of avocado pulp (Persea americana mill. Cv. Hass)
Osorio, F.; Roman, A.; Ortiz, J.
2015-04-01
Avocado (Persea americana Mill) Hass variety is the most planted in Chile with a greater trade prospect. The aim of this study was to investigate the effect of maturity on rheological properties of Chilean Avocado Hass pulp. Fresh unripe avocados were washed and peeled, cut and stored at 3 different times; a portion was treated at 5°C and the other was treated at 20°C until it reached 2 lb puncture pressure. During maturation changes would develop due to temperature and time, with internal cellular structure changes. Preliminary results of the rheological characteristics of avocado puree show a Bingham plastic behavior.
Directory of Open Access Journals (Sweden)
Pierluigi Chiassoni
2010-03-01
Full Text Available A review of Thomas Jefferson, I dilemmi della democrazia americana, translated and edited by Alberto Giordano, with a preface by Dino Cofrancesco (Novi Ligure: Città del Silenzio, 2007
Diversity and genetic structure of jenipapo (Genipa americana L. Brazilian accessions
Directory of Open Access Journals (Sweden)
Ana Veruska Cruz da Silva
2014-10-01
Full Text Available Usually known as jenipapo, Genipa americana L. is a Rubiaceae Brazilian native species. It is an important species in the restoration of Brazilian riparian forests and is one of the most promising fruit trees for sustainable harvesting programs. In this study we provide the first data on the genetic diversity and structure of a Jenipapo Germplasm Bank using inter simple sequence repeat (ISSR markers. We evaluated 160 accessions from wild populations, and the data generated from 12 ISSR primers were used to determine genetic variability via a model-based Bayesian procedure (Structure and molecular variance analysis. In addition, Shannon index, genetic diversity and Jaccard coefficients were estimated. A total of 12 primers were used, which generated 123 polymorphic fragments. Four groups were formed from the analysis of the fragments, and the CR1-2 genotype was isolated, being more divergent than the other genotypes.
Morfologia das células do sangue periférico em emas (Rhea americana
Directory of Open Access Journals (Sweden)
Eunice Anita de Moura Fortes
2009-06-01
Full Text Available The rhea (Rhea americana is a South American bird of the ratite group and of the Rheiformes order. It has been exploited for economical purposes, as cattle alternative in European and South American countries. In Brazil, the State of Rio Grande do Sul is outstanding, in rhea rearing and it is in the process of implantation in the Country Northeasty Region. This work aims to describe the morphology of the blood cells in rheas. In this work ten rheas were used, regardless age and sex. Two ml of peripheral blood were collected by puncture of the brachial vein with disposable syringe. The samples here partially used to make extensions with Leishman stain. Seven types of nucleate cells have been observed through morphologic analysis on the light microscope. The erythrocyte revealed an elliptical form, with condensed nucleus of elliptical form; acidophilic cytoplasm. The thrombocyte revealed an elliptical form, with nucleus located in one of the polar regions; pale cytoplasm. As to the round-shaped leukocytes, within the granulocytes, the heterophils presented excentric, condensed, and lobulated nucleus; cytoplasm rich in fusiform salmon-colored granules. The eosinophils distinguish from the heterophils due to the round eosinophilic granules. The basophils stand out from the other granulocytes due to its large and central nucleus with round specific cytoplasmic and highly basophilic granules. Within the agranulocytes, the monocytes presented reniform nucleus, which is frequently central, with slack chromatin, with small areas of condensation; cytoplasm lightly basophilic and with vacuoles. The lymphocytes presented varies forms and sizes; large nucleus with slack chromatin with some nucleoli; scarce and basophilic cytoplasm. The cells of the peripheral blood of Rhea americana present on the light microscope morphology similar to the other birds which have already been studied.
CARACTERIZAÇÃO QUÍMICA E FÍSICA DO JENIPAPO (Genipa americana L. ARMAZENADO
Directory of Open Access Journals (Sweden)
A. P. da SILVA
1998-01-01
Full Text Available As características do jenipapo (Genipa americana L. produzido na região de Botucatu-SP, bem como sua conservação pós-colheita foram estudados quando armazenado sob temperatura ambiente e sob refrigeração (10ºC. Os frutos foram avaliados a cada 7 dias quanto à perda de peso, diâmetro, vitamina C, sólidos solúveis totais, acidez total titulável, pH e firmeza. Ao final do período de armazenamento (28 dias de conservação, os resultados mostraram que a temperatura de 10ºC foi adequada para a conservação do jenipapo e, que as características químicas e físicas dos frutos produzidos na região de Botucatu, são comparativamente semelhantes aos produzidos em outras regiões produtoras, com exceção do teor de sólidos solúveis totais que estão abaixo dos relatados.To study the chemical and physical characteristics of jenipap (Genipa americana L. produced in the Botucatu-SP region, and its post-harvest conservation fruits, were studied when stored at ambient temperature and under refrigeration. The fruits were evaluated every 7 days for weight loss, diameter, vitamin C, total soluble solids, titratable acidity, pH and texture (flesh firmness. At the end of the 4th week of storage the results showed that the temperature of 10ºC was adequate for the conservation of jenipap, and that the chemical and physical characteristcs of the fruits produced in the Botucatu-SP region are similar to those produced in the other regions, except for total soluble solids, which was lower.
A Revista Ibero-Americana De Estratégia Em 2016 E 2017
Directory of Open Access Journals (Sweden)
Fernando Antonio Ribeiro Serra
2018-04-01
Full Text Available Nestes últimos dois anos a Revista Ibero-Americana de Estratégia (RIAE – Iberoamerican Journal of Strategic Management (IJSM tem procurado aprimorar e consolidar as mudanças realizadas desde 2014. Este movimento não poderia acontecer sem que os autores, a quem agradecemos, apesar das diversas alternativas de periódicos onde submeter os seus trabalhos, tenham escolhido a RIAE/IJSM. Também não seria possível sem o esforço e dedicação dos revisores. Agradecemos aos nossos revisores, não só pela dedicação, mas pelo esforço que têm feito em melhorar a qualidade das revisões e apontar possibilidades de melhoria, mesmo para os artigos que por ventura não sejam aceitos.
List, Olivier; Calas-List, Delphine; Taillebois, Emiliane; Juchaux, Marjorie; Heuland, Emilie; Thany, Steeve H
2014-08-01
Cellular responses to Ca(2+) require intermediary proteins such as calcium/calmodulin-dependent protein kinase II (CaMKII), which transduces the signal into downstream effects. We recently demonstrated that the cockroach genome encodes five different CaMKII isoforms, and only PaCaMKII-E isoform is specifically expressed in the dorsal unpaired median neurosecretory cells. In the present study, using antisense oligonucleotides, we demonstrated that PaCaMKII-E isoform inhibition reduced nicotine-induced currents through α-bungarotoxin-sensitive and -insensitive nicotinic acetylcholine receptor subtypes. Specifically, PaCaMKII-E isoform is sufficient to repress nicotinic current amplitudes as a result of its depression by antisense oligonucleotides. Similar results were found using the neonicotinoid insecticide clothianidin, which acted as a full agonist of dorsal unpaired median neuron nicotinic acetylcholine receptors. Clothianidin current amplitudes are strongly reduced under bath application of PaCaMKII-E antisense oligonucleotides but no significant results are found with α-bungarotoxin co-applied, demonstrating that CaMKII-E isoform affects nicotine currents through α-bungarotoxin-sensitive and -insensitive receptor subtypes whereas clothianidin currents are reduced via α-bungarotoxin-insensitive receptors. In addition, we found that intracellular calcium increase induced by nicotine and clothianidin were reduced by PaCaMKII-E antisense oligonucleotides, demonstrating that intracellular calcium increase induced by nicotine and clothianidin are affected by PaCaMKII-E inhibition. Cellular responses to Ca(2+) require intermediary proteins such as calcium/calmodulin-dependent protein kinase II (CaMKII). We recently demonstrated that the cockroach genome encodes five different CaMKII isoforms and only PaCaMKII-E isoform was specifically expressed in the dorsal unpaired median neurosecretory cells. Here we show that specific inhibition of PaCaMKII-E isoform is
Tratamento da leishmaniose tegumentar americana pelo niridazol
Directory of Open Access Journals (Sweden)
Miroslau Constante Baranski
1970-08-01
Full Text Available Foi empregue o niridazol um derivado do nitrotiazol, em doze pacientes com leishmaniose tegumentar americana. Em todos êles, o diagnóstico clínico da doença foi confirmado pela biópsia das lesões e em oito dêles também pela positividade da intradetermorreação de Montenegro. Oito pacientes tinham lesões mucosas metastáticas em atividade e lesões cutâneas iniciais cicatrizadas há tempo mais ou menos longo. Dois apresentavam concomitância de lesões cutâneas e mucosas em atividade, e dois tinham lesões cutâneas exclusivas. A duração da doença variou de 2 meses a 32 anos. A posologia diária do niridazol foi uniformememente de 25 mg/kg de pêso corpóreo. O medicamento foi administrado por via oral, em duas tomadas diárias, sempre com o doente internado em hospital. Quando a tolerância o permitia, o paciente recebia cinco séries de tratamento de 10 dias de duração cada, intercaladas por períodos áe suspensão da droga de 10 dias entre uma série e outra. Isso foi possível em 10 dos 12 pacientes. O tratamento foi bem tolerado em 5 doentes e de tolerância regular em 4. Mal tolerado em um paciente pela ocorrência de alucinações e excitação mental e interrompido pela péssima tolerância em dois doentes devido ao aparecimento de convulsões generalizadas com perda da consciência. O tratamento acompanhou-se de grande incidência, de efeitos colaterais. A ocorrência de para-efeitos mais intensos não foi devida às más condições hepáticas. Provas de função hepática. hemogramas, estudos bioquímicos do sangue e exames de urina, realizados antes, durante e após o tratamento, não revelaram alterações significativas. Biópsias hepáticas por punção com agulha em dez doentes, prévias e posteriores ao tratamento, não detectaram lesões hepáticas que pudessem ser atribuídas à medicação. O seguimento dos doentes prolongou-se pelo prazo de dois a 36 meses apos o tratamento. Alterações eletrocardiogr
Food habits of stunted and non-stunted white perch (Morone americana)
Gosch, N.J.C.; Stittie, J.R.; Pope, K.L.
2010-01-01
We studied food habits of white perch (Morone americana) from two populations with different stable states (stunted [Branched Oak Lake, Nebraska] and nonstunted [Pawnee Lake, Nebraska]) to determine if change in food habits of white perch is likely to occur in situations where a stunted white perch population is altered to a nonstunted state and vice versa. Three approaches were used to quantitatively describe seasonal (spring = March-May, summer = June-August, autumn = September-November) diets of white perch - 1) frequency of occurrence, 2) percentage of composition by volume, and 3) mean stomach fullness. White perch diets were dominated by cladocerans and dipterans in both reservoirs during all seasons. Fish egg predation was similar between reservoirs, and white perch rarely consumed fishes in either the stunted or the non-stunted population. Shifting a white perch population between stunted and non-stunted states will likely cause little or no change in food habits; fish in both states will primarily consume invertebrates.
International Nuclear Information System (INIS)
Tang, Shirong; Liao, Shangqiang; Guo, Junkang; Song, Zhengguo; Wang, Ruigang; Zhou, Xiaomin
2011-01-01
Highlights: ► Elevated CO 2 and microbial inoculation, alone or in combination, significantly promoted growth of P. americana, and A. cruentus. ► Total tissue Cs in plants was significantly increased. ► A. cruentus had higher tissue Cs concentration, Cs transfer factors and concentration ratios than P. americana. ► The two plants had slightly different contents of antioxidant enzymes. ► Combined effects of elevated CO 2 and microbial inoculation can be explored for CO 2 - and microbe-assisted phytoextraction technology. - Abstract: Growth and cesium uptake responses of plants to elevated CO 2 and microbial inoculation, alone or in combination, can be explored for clean-up of contaminated soils, and this induced phytoextraction may be better than the natural process. The present study used open-top chambers to investigate combined effects of Burkholderia sp. D54 inoculation and elevated CO 2 (860 μL L −1 ) on growth and Cs uptake by Phytolacca americana and Amaranthus cruentus grown on soil spiked with various levels of Cs (0–1000 mg kg −1 ). Elevated CO 2 and bacterial inoculation, alone or in combination, significantly increased biomass production with increased magnitude, ranging from 22% to 139% for P. americana, and 14% to 254% for A. cruentus. Total tissue Cs in both plants was significantly greater for bacterial inoculation treatment singly, and combined treatments of bacterial inoculation and elevated CO 2 than for the control treatment in most cases. Regardless of CO 2 concentrations and bacterial inoculation, A. cruentus had higher tissue Cs concentration, Cs transfer factors and concentration ratios than P. americana, but they had slightly different contents of antioxidant enzymes. It is concluded that combined effects of elevated CO 2 and microbial inoculation with regard to plant ability to grow and remove radionuclides from soil can be explored for CO 2 - and microbe-assisted phytoextraction technology.
Apios (Apios americana; “apios”), a tuberous perennial legume in the Phaseoleae tribe, was widely used as a food by Native Americans. Work in the last 40 years has led to several improved breeding lines. Aspects of the pollination biology (complex floral structure and tripping mechanism) have made c...
Biodiversidad antropoentomofágica de la región de Zongolica, Veracruz, México
Directory of Open Access Journals (Sweden)
Julieta Ramos-Elorduy
2008-03-01
"protoculture" of three species, one cockroach (Periplaneta australasiae Fabricius and two moths (Latebraria amphipyroides Guenée and Arsenura armida armida Cramer. In Zongolica, anthropoentomophagy is an ancestral habit. Rev. Biol. Trop. 56 (1: 303-316. Epub 2008 March 31
Directory of Open Access Journals (Sweden)
Nurdia Asdar
2014-07-01
Full Text Available Identification of metabolite compound in acetone Extract from Fruits Avocado seed (Percea americana Mill and toxicity test against Artemia salina Leach. Aim of this research is to identify the secondary metabolite compound in aceton extract from fruits Avocado seed (Percea americana Mill and to determine the potential of secondary metabolites from an avocado extract as anticancer. The compound was obtained from Identification process in several stages, namely extraction, fractination, purification and identification. The identification process was color test, TLC, spectroscopy IR. The toxicity test by Brine Shrimp Lethality Test (BSLT to Artemia salina Leach. The compound obtained from this research was yellow-white crystalline needle-shaped, the purity test with TLC analysis showed a stain in three eluen system on the stain test on three eluent systems with Rf proportions as follows; 0,15 from chloroform:ethyl acetat (6:4, 0,33 from methanol:chloroform (1:9, 0,75 for acetone:ethyl acetat, and positively to the reagent Wagner and gave brown precipitate for indicate as alcaloid group. This result is supported by spectroscopy from compound.While toxicity tests showed condensed acetone extracts and pure compounds are toxic with LC50 value of each is 20.61 mg/mL and 39,81 mg/mL.
As bibliotecas nacionais latino americanas e o capital social
Directory of Open Access Journals (Sweden)
Deborah Medeiros
2017-01-01
Full Text Available Resumo Estudo que pretende analisar o uso da web social nos serviços das bibliotecas nacionais latino americanas e as formas de fomentar Capital Social em sua comunidade. Buscou-se verificar quais mídias sociais as bibliotecas nacionais usam, avaliando como adaptam aos serviços das bibliotecas e como as utilizam para fomentar o Capital Social, adotando-se para isso a teoria do fator whuffie. Utilizou-se a coleta e mapeamento de mídias sociais e observação não participante para a análise dos websites das Bibliotecas Nacionais analisadas. Como resultado, a pesquisa constatou que as Bibliotecas Nacionais em sua grande maioria utilizam seus sites e bibliotecas digitais para oferecer serviços e fomentar Capital Social entre seus interagentes. Por fim, conclui-se que as bibliotecas analisadas ainda utilizam suas mídias sociais na internet para fins administrativos e de divulgação, e observa-se que, através de algumas práticas identificadas nas bibliotecas analisadas nesta pesquisa, as demais bibliotecas podem buscar novas formas e possibilidades de interação dos seus serviços com seus interagentes por meio dessas mídias e de seus websites.
Directory of Open Access Journals (Sweden)
D. Jesus
2015-01-01
Full Text Available This study evaluated the antifungal activity of Persea americana extract on Candida albicans biofilm and its cytotoxicity in macrophage culture (RAW 264.7. To determine the minimum inhibitory concentration (MIC, microdilution in broth (CLSI M27-S4 protocol was performed. Thereafter, the concentrations of 12.5, 25, 50, 100, and 200 mg/mL (n=10 with 5 min exposure were analyzed on mature biofilm in microplate wells for 48 h. Saline was used as control (n=10. After treatment, biofilm cells were scraped off and dilutions were plated on Sabouraud dextrose agar. After incubation (37°C/48 h, the values of colony forming units per milliliter (CFU/mL were converted to log10 and analyzed (ANOVA and Tukey test, 5%. The cytotoxicity of the P. americana extract was evaluated on macrophages by MTT assay. The MIC of the extract was 6.25 mg/mL and with 12.5 mg/mL there was elimination of 100% of planktonic cultures. Regarding the biofilms, a significant reduction (P<0.001 of the biofilm at concentrations of 50 (0.580±0.209 log10, 100 (0.998±0.508 log10, and 200 mg/mL (1.093±0.462 log10 was observed. The concentrations of 200 and 100 mg/mL were cytotoxic for macrophages, while the concentrations of 50, 25, and 12.5 mg/mL showed viability higher than 55%.
Políticas e poéticas feministas : imagens em movimento sob a ótica de mulheres latino-americanas
Maria Célia Orlato Selem
2013-01-01
Resumo: A presente pesquisa busca identificar poéticas feministas no cinema de mulheres latino-americanas neste século XXI. Nesse intuito, foram selecionados os seguintes filmes: La teta asustada, de Claudia Llosa (Peru - 2009); Que tan lejos, de Tania Hermida (Equador - 2006); Rompecabezas, Natalia Smirnoff (Argentina, 2009); Entre nós, de Paola Mendoza e Gloria La Morte (Colômbia, 2009); Sonhos Roubados, de Sandra Werneck (Brasil, 2009); En la puta vida, de Beatriz Flores Silva (Uruguai, 20...
Directory of Open Access Journals (Sweden)
Natalie G. Schimpf
2012-09-01
Metabolic rate varies significantly between individuals, and these differences persist even when the wide range of biotic and abiotic factors that influence metabolism are accounted for. It is important to understand the life history implications of variation in metabolic rate, but they remain poorly characterised despite a growing body of work examining relationships between metabolism and a range of traits. In the present study we used laboratory-bred families (one sire to three dams of Nauphoeta cinerea (Olivier (speckled cockroaches to examine the relationship between standard metabolic rate (SMR and reproductive performance (number of offspring and gestation duration. We show that SMR is negatively associated with female gestation duration. Age at mating is negatively associated with gestation duration for females, and mass is negatively associated with the average gestation duration of the females a male was mated with. In addition to the results in the current literature, the results from the present study suggest that the association between metabolism and life history is more complex than simple relationships between metabolism and various fitness traits. Future work should consider longitudinal, ontogenetic as well as selective and quantitative genetic breeding approaches to fully examine the associations between metabolism and fitness.
Directory of Open Access Journals (Sweden)
V. Benavides
2014-06-01
Full Text Available The growing interest in natural medicine makes it necessary to study plant properties as well as their possible secondary effects. In recent years the toxic effects of many medicinal plants on the preimplantational mouse embryo development have been studied. Many of them produce malformations and alterations in the embryonic development. Ruta graveolens "ruda", Origanum vulgare "oregano" and Persea americana "palta" are used in rural areas to menstrual colic and to provoke abortion (estrella, 1995. This study is aimed at assessing "in vivd'the effect of extracts of "oregano", "ruda" and "palta" to 20% on the morphology and growth of preimplantational mouse embryos.
Balvín Calderón, Eduardo Simeón
2016-01-01
Universidad Nacional Agraria La Molina. Escuela de Posgrado. Maestría en Agronegocios La presente investigación denominada “Competitividad de la oferta exportable de la palta Hass (Persea americana) en el Mercado de Estados Unidos”, se realizó en el departamento de Lima e Ica, durante el periodo del 2004 al 2014. El propósito de la investigación fue realizar el análisis la oferta exportable, además se analizó las características del mercado de Estados Unidos de América y el nivel de compet...
Directory of Open Access Journals (Sweden)
D. Martins
2011-03-01
Full Text Available O objetivo deste estudo foi determinar a frequência relativa e o nível de infestação de cada espécie da flora aquática presente no reservatório de Salto Grande, Americana-SP. O levantamento e a identificação das plantas aquáticas foram realizados percorrendo-se as margens do reservatório em uma embarcação. Ao longo dele foram estabelecidos 20 pontos de avaliação, sendo todos eles fotografados e georreferenciados. Foram atribuídos valores de 0 a 100% tanto para as espécies presentes como para os espaços livres de macrófitas aquáticas que eventualmente pudessem ocorrer dentro dos pontos amostrados. Com os dados referentes ao número de indivíduos e pontos avaliados, foi determinada a frequência relativa de cada espécie. Foram identificadas 13 espécies em todo o reservatório, sendo 12 vasculares e uma de alga-verde (Chlorella spp.. Entre as espécies vasculares, nove eram plantas emersas flutuantes, as quais poderiam estar ou não ancoradas no leito do reservatório: Alternanthera philoxeroides, Brachiaria subquadripara, Cyperus difformis, Echinochloa polystachia var. spectabilis, Eichhornia crassipes, Panicum rivulare, Pistia stratiotes, Salvinia auriculata e Typha angustifolia. Outras três espécies foram encontradas somente em solo firme alagado: Aeschynomene sensitiva, Hedychium coronarium e Mimosa pigra.The objectives of this work were to determine the relative frequency and infestation level of each species present in the Salto Grande Reservoir in Americana-SP. The survey and identification of the aquatic plants were carried out in the Salto Grande reservoir on a boat. Twenty evaluation sites were established along the reservoir, photographed and geo-referenced. Values from 0 to 100% were assigned for both the species present and for the aquatic plants that could possibly occur within the sampled sites. Based on the number of individuals and points evaluated, the relative frequency of each species was determined
Subcellular distribution and chemical forms of cadmium in Phytolacca americana L
Energy Technology Data Exchange (ETDEWEB)
Fu Xiaoping; Dou Changming [Ministry of Agriculture Key Laboratory of Non-point Source Pollution Control, Institute of Environmental Science and Technology, Zhejiang University, Hangzhou 310029 (China); Chen Yingxu, E-mail: yingxu_chen@hotmail.com [Ministry of Agriculture Key Laboratory of Non-point Source Pollution Control, Institute of Environmental Science and Technology, Zhejiang University, Hangzhou 310029 (China); Chen Xincai; Shi Jiyan; Yu Mingge; Xu Jie [Ministry of Agriculture Key Laboratory of Non-point Source Pollution Control, Institute of Environmental Science and Technology, Zhejiang University, Hangzhou 310029 (China)
2011-02-15
Phytolacca americana L. (pokeweed) is a promising species for Cd phytoextraction with large biomass and fast growth rate. To further understand the mechanisms involved in Cd tolerance and detoxification, the present study investigated subcellular distribution and chemical forms of Cd in pokeweed. Subcellular fractionation of Cd-containing tissues indicated that both in root and leaves, the majority of the element was located in soluble fraction and cell walls. Meanwhile, Cd taken up by pokeweed existed in different chemical forms. Results showed that the greatest amount of Cd was found in the extraction of 80% ethanol in roots, followed by 1 M NaCl, d-H{sub 2}O and 2% HAc, while in leaves and stems, most of the Cd was extracted by 1 M NaCl, and the subdominant amount of Cd was extracted by 80% ethanol. It could be suggested that Cd compartmentation with organo-ligands in vacuole or integrated with pectates and proteins in cell wall might be responsible for the adaptation of pokeweed to Cd stress.
Directory of Open Access Journals (Sweden)
Marisa Furtado Mozini Cardim
2013-08-01
Full Text Available OBJETIVO : Analisar a expansão da ocorrência de leishmaniose visceral americana em humanos e identificar localidades prioritárias para o desenvolvimento de ações de vigilância e controle. MÉTODOS : A área de estudo constituiu-se dos 316 municípios do estado de São Paulo pertencentes às cinco regiões de saúde com ocorrência da leishmaniose visceral americana em humanos, utilizando os casos autóctones e óbitos, com ano de notificação e município de ocorrência. Calcularam-se taxas de incidência e de mortalidade e letalidade por município, por região e para a área de estudo. Utilizaram-se o estimador bayesiano empírico para obtenção de taxas de incidência e de mortalidade bayesianas locais para cada município e a krigagem para visualização da distribuição espacial das temperaturas e das precipitações pluviométricas. RESULTADOS : Foram detectados 73 municípios com transmissão da doença. As primeiras ocorrências deram-se em áreas com maiores temperaturas e menores pluviosidades, mas sua disseminação também ocorreu em áreas menos quentes e mais úmidas. A expansão da leishmaniose visceral americana em humanos apresentou um eixo principal de disseminação no sentido noroeste para sudeste, acompanhando a rodovia Marechal Rondon e o gasoduto Bolívia-Brasil, e um eixo secundário, na direção norte-sul, acompanhando a malha rodoviária. As taxas de incidência, segundo regiões de saúde, apresentaram um pico seguido de queda, com exceção da região de São José do Rio Preto. Observou-se maior concentração de municípios com altas taxas de incidência e mortalidade nas regiões de saúde de Araçatuba, Presidente Prudente e Marília. CONCLUSÕES : Possíveis fatores determinantes da expansão da doença incluíram a rodovia Marechal Rondon e a construção do gasoduto Bolívia-Brasil. Fatores climáticos pareceram não ter papel determinante nessa expansão. O uso de técnicas de análise espacial
Kenawy, Mohamed A; Amer, Hanan S; Lotfy, Nadia M; Khamis, Nagwa; Abdel-Hamid, Yousrya M
2014-12-01
A study was planned to examine the insect fauna associated with two hospitals: urban (A) in Cairo and rural (B) in Banha, Egypt with varying hygienic levels and their adjacent residential areas (AC) and (BC), respectively and to investigate the effect of hygienic level on species composition and relative abundance. A total of 22 species belonging to 7 orders and 15 families were reported in the four study areas of which, Dipterous flies were the most common (8/22, 36.36% species). A total of 5257 adults were collected of which Dipterous flies were the abundant (3800, 72.28% insect) and Musca domestica was the most abundant species (3535, 67.24% insect) which was present in all areas where it was more common / predominant species (21.94%-90.91% insect). Moreover, higher densities of M domestica were in (B) and BC than in (A) or (AC). The heavily infested area was AC (54.55% species) followed by (A), (BC) and (B) however, the total number of the collected insects was higher in (BC) and (B) than in (AC) and (A). This was confirmed by finding maximum diversity indices in (AC) and minimum ones in B. In all areas, means of M domestica was more common during summer/autumn and spring than in the winter. Periplaneta americana collected oily during autumn in AC and was more common in autumn in (BC) while Blatella germanica collected only during summer in (AC) and was more common in autumn in (B). The prevalence and higher abundance of the medically important species mainly M domestica, P. americana and B. germanica in rural hospital than in urban one attribute mainly to the lower hygienic level of rural hospital This require a control program based mainly on sanitation supplemented by other measures to overcome the risk of disease transmission by such insects
Directory of Open Access Journals (Sweden)
Benjamín Mera
1942-08-01
Full Text Available Una sinopsis de los hechos más notables presentados a la Asociación Médica Americana como fruto del trabajo de investigadores de diversas partes del Hemisferio Occidental, reviste la mayor importancia para la información de los profesionales colombianos. Datos generales, y en lo posible lo más concisos, se dan en este resumen sobre trabajos personalmente seleccionados de Medicina General, Patología, Fisiología, Medicina Tropical e Higiene Pública, los cuales fueron presentados o exhibidos ante los 8.103 médicos que asistieron a la Convención médica más importante de los tiempos actuales.
Energy Technology Data Exchange (ETDEWEB)
Tang, Shirong, E-mail: tangshir@hotmail.com [Centre for Research in Ecotoxicology and Environmental Remediation, Agro-Environmental Protection Institute, Ministry of Agriculture, Tianjin 300191 (China); Key Laboratory of Production Environment and Agro-product Safety of Ministry of Agriculture, Tianjin (China); Liao, Shangqiang; Guo, Junkang; Song, Zhengguo; Wang, Ruigang [Centre for Research in Ecotoxicology and Environmental Remediation, Agro-Environmental Protection Institute, Ministry of Agriculture, Tianjin 300191 (China); Key Laboratory of Production Environment and Agro-product Safety of Ministry of Agriculture, Tianjin (China); Zhou, Xiaomin [Plant Science Department, McGill University, Macdonald Campus, 21111 Lakeshore Road, Ste. Anne de Bellevue, Quebec, Canada H9X 3V9 (Canada)
2011-12-30
Highlights: Black-Right-Pointing-Pointer Elevated CO{sub 2} and microbial inoculation, alone or in combination, significantly promoted growth of P. americana, and A. cruentus. Black-Right-Pointing-Pointer Total tissue Cs in plants was significantly increased. Black-Right-Pointing-Pointer A. cruentus had higher tissue Cs concentration, Cs transfer factors and concentration ratios than P. americana. Black-Right-Pointing-Pointer The two plants had slightly different contents of antioxidant enzymes. Black-Right-Pointing-Pointer Combined effects of elevated CO{sub 2} and microbial inoculation can be explored for CO{sub 2}- and microbe-assisted phytoextraction technology. - Abstract: Growth and cesium uptake responses of plants to elevated CO{sub 2} and microbial inoculation, alone or in combination, can be explored for clean-up of contaminated soils, and this induced phytoextraction may be better than the natural process. The present study used open-top chambers to investigate combined effects of Burkholderia sp. D54 inoculation and elevated CO{sub 2} (860 {mu}L L{sup -1}) on growth and Cs uptake by Phytolacca americana and Amaranthus cruentus grown on soil spiked with various levels of Cs (0-1000 mg kg{sup -1}). Elevated CO{sub 2} and bacterial inoculation, alone or in combination, significantly increased biomass production with increased magnitude, ranging from 22% to 139% for P. americana, and 14% to 254% for A. cruentus. Total tissue Cs in both plants was significantly greater for bacterial inoculation treatment singly, and combined treatments of bacterial inoculation and elevated CO{sub 2} than for the control treatment in most cases. Regardless of CO{sub 2} concentrations and bacterial inoculation, A. cruentus had higher tissue Cs concentration, Cs transfer factors and concentration ratios than P. americana, but they had slightly different contents of antioxidant enzymes. It is concluded that combined effects of elevated CO{sub 2} and microbial inoculation with
Reunión y escritura femeninas en los contextos de las independencias americanas
Directory of Open Access Journals (Sweden)
Patricia Martínez i Álvarez
2010-10-01
Full Text Available En los ámbitos de las relaciones de género y la representación de la diferencia sexual femenina, las mujeres –en el contexto de los procesos de emancipación y de construcción de los nuevos Estados en América Latina en el siglo XIX– llevaron a cabo proyectos propios de significación, al margen de los proyectos políticos que había en el escenario. El objetivo de la investigación que sustenta el artículo, es dar lectura, a la luz de los sentidos que las mujeres les dieron, a textos y contextos de aquel momento. Se recurre a fragmentos de dos de las obras literarias más importantes de finales del siglo XIX, para afirmar una historia de las mujeres que invita al final de la colonialidad americana.
Reunión y escritura femeninas en los contextos de las independencias americanas
Directory of Open Access Journals (Sweden)
Patricia Martínez i Álvarez
2010-01-01
Full Text Available En los ámbitos de las relaciones de género y la representación de la diferencia sexual femenina, las mujeres en el contexto de los procesos de emancipación y de construcción de los nuevos Estados en América Latina en el siglo XIX llevaron a cabo proyectos propios de significación, al margen de los proyectos políticos que había en el escenario. El objetivo de la investigación que sustenta el artículo, es dar lectura, a la luz de los sentidos que las mujeres les dieron, a textos y contextos de aquel momento. Se recurre a fragmentos de dos de las obras literarias más importantes de finales del siglo XIX, para afirmar una historia de las mujeres que invita al final de la colonialidad americana.
Birnbaum, Kenneth; Desalle, Rob; Peters, Charles M; Benfey, Philip N
2003-11-01
Maintaining crop diversity on farms where cultivars can evolve is a conservation goal, but few tools are available to assess the long-term maintenance of genetic diversity on farms. One important issue for on-farm conservation is gene flow from crops with a narrow genetic base into related populations that are genetically diverse. In a case study of avocado (Persea americana var. americana) in one of its centers of diversity (San Jerónimo, Costa Rica), we used 10 DNA microsatellite markers in a parentage analysis to estimate gene flow from commercialized varieties into a traditional crop population. Five commercialized genotypes comprised nearly 40% of orchard trees, but they contributed only about 14.5% of the gametes to the youngest cohort of trees. Although commercialized varieties and the diverse population were often planted on the same farm, planting patterns appeared to keep the two types of trees separated on small scales, possibly explaining the limited gene flow. In a simulation that combined gene flow estimates, crop biology, and graft tree management, loss of allelic diversity was less than 10% over 150 yr, and selection was effective in retaining desirable alleles in the diverse subpopulation. Simulations also showed that, in addition to gene flow, managing the genetic makeup and life history traits of the invasive commercialized varieties could have a significant impact on genetic diversity in the target population. The results support the feasibility of on-farm crop conservation, but simulations also showed that higher levels of gene flow could lead to severe losses of genetic diversity even if farmers continue to plant diverse varieties.
Arriola Guillén, Luis; Sacsaquispe-Contreras, Sonia
2014-01-01
Objetivo: Evaluar el efecto antiinflamatorio de la Ephedra americana HyB en cirugía gingival en cobayos. Materiales y Métodos: Estudio experimental en 32 cobayos: 16 cobayos a los que se les aplicó el extracto etanólico de la planta (grupo experimental) y 16 el grupo control. Se les realizó incisión tipo media luna en la encía inferior, con desprendimient o del colgajo y se suturó; luego se obtuvieron biopsias excisionales a las 48 horas y a los 7 días para evaluación histopatológica del proc...
Buelvas Salgado, Gustavo Andrés; Patiño Gómez, J. H.; Cano Salazar, J. A.
2012-01-01
Introduction. Avocado oil is rich in vitamins A, B, C and E, and is mainly composed by monounsaturated fat acids, which effectively reduce cholesterol levels in blood, thus helping to prevent cardiovascular diseases. Objective. Evaluating the performance of Hass avocado (Persea americana Mill) oil extraction in E3-M (mature) from the East of Antioquia, by the use of commercial enzymatic complexes. Materials and methods. To develop this research work, a physical-chem...
Effect of an admixture from Agave americana on the physical and mechanical properties of plaster
Directory of Open Access Journals (Sweden)
Ochoa, J. C.
2013-03-01
Full Text Available Physical and mechanical properties of a plaster paste added with an organic admixture, of the leaves of Agave americana, were studied. Plastic consistency behavior was evaluated and the water/gypsum(w/g ratio was determined for each dosage of the admixture. Admixtur eeffect on setting was evaluated too. The chemical transformation of the hemihydrated form to gypsum (dihydrated form was studied using a novel technique based on a moisture analyzer by halogen light. Flexural and compressive strengths were measured. The results show that ,for the same consistency, accordingly mechanical strengths were improved too. The setting times were increased which would enhance the application time of plaster and would reduce plastic shrinkage, common problems in this type of material. The changes in these physical properties not substantially affect the final mechanical strengths.
Se estudiaron algunas propiedades físicas y mecánicas de pastas de yeso de construcción adicionadas con un aditivo de origen orgánico, producto de las hojas de la planta Agave americana. Se evaluó el comportamiento plástico de la pasta mediante ensayos de consistencia y se determinó, para cada dosificación, su relación agua/ yeso (a/y. Se evaluó la incidencia del aditivo en los tiempos de fraguado. La transformación química del hemihidrato a yeso dihidrato se estudió mediante una novedosa técnica basada en un analizador de humedad por luz halógena. Se midieron las resistencias mecánicas a flexo-tracción y a compresión. Los resultados del estudio muestran que, para una misma consistencia, se mejoran las resistencias mecánicas. Los tiempos de fraguado de la pasta se aumentaron lo que ayudaría mejorar los tiempos de aplicación del yeso y a disminuir las retracciones plásticas. Las modificaciones de estas propiedades físicas no afectan considerablemente las resistencias mecánicas finales.
Cinética de secagem e difusividade efetiva em folhas de jenipapo (Genipa americana L.
Directory of Open Access Journals (Sweden)
L.A. SILVA
2015-01-01
Full Text Available RESUMO O jenipapo (Genipa americana L. é uma espécie nativa com importância medicinal, sendo amplamente utilizada no Brasil. Em função da necessidade de conhecimento à cerca do pré-processamento desta espécie, este trabalho foi desenvolvido com o objetivo de avaliar a cinética de secagem de folhas de jenipapo (G. americana L., bem como determinar a difusividade efetiva da água durante o processo. As folhas foram coletadas com teor de água inicial de 2,30±0,05 (decimal b.s., e submetidas à secagem em três condições de temperatura do ar (35,3; 46,0 e 65,0°C até atingirem o teor de água de equilíbrio. Aos dados experimentais, ajustaram-se doze modelos matemáticos, recomendados para representar o processo de secagem de produtos agrícolas. As magnitudes do coeficiente de determinação (R2, do erro médio relativo (P, do erro médio estimado (SE e do teste do qui-quadrado (χ2, foram utilizadas para verificar o grau de ajuste dos modelos. Os modelos de Henderson e Pabis modificado e Midilli apresentaram ajustes adequados aos dados experimentais, sendo o modelo de Midilli, em função de sua simplicidade, escolhido para representar a cinética de secagem das folhas de jenipapo. Aumentando a temperatura do ar de secagem de 35,3 para 46,0 e 65,0ºC houve redução no tempo de secagem das folhas de jenipapo de 91,1 para 62,5 e 24,2 horas, respectivamente. O coeficiente de difusão efetivo aumenta com a elevação da temperatura, e esta relação é descrita pela equação de Arrhenius, que apresenta energia de ativação para a difusão líquida de 33,9 kJ mol-1.
Brown, W V; Rose, H A; Lacey, M J; Wright, K
2000-11-01
The cuticular hydrocarbons of a widespread species of soil-burrowing cockroach, Macropanesthia rhinoceros, have been sampled from most of its known geographical locations. Analysis of extracts from individual insects has enabled a study of differences within a population as well as among geographical locations. In the case of M. rhinoceros, except for newly hatched first-instar nymphs, variations in hydrocarbon composition among individuals of different cohorts of M. rhinoceros, based on age and sex, are no greater than those among individuals of a single cohort. Geographical populations of this species are variable in hydrocarbon composition unless they occur within a few kilometres of each other. A few populations showed very different hydrocarbon patterns but, in the absence of any correlating biological differences, it is uncertain whether this signifies the presence of otherwise unrecognizable sibling species or just extreme examples of the geographical variation characteristic of this group of insects.
Directory of Open Access Journals (Sweden)
R.A.R. Ferreira
2005-06-01
Full Text Available Este trabalho foi realizado na UHE Americana, pertencente à Companhia Paulista de Força e Luz, e faz parte de um projeto de pesquisa e desenvolvimento realizado em conjunto com a Faculdade de Ciências Agronômicas - UNESP, de Botucatu. As amostragens de água foram realizadas nos meses de fevereiro, abril, junho e outubro de 2004. As características analisadas foram: temperatura da água, pH, oxigênio dissolvido, condutividade, nitrogênio total, nitrito, nitrato, amônia, fósforo total, fosfato, fosfato inorgânico, juntamente com análise qualitativa e quantitativa da comunidade fitoplanctônica e a toxicidade. O reservatório apresentou valores elevados de fósforo total, variando de 18 a 509 µg L-1; fosfato, de 4 a 463 µg L-1; nitrogênio total, de 0,99 a 17,25 mg L-1; e nitrato, de 0,26 a 15,29 mg L-1. Para a comunidade fitoplanctônica foram encontrados 103 táxons em todo o período amostrado; a maior riqueza foi encontrada no ponto P06, e a maior pobreza de táxons, nos pontos localizadas no corpo central do reservatório (P02, P03, P04 e P05. A maior concentração de cianofícea ocorreu em abril de 2004: 5.375.175 ind. L-1. As espécies que apresentaram as maiores densidades foram Microcystis aeruginosa, Anabaena spiroides, Microcystis sp. e Pseudoanabaena mucicola; a maior densidade foi apresentada por Anabaena spiroides, com 4.178.084 ind. L-1. Nos meses de junho e outubro a classe Cryptophyceae teve uma grande contribuição para a densidade total. Apesar da grande densidade de cianobactérias, os valores de toxicidade ficaram abaixo do limite permitido pela Portaria nº 1.469.This work was carried out at the Americana Reservoir, owned by Companhia Paulista de Força e Luz, and was part of a joint R&D project with Faculdade de Ciências Agronômicas - Botucatu - São Paulo - Brazil. Water sampling was collected in February, April, June and October 2004. The following characteristics were analyzed: water temperature, p
Effects of whole body γ irradiation on skin wound cells and the repaired-promoting action of W11-a12
International Nuclear Information System (INIS)
Shu Chongxiang; Cheng Tianmin; Yan Guohe; Ran Xinze
2002-01-01
Objective: To study the effects of 6 Gy whole body γ irradiation on components of wound cells and the repair-promoting action of W 11 -a 12 , an extract from Periplaneta americana. Methods: After mice were received 6 Gy gamma ray irradiation, the area of healing range in wound cross section, the cellular infiltration of wound and the content of basic fibroblast growth factor (bFGF) in wound epithelial cells were observed and the healing-promoting effect of W 11 -a 12 on the radiation-impaired wound was investigated. Results: The area of healing range in cross section was decreased, various infiltrated cells were all inhibited by radiation, but the range of inhibition was more or less different, and the descending order of severity was as follows: macrophages, vascular endothelial cells, fibroblasts and epithelial cells. The content of bFGF in epithelial cells was decreased. W 11 -a 12 had beneficial heal-promoting effect on radiation-impaired wound: it increased cellular infiltration and promoted synthesis and secretion of bFGF in epithelial cells. Conclusion: The depletion of wound cells is mainly responsible for the healing deficits of radiation-impaired skin wound and W 11 -a 12 enhances cell migration and proliferation and promotes synthesis and secretion of bFGF in epithelial cells
Kulkarni, Paresh; Paul, Rajkumar; Ganesh, N
2010-07-01
Persea americana is much sought after both for the nutritional value of its fruit and the medicinal values of its various plant parts. A chromosomal aberration assay was undertaken to evaluate the potential genotoxicity of crude extracts from avocado fruits and leaves. Chromosomal aberrations were observed in cultured human peripheral lymphocytes exposed to separately increasing concentrations of 50% methanolic extracts of Persea americana fruit and leaves. The groups exposed to leaf and fruit extracts, respectively, showed a concentration-dependent increase in chromosomal aberrations as compared to that in a control group. The mean percentage total aberrant metaphases at 100 mg/kg, 200 mg/kg, and 300 mg/kg concentrations of leaf extract were found respectively to be 58 ± 7.05, 72 ± 6.41, and 78 ± 5.98, which were significantly higher (p < 0.0001 each) than that in the control group (6 ± 3.39). The mean percentage total aberrant metaphases at 100 mg/kg, 200 mg/kg, and 300 mg/kg concentrations of fruit extract were found to be 18 ± 5.49, 40 ± 10.00, and 52 ± 10.20, respectively, which were significantly higher (p = 0.033, p < 0.0001, and p < 0.0001, respectively) than that for control (6 ± 3.39). Acrocentric associations and premature centromeric separation were the two most common abnormalities observed in both the exposed groups. The group exposed to leaf extracts also showed a significant number of a variety of other structural aberrations, including breaks, fragments, dicentrics, terminal deletion, minutes, and Robertsonian translocations. The group exposed to leaf extract showed higher frequency of all types of aberrations at equal concentrations as compared to the group exposed to fruit extract.
Nucleolar organizer regions and a new chromosome number for Rhea americana (Aves: Rheiformes
Directory of Open Access Journals (Sweden)
Ricardo José Gunski
1998-06-01
Full Text Available Sequential banding analysis (Giemsa-C-banding-Ag NOR of chromosomes of the common rhea (Rhea americana was performed. Metaphases were obtained by peripheral blood lymphocyte culture and monolayer embryo cell culture. The diploid chromosome number was 80, different from the 2n = 82 in previous reports. Macrochromosome pairs 1, 2 and 5 were submetacentric and pair 3, subacrocentric. The 4th pair was acrocentric and all of the microchromosomes appeared to be acrocentric, with the exception of a clearly metacentric pair which was fully heterochromatic. The Z was slightly larger than the W, both being acrocentric and C-band negative. Nucleolar organizer regions were observed in the secondary constriction of a microchromosome pair. Correct identification of the NOR-bearing pair was possible only by sequential analyses, Giemsa staining followed by the Ag-NOR technique.Foram efetuadas análises seqüenciais de bandeamento cromossômico (Giemsa-banda-C-AgNOR em material da espécie Rhea americana (ema com o objetivo de identificar os cromossomos portadores de regiões organizadoras de nucléolos e confirmar o cariótipo desta espécie. As metáfases foram obtidas de culturas de leucócitos e de células de embrião. O número diplóide de cromossomos, determinado pela análise de metáfases oriundas de 19 espécimes, foi de 80 (2n = 80, NF = 95, o que difere da literatura. Os pares de macrocromossomos números 1, 2 e 5 eram submetacêntricos e o par 3 era sub-acrocêntrico, confirmado pelo bandeamento C. O par 4 era acrocêntrico, bem como todos os microcromossomos, com exceção de um metacêntrico inteiramente heterocromático. O cromossomo Z era ligeiramente maior que o W, sendo ambos acrocêntricos e banda-C negativos. A região organizadora de nucléolos foi observada na constrição secundária de um par de microcromossomos. A correta identificação do par portador da NOR só foi possível com a utilização da análise seqüencial de colora
Lalisa Wakjira Duresa1*, Daniel Manaye2
2017-01-01
Mango (Mangifera indica L.) and Avocado (Persea americana) fruits are rich in bioactive molecules that protect human cells against the detrimental effect of free radicals. The phytochemical analysis revealed the Presence of alkaloids, terpenoids, saponins, tannins, phenolics and flavonoids in both fruits. The free radical scavenging activity using total antioxidant capacity of the phosphomolybdenum method and hydrogen peroxide method were carried out on the water extracts of mango and avocado...
[The Unión Médica Hispano-Americana (1900) and its contribution to scientific internationalism].
Olagüe de Ros, Guillermo
2006-01-01
The Unión Médica Hispano-Americana was founded during the XIII International Congress of Medicine of Paris in 1900. Its main aim was to strengthen the cultural and scientific ties among Spanish speaking countries. The first assembly took place in Madrid in the Spring of 1903. The most interesting paper presented was undoubtedly that of Manuel Tolosa Latour. He suggested creating a Diccionario Tecnológico Médico Hispano-Americano. The society had no continuity and neither did the dictionary. The reasons for this failure must be seen in the absence of economic support by political authorities in Spain and America, the organizational weakness of the Unión and the poverty of its action program, which was imbued with a triumphalist rhetoric, empty of content and highly paternalistic in its relations with the American world.
Avocado (Persea americana) seed as a source of bioactive phytochemicals.
Dabas, Deepti; Shegog, Rachel M; Ziegler, Gregory R; Lambert, Joshua D
2013-01-01
The pulp of avocado (Persea americana, Lauraceae) has been reported to have beneficial cardiovascular health effects. Avocado oil is used for dermatological applications and its unsaponifiable portion is reported to have beneficial effects against osteoarthritis. Although the seed represents a considerable percentage of the total fruit, scientific research on the phytochemistry and biological effects of avocado seeds is in the nascent stages,. Currently, the seed represents an under-utilized resource and a waste issue for avocado processors. There is ethno-pharmacological information on the use of seeds for the treatment of health-related conditions, especially in South American countries where avocados are endemic and currently grown on a large scale. Current research has shown that avocado seeds may improve hypercholesterolemia, and be useful in the treatment of hypertension, inflammatory conditions and diabetes. Seeds have also been found to possess insecticidal, fungicidal, and anti-microbial activities. The avocado seeds and rich in phenolic compounds, and these may play a role in the putative health effects. Historically, extracts of avocado seeds were also used as ink for writing and research in our laboratory has explored the potential colorant properties of a polyphenol oxidase-produced colored avocado seed extract. Here, we review the currently-available data on the bioactivity and other functional properties of avocado seeds. We discuss the strength of the available data, the putative active compounds, and potential directions for future studies.
Transcriptome analysis of Phytolacca americana L. in response to cadmium stress.
Directory of Open Access Journals (Sweden)
Yongkun Chen
Full Text Available Phytolacca americana L. (pokeweed has metal phytoremediation potential, but little is known about its metal accumulation-related genes. In this study, the de novo sequencing of total RNA produced 53.15 million reads covering 10.63 gigabases of transcriptome raw data in cadmium (Cd-treated and untreated pokeweed. Of the 97,502 assembled unigenes, 42,197 had significant matches in a public database and were annotated accordingly. An expression level comparison between the samples revealed 1515 differentially expressed genes (DEGs, 923 down- and 592 up-regulated under Cd treatment. A KEGG pathway enrichment analysis of DEGs revealed that they were involved in 72 metabolism pathways, with photosynthesis, phenylalanine metabolism, ribosome, phenylpropanoid biosynthesis, flavonoid biosynthesis and carbon fixation in photosynthetic organisms containing 24, 18, 72, 14, 7 and 15 genes, respectively. Genes related to heavy metal tolerance, absorption, transport and accumulation were also identified, including 11 expansins, 8 nicotianamine synthases, 6 aquaporins, 4 ZRT/IRT-like proteins, 3 ABC transporters and 3 metallothioneins. The gene expression results of 12 randomly selected DEGs were validated using quantitative real-time PCR, and showed different response patterns to Cd in their roots, stems and leaves. These results may be helpful in increasing our understanding of heavy metal hyperaccumulators and in future phytoremediation applications.
Oboh, Ganiyu; Odubanjo, Veronica O; Bello, Fatai; Ademosun, Ayokunle O; Oyeleye, Sunday I; Nwanna, Emem E; Ademiluyi, Adedayo O
2016-03-01
Avocado pear (Persea americana Mill.) leaves and seeds are used in traditional medicine for the treatment/management of Alzheimer disease (AD); however, information on the mechanism of actions is limited. This study sought to investigate the effect of P. americana leaf and seed aqueous extracts on some enzymes linked with AD (acetylcholinesterase [AChE] and butyrylcholinesterase [BChE] activities) and their antioxidant potentials in vitro. The inhibitory effects of extracts on AChE and BChE activities and antioxidant potentials (inhibition of Fe2+- and sodium nitroprusside-induced thiobarbiturate reactive species [TBARS] production in rat brain homogenates, radicals [1,1-diphenyl-2-picrylhydrazyl, hydroxyl, and nitric oxide] scavenging and iron [Fe] chelation abilities) were investigated. Phenolic content and phytochemical screening were carried out. Alkaloid profile was also determined using gas chromatography coupled with flame ionization detector (GC-FID). The extracts inhibited AChE and BChE activities and prooxidant-induced TBARS production in a dose-dependent manner, with the seed extract having the highest inhibitory effect and the leaf extract exhibiting higher phenolic content and radical scavenging abilities, but lower Fe chelation ability compared with that of the seed. The phytochemical screening revealed the presence of saponins, alkaloids, and terpenoids in both extracts, whereas the total alkaloid profile was higher in the seed extract than in the leaf extract, as revealed by GC-FID. The anti-cholinesterase and antioxidant activities of avocado leaf and seed could be linked to their phytoconstituents and might be the possible mechanisms underlying their use as a cheap and natural treatment/management of AD. However, these extracts should be further investigated in vivo.
Gondwe, M; Kamadyaapa, D R; Tufts, M A; Chuturgoon, A A; Ojewole, J A O; Musabayane, C T
2008-01-01
Extracts of Persea americana Mill (Lauraceae) ("Avocado") have been traditionally used to treat hypertension and diabetes mellitus. Accordingly, we studied the hypoglycaemic and renal function effects of P. americana leaf ethanolic extracts (PAE) in STZ-induced diabetic rats. Oral glucose tolerance responses to various doses of PAE were monitored in fasted rats following a glucose load. Rats treated with deionized water or standard hypoglycaemic drugs acted as untreated and treated positive controls, respectively. Acute renal effects of PAE were investigated in anesthetized rats challenged with 0.077 M NaCl after a 3.5-h equilibration for 4 h comprising 1 h control, 1.5 h treatment and 1.5 h recovery periods. PAE was added to the infusate during the treatment period. Hepatic glycogen concentration was measured after 6 weeks of daily treatment with PAE. PAE induced dose-dependent hypoglycaemic responses in STZ-induced diabetic rats while subchronic PAE treatment additionally increased hepatic glycogen concentrations. Acute PAE infusion decreased urine flow and electrolyte excretion rates, whilst subchronic treatment reduced plasma creatinine and urea concentrations. These results indicate not only the basis of the ethnomedicinal use of P. americana leaf extract in diabetes management, but also of need for further studies to identify and evaluate the safety of PAE's bioactive compounds. (c) 2008 Prous Science, S.A.U. or its licensors. All rights reserved.
Directory of Open Access Journals (Sweden)
Retno Sintowati
2017-01-01
Metode penelitian menggunakan eksperimental laboratorik dengan rancangan penelitian pretest – posttest with control group design. Hewan uji yang digunakan 25 ekor tikus jantan galur Wistar, umur 2-3 bulan, dan berat badan 150-200 gram yang dibagi dalam 5 kelompok. Kelompok I: kontrol negatif (aquades, kelompok II: kontrol positif (glibenklamid, kelompok III, IV, V : ekstrak metanol 70% daun alpukat dengan dosis berturut-turut adalah sebagbai berikut: 100 mg/ 200 grBB, 150 mg/ 200 grBB, 200 mg/ 200 grBB. Gula darah diukur dengan alat spektrofotometer. Berdasarkan hasil uji ANOVA, data penurunan kadar gula darah hari ke-7 pemberian ekstrak nilai probabilitas signifikan p = 0, 000 dengan demikian p < 0, 05 maka terdapat perbedaan penurunan kadar gula darah yang bermakna. Berdasarkan uji LSD dari semua kelompok didapatkan nilai p < 0,05 yang berarti terdapat perbedaan penurunan kadar gula darah yang signifikan antara2 kelompok. Kesimpulan: Ekstrak metanol 70% daun alpukat (Persea americana Mill dosis 200 mg/200; 100 mg/200 and 150 mg/ 200 gram/berat badan dapat menurunkan kadar gula darah pada mencit jantan galur wistar Kata Kunci : Ekstrak metanol 70%, Alpukat (Persea americana Mill, gula darah, diabetes mellitus.
Directory of Open Access Journals (Sweden)
Samira S.M. Gallo
2014-12-01
Full Text Available A new species of coccidian (Protozoa: Apicomplexa: Eimeriidae obtained from rheas, Rhea americana, is reported in Brazil. Oocysts of Isospora rheae sp. nov. are spherical to subspheroidal, measuring 22.6 × 21.0 µm, and have a double and smooth wall that is approximately 1.7 µm thick. The micropyle, oocyst residuum and polar granule are absent. Sporocysts are slightly ovoid, measuring 13.9 × 9.6 µm. The Stieda body is flattened, the substieda body is pointed, irregular and wavy and the sporocyst residuum is composed of scattered granules of varying sizes. Sporozoites have an oblong refractile body and one nucleus. This is the first description of an isosporid coccidian infecting birds of the family Rheidae.
Directory of Open Access Journals (Sweden)
Beltrão Kaizô Iwakami
2002-01-01
Full Text Available Neste trabalho comparam-se informações sobre o estado de saúde geral referido das populações brasileira e norte-americana, desagregado por grupo etário, sexo e raça/cor. São comparadas, também desagregadas da mesma forma, taxas de prevalência de morbidades selecionadas, a saber: artrite/reumatismo, diabetes, bronquite/asma, hipertensão e doenças do coração. Os dados concernentes à população brasileira são oriundos do suplemento saúde da PNAD/1998, e os relativos à norte-americana, da NHIS/1996. Em linhas gerais, com respeito ao estado de saúde referido, as mulheres se declaram em pior estado em ambos os países, e os brasileiros se declaram em pior situação. Com respeito à morbidade, não há comportamento comum, e padrões de diferença raça/cor e sexo, via de regra, não se reproduzem igualmente para os dois países.
Degenhardt, Andreas Georg; Hofmann, Thomas
2010-12-22
Sequential application of solvent extraction and RP-HPLC in combination with taste dilution analyses (TDA) and comparative TDA, followed by LC-MS and 1D/2D NMR experiments, led to the discovery of 10 C(17)-C(21) oxylipins with 1,2,4-trihydroxy-, 1-acetoxy-2,4-dihydroxy-, and 1-acetoxy-2-hydroxy-4-oxo motifs, respectively, besides 1-O-stearoyl-glycerol and 1-O-linoleoyl-glycerol as bitter-tasting compounds in thermally processed avocado (Persea americana Mill.). On the basis of quantitative data, dose-over-threshold (DoT) factors, and taste re-engineering experiments, these phytochemicals, among which 1-acetoxy-2-hydroxy-4-oxo-octadeca-12-ene was found with the highest taste impact, were confirmed to be the key contributors to the bitter off-taste developed upon thermal processing of avocado. For the first time, those C(17)-C(21) oxylipins exhibiting a 1-acetoxy-2,4-dihydroxy- and a 1-acetoxy-2-hydroxy-4-oxo motif, respectively, were discovered to induce a mouthfulness (kokumi)-enhancing activity in sub-bitter threshold concentrations.
Buelvas Salgado, G. A; Patiño Gómez, J. H; Cano-Salazar, J. A
2012-01-01
Introducción. El aceite de aguacate es rico en vitaminas A, B, C y E, y está compuesto mayoritariamente por ácidos grasos monoinsaturados los cuales reducen de manera efectiva el nivel de colesterol en la sangre, ayudando en la prevención de enfermedades cardiovasculares. Objetivo. Evaluar el rendimiento de extracción de aceite de aguacate Hass (Persea americana Mill) en estado E3-M (maduro) procedente del Oriente Antioqueño, empleando complejos enzimáticos comerciales. Materiales y métodos. ...
Directory of Open Access Journals (Sweden)
Ana Carla Marques Pinheiro
2009-08-01
Full Text Available The goal of this work was to evaluate the effect of different storage temperatures on the quality maintenance of fresh-cut 'Fortuna' avocado (Persea americana Mill.. The fruit was selected, washed and sanitized with sodium hypochlorite solution (190 ppm total residual chlorinee for 15 minutes. After that, the tip was cut and the fruit was also cut in halves, peeled and the pit removed, manually. Then the halves were immersed in 0.5% calcium chlorite + 0.5% cysteine solution for 2 minutes, to avoid darkening and packed in rigid plastic covered with 20 micrometer thick plastic wrap (PVC film with a permeability to O2, CO2 and water vapor of 15,000, 80,000 and 390 cm³/m²/day, respectively. The product was stored under 3 different temperatures 0, 5, 10ºC and evaluated at 5 different storege periods of 0, 2, 3, 5 and 6 days, in a randomized design in a 3x5 factorial. The storage of fresh-cut avocado at 5ºC is the best alternative because it determines better maintenance of quality of the avocado. These presented lower darkening of pulp, better scores for appearance and acceptability, lower softening and polyphenoloxidase activity, in comparison to those stored at 0 and 10ºC. The fresh-cut avocados stored at 5ºC presented a shelf life of 5 days, based, mainly on, appearance, score 7.3, sited between the concepts "like moderately" and "like very much" on a hedonic scale of 9 points and 86% of acceptability, at the end of 5 days of storage.Objetivou-se avaliar o efeito de diferentes temperaturas de armazenamento na manutenção da qualidade de abacates 'Fortuna' (Persea americana Mill. minimally processados. Os frutos foram lavados e sanificados em solução de hipoclorito de sódio (190 ppm de cloro residual total por 15 minutos. Posteriormente, efetuou-se a retirada da extremidade onde se insere o pedúnculo, o corte em metades, retirada do caroço e casca, manualmente. Em seguida, as metades foram imersas em solução com cloreto de cálcio 0
Mito e sociedade na literatura latino-americana: Neruda, Carpentier, Bolaño
Directory of Open Access Journals (Sweden)
Pedro Dolabela Chagas
2013-09-01
Full Text Available Resumo: Discussão sobre a problemática identitária na literatura latino-americana: a sua associação oitocentista à representação da natureza e da paisagem social; a sua longa duração entre os séculos XIX e XX; a sua politização pela dicotomia entre a América Latina e o Centro representado pela Europa e pelos EUA. A construção da identidade como produção de mitos: como construção de passados úteis, valoração positiva ou negativa do presente, projeção de futuros possíveis. A presença do mito em Canto geral, de Pablo Neruda; a sua recusa em 2666, de Roberto Bolaño; discussão sobre as razões desta recusa: a concentração no presente em detrimento da projeção do futuro. Localização de um tensionamento embrionário do mito identitário em Os passos perdidos, de Alejo Carpentier: discussão sobre os termos de orientação deste tensionamento e a diferença que ele produzia em relação à história anterior do romance latino-americano. Sugestão do fechamento recente da época histórica dominada pela problemática identitária na narrativa latino-americana.Palavras-chave: Pablo Neruda; Alejo Carpentier; Roberto Bolaño; romance latino-americano; mito e identidade. Abstract: The problematic of identity representation in Latin- American literature: its 19th Century association to the representation of nature and the social landscape; its long duration in the 19th and 20th Centuries; its politicization through the dichotomy between Latin America and a Center represented by Europe and the USA. Identity construction as a production of myths: as a construction of usable pasts, as a positive or negative evaluation of the present, as a projection of possible futures. The presence of myth in Pablo Neruda’s Canto general; its rejection in Roberto Bolaño’s 2666; the possible reasons of this rejection: a concentration in the present in detriment of the future. Location of an embrionary tensioning of the identity myths
Directory of Open Access Journals (Sweden)
Mahomed Waheed
2011-11-01
Full Text Available Abstract Background Avocado (Persea americana belongs to the Lauraceae family and is an important commercial fruit crop in over 50 countries. The most serious pathogen affecting avocado production is Phytophthora cinnamomi which causes Phytophthora root rot (PRR. Root pathogens such as P. cinnamomi and their interactions with hosts are poorly understood and despite the importance of both the avocado crop and the effect Phytophthora has on its cultivation, there is a lack of molecular knowledge underpinning our understanding of defence strategies against the pathogen. In order to initiate a better understanding of host-specific defence we have generated EST data using 454 pyrosequencing and profiled nine defence-related genes from Pc-infected avocado roots. Results 2.0 Mb of data was generated consisting of ~10,000 reads on a single lane of the GS FLX platform. Using the Newbler assembler 371 contigs were assembled, of which 367 are novel for Persea americana. Genes were classified according to Gene Ontology terms. In addition to identifying root-specific ESTs we were also able to identify and quantify the expression of nine defence-related genes that were differentially regulated in response to P. cinnamomi. Genes such as metallothionein, thaumatin and the pathogenesis related PsemI, mlo and profilin were found to be differentially regulated. Conclusions This is the first study in elucidating the avocado root transcriptome as well as identifying defence responses of avocado roots to the root pathogen P. cinnamomi. Our data is currently the only EST data that has been generated for avocado rootstocks, and the ESTs identified in this study have already been useful in identifying defence-related genes as well as providing gene information for other studies looking at processes such as ROS regulation as well as hypoxia in avocado roots. Our EST data will aid in the elucidation of the avocado transcriptome and identification of markers for improved
Directory of Open Access Journals (Sweden)
Rúbia Caroline Luíz
2007-12-01
Full Text Available Extratos enzimáticos foram preparados a partir da polpa de abacate (Persea americana Mill. dos cultivares Quintal, Fortuna e Choquete, em dois estádios de maturação (verde e maduro. A polpa de abacate (150,00g foi homogeneizada em liquidificador, com 300 mL de solução tampão fosfato de sódio 100mM em pH 7,4 para polifenoloxidase (PPO e pH 6,0 para peroxidase (POD. A peroxidase ionicamente ligada foi extraída usando solução de NaCl 1,0M, em tampão fosfato de sódio 100mM pH 6,0. Para o estudo da estabilidade térmica, os extratos foram submetidos a temperaturas de 60, 65, 70, 75 e 80ºC e por períodos que variaram de 1 à 10 minutos e a atividade enzimática foi determinada por espectrofotometria (lambda= 395nm para PPO e lambda= 460nm para POD. Pode-se observar que o declínio rápido da atividade das enzimas era maior nos primeiros quatro minutos e após esse período, com o aumento da temperatura e do tempo, a atividade continuou diminuindo, porém de forma mais lenta. A energia de ativação na faixa de temperatura estudada para as porções termolábil e termorresistente, apresentou valores dentro da faixa 12-100 kcal/mol.Enzymatic extracts were prepared from the avocado pulp (Persea americana Mill., using the cultivars Quintal, Fortuna and Choquete, in two different maturation stages (green and mature avocados. The avocado pulp (150,00g was homogenized in blender with 300 mL of sodium phosphate buffer 100mM at pH 7.4 for polyphenoloxidase (PPO and pH 6.0 for peroxidase (POD. The peroxidase ionically bound was extracted using NaCl solution 1.0M in sodium phosphate buffer 100mM pH 6.0. For the study of the thermal stability the extracts were submitted at temperatures of 60, 65, 70, 75 and 80ºC for periods that had a variation from 1 to 10 minutes and the enzymatic activity was determined using a spectrophotometer (lambda= 395nm for PPO and lambda= 460nm for POD. It was possible to observe a fast decline of the enzyme activity in
Dutech, Cyril; Maggia, Laurent; Tardy, Christophe; Joly, Hélène I; Jarne, Philippe
2003-12-01
Drier periods from the late Pleistocene and early Holocene have been hypothesized to have caused the disappearance of various rainforest species over large geographical areas in South America and restricted the extant populations to mesic sites. Subsequent improvement in climatic conditions has been associated with recolonization. Changes in population size associated with these extinction-recolonization events should have affected genetic diversity within species. However, these historical hypotheses and their genetic consequences have rarely been tested in South America. Here, we examine the diversity of the chloroplast and nuclear genomes in a Neotropical rainforest tree species, Vouacapoua americana (Leguminosae, Caesalpinioideae) in French Guiana. The chloroplast diversity was analyzed using a polymerase chain reaction-restriction fragment length polymorphism method (six pairs of primers) in 29 populations distributed over most of French Guiana, and a subset of 17 populations was also analyzed at nine polymorphic microsatellite loci. To determine whether this species has experienced extinction-recolonization, we sampled populations in areas supposedly not or only slightly affected by climatic changes, where the populations would not have experienced frequent extinction, and in areas that appear to have been recently recolonized. In the putatively recolonized areas, we found patches of several thousands of hectares homogeneous for chloroplast variation that can be interpreted as the effect of recolonization processes from several geographical origins. In addition, we observed that, for both chloroplast and nuclear genomes, the populations in newly recolonized areas exhibited a significantly smaller allelic richness than others. Controlling for geographic distance, we also detected a significant correlation between chloroplast and nuclear population differentiation. This result indicates a cytonuclear disequilibrium that can be interpreted as a historical signal
La exposición histórico-americana de Madrid de 1892 y la ¿ausencia? de México
Directory of Open Access Journals (Sweden)
Ramírez Losada, Dení
2009-08-01
Full Text Available The Fourth Centennial of the Discovery of America was celebrated in 1892. Together with the rest of the festivities, the Historical American Exposition of Madrid is considered a landmark not only for its political, cultural and scientific relevance, which, to this day, have not been studied in their entirety, but as well for the implications that resulted for Mexico. This article is meant to show, on the one side, the singularity of such festivities, and, on the other, the fact that Mexico’s participation constituted an important historical moment for Mexican scientific anthropology. This research was essentially carried out based on the numerous documentation found at the Archivo General de la Administración, Alcalá de Henares.
En 1892 se celebró en España el IV Centenario del Descubrimiento de América. En el marco de este festejo destacó, sin duda, la Exposición Histórico Americana de Madrid no sólo por su enorme relevancia política, cultural y científica que, hasta ahora, se ha estudiado poco, sino por todo aquello que significó para México en particular. El artículo centra su interés en destacar, por un lado, la singularidad de los festejos colombinos y, por el otro, mostrar que la participación de México en la Exposición Histórico-Americana constituyó todo un hito científico en la antropología mexicana. La investigación se llevó a cabo, fundamentalmente, sobre la copiosa documentación encontrada en el Archivo General de la Administración, Alcalá de Henares.
Directory of Open Access Journals (Sweden)
Debora Cristina Cantador
2017-05-01
Full Text Available Ao analisar as águas urbanas tendo como recorte territorial o município, vários aspectos precisam ser levados em consideração. Assim pode-se entender como se realiza a gestão e, principalmente, como se encontra a qualidade, a preservação e a conservação dos cursos d’água. Esses aspectos devem estar relacionados, principalmente, com as legislações existentes que servem de subsídios para os gestores. Além disso, entende-se que a dinâmica espacial também auxilia na compreensão e visualização de como os recursos hídricos e os elementos associados a eles se comportam de forma mais ampla. Neste trabalho, buscou-se abordar sobre que modo as geotecnologias podem contribuir como um instrumento importante para a análise da atual situação da gestão dos recursos hídricos, usando como área de estudo o município de Americana (SP.
Tang, Shirong; Liao, Shangqiang; Guo, Junkang; Song, Zhengguo; Wang, Ruigang; Zhou, Xiaomin
2011-12-30
Growth and cesium uptake responses of plants to elevated CO(2) and microbial inoculation, alone or in combination, can be explored for clean-up of contaminated soils, and this induced phytoextraction may be better than the natural process. The present study used open-top chambers to investigate combined effects of Burkholderia sp. D54 inoculation and elevated CO(2) (860 μL L(-1)) on growth and Cs uptake by Phytolacca americana and Amaranthus cruentus grown on soil spiked with various levels of Cs (0-1000 mg kg(-1)). Elevated CO(2) and bacterial inoculation, alone or in combination, significantly increased biomass production with increased magnitude, ranging from 22% to 139% for P. americana, and 14% to 254% for A. cruentus. Total tissue Cs in both plants was significantly greater for bacterial inoculation treatment singly, and combined treatments of bacterial inoculation and elevated CO(2) than for the control treatment in most cases. Regardless of CO(2) concentrations and bacterial inoculation, A. cruentus had higher tissue Cs concentration, Cs transfer factors and concentration ratios than P. americana, but they had slightly different contents of antioxidant enzymes. It is concluded that combined effects of elevated CO(2) and microbial inoculation with regard to plant ability to grow and remove radionuclides from soil can be explored for CO(2)- and microbe-assisted phytoextraction technology. Copyright © 2011 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
JOSÉ ALONSO BORBA
2009-04-01
Full Text Available O objetivo desta pesquisa é identificar a percepção de docentes de universidades norte-americanas acerca do paradigma da pesquisa científica em Contabilidade. Para isso, elaborou-se um questionário eletrônico, o qual foi enviado para 1.671 professores provenientes de 92 universidades norte-americanas que possuíam Doutorado em Contabilidade. Um total de 150 docentes respondeu ao questionário de pesquisa. Os resultados evidenciam que: (i os docentes norte-americanos não acreditam que possuir graduação em Contabilidade seja essencial para torna-se um professor/pesquisador de sucesso na área; (ii a University of Texas possui o melhor curso de graduação em Contabilidade e a University of Chicago possui o melhor doutorado na área; (iii The Accounting Review (TAR é considerado o principal periódico de Contabilidade; (iv William Beaver é o principal pesquisador da área; (v temas emergentes na área contábil estão relacionados a governança corporativa, valuation e harmonização contábil. Finalmente, o presente trabalho busca contribuir para o desenvolvimento de futuras pesquisas no cenário nacional, na medida em que evidencia traços e características do principal pólo mundial da Contabilidade.
Guzmán-Rodríguez, Jaquelina J; Ibarra-Laclette, Enrique; Herrera-Estrella, Luis; Ochoa-Zarzosa, Alejandra; Suárez-Rodríguez, Luis María; Rodríguez-Zapata, Luis C; Salgado-Garciglia, Rafael; Jimenez-Moraila, Beatriz; López-Meza, Joel E; López-Gómez, Rodolfo
2013-09-01
Avocado is one of the most important fruits in the world. Avocado "native mexicano" (Persea americana var. drymifolia) seeds are widely used in the propagation of this plant and are the primary source of rootstocks globally for a variety of avocado cultivars, such as the Hass avocado. Here, we report the isolation of 5005 ESTs from the 5' ends of P. americana var. drymifolia seed cDNA clones representing 1584 possible unigenes. These avocado seed ESTs were compared with the avocado flower EST library, and we detected several genes that are expressed either in both tissues or only in the seed. The snakin gene, which encodes an element of the innate immune response in plants, was one of those most frequently found among the seed ESTs, and this suggests that it is abundantly expressed in the avocado seed. We expressed the snakin gene in a heterologous system, namely the bovine endothelial cell line BVE-E6E7. Conditioned media from transfected BVE-E6E7 cells showed antimicrobial activity against strains of Escherichia coli and Staphylococcus aureus. This is the first study of the function of the snakin gene in plant seed tissue, and our observations suggest that this gene might play a protective role in the avocado seed. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
S. TJITROSEMITO
1989-01-01
Full Text Available A field experiment was conducted to investigate the performance of soybean (c.v. Americana when established with zero tillage technique on Imperata dominated area. Four different techniques of alang-alang control i.e. imazapyr (20 kg ai/ha, glyphosate (25 kg ai/ha, glufosinate (3.0 kg ai/ha and manual cultivation were arranged factorially with time of plantings i.e. 1,2 and 3 months after treatments. The alang-alang damages varied with herbicides and times, imazapyr (20 kg ai/ha showed slow appearance of damage at 3 months after application it was only 69%, while that of glufosinate was already down to 48% due to regrowth. No phytotoxicity was recorded, but the yield was low.
Símbolos del Tiempo, la Identidad y la Alteridad en la Visión Americana de José Martí
Directory of Open Access Journals (Sweden)
Ricardo Melgar Bao
2001-01-01
Full Text Available Desde nuestro mirador antropológico, consideramos que el proceso de simbolización cobró par ticular visibilidad y desarrollo en la perspectiva americana de José Martí du rante los últimos quince años de su vida. Nos referimos particularmente al tiempo, la identidad y la alteridad presentes en su ensayo Nuestra América y algunos otros escritos. Sostenemos que el análisis de este cam po simbólico en el pensamiento de un autor, nos puede decir tanto o más que los enfoques tradicionales propios a la historia de las ideas en América Latina.
Bircher, Andreas J; Sigg, Rita; Scherer Hofmeier, Kathrin; Schlegel, Urs; Hauri, Urs
2017-12-01
Temporary tattoos made with an extract of the jagua fruit (Genipa americana L.) are becoming increasingly popular. It is claimed that it is 'dermatologically tested' and does not contain p-phenylenediamine. Extracts of jagua and gardenia fruits have been used by indigenous people in South America, as well as in traditional Chinese medicine, for centuries. Genipin is currently used for its cross-linking effect in the manufacture of polysaccharides, and is being investigated for its anti-inflammatory and other properties. To report the presence of the allergenic substance genipin in a self-administered temporary tattoo dye made from the fruit juice of jagua (Genipa americana L.). A 39-year-old female who repeatedly applied 'completely natural and 100% safe' Earth Jagua® tattoo, obtained via the internet, to her left hand developed allergic contact dermatitis within 6 weeks. Analysis of the dye showed the presence of geniposide and genipin. Patch tests with the dye and with its main components, including genipin, gave strong positive reactions to the latter. There was no sensitization to other ingredients or p-amino compounds. We report an extensively evaluated case of allergic contact dermatitis caused by a temporary Earth Jagua® tattoo. The allergen identified is genipin, a substance that is increasingly used for tattoos and as a therapeutic agent in medicine. This could result in an increase in the number of allergic reactions in the future. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Energy Technology Data Exchange (ETDEWEB)
Figueiredo, Paulo Jorge Moraes; Martins, Gilberto [Universidade Metodista de Piracicaba (UNIMEP), SP (Brazil)]. E-mails: pfigueir@unimep.br; gmartins@unimep.br
2001-06-01
This document represents a partial analysis and a technical review about the environmental study and report of a 1200 MW thermoelectric power plant, proposed for the Americana district, SP, Brazil. Published on June, 4th 2001, this article points out many problems and mistakes of the referred studies, with the objective of providing support to the Federal attorney office and the general public. (author)
Persea americana (avocado): bringing ancient flowers to fruit in the genomics era.
Chanderbali, André S; Albert, Victor A; Ashworth, Vanessa E T M; Clegg, Michael T; Litz, Richard E; Soltis, Douglas E; Soltis, Pamela S
2008-04-01
The avocado (Persea americana) is a major crop commodity worldwide. Moreover, avocado, a paleopolyploid, is an evolutionary "outpost" among flowering plants, representing a basal lineage (the magnoliid clade) near the origin of the flowering plants themselves. Following centuries of selective breeding, avocado germplasm has been characterized at the level of microsatellite and RFLP markers. Nonetheless, little is known beyond these general diversity estimates, and much work remains to be done to develop avocado as a major subtropical-zone crop. Among the goals of avocado improvement are to develop varieties with fruit that will "store" better on the tree, show uniform ripening and have better post-harvest storage. Avocado transcriptome sequencing, genome mapping and partial genomic sequencing will represent a major step toward the goal of sequencing the entire avocado genome, which is expected to aid in improving avocado varieties and production, as well as understanding the evolution of flowers from non-flowering seed plants (gymnosperms). Additionally, continued evolutionary and other comparative studies of flower and fruit development in different avocado strains can be accomplished at the gene expression level, including in comparison with avocado relatives, and these should provide important insights into the genetic regulation of fruit development in basal angiosperms.
Kocovsky, Patrick
2016-01-01
This study tested the hypothesis that duration of freezing differentially affects whole-body morphometrics of a derived teleost. Whole-body morphometrics are frequently analyzed to test hypotheses of different species, or stocks within a species, of fishes. Specimens used for morphometric analyses are typically fixed or preserved prior to analysis, yet little research has been done on how fixation or preservation methods or duration of preservation of specimens might affect outcomes of multivariate statistical analyses of differences in shape. To determine whether whole-body morphometrics changed as a result of freezing, 23 whole-body morphometrics of age-1 white perch (Morone americana) from western Lake Erie (n = 211) were analyzed immediately after capture, after being held on ice overnight, and after freezing for 100 or 200 days. Discriminant function analysis revealed that all four groups differed significantly from one another (P time to avoid biases related to the length of time they were frozen. Similar experiments should be conducted on other species and also using formalin- and alcohol-preserved specimens.
Estudios sobre Trypanosomiasis americana en el Perú. Observaciones en el departamento de Ica
Directory of Open Access Journals (Sweden)
Víctor M Ayulo Robles
1946-01-01
Full Text Available Hemos comprobado la presencia de Triatomas en las ciudades de Ica y Nazca. Los Triatomas encontrados en esas localidades son de la especie del Triatoma Infestans. Las observaciones del contenido intestinal de los Triatomas capturados en ambas ciudades reveló que ellos no se encuentran infestados; lo que hace sospechar que estos insectos procedan de la Ciudad de Arequipa. Los exámenes de sangre en fresco, gota gruesa y frotis coloreados por el método de Giemsa en 174 personas y 32 animales, así como las pruebas de Desviación del Complemento (Reacción de GUERREIRO Y MACHADO e intradermo-reacción en las 174 personas, fueron negativas; lo que demuestra que actualmente no existe la Enfermedad de Chagas en el Departamento de Ica. Dada la presencia de Triatomas en Ica y Nazca y la existencia de la Enfermedad de Chagas en Vitor, Sihuas y Quishuarani del Departamento de Arequipa no se excluye la posibilidad de que posteriormente se haga presente la Trypanosomiasis americana, también, en esas zonas.
Capinera, John L; Froeba, Jason G
2007-02-01
Azadirex (azadirachtin and other biologically active extracts from neem trees) has been shown to have considerable potential to be used in integrated pest management systems based on its growth regulator/insecticide properties. Less well known are the antifeedant properties. The feeding-deterrent properties of a commercial azadirex formulation (Azatrol EC) were evaluated using both no-choice and choice tests, the American grasshopper, Schistocerca americana (Drury), and four host plants [savoy cabbage, Brassica oleracea variety capitata L.; cos (romaine) lettuce, Lactuca sativa variety longifolia Lam.; sweet orange, Citrus sinensis variety Hamlin L.; and peregrina, Jatropha integerrima Jacq.]. These studies demonstrated that azadirex application can significantly affect the feeding behavior of grasshoppers. Some degree of protection can be afforded to plants that differ markedly in their innate attractiveness to the insect, although the level of protection varies among hosts. The tendency of grasshoppers to sometimes feed on azadirex-treated foliage suggests that it will be difficult to prevent damage from occurring at all times, on all hosts. No evidence of rapid habituation to azadirex was detected. Rapid loss of efficacy was observed under field conditions, suggesting that daily retreatment might be necessary to maintain protection of plants from feeding.
Directory of Open Access Journals (Sweden)
Laura Cecilia López
2015-06-01
Full Text Available ResumoO artigo tece uma relação entre corpo colonial e diáspora como dimensões relevantes para compreender as mobilizações afro-latino-americanas, particularmente no Brasil. A partir de dados etnográficos e produções discursivas de intelectuais e militantes negros, analiso a relação entre corpo e poder em diferentes dimensões da luta antirracista. Abordarei dois cenários diferenciados para analisar como a diáspora aparece nas narrativas de sujeitos negros como dimensão disruptiva da colonialidade, provocando a possibilidade de corpos/sujeitos decoloniais que demandam justiça racial. Enfatizarei a dimensão diaspórica como força desse deslocamento nas mobilizações negras: como ela se vincula às políticas e poéticas do corpo/espaço/tempo. Indagarei também na visibilização do corpo colonial na crítica das feministas negras, ao considerar raça e gênero como opressões entrelaçadas. Propõem-se contribuições para uma antropologia política do corpo ao levar a sério perspectivas diaspóricas afro-latino-americanas que focam o corpo como centro das disputas políticas, no sentido de desracializar e pluralizar nossas sociedades.
Sá, Magali Romero; Cândido da Silva, André Felipe
2010-01-01
This article presents the development of the journals "Revista Médica de Hamburgo" and "Revista Médica Germano-Ibero-Americana," which were created to promote and disseminate the German science among the medical community in Latin America and Spain between the two World Wars. Shaken by the loss of Germany's colonies in Africa, the difficulties faced due to post-war economy, and the restrictions imposed by the armistice, the Germans sought to restore their cultural and scientific prestige through such initiative.
Directory of Open Access Journals (Sweden)
Romero Sá, Magali
2010-06-01
Full Text Available This article presents the development of the journals Revista Médica de Hamburgo and Revista Médica Germano-Ibero-Americana, which were created to promote and disseminate the German science among the medical community in Latin America and Spain between the two World Wars. Shaken by the loss of Germany’s colonies in Africa, the difficulties faced due to post-war economy, and the restrictions imposed by the armistice, the Germans sought to restore their cultural and scientific prestige through such initiative.
El trabajo aborda la trayectoria de la Revista Médica de Hamburgo (RMH y la Revista Médica Germano-Ibero-Americana (RMGIA, publicaciones creadas para promover y difundir la ciencia alemana entre las comunidades médicas de América Latina y España en el contexto de entreguerras. Sacudidos por la pérdida de las colonias en África, por las dificultades enfrentadas por la economía y por las condiciones impuestas por el armisticio, los alemanes pretendían con esa iniciativa recuperar el prestigio cultural y científico.
C.E. Flower; N. Hayes-Plazolles; J.M. Slavicek; C. Rosa
2018-01-01
During the investigation of the sudden and early onset of yellowing and mortality of American elm (Ulmus americana L.) trees at the USDA Forest Service Northern Research Station in Delaware, OH, a phytoplasma of the clover proliferation group (16SrVI) was detected as the putative causal agent of the disease outbreak.
Burger, J; Rodgers, J A; Gochfeld, M
1993-05-01
Colonially-nesting birds often nest in coastal areas, along rivers, or near other bodies of water that also are potentially polluted from industrial, agricultural or urban development. The levels of heavy metals and selenium were examined in the feathers of young wood storks Mycteria americana nesting in Northeastern Florida and from adult and young storks nesting on the Tempisque River on the west coast of Costa Rica. There were no significant yearly differences among the chicks from Costa Rica. Concentration of mercury, cadmium, and lead were significantly higher in the chicks from Florida compared to those from Costa Rica. Adult wood storks at Costa Rica had significantly higher levels of lead, cadmium, selenium, and manganese than young from the same colony.
An investigation into the chemical composition of alternative invertebrate prey
Oonincx, D.G.A.B.; Dierenfeld, E.S.
2012-01-01
The aim of this study was to determine the chemical composition of eight invertebrate species and evaluate their suitability as alternative prey. The species selected were rusty red cockroaches (Blatta lateralis), six-spotted cockroaches (Eublaberus distanti), Madagascar hissing cockroaches
Stanley, Christina R; Mettke-Hofmann, Claudia; Preziosi, Richard F
2017-01-01
Despite a recent surge in the popularity of animal personality studies and their wide-ranging associations with various aspects of behavioural ecology, our understanding of the development of personality over ontogeny remains poorly understood. Stability over time is a central tenet of personality; ecological pressures experienced by an individual at different life stages may, however, vary considerably, which may have a significant effect on behavioural traits. Invertebrates often go through numerous discrete developmental stages and therefore provide a useful model for such research. Here we test for both differential consistency and age effects upon behavioural traits in the gregarious cockroach Diploptera punctata by testing the same behavioural traits in both juveniles and adults. In our sample, we find consistency in boldness, exploration and sociality within adults whilst only boldness was consistent in juveniles. Both boldness and exploration measures, representative of risk-taking behaviour, show significant consistency across discrete juvenile and adult stages. Age effects are, however, apparent in our data; juveniles are significantly bolder than adults, most likely due to differences in the ecological requirements of these life stages. Size also affects risk-taking behaviour since smaller adults are both bolder and more highly explorative. Whilst a behavioural syndrome linking boldness and exploration is evident in nymphs, this disappears by the adult stage, where links between other behavioural traits become apparent. Our results therefore indicate that differential consistency in personality can be maintained across life stages despite age effects on its magnitude, with links between some personality traits changing over ontogeny, demonstrating plasticity in behavioural syndromes.
Mettke-Hofmann, Claudia; Preziosi, Richard F.
2017-01-01
Despite a recent surge in the popularity of animal personality studies and their wide-ranging associations with various aspects of behavioural ecology, our understanding of the development of personality over ontogeny remains poorly understood. Stability over time is a central tenet of personality; ecological pressures experienced by an individual at different life stages may, however, vary considerably, which may have a significant effect on behavioural traits. Invertebrates often go through numerous discrete developmental stages and therefore provide a useful model for such research. Here we test for both differential consistency and age effects upon behavioural traits in the gregarious cockroach Diploptera punctata by testing the same behavioural traits in both juveniles and adults. In our sample, we find consistency in boldness, exploration and sociality within adults whilst only boldness was consistent in juveniles. Both boldness and exploration measures, representative of risk-taking behaviour, show significant consistency across discrete juvenile and adult stages. Age effects are, however, apparent in our data; juveniles are significantly bolder than adults, most likely due to differences in the ecological requirements of these life stages. Size also affects risk-taking behaviour since smaller adults are both bolder and more highly explorative. Whilst a behavioural syndrome linking boldness and exploration is evident in nymphs, this disappears by the adult stage, where links between other behavioural traits become apparent. Our results therefore indicate that differential consistency in personality can be maintained across life stages despite age effects on its magnitude, with links between some personality traits changing over ontogeny, demonstrating plasticity in behavioural syndromes. PMID:28489864
Thany, Steeve H
2009-11-01
Clothianidin is new neonicotinoid insecticide acting selectively on insect nicotinic acetylcholine receptors (nAChRs). Its effects on nAChRs expressed on cercal afferent/giant interneuron synapses and DUM neurons have been studied using mannitol-gap and whole-cell patch-clamp techniques, respectively. Bath-application of clothianidin-induced dose-dependent depolarizations of cockroach cercal afferent/giant interneuron synapses which were not reversed after wash-out suggesting a strong desensitization of postsynaptic interneurons at the 6th abdominal ganglion (A6). Clothinidin activity on the nerve preparation was characterized by an increased firing rate of action potentials which then ceased when the depolarization reached a peak. Clothianidin responses were insensitive to all muscarinic antagonists tested but were blocked by co-application of specific nicotinic antagonists methyllicaconitine, alpha-bungarotoxin and d-tubocurarine. In a second round of experiment, clothianidin actions were tested on DUM neurons isolated from the A6. There was a strong desensitization of nAChRs which was not affected by muscarinic antagonists, pirenzepine and atropine, but was reduced with nicotinic antagonist alpha-bungarotoxin. In addition, clothianidin-induced currents were completely blocked by methyllicaconitine suggesting that (1) clothianidin acted as a specific agonist of nAChR subtypes and (2) a small proportion of receptors blocked by MLA was insensitive to alpha-bungarotoxin. Moreover, because clothianidin currents were blocked by d-tubocurarine and mecamylamine, we provided that clothianidin was an agonist of both nAChRs: imidacloprid-sensitive nAChR1 and -insensitive nAChR2 subtypes.
“Ser devorado no duele”. Th. W. Adorno y la experiencia americana
Directory of Open Access Journals (Sweden)
Maiso, Jordi
2009-10-01
Full Text Available The present text aims to fathom Theodor W. Adorno’s american experience as a deciding learning process in the development of his Critical Theory. As a consequence of his New York exile years and his participance on the Princeton Radio Research Project, Adorno not only gets in touch with the proceeding of the culture industry and sets down a resolute theoretical approach to radio music, but also realizes a shift has taken place on the social function of theory which enables him a poignant self-reflection on the situation of the emigrated intellectual.El presente texto pretende desentrañar la experiencia americana de Theodor W. Adorno como un proceso de aprendizaje decisivo en la formulación de su Teoría Crítica. A partir de su exilio en Nueva York y de su participación en el Princeton Radio Research Project, Adorno no sólo adquiere un conocimiento directo del funcionamiento de la industria de la cultura y formula una decisiva aproximación teórica a la música radiofónica, sino que también toma conciencia de un cambio en la función social de la teoría que le permite llevar a cabo una aguda autorreflexión sobre la situación del intelectual emigrado.
Chanderbali, André S; Albert, Victor A; Leebens-Mack, Jim; Altman, Naomi S; Soltis, Douglas E; Soltis, Pamela S
2009-06-02
The debate on the origin and evolution of flowers has recently entered the field of developmental genetics, with focus on the design of the ancestral floral regulatory program. Flowers can differ dramatically among angiosperm lineages, but in general, male and female reproductive organs surrounded by a sterile perianth of sepals and petals constitute the basic floral structure. However, the basal angiosperm lineages exhibit spectacular diversity in the number, arrangement, and structure of floral organs, whereas the evolutionarily derived monocot and eudicot lineages share a far more uniform floral ground plan. Here we show that broadly overlapping transcriptional programs characterize the floral transcriptome of the basal angiosperm Persea americana (avocado), whereas floral gene expression domains are considerably more organ specific in the model eudicot Arabidopsis thaliana. Our findings therefore support the "fading borders" model for organ identity determination in basal angiosperm flowers and extend it from the action of regulatory genes to downstream transcriptional programs. Furthermore, the declining expression of components of the staminal transcriptome in central and peripheral regions of Persea flowers concurs with elements of a previous hypothesis for developmental regulation in a gymnosperm "floral progenitor." Accordingly, in contrast to the canalized organ-specific regulatory apparatus of Arabidopsis, floral development may have been originally regulated by overlapping transcriptional cascades with fading gradients of influence from focal to bordering organs.
Aspectos eco-epidemiológicos da leishmaniose tegumentar americana no Município de Campinas
Directory of Open Access Journals (Sweden)
Corte Antônio Ângelo
1996-01-01
Full Text Available Os autores descrevem um surto de leishmaniose tegumentar americana ocorrido no período de fevereiro de 1993 a setembro de 1994, nos Distritos de Sousas e Joaquim Egídio, Município de Campinas, SP. Ocorreram 25 casos, sete na área rural, nove na área peri-urbana e nove na urbana. Verifica-se uma mobilidade da ocorrência dos casos em direção rural-urbana. Em relação ao sexo, houve predomínio do masculino (60% sobre o feminino (40%, com 44% dos casos concentrados na faixa etária de 11 e trinta anos. Quanto à ocupação, 48% correspondem a estudantes, empregadas domésticas e donas-de-casa. Em 92% dos casos, a doença manifestou-se com lesão única, predominantemente localizadas nos membros inferiores e superiores. O surgimento desses casos na área está provavelmente associado à expansão urbana ocorrida nas décadas de 70-80 e acelerada mais recentemente.
SOARES, H.S.; ALVES, N.D.; PEREIRA, R.H.M.A.; MATOS, S.M.; PENA, H.F.J.; GENNARI, S.M.; FEIJÓ, F.M.C.; AMÓRA, S.S.A.; PEIXOTO, G.C.X.
2010-01-01
Anti-Toxoplasma gondii antibodies were evaluated in greater rheas (Rhea americana) from the Reproduction Centre for Wild Animals located at the Universidade Federal Rural do Semiárido in the city of Mossoró, Rio Grande do Norte, by the modified agglutination test (MAT ≥25). It was verified that, from the 69 examined birds, 4.3% (three rheas) tested positive. The research about ratites toxoplasmoses are scarce, this way, the results showed the importance of the T. gondii diagnosis ...
Anti Lithiasis Activity of Avocado (Persea americana Mill Leaves Extract in White Male Rats
Directory of Open Access Journals (Sweden)
IETJE WIENTARSIH
2012-03-01
Full Text Available In Indonesia, avocado leaves have been used as traditional medicines for diureticum to cure urolithiasis. This research was to determine anti lithiasis activity of avocado leaves (Persea americana Mill extract on white male rats nefrolithiasis model induced by ethylene glycol. Ethanol extraction method was used to get extract of avogadro leaves. Twenty adult male white rats were divided into 4 different induction treatments i.e. aquadest, ethylene glycol 0.75% and ammonium chloride 2%, and extract of avocado leaves with different levels of 100 and 300 mg/kg bw respectively. Their body weight was measured daily to determine their growth ratio. And at the end of the trial, the kidney was analyzed its calcium level and inhibitory activity to formation of calcium oxalate crystals. The results showed that the amount of calcium level in the kidney of rats treated with extract of avogadro leaves was significantly decreased than that of rats treated with ethylene glycol 0.75% and ammonium chloride 2% (P < 0.05. The extract avocado leaves as a herbal remedy can be recommended as a phytotherapeutic agent especially for preventive action for urolithiasis diseases.
Directory of Open Access Journals (Sweden)
Fábio de Almeida Vieira
2006-06-01
Full Text Available The aim of this paper was to verify the effect of different doses of gibberellic acid (GA3 (0, 250, 500, 750 and 1000 µg.L-1, of fungicides of the groups chemical benzimidazol (0, 25, 50 and 100 g.L-1 and ditiocarbamato (0, 1,25, 2,50 and 5,00 g.L-1 on seed germination. Viability of those seeds was evaluated through germination tests at 0, 15, 30 and 60 days. The experiment was carried out in greenhouse. The experimental design was fully randomized one, with five replicates per treatment. The traits evaluated were emergence and index of emergence speed. The treatment with GA3 didn't provide significant so much differences among the germination rates as well as for the emergence speed. It was verified that the use of the fungicides in smaller concentrations (25 g.L-1 of benzimidazol and 1,25 g.L-1 of ditiocarbamato promoted a better germination speed. The seeds of G. americana possess viability period relatively short, with germination absence 60 days period of storage, and it could be associated to the humidity tenors presented by the seeds in this period.
GÓMEZ DORANTES, NÚRIA
2012-01-01
Se realizó un estudio para identificar las especies de hongos micorrizógenos arbusculares (HMA) asociados al suelo y al interior de las raíces de plantas de aguacate (Persea americana Mill.) en una huerta denominada las Parrillas en la región aguacatera del Estado de Michoacán, México. Cinco árboles de aguacate establecidos en un diseño completamente al azar fueron muestreados, mostrando altos porcentajes de colonización micorrízica al interior de las raíces (>94%) sin prese...
Directory of Open Access Journals (Sweden)
Darclet Terezinha Malerbo Souza
2002-04-01
Full Text Available O presente experimento teve como objetivo avaliar métodos de atração da abelha Apis mellifera L. (Hymenoptera, Apidae em duas variedades de abacate (Persea americana Mill.. Os atrativos utilizados foram extratos de Cymbopogon citratus, Ocimum basilicum, Lippia alba, folha de Citrus sp, folha de Eucaliptus sp. e o eugenol e o linalol (SIGMA. Os tratamentos utilizados foram: coberto; descoberto pulverizado (DP; descoberto com tubos e descoberto não pulverizado (DNP. Observou-se que a atratividade das substâncias testadas desapareceu minutos após a sua aplicação, utilizando ou não a glicerina, em ambas as variedades. A pulverização dos extratos de falsa melissa, folhas de eucalipto e folhas de laranja apresentaram um aumento no número de abelhas Apis mellifera, na variedade Quintal. Os dados mostraram que a freqüência das abelhas A. mellifera foi maior na variedade Quintal comparada à variedade Fortuna. Isto pode ter ocorrido devido à maior concentração de açúcares do néctar de suas flores. Observou-se que as abelhas A. mellifera preferiram visitar as flores do abacateiro da variedade Quintal, tanto para néctar quanto para coleta de pólen, comparada à variedade Fortuna. Com relação aos frutos, nenhuma das características apresentou diferença significativa entre os tratamentos, em ambas as variedades. Entretanto, observou-se que na variedade Quintal os frutos decorrentes dos tratamentos DP e DNP foram mais pesados, mais compridos e com maior espessura da polpa, comparados ao único fruto obtido do tratamento coberto. Os produtos testados em tubos não foram eficientes para atrair a abelha Apis mellifera, em ambas as variedades.The present experiment was carried out to evaluate some methods to attract honeybee Apis mellifera L. (Hymenoptera, Apidae to two avocado varieties (Persea americana Mill.. Extracts of Cymbopogon citratus, Ocimum basilicum, Lippia alba, Citrus sp leaf, Eucalyptus sp leaf, the eugenol and linalol
Paul, Rajkumar; Kulkarni, Paresh; Ganesh, Narayan
2011-01-01
Diets rich in fruits and vegetables have been associated with reduced risks for many types of cancers. Avocado (Persea americana Mill.) is a widely consumed fruit containing many cancer preventing nutrients, vitamins and phytochemicals. Studies have shown that phytochemicals extracted from the avocado fruit selectively induce cell cycle arrest, inhibit growth, and induce apoptosis in precancerous and cancer cell lines. Our recent studies indicate that phytochemicals extracted with 50% Methanol from avocado fruits help in proliferation of human lymphocyte cells and decrease chromosomal aberrations induced by cyclophosphamide. Among three concentrations (100 mg, 150 mg and 200 mg per Kg Body Weight), the most effective conc. of extract was 200 mg/Kg Body Wt. It decreased significant level of numerical and structural aberrations (breaks, premature centromeric division etc. up to 88%, p avocado fruit can be utilized for making active chemoprotective ingredient for lowering the side effect of chemotherapy like cyclophosphamide in cancer therapy.
Hurtado-Fernández, Elena; Carrasco-Pancorbo, Alegría; Fernández-Gutiérrez, Alberto
2011-03-23
A powerful HPLC-DAD-ESI-TOF MS method was established for the efficient identification of the chemical constituents in the methanolic extracts of avocado (Persea americana). Separation and detection conditions were optimized by using a standard mix containing 39 compounds belonging to phenolic acids and different categories of flavonoids, analytes that could be potentially present in the avocado extracts. Optimum LC separation was achieved on a Zorbax Eclipse Plus C18 analytical column (4.6×150 mm, 1.8 μm particle size) by gradient elution with water+acetic acid (0.5%) and acetonitrile as mobile phases, at a flow rate of 1.6 mL/min. The detection was carried out by ultraviolet-visible absorption and ESI-TOF MS. The developed method was applied to the study of 3 different varieties of avocado, and 17 compounds were unequivocally identified with standards. Moreover, around 25 analytes were tentatively identified by taking into account the accuracy and isotopic information provided by TOF MS.
Esteve, Clara; D'Amato, Alfonsina; Marina, María Luisa; García, María Concepción; Righetti, Pier Giorgio
2012-09-01
Avocado (Persea americana) proteins have been scarcely studied despite their importance, especially in food related allergies. The proteome of avocado pulp was explored in depth by extracting proteins with capture by combinatorial peptide ligand libraries at pH 7.4 and under conditions mimicking reverse-phase capture at pH 2.2. The total number of unique gene products identified amounts to 1012 proteins, of which 174 are in common with the control, untreated sample, 190 are present only in the control and 648 represent the new species detected via combinatorial peptide ligand libraries of all combined eluates and likely represent low-abundance proteins. Among the 1012 proteins, it was possible to identify the already known avocado allergen Pers a 1 and different proteins susceptible to be allergens such as a profilin, a polygalacturonase, a thaumatin-like protein, a glucanase, and an isoflavone reductase like protein. © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Gomez-Puerta, Luis A; Pacheco, Joel; Gonzales-Viera, Omar; Lopez-Urbina, Maria T; Gonzalez, Armando E
2015-09-15
In the present report metacestodes were collected from the mesentery of a taruca (Hippocamelus antisensis) and from the omentum of a red brocket deer (Mazama americana) in Peru. Various metacestodes parameters, including rostellar hook characteristics, were measured. Molecular analysis was performed to amplify the mitochondrial cytochrome c oxidase subunit 1 gene from metacestode isolates. Metacestodes were identified as T. hydatigena by morphology and molecular methods. This constitutes the first molecular detection of T. hydatigena metacestodes in the taruca and the red brocket deer and demonstrates that these animal species are natural intermediate hosts for this parasite. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Germán Darío Vélez López
2013-01-01
Full Text Available Partiendo de una formulación básica de algunos elementos relevantes de la hermenéutica fenomenológica de Heidegger, el presente artículo propone una lectura de la obra del escritor norteamericano Philip Roth titulada Pastoral americana, que lo hizo acreedor al premio Pulitzer en 1989. El propósito cen- tral de esa lectura consiste en mostrar de qué manera fenómenos existenciales elementales como estar-lejos (Wegsein, estar-despierto (Wachsein, estar-ahí (Dasein permiten una articulación propia del sentido de la obra de Roth en la que ésta manifiesta su particular compromiso existencial.
Purification and characterization of peroxidase from avocado (Persea americana Mill, cv. Hass).
Rojas-Reyes, José O; Robles-Olvera, Victor; Carvajal-Zarrabal, Octavio; Castro Matinez, Claudia; Waliszewski, Krzysztof N; Aguilar-Uscanga, María Guadalupe
2014-07-01
Avocado (Persea americana Mill, cv. Hass) fruit ranks tenth in terms of the most important products for Mexico. Avocado products are quite unstable due to the presence of oxidative enzymes such as polyphenol oxidase and peroxidase. The present study is to characterize the activity of purified avocado peroxidase from avocado in order to ascertain the biochemical and kinetic properties and their inhibition conditions. Purification was performed by Sephacryl S 200 HR gel filtration chromatography and its estimated molecular weight was 40 kDa. The zymogram showed an isoelectric point of 4.7. Six substrates were tested in order to ascertain the affinity of the enzyme for these substrates. The purified peroxidase was found to have low Km (0.296 mM) and high catalytic efficiency (2688 mM(-1) s(-1)) using 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid), optimum activity being reached at 51°C, pH 3.8. The addition of dithiothreitol, β-mercaptoethanol, ascorbic acid, sodium azide, L-cysteine and Tween-20 had high inhibitory effects, while metals ions such as Cu(+), Fe(2+) and Mn(2+) had weak inhibitory activity on purified avocado peroxidase. The purified avocado peroxidase exhibits high inhibition (Ki = 0.37 µM) with 1.97 µM n-propyl gallate using ABTS as substrate at 51°C, pH 3.8 for 10 min. © 2013 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Maria C. Spriggs
2016-12-01
Full Text Available The American marten (Martes americana was reintroduced to both the Upper (UP and northern Lower Peninsula (NLP of Michigan during the 20th century. This is the first report of endoparasites of American marten from the NLP. Faeces from live-trapped American marten were examined for the presence of parasitic ova, and blood samples were obtained for haematocrit evaluation. The most prevalent parasites were Capillaria and Alaria species. Helminth parasites reported in American marten for the first time include Eucoleus boehmi, hookworm, and Hymenolepis and Strongyloides species. This is the first report of shedding of Sarcocystis species sporocysts in an American marten and identification of 2 coccidian parasites, Cystoisospora and Eimeria species. The pathologic and zoonotic potential of each parasite species is discussed, and previous reports of endoparasites of the American marten in North America are reviewed.
DEFF Research Database (Denmark)
Elbrønd, Vibeke Sødring; Laverty, Gary; Dantzer, Vibeke
2009-01-01
chloride secretion response, and ouabain, the Na+/K+-ATPase inhibitor, abolished most of the ISC. The transepithelial resistance (TER) of the diverticulum was much higher than the other tissues. Upon dissection, urate from ureteral urine was observed in the lower third of the colon and to a lesser extent......The structure and function of the lower intestinal tract of Rhea americana were characterized to evaluate the evolutionary relationship to other struthioniform and avian species. In 5 rheaqs the gross anatomy and the light and transmission electron microscopy were studied in parallel to in vitro...... large amounts of mucus. The proctodeal diverticulum was rich in lymphoid tissue arranged into lobuli bursales, and it was concluded that this structure is a modified bursa of Fabricius. The sparse interlobular epithelium of the diverticulum resembled that of colon and coprodeum. Baseline short circuit...
Potential risk to wood storks (Mycteria americana) from mercury in Carolina Bay fish
International Nuclear Information System (INIS)
Brant, H.A.; Jagoe, C.H.; Snodgrass, J.W.; Bryan, A.L.; Gariboldi, J.C.
2002-01-01
Fish mercury levels from some Carolina bays pose risk to wood stork. - Carolina bays are freshwater wetlands that serve as important feeding habitats for the endangered wood stork (Mycteria americana). Water levels in these bays fluctuate greatly and tend to be acidic and rich in dissolved organic carbon (DOC), factors that favor mercury (Hg) methylation and bioaccumulation in fish. To assess potential risks to wood storks consuming mercury contaminated fish in bays, we sampled fish from 10 bays on the Savannah River Site (SRS), South Carolina, an area with documented use by wood storks. Whole body mercury concentrations in 258 fishes of three species (Erimyzon sucetta, Acantharchus pomotis and Esox americanus) commonly consumed by wood storks were determined. Risk factors for nestlings and free-ranging adults were calculated using published no and lowest observable adverse effect concentration (NOAEC and LOAEC) values for birds. Fish from higher trophic levels and those from wetlands with relatively shallow maximum depths and fluctuating water levels were more likely to exceed NOAEC and LOAEC values. Calculation of exposure rates of nestling wood storks indicated they are at highest risk during the first 10 days of the nestling period. These calculations suggest that there is potential concern for wood storks foraging in relatively shallow bays with fluctuating water levels, even though there is no obvious local source of mercury to these wetlands
Ashworth, V E T M; Clegg, M T
2003-01-01
Twenty-five microsatellite markers uniquely differentiated 35 avocado cultivars and two wild relatives. Average heterozygosity was high (60.7%), ranging from 32% in P. steyermarkii to 84% in Fuerte and Bacon. In a subset of 15 cultivars, heterozygosity averaged 63.5% for microsatellites, compared to 41.8% for restriction fragment length polymorphisms (RFLPs). A neighbor-joining tree, according to average shared allele distances, consisted of three clusters likely corresponding to the botanical races of avocado and intermediate clusters uniting genotypes of presumably racially hybrid origin. Several results were at odds with existing botanical assignments that are sometimes rendered difficult by incomplete pedigree information, the complexity of the hybrid status (multiple backcrossing), or both. For example, cv. Harvest clustered with the Guatemalan race cultivars, yet it is derived from the Guatemalan x Mexican hybrid cv. Gwen. Persea schiedeana grouped with cv. Bacon. The rootstock G875 emerged as the most divergent genotype in our data set. Considerable diversity was found particularly among accessions from Guatemala, including G810 (West Indian race), G6 (Mexican race), G755A (hybrid Guatemalan x P. schiedeana), and G875 (probably not P. americana). Low bootstrap support, even upon exclusion of (known) hybrid genotypes from the data matrix, suggests the existence of ancient hybridization or that the botanical races originated more recently than previously thought.
Plantio direto de alface americana sobre plantas de cobertura dessecadas ou roçadas
Directory of Open Access Journals (Sweden)
Andréia Cristina Silva Hirata
2014-06-01
Full Text Available O objetivo deste trabalho foi avaliar o plantio direto de alface americana no verão sobre plantas de cobertura dessecadas ou roçadas em cultivos sucessivos. O trabalho foi desenvolvido no município de Álvares Machado, São Paulo, Brasil. O delineamento experimental foi em blocos ao acaso, dispostos em parcelas subdivididas, com quatro repetições. O fator da parcela principal foram dois manejos das plantas de cobertura (dessecadas com herbicida ou roçadas e as subparcelas, seis espécies de plantas de cobertura (Cajanus cajan cv. IAPAR 43, Crotalaria spectabilis, Crotalaria juncea, Mucuna pruriens, Pennisetum glaucum e vegetação natural, além da testemunha sem plantas de cobertura. O manejo roçado apresentou desempenho inferior no primeiro cultivo da alface, todavia não diferiu do manejo químico no segundo cultivo. A cobertura do solo com mucuna apresentou maior produtividade da alface no primeiro cultivo devido ao excesso de palha das demais coberturas, o qual prejudicou o estabelecimento da alface. No segundo cultivo não houve diferenças entre as coberturas. A roçagem de plantas de cobertura é uma opção viável para plantio direto de alface sem herbicidas.
Directory of Open Access Journals (Sweden)
Renata P. Sousa
Full Text Available ABSTRACT: The rhea (Rhea americana is an important wild species that has been highlighted in national and international livestock. This research aims to analyse embryo-foetal development in different phases of the respiratory system of rheas. Twenty-three embryos and foetuses were euthanized, fixed and dissected. Fragments of the respiratory system, including the nasal cavity, larynx, trachea, syrinx, bronchi and lungs, were collected and processed for studies using light and scanning electron microscopy. The nasal cavity presented cubic epithelium in the early stages of development. The larynx exhibited typical respiratory epithelium between 27 and 31 days. The trachea showed early formation of hyaline cartilage after 15 days. Syrinx in the mucous membrane of 18-day foetuses consisted of ciliated epithelium in the bronchial region. The main bronchi had ciliated epithelium with goblet cells in the syringeal region. In the lung, the parabronchial stage presented numerous parabronchi between 15 and 21 days. This study allowed the identification of normal events that occur during the development of the rhea respiratory system, an important model that has not previously been described. The information generated here will be useful for the diagnosis of pathologies that affect this organic system, aimed at improving captive production systems.
Directory of Open Access Journals (Sweden)
Carlos A. Rojas
2006-10-01
Full Text Available Introducción. La leishmaniasis cutánea americana es endémica en Colombia, donde cada año son notificados aproximadamente 6000 casos nuevos. En la actualidad las medidas de prevención y control están limitadas al diagnóstico y tratamiento de los casos. Objetivo. Evaluar la eficacia de una intervención múltiple para prevenir la transmisión de Leishmania en el foco endémico de Tumaco, costa Pacífica de Colombia. Materiales y métodos. Se realizó un ensayo de grupos aleatorizados. Veinte veredas fueron pareadas según prevalencia deLeishmania, habitantes y participación comunitaria y luego asignadas aleatoriamente a intervención o control. La intervención incluyó toldillos impregnados con deltametrina, repelente (N, N-dietil-m-toluamida 20% y Permetrina 0,5%, modificación de lugares de reposo para los vectores y educación. Al cabo de un año se comparó la incidencia de infección y enfermedad producida porLeishmania en los dos grupos, se monitorearon la adherencia a la intervención y la aparición de efectos adversos. Los resultados finales fueron ajustados por el efecto de correlación intra-grupo. Resultados. Se presentaron 10 casos de leishmaniasis cutánea americana en el grupo que recibió la intervención y 23 en el grupo control, OR=0,42, IC95% 0,14-1,26. La intervención tuvo un mayor efecto en los niños menores de 10 años, en aquellos que residían en la periferia de la vereda y en veredas con una prevalencia de infección en niños pequeños mayor del 1%. Se reportaron eventos adversos leves asociados con el uso de los toldillos impregnados y el repelente en 2% de los participantes. Conclusión. Los casos nuevos de Leishmaniasis cutánea americana se redujeron en un 58% en el grupo que recibió la intervención. Sin embargo, el número pequeño de casos hace que la estimación de la medida de efecto sea imprecisa y no nos permite afirmar que la intervención tiene un efecto protector. Poblaciones específicas podr
Directory of Open Access Journals (Sweden)
Álvaro Paúl Díaz
2012-01-01
Full Text Available Este estudio interpreta el ambiguo artículo 4.1 de la Convención Americana sobre Derechos Humanos, que dispone que el derecho a la vida deberá protegerse, "en general, a partir del momento de la concepción". Al hacerlo, toma en cuenta diversos sistemas de interpretación, y tiene presente lo registrado en los trabajos preparatorios de la Convención. Asimismo, este estudio analiza lo que la Comisión Interamericana ha resuelto en esta materia, evaluando el valor de tales decisiones. Este artículo concluye que, si bien una de las posibles interpretaciones de la Convención Americana sostiene que ella toleraría ciertas legislaciones nacionales que permitan el aborto en circunstancias excepcionales, ella declara la personalidad del nasciturus.This study interprets the ambiguous Article 4(1 of the American Convention on Human Rights, which establishes that life shall be protected "in general, from the moment of conception". When doing so, it pays attention to different interpretive systems, and takes into account what is recorded in the travaux préparatoires of the Convention. Likewise, this study analyzes what the Inter-American Commission has determined on this issue, and assesses the value of those decisions. This article concludes that, even though one of the possible interpretations of the American Convention affirms that it would tolerate domestic legislations providing for abortion in exceptional circumstances, it declares the unborn's personhood.
Directory of Open Access Journals (Sweden)
Dieter Wicher
2007-12-01
Full Text Available The metabolic state is one of the determinants of the general activity level. Satiety is related to resting or sleep whereas hunger correlates to wakefulness and activity. The counterpart to the mammalian satiety signal cholecystokinin (CCK in insects are the sulfakinins. The aim of this study was to resolve the mechanism by which the antifeedant activity of perisulfakinin (PSK in Periplaneta americana is mediated. We identified the sources of PSK which is used both as hormone and as paracrine messenger. PSK is found in the neurohemal organ of the brain and in nerve endings throughout the central nervous system. To correlate the distributions of PSK and its receptor (PSKR, we cloned the gene coding for PSKR and provide evidence for its expression within the nervous system. It occurs only in a few neurons, among them are the dorsal unpaired median (DUM neurons which release octopamine thereby regulating the general level of activity. Application of PSK to DUM neurons attenuated the spiking frequency (EC50=11pM due to reduction of a pacemaker Ca2+ current through cAMP-inhibited pTRPγ channels. PSK increased the intracellular cAMP level while decreasing the intracellular Ca2+ concentration in DUM neurons. Thus, the satiety signal conferred by PSK acts antagonistically to the hunger signal, provided by the adipokinetic hormone (AKH: PSK depresses the electrical activity of DUM neurons by inhibiting the pTRPγ channel that is activated by AKH under conditions of food shortage.
Directory of Open Access Journals (Sweden)
Escandón Gil Gonzalo
1989-12-01
Full Text Available En Palmira (Colombia entre 1984 y 1988 se caracterizó la colección de aguacate, Persia americana Mili. Se halló la ecuación de regresión AF = 89.25 + 0.60 (La -144, R2= 98.58 %, que permite estimar el área foliar (AF con el producto largo por ancho de las hojas (A. Las variedades Mayapan, Oriente 1, Oriente 3, Simonds y los materiales 2, 3, 4, 5 y 6 presentaron épocas de floración definidas, Trinidad y Material 2 presentaron floraciones bajas pero continuas. El porcentaje de flores que llegó a frutos osciló entre 0.03 % para Oriente 3 y 0.57 % para Trinidad. La mayor pérdida de estructuras reproductivas ocurrió en los primeros días de floración. El modelo logístico no describió correctamente el desarrollo de los frutos, por esto se utilizó el modelo de línea recta por fases. Los materiales 2 y 5 presentaron 105mayores pesos de frutos (621 y 626 g; el de menor peso fue Booth 8. La pérdida de peso del fruto durante la maduración fluctuó entre 3.5 Y 12.8 % para el material 2 y Oriente 3 respectivamente. Los materiales de mayor aceptación por la presentación del fruto y sabor fueron los materiales 1, 2 y 5.A collection of avocado, Persea americana Mill, was characterized in Palmira (Colombia between1984 and 1988. It was found that regretion equation AF = 89.25 + 0.60 (LA-144, R2 = 98.58 %, allows to estimate the foliar area with the product length x width of the leaves. The Mayapan, Oriente 1, Oriente 3, Simmonds and Materia.1 2,3,4,5,6, varieties showed defined blooming time, Trinidad and Material 2 showed low and continue blooming times. The percentajes of flowers that matured in fruit fluctuated between 0.03 % of Oriente 3 and 0.57 % for Trinidad. The greater loss proportion of reproductive structures occurred during the first days of flowering. The logistic model did not describe the right developments of fruits, that is why a straight line model by stages was used. Material 2 and 5 showed the greatest fruit weights during
International Nuclear Information System (INIS)
Song, Ningning; Zhang, Ximei; Wang, Fangli; Zhang, Changbo; Tang, Shirong
2012-01-01
General concern about increasing global atmospheric CO 2 levels owing to the ongoing fossil fuel combustion and elevated levels of radionuclides in the environment, has led to growing interest in the responses of plants to interactive effects of elevated CO 2 and radionuclides in terms of phytoremediation and food safety. To assess the combined effects of elevated CO 2 and cesium contamination on plant biomass, microbial activities in the rhizosphere soil and Cs uptake, Phytolacca americana Linn (pokeweed, C3 specie) and Amaranthus cruentus L. (purple amaranth, C4 specie) were grown in pots of soils containing five levels of cesium (0, 100, 300, 500 and 1000 mg Cs kg −1 ) under two levels of CO 2 (360 and 860 μL L −1 , respectively). Shoot and root biomass of P. americana and Amaranthus crentus was generally higher under elevated CO 2 than under ambient CO 2 for all treatments. Both plant species exhibited higher Cs concentration in the shoots and roots under elevated CO 2 than ambient CO 2 . For P. americana grown at 0, 100, 300, 500 and 1000 mg Cs kg −1 , the increase magnitude of Cs concentration due to elevated CO 2 was 140, 18, 11, 34 and 15% in the shoots, and 150, 20, 14, 15 and 19% in the roots, respectively. For A. cruentus, the corresponding value was 118, 28, 21, 14 and 17% in the shoots, and 126, 6, 11, 17 and 22% in the roots, respectively. Higher bioaccumulation factors were noted for both species grown under elevated CO 2 than ambient CO 2 . The populations of bacteria, actinomycetes and fungi, and the microbial C and N in the rhizosphere soils of both species were higher at elevated CO 2 than at ambient CO 2 with the same concentration of Cs. The results suggested that elevated CO 2 significantly affected plant biomass, Cs uptake, soil C and N concentrations, and community composition of soil microbes associated with P. americana and A. cruentus roots. The knowledge gained from this investigation constitutes an important advancement in
Modelos de educação geral na experiência universitária americana
Directory of Open Access Journals (Sweden)
José Camilo dos Santos Filho
2010-06-01
Full Text Available http://dx.doi.org/10.5007/1983-4535.2010v3n1p57 Em conseqüência da descentralização e da flexibilidade do sistema de educação superior e da grande autonomia das instituições universitárias nos Estados Unidos, não há obrigação legal de adoção de um programa de educação geral comum ou padrão para todo o país ou para todo um Estado da Federação. Por um lado, as instituições gozam de ampla liberdade e autonomia para conceberem seus programas de educação geral, o que tem levado a uma considerável variedade de abordagens institucionais da educação geral. Por outro lado, esse processo não impositivo tem levado ao longo do tempo a uma progressiva homogeneização básica de pressuposições e padrões semelhantes, mediante o processo de imitação dos programas das instituições de maior prestígio nacional. Robert Newton (2000 destaca esse caráter descentralizador e flexível da educação superior americana e a existência de quase tantos programas de educação geral quantos são os `colleges` e universidades do país. No entanto, acredita que, descartando-se os detalhes desses programas, podem emergir certas pressuposições e padrões esclarecedores. Desse modo, Newton propõe três abordagens que, no seu entender, podem fornecer um contexto para o planejamento, a compreensão e o aprimoramento de programas de educação geral. Os três modelos de educação geral dominantes atualmente nas universidades e ´colleges´ americanos são: o modelo centrado na disciplina acadêmica, o centrado nos Grandes Livros e o centrado na formação do cidadão efetivo. O propósito deste trabalho é analisar esses três modelos de educação geral adotados por essas instituições, destacando suas raízes históricas e as características básicas de cada um, à luz dos princípios subjacentes aos programas de educação geral. Cabe salientar que a discussão teórica e a prática efetiva de mais de cem anos de educação geral
Application of irradiation in bait production to the control of crawling insects in urban areas
Migdał, W.; Owczarczyk, H. B.; Świ ȩtosławski, J.; Świ ȩtosławski, J.
2000-03-01
The efficiency and palatability of two baits were studied to the control of crawling insects in urban areas: "Cockroach Kill Gel" for control of cockroaches and Faratox B for control of ants. Ionizing energy was used in producing the baits. It was concluded, that after irradiation the palatability of Faratox B improved and palatability of Cockroach Kill Gel did not change.
Application of irradiation in bait production to the control of crawling insects in urban areas
International Nuclear Information System (INIS)
Migdal, W.; Owczarczyk, H.B.; Swietoslawski, J.; Swietoslawski, J.
2000-01-01
The efficiency and palatability of two baits were studied to the control of crawling insects in urban areas: 'Cockroach Kill Gel' for control of cockroaches and Faratox B for control of ants. Ionizing energy was used in producing the baits. It was concluded, that after irradiation the palatability of Faratox B improved and palatability of Cockroach Kill Gel did not change
Application of irradiation in bait production to the control of crawling insects in urban areas
Energy Technology Data Exchange (ETDEWEB)
Migdal, W.; Owczarczyk, H.B.; Swietoslawski, J.; Swietoslawski, J
2000-03-01
The efficiency and palatability of two baits were studied to the control of crawling insects in urban areas: 'Cockroach Kill Gel' for control of cockroaches and Faratox B for control of ants. Ionizing energy was used in producing the baits. It was concluded, that after irradiation the palatability of Faratox B improved and palatability of Cockroach Kill Gel did not change.
Aluja, Martín; Díaz-Fleischer, Francisco; Arredondo, José
2004-04-01
The objective of this study was to determine the host status in Mexico of commercially cultivated and marketed avocado, Persea americana (Mill.), 'Hass' to Anastrepha ludens (Loew), Anastrepha obliqua (Macquart), Anastrepha serpentina (Wiedemann), and Anastrepha striata (Schiner) (Diptera: Tephritidae). Experiments in Michoacán, Mexico, were carried out in six orchards located at three altitudes above sea level during two times (August-October 2001 and April-June 2002). They included choice ('Hass' avocado plus natural host) and no-choice foraging behavior tests on trees under field cages; no-choice, forced infestation trials on caged, fruit-bearing branches in the field, and with individual fruit under laboratory conditions; infestation trials using 'Hass' avocados left unprotected over 1 and 7 d on the ground of orchards; studies to ascertain depth of oviposition and determine egg hatchability; and experiments to determine susceptibility by using time elapsed since removal of fruit from tree as the experimental variable. We trapped adult Anastrepha (n = 7,936) in all orchards and dissected fruit (n = 7,695) from orchards and packing houses (n = 1,620) in search of eggs or larvae. Most (96.7%) A. ludens, A. obliqua, A. striata, and A. serpentina adults were captured in low-elevation orchards. No eggs or larvae were detected in any of the fruit from foraging behavior studies or dissected fruit from orchards or packing houses. Of 5,200 mature, intact fruit on trees in the field forcibly exposed to no-choice female oviposition activity (five females/fruit), we only found four fruit infested by A. ludens but no adults emerged. 'Hass' avocados only became marginally susceptible to attack by A. ludens (but not A. obliqua, A. serpentina, and A. striata) 24 h after being removed from the tree. Fruit placed on the ground in orchards (n = 3,600) were occasionally infested by Neosilba batesi (Curran) (Diptera: Lonchaeidae), a decomposer, but not Anastrepha spp. Based on our
Directory of Open Access Journals (Sweden)
Amanda Brentano Almeida
Full Text Available This study aimed to verify the occurrence of antibodies againstToxoplasma gondii in rheas (Rhea americana and ostriches (Struthio camelus commercially breeding in Brazil. Blood samples from 20 rheas and 46 ostriches (young and adults were serologically tested using a technique known as modified agglutination test (MAT at an initial titration of 1:16 for ostriches and 1:25 for rheas. Antibodies against T. gondii were found in 50% (10/20 of the rheas, with titers ranging from 1:25 to 1:6,400. The incidence of antibodies against T. gondii in ostriches was 17.4% (8/46 with titers ranging from 1:16 to 1:256. Birds showing titers higher than 1:200 forT. gondii were mainly the young ones. Therefore, rheas and ostriches may be parasitized by T. gondii, showing high levels of antibodies against this parasite.
Lopes, Rafael Henrique Oliveira; Macorini, Luis Fernando Benitez; Antunes, Katia Ávila; Espindola, Priscilla Pereira de Toledo; Alfredo, Tamaeh Monteiro; da Rocha, Paola Dos Santos; Pereira, Zefa Valdivina; Dos Santos, Edson Lucas; de Picoli Souza, Kely
2016-01-01
High levels of reactive oxygen species in the body and hyperlipidemia are key factors for the development of cardiovascular diseases such as atherosclerosis. The present study investigated the antioxidant and hypolipidemic activity of hydroethanolic extract of Curatella americana L. leaves (ExC). The antioxidant activity of ExC was assessed by 2,2-diphenyl-1-picrylhydrazyl free radical (DPPH) scavenging capacity and protection against hemolysis induced by 2,2'-azobis(2-amidinopropane) dihydrochloride (AAPH), followed by quantification of malondialdehyde (MDA). Wistar rats with hyperlipidemia induced by high-fructose diet (60%) were treated for 60 days with water, simvastatin (30 mg·Kg(-1)), ciprofibrate (2 mg·Kg(-1)), and ExC (200 mg·Kg(-1)). ExC revealed IC50 of 6.0 ± 0.5 μg·mL(-1), an intermediary value among positive controls used in the assay of DPPH scavenging capacity. At all concentrations (50 to 125 μg·mL(-1)) and times (60 to 240 min) evaluated, ExC protected erythrocytes against AAPH-induced hemolysis, which was confirmed by lower MDA levels. In vivo tests showed a reduction of 34 and 45%, respectively, in serum concentration of cholesterol and triglycerides in hyperlipidemic rats treated with ExC, a similar effect compared to the reference drugs, simvastatin and ciprofibrate, respectively. Together, the results showed the antioxidant activity of ExC and its ability to improve the serum lipid profile in hyperlipidemic rats.
Leishmaniasis tegumentaria americana: encuesta epidemiológica en una comunidad indígena
Directory of Open Access Journals (Sweden)
Martha Wolff
1988-01-01
Full Text Available Se realizó un estudio epidemiológico sobre Leishmaniasis tegumentarla americana (LTA en 809 personas del Resguardo Indígena de San Andrés de Sotavento, Departamento de Córdoba, foco endémico tanto de Leishmaniasis cutánea como de Leishmaniasis visceral. La distribución por sexo de la población encuestada fue de 355 (43,9% hombres y 454 (56, 1% mujeres; sus índices alérgicos fueron de 36,9% y 40,5% respectivamente. La positividad de la Intradermorreacción de Montenegro ascendió en personas de ambos sexos, a medida que aumentó la edad. El índice parasitario fue de 0.37%. La especie de Lutzomyia más frecuente en el intra y peridomicilio fue la Lu. evansi que mostró comportamiento antropofílico. Se encontró una alta exposición de la población general al vector dada la facilidad de penetración de los flebotomineos alintradomicilio, por el tipo de construcción de las viviendas; además, al no existir servicios sanitarios, acueductos ni alcantarillados Intradomiciliarios, todo el núcleo familiar debe desplazarse al peridomicilio para la disposición de excretas y en busca del agua. Otros hallazgos fueron el gran desconocimiento sobre la etiología y tratamiento de la Leishmaniasis y las pésimas condiciones sociales y económicas de la región.
Chioquetta, Gabriela Dotti
2012-01-01
Anais do I Encontro de Iniciação Científica e de Extensão da Unila - Sessão de Artes e Linguística - 05/06/12 - 14h00 às 18h00 - Unila-Centro - Sala 16 - 3o Piso O objetivo deste projeto é o levantamento histórico e estético da arte latino americana, visando a publica - ção de um livro. Para isso criou-se o GIPE Grupo Interdisciplinar de Pesquisas em Estética Latino Ameri - cana, registrado no CNPQ. Sabendo-se da amplitude da iniciativa, decidiu-se pela divisão do trabalho em doze...
Directory of Open Access Journals (Sweden)
Rodrigo C. VERGARA, Alejandra TORRES-ARANEDA, Diego A. VILLAGRA, Robert A. RAGUSO, Mary T. K. ARROYO, Cristian A. VILLAGRA
2011-04-01
Full Text Available The study of multi-modal communication has only recently been extended to innate and learned interactions between flowers and their animal visitors, and usually only to pollinators. Here we studied the relevance of floral scent and visual display of a night blooming, putatively hawkmoth-pollinated plant Oenothera acaulis (Onagraceae in the attraction of non-native cockroaches Blatta orientalis (Blattodea: Blattidae, which function as facultative floral larcenists in coastal habitats of central Chile. We experimentally decoupled visual (corolla and olfactory (fragrance stimuli by presenting paper corollas and green mesh bags, with or without a freshly-picked natural flower inside. We then contrasted the behavioral responses of roaches in these treatments with those to the natural combination of traits in actual flowers and their respective control treatments, measuring the roaches’ frequency of first visits, mean and total residence time spent in each treatment. The roaches primarily used olfactory cues when approaching O. acaulis flowers at two biologically relevant spatial scales. In addition, the presence of conspecific roaches had a strong influence on recruitment to the experimental arena, increasing the statistical differences among treatments. Our results suggest a primacy of floral fragrance over visual stimuli in the foraging responses of B. orientalis. Olfactory cues were necessary and sufficient to attract the roaches, and the visual cues presented in our manipulations only marginally increased their attraction within a 20 cm diameter of the stimulus. The full spectrum of floral visitation behavior was not elicited by the artificial flowers, suggesting the need for additional tactile or contact chemosensory stimuli not provided by paper. Although the nitrogenous scent compounds that we found in O. acaulis flowers are almost exclusively found in hawkmoth-pollinated flowers, the attractiveness of these compounds to a non
Utilization of modified starch from avocado (Persea americana Mill.) seed in cream soup production
Cornelia, M.; Christianti, A.
2018-01-01
Avocado (Persea americana Mill.) seed was often seen as waste and underutilized resources, especially in the food industry. The aim of this research was to modify the structure of avocado seed starch using the cross-linking method, to improve the viscosity stability in the cream soup. In the preliminary research, starch was isolated from the seed and modified by STPP (sodium tripolyphosphate) with 2%, 4%, and 6% concentration and were reacted for 1, 2, and 3 hours. Starches were analyzed for moisture and ash content, paste clarity, gel strength, swelling power, solubility, yield, and degree of whiteness. Based on the analysis results, the best reaction time and STPP concentration was 6% at 1 hour reaction time. Native starch and the best-modified starch were applied in the cream soup and compared with commercial cream soup. Cream soups were analyzed for viscosity stability using viscometer in 0, 1, 3, and 5 hours after storage in room temperature. The result showed that cream soup using modified starch has better viscosity stability than native starch and commercial cream soup after 5 hours storage, which was 181.7 ± 4.85 cP. Sensory analysis showed that cream soup using modified starch was more acceptable than the others. Avocado seed modified starch has phosphate group that strengthen the starch chain to prevent viscosity breakdown.
Hausmann, Jennifer C; Cray, Carolyn; Hartup, Barry K
2015-09-01
Protein electrophoresis of serum samples from endangered, wild whooping cranes ( Grus americana ) was performed to help assess the health of the only self-sustaining, migratory population in North America. Serum samples from wild adult cranes (n = 22) were taken at Aransas National Wildlife Refuge, Texas, USA during winter. Wild juvenile cranes (n = 26) were sampled at Wood Buffalo National Park, Northwest Territories, Canada, in midsummer. All captive crane samples were acquired from the International Crane Foundation, Baraboo, WI, USA. Captive adult cranes (n = 30) were sampled during annual examinations, and archived serum samples from captive juvenile cranes (n = 19) were selected to match the estimated age of wild juveniles. Wild juveniles had significantly lower concentrations of all protein fractions than wild adults, except for prealbumin and γ globulins. All protein fraction concentrations for wild juveniles were significantly lower compared with captive juveniles, except for prealbumin and γ globulins, which were higher. Wild adults had significantly greater γ globulin concentrations than captive adults. Captive juveniles had significantly lower prealbumin and albumin concentrations and albumin : globulin ratios than captive adults. The higher γ globulin concentrations in wild versus captive cranes are likely because of increased antigenic exposure and immune stimulation. Protein fraction concentrations vary significantly with age and natural history in this species. Reference intervals for serum protein electrophoresis results from captive adult whooping cranes are provided in this study.
Directory of Open Access Journals (Sweden)
H. Cuiris-Pérez
2009-01-01
Full Text Available El presente estudio se efectuó para determinar la existencia de diversidad genética dentro de una colección de germoplasma de aguacate (Persea americana Mill. perteneciente al Instituto Nacional de Investigaciones Forestales, Agrícolas y Pecuarias (INIFAP, Campo Experimental Uruapan (CEFAP-Uruapan. Se investigó la relación parental entre 77 accesiones (231 plantas de la raza Mexicana con el uso de siete ISSRs (Inter Simple Sequence Repeat microsatellites, en inglés. En total se detectaron 154 loci. El porcentaje de polimorfismo varió de 82.3 a 95.4, con un número de bandas entre 17 y 25 dentro de las accesiones. El análisis de similitud genética reveló la formación de dos grupos principales, uno con once subgrupos y el otro con tres subgrupos. La similitud genética fue más alta entre las accesiones 237 (Atlixco, Puebla y XTC01 (Uruapan, Michoacán, mientras que las accesiones 532 (Atlixco, Puebla y 369 (Chilchota, Michoacán fueron las más disímiles. No se encontraron duplicados en los genotipos analizados. En general, el presente estudio demostró la utilidad del análisis mediante ISSRs para la determinación de diversidad genética en aguacate.
Directory of Open Access Journals (Sweden)
Alex L. Vasconcelos
Full Text Available Abstract Inserted in one of the largest families among the Angiosperms, Genipa americana L., Rubiaceae, can be found in all Brazilian territory, presenting great medicinal importance, where several uses have been attributed. In view of this, this work has the purpose of analyzing the ultrastructural, biomineral, phytochemical and histochemical characteristics of the leaves of this native species from Brazil. For this, light microscopy, polarization and scanning electron microscopy techniques were used with X-ray scattering energy, associated to chromatographic and histochemical tests. The anatomical ultrastructural characteristics of the leaves detailed information about the type and arrangement of the cuticle, trichomes, surface and arrangement of the tissues that determine the botanical identity of this species. The phytochemical tests allowed determining their chromatographic pattern and histochemistry to determine the exact storage site of these substances in the leaf. It was observed that the characterization of the crystalline macro-pattern present in the analyzed species, as well as its exact elemental composition, can be considered an important differential diagnosis factor. The results characterize the leaves of this species in different aspects, being a native species and pharmacologically promising, with different popular uses and proven pharmacological activities, and more in depth studies is needed.
Brown, Megan E; Converse, Sarah J.; Chandler, Jane N.; Shafer, Charles; Brown, Janine L; Keefer, Carol L; Songsasen, Nucharin
2016-01-01
Reproductive success of endangered whooping cranes (Grus americana) maintained ex situ is poor. As part of an effort to identify potential causes of poor reproductive success in a captive colony, we used non-invasive endocrine monitoring to assess gonadal and adrenal steroids of bird pairs with various reproductive outcomes and evaluated the relationships of hormones and behaviors to reproductive performance. Overall, reproductively successful (i.e., egg laying) females had significantly higher mean estrogen levels but lower mean progestogen concentrations than did unsuccessful females. Other hormones, including glucocorticoids and androgens, were not significantly different between successful and unsuccessful individuals. Observations of specific behaviors such as unison calling, marching, and the number of copulation attempts, along with overall time spent performing reproductive behaviors, were significantly higher in successful pairs. Our findings indicate that overall reproductive performance of whooping crane pairs is linked to female gonadal hormone excretion and reproductive behaviors, but not to altered adrenal hormone production.
Brown, Megan E; Converse, Sarah J; Chandler, Jane N; Shafer, Charles; Brown, Janine L; Keefer, Carol L; Songsasen, Nucharin
2016-05-01
Reproductive success of endangered whooping cranes (Grus americana) maintained ex situ is poor. As part of an effort to identify potential causes of poor reproductive success in a captive colony, we used non-invasive endocrine monitoring to assess gonadal and adrenal steroids of bird pairs with various reproductive outcomes and evaluated the relationships of hormones and behaviors to reproductive performance. Overall, reproductively successful (i.e., egg laying) females had significantly higher mean estrogen levels but lower mean progestogen concentrations than did unsuccessful females. Other hormones, including glucocorticoids and androgens, were not significantly different between successful and unsuccessful individuals. Observations of specific behaviors such as unison calling, marching, and the number of copulation attempts, along with overall time spent performing reproductive behaviors, were significantly higher in successful pairs. Our findings indicate that overall reproductive performance of whooping crane pairs is linked to female gonadal hormone excretion and reproductive behaviors, but not to altered adrenal hormone production. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Szymon Chowański
Full Text Available Protective mechanisms against cold stress are well studied in terrestrial and polar insects; however, little is known about these mechanisms in tropical insects. In our study, we tested if a tropical cockroach Gromphadorhina coquereliana, possesses any protective mechanisms against cold stress. Based on the results of earlier studies, we examined how short-term (3 h cold (4°C influences biochemical parameters, mitochondrial respiration activity, and the level of HSPs and aquaporins expression in the fat body and leg muscles of G. coquereliana. Following cold exposure, we found that the level of carbohydrates, lipids and proteins did not change significantly. Nevertheless, we observed significant changes in mitochondrial respiration activity. The oxygen consumption of resting (state 4 and phosphorylating (state 3 mitochondria was altered following cold exposure. The increase in respiratory rate in state 4 respiration was observed in both tissues. In state 3, oxygen consumption by mitochondria in fat body was significantly lower compared to control insects, whereas there were no changes observed for mitochondria in muscle tissue. Moreover, there were cold-induced changes in UCP protein activity, but the changes in activity differed in fat body and in muscles. Additionally, we detected changes in the level of HSP70 and aquaporins expression. Insects treated with cold had significantly higher levels of HSP70 in fat body and muscles. On the other hand, there were lower levels of aquaporins in both tissues following exposure to cold. These results suggest that fat body play an important role in protecting tropical insects from cold stress.
Directory of Open Access Journals (Sweden)
Leila Martins
2010-06-01
Full Text Available Foi realizado diagnóstico para leishmaniose tegumentar americana a partir de sangue de pacientes residentes em dois municípios endêmicos do estado de Pernambuco. O DNA de 119 amostras de sangue foi extraído e submetido a reação em cadeia da polimerase. Utilizaram-se primers do minicírculo do DNA do cinetoplasto (kDNA de Leishmania braziliensis, circulante em Pernambuco, cuja seqüência-alvo gera um fragmento de 750 pares de bases. No total 58 (48,7% indivíduos apresentaram amplificação positiva e 61 (51,3% negativa. Das amostras positivas para a PCR, 37 (≅ 64% pertenciam a indivíduos tratados e sem lesão. Conclui-se que a técnica de PCR é eficaz para identificar o DNA de leishmânia em material de biópsias e em sangue venoso.Fue realizado diagnóstico para leishmaniosis tegumentaria americana a partir de sangre de pacientes residentes en dos municipios endémicos del estado de Pernambuco (Noreste de Brasil. El DNA de 119 muestras de sangre fue extraído y sometido a la reacción en cadena de la polimerasa. Se utilizaron primers del minicírculo del DNA del cinetoplasto (kDNA de Leishmania braziliensis, circulante en Pernambuco, cuya secuencia blanco genera un fragmento de 750 pares de bases. En total 58 (48,7% individuos presentaron amplificación positiva y 61 (51,3% negativa. De las muestras positivas para la PCR, 37 (≅64% pertenecían a individuos tratados y sin lesión. Se concluyó que la técnica de la PCR es eficaz para identificar el DNA de Leishmania en material de biopsias y en sangre venosa.Diagnostic tests for American tegumentary leishmaniasis were performed on blood samples of patients living in two endemic municipalities in the state of Pernambuco, Northeastern Brazil. DNA was extracted from 119 samples and used as template for polymerase chain reaction (PCR analysis. The tests used primers specific for the kinetoplast mini-circle DNA (kDNA of Leishmania braziliensis, a species circulating in Pernambuco, which
Padmanabhan, Monika; Arumugam, Geetha
2014-06-01
Persea americana, commonly known as avocado, is traditionally consumed fruit which possesses body fat lowering capacity. Adiponectin plays an important role in regulating obesity. In this study, the effect of hydro-alcoholic fruit extract of P. americana (HAEPA) on the level of blood lipids, glutathione, lipid peroxidation products, adiponectin and peroxisome proliferator activated receptor (PPAR)-γ expressions was investigated in rats fed a high-fat diet (HFD). Male Sprague Dawley rats were divided into four groups: groups 1 and 2 were fed normal rat chow (5% fat) and groups 3 and 4 were fed HFD (23% fat) for a period of 14 weeks. In addition, groups 2 and 4 rats were administered orally with 100 mg/kg body weight of HAEPA from third week. After 14 weeks, rats were sacrificed, and serum/plasma levels of total cholesterol, phospholipids, triglyceride, high-density lipoprotein (HDL), low-density lipoprotein (LDL) and adiponectin were determined. The mRNA expression of adiponectin, PPAR-γ and protein expression of PPAR-γ were also evaluated. The body mass index (BMI), total fat pad mass and adiposity index were significantly decreased in HAEPA co-administered rats than in HFD-fed rats. The levels of LDL and lipid peroxides were significantly higher in HFD group than in HFD+HAEPA group. Levels of reduced glutathione, adiponectin, mRNA expression of adiponectin, PPAR-γ and protein expression of PPAR-γ were found to be increased in HFD+HAEPA group than in HFD group. The hypolipidemic effect of HAEPA is also evidenced by the histological observations in liver, heart and adipose tissue. The results indicate that HAEPA exhibits hypolipidemic activity probably by increasing the mRNA expression of adiponectin and PPAR-γ, which reduce the risk of hyperlipidemia and obesity.
Enfermedad de Chagas o Tripanosomiasis Americana.
Directory of Open Access Journals (Sweden)
Felipe Guhl
2000-08-01
Full Text Available
Situación Actual de Colombia.
La enfermedad de Chagas o tripanosomiasis americana es una enfermedad parasitaria crónica causada por un protozoario flagelado el Trypanosoma cruzi, descrito por primera vez por Carlos Chagas, médico brasileño, a comienzos de este siglo y en su honor se denominó la enfermedad que lleva su nombre.
Este parásito normalmente se transmite al ser humano a través de insectos triatomíneos estrictamente hematófagos de la familia Reduviidae, en el momento en que perforan la piel para succionar la sangre que los alimenta.
Sin embargo, no se inocula directamente por intermedio de las estructuras bucales del insecto en el momento de la picadura como en el caso de las tripanosomiasis africanas, si no que se deposita pasivamente en la piel a través de las heces del insecto, penetrando en el cuerpo por la herida que causa la picadura u otras abrasiones de la piel o de la mucosa. El T. cruzi, también puede transmitirse por infección congénita, por transfusión de sangre contaminada o por el transplante de órganos contaminados. El ciclo vital del parásito es largo y complejo y su desarrollo tiene varias etapas, tanto en el vector triatomineo como en el huésped vertebrado .
La Enfermedad de Chagas constituye una amenaza permanente para casi la cuarta parte de toda la población de América Latina. Si bien la enfermedad se encuentra presente en toda América Central y del Sur, sus manifestaciones y características epidemiológicas son altamente variables entre una y otra zona endémica. Existe una gran diversidad en las tasas de prevalencia, formas de transmisión, características parasitarias, patología clínica, vectores y reservorios.
Más que cualquier otra enfermedad parasitaria, la enfermedad de Chagas se relaciona con el desarrollo económico y social de la población: los insectos triatomineos y las enfermedades que ellos transmiten existirán mientras en
Directory of Open Access Journals (Sweden)
França, Eduardo Luzia
2009-01-01
Conclusões: a análise dos dados revelou que a Leishmaniose Tegumentar Americana é uma parasitose importante no município de Juína. Os dados sugerem relação com a atividade laboral e um perfil de transmissão predominantemente silvestre, o que deve ser levado em conta ao definir medidas de controle da doença na região
Directory of Open Access Journals (Sweden)
E.D. Velini
2005-06-01
Full Text Available Este trabalho foi realizado na UHE Americana, pertencente à Companhia Paulista de Força e Luz, e faz parte de um projeto de pesquisa e desenvolvimento realizado em conjunto com a Faculdade de Ciências Agronômicas (UNESP de Botucatu. Foram realizadas amostragens de água e sedimento nos meses de outubro e dezembro de 2003 e fevereiro, abril e junho de 2004. Selecionaram-se seis pontos de coleta no reservatório, sendo cinco a montante da barragem e um a jusante. Levantamentos de flora foram realizados nos meses de dezembro de 2003 e abril e julho de 2004, sendo constatados elevados teores de nitrogênio e fósforo nas amostras de água, com valores médios de 3,867 mg L-1 para nitrato, 0,706 mg L-1 para amônia, 1,372 mg L-1 para nitrito e 151,979 µg L-1 para fosfato dissolvido na água. O sedimento apresentou elevado nível de fertilidade, com médias de 32,18 g kg-1 para matéria orgânica, 68,87 mg dm-3 para P, 36,96 mmol dm-3 para Ca e 11,88 mmol dm-3 para Mg. Espécies marginais e flutuantes foram as principais infestantes do reservatório, destacando-se Brachiaria subquadripara, Eichhornia crassipes, Pistia stratiotes e Salvinia auriculata.This work was carried out at the Americana Reservoir, owned by Companhia Paulista de Força e Luz, and was part of a joint R & D project with Faculdade de Ciências Agronômicas - Botucatu - São Paulo - Brazil. Water and sediment samplings were collected in October and December 2003 and February, April and June 2004. Six sampling points were selected, being five upstream the barrage and one downstream. Flora assessment was carried out in December 2003, April and July 2004. High levels of nitrogen and phosphorus were observed in the water samples with average values of 3.867 mg L-1 for nitrate, 0.706 mg L-1 for ammonia, 1.372 mg L-1 for nitrite and 151.979 µg L-1 for phosphate dissolved in water. Sediment presented a high level of fertility with mean values of 31.18 g kg-1 for organic matter, 68
Directory of Open Access Journals (Sweden)
Rafael Henrique Oliveira Lopes
2016-01-01
Full Text Available High levels of reactive oxygen species in the body and hyperlipidemia are key factors for the development of cardiovascular diseases such as atherosclerosis. The present study investigated the antioxidant and hypolipidemic activity of hydroethanolic extract of Curatella americana L. leaves (ExC. The antioxidant activity of ExC was assessed by 2,2-diphenyl-1-picrylhydrazyl free radical (DPPH scavenging capacity and protection against hemolysis induced by 2,2′-azobis(2-amidinopropane dihydrochloride (AAPH, followed by quantification of malondialdehyde (MDA. Wistar rats with hyperlipidemia induced by high-fructose diet (60% were treated for 60 days with water, simvastatin (30 mg·Kg−1, ciprofibrate (2 mg·Kg−1, and ExC (200 mg·Kg−1. ExC revealed IC50 of 6.0±0.5 μg·mL−1, an intermediary value among positive controls used in the assay of DPPH scavenging capacity. At all concentrations (50 to 125 μg·mL−1 and times (60 to 240 min evaluated, ExC protected erythrocytes against AAPH-induced hemolysis, which was confirmed by lower MDA levels. In vivo tests showed a reduction of 34 and 45%, respectively, in serum concentration of cholesterol and triglycerides in hyperlipidemic rats treated with ExC, a similar effect compared to the reference drugs, simvastatin and ciprofibrate, respectively. Together, the results showed the antioxidant activity of ExC and its ability to improve the serum lipid profile in hyperlipidemic rats.
Los aportes de una antropología americana en el pensamiento de Rodolfo Kusch
Directory of Open Access Journals (Sweden)
Dina Picotti
2010-01-01
Full Text Available El presente texto versa sobre la propuesta de Rodolfo Kusch en torno a una antropología del hombre americano a partir de un recorrido por algunas obras insignes de su pensamiento antropológico. El trabajo parte de la pro - blematización de la categoría de situación. A partir de ciertas distinciones filosóficas establecidas entre ser y estar , la autora aborda la cuestión de la identidad americana como pueblo , para indicar la manera en que el habla popular, en su nombrar y callar, es la base de lo que pueda ser el hombre ame - ricano. Después de la descripción de la consolidación del hombre americano tras el dualismo mito-razón y la formulación de la inconmensurabilidad del hombre americano ante criterios que resultan discordes, se sugiere otro modo de pensar, en este caso, de concebir una antropología, otra línea de encarar lo humano en relación con el orden vigente. De esta manera, se postula la idea de que el problema de América es el de recuperar toda la potencialidad del pensar y saber apostar al futuro, lo cual se realiza a partir de la revisión de los niveles económicos, educativos y artísticos del hombre americano.
Pickens, Bradley A.; King, Sammy L.; Vasseur, Phillip L.; Zimorski, Sara E.; Selman, Will
2017-01-01
Eleven of 15 species of cranes (family: Gruidae) are considered vulnerable or endangered, and the increase of agriculture and aquaculture at the expense of natural wetlands and grasslands is a threat to Gruidae worldwide. A reintroduced population of Whooping Crane (Grus americana) was studied in coastal and agricultural wetlands of Louisiana and Texas, USA. The objectives were to compare Whooping Crane movements across seasons, quantify multiscale habitat selection, and identify seasonal shifts in selection. Whooping Cranes (n = 53) were tracked with satellite transmitters to estimate seasonal core-use areas (50% home range contours) via Brownian bridge movement models and assess habitat selection. Whooping Crane core-use areas (n = 283) ranged from 4.7 to 438.0 km2, and habitat selection changed seasonally as shallow water availability varied. Whooping Crane core-use areas were composed of more fresh marsh in spring/summer, but shifted towards rice and crawfish (Procambarus spp.) aquaculture in the fall/winter. Within core-use areas, aquaculture was most strongly selected, particularly in fall when fresh marsh became unsuitable. Overall, the shifting of Whooping Crane habitat selection over seasons is likely to require large, heterogeneous areas. Whooping Crane use of agricultural and natural wetlands may depend on spatio-temporal dynamics of water depth.
Directory of Open Access Journals (Sweden)
P. N. Pedrosa
1974-06-01
Full Text Available Acentuando a necessidade da continuação das pesquisas terapêuticas em pacientes com paracoccidioidose (blastomicose sul-americana, os autores apresentam 23 pacientes submetidos a diferentes esquemas terapêuticos, sendo 14 virgens de tratamento e 9 com uso prévio de uma ou mais drogas. A associação sulfametoxazol + trimetoprim ( SMZ + TMP foi empregada em 5 pacientes virgens de tratamento e 9 sulfa-resistentes. Outros sete foram submetidos ao esquema clássico com sulfadoxina. Os pacientes que não responderam aos dois esquemas anteriores, com exceção de dois casos inicialmente graves, receberam anfotericina B. A avaliação clínica, radiológica, micológica e sorológica a longo prazo não demonstrou vantagens no emprego de SMZ + TMP em substituição aos sulfamídicos, nos pacientes virgens de tratamento. Entretanto, a associação SMZ + TMP parece ser uma opção válida nos casos sulfa-resistentes, onde teria primazia, considerando-se a toxicidade e necessidade de controle em regime hospitalar da anfotericina B. Ressaltam ainda a boa tolerância clínica e laboratorial da associação SMZ + TMP em cursos terapêuticos prolongados de até 2 anos, quando empregadas em baixas doses de manutenção.
Directory of Open Access Journals (Sweden)
Nayara Torre de Almeida
2012-06-01
Full Text Available O presente artigo constitui um relato de experiência do processo de planejamento e implementação do projeto "Recreio nas Férias" em um dos núcleos do Programa Segundo Tempo, localizado no bairro Vila Jones na cidade Paulista de Americana. O Projeto "Recreio nas Férias" é uma iniciativa do Ministério do Esporte, implantada em 2009 com o objetivo de, no período de férias escolares, oferecer às crianças e adolescentes participantes do programa, opções de esporte e lazer (e.g., atividades lúdicas, esportivas, artísticas, culturais, sociais e turísticas que "preencham o seu tempo livre de forma prazerosa e ao mesmo tempo construtiva" (BRASIL, 2010. Confrontando tais objetivos com os estudos mais atuais no campo do lazer é possível perceber que, no campo das políticas públicas, ainda permanece a visão histórica que tende a tratar o lazer como ocupação do tempo ocioso, principalmente quando se trata das propostas voltadas às classes populares. Isso fica evidente na preocupação explícita de "preencher o tempo livre", enfatizando seu caráter ocupacional. Nesse sentido, tecemos algumas aproximações com estudos de Silva (2003, 2008 e Marcellino (1995, 2001, 2008 compreendendo o lazer como uma das possibilidades de vivência do lúdico e construção da cidadania, ou seja, buscando responder a seguinte questão: pode o lazer assumir outro papel, senão este "ocupacional" historicamente observado nas políticas de esporte e lazer voltadas às classes populares?This study reports the planning and the implementation of the program "Recreio nas Férias" in one of the centers of the program "Second Half" ("Programa Segundo Tempo", located in Vila Jones in the Brazilian city of Americana, State of São Paulo. The program "Leisure During the School Break" ("Recreio nas Férias" is a project of the Ministry of Sports, lounged in 2009. The aim was, during the school break, to provide children and adolescents with sports and leisure
Mindaye, S T; Spiric, J; David, N A; Rabin, R L; Slater, J E
2017-12-01
German cockroach (GCr) allergen extracts are complex and heterogeneous products, and methods to better assess their potency and composition are needed for adequate studies of their safety and efficacy. The objective of this study was to develop an assay based on liquid chromatography and multiple reaction monitoring mass spectrometry (LC-MRM MS) for rapid, accurate, and reproducible quantification of 5 allergens (Bla g 1, Bla g 2, Bla g 3, Bla g 4, and Bla g 5) in crude GCr allergen extracts. We first established a comprehensive peptide library of allergens from various commercial extracts as well as recombinant allergens. Peptide mapping was performed using high-resolution MS, and the peptide library was then used to identify prototypic and quantotypic peptides to proceed with MRM method development. Assay development included a systematic optimization of digestion conditions (buffer, digestion time, and trypsin concentration), chromatographic separation, and MS parameters. Robustness and suitability were assessed following ICH (Q2 [R1]) guidelines. The method is precise (RSD 0.99, 0.01-1384 fmol/μL), and sensitive (LLOD and LLOQ MS, we quantified allergens from various commercial GCr extracts and showed considerable variability that may impact clinical efficacy. Our data demonstrate that the LC-MRM MS method is valuable for absolute quantification of allergens in GCr extracts and likely has broader applicability to other complex allergen extracts. Definitive quantification provides a new standard for labelling of allergen extracts, which will inform patient care, enable personalized therapy, and enhance the efficacy of immunotherapy for environmental and food allergies. © 2017 The Authors. Clinical & Experimental Allergy published by John Wiley & Sons Ltd. This article has been contributed to by US Government employees and their work is in the public domain in the USA.
UJI STABILITAS FORMULA KRIM TABIR SURYA EKSTRAK UMBI BAWANG DAYAK (Eleutherine americana L. Merr.
Directory of Open Access Journals (Sweden)
Islamudin Ahmad
2013-12-01
Full Text Available Has conducted research on formulation and stability of sunscreen cream onion bulb extract dayak ( Eleutherine Americana L. Merr . . From the empirical data for the onions dayak has been used as an anti- cancer prevention and treatment by people of Borneo so it needs to be further investigated to obtain the data laboratory to support the empirical data . Several classes of secondary metabolites found in the bulbs of onions dayak alkaloids , glycosides , flavonoids , phenolics , steroids and tannins . The study was conducted as the basis for the formulation of sunscreen preparations aimed at the prevention of skin cancer . The study was conducted with bulb onions dayak extraction using Soxhlet method with solvent n - hexane , ethyl acetate , n - butanol , and ethanol as the active ingredient of the formula of making preparations . Tests conducted on formulations A and B with the concentration of garlic bulb extract dayak by 0.1% , consisting of physical stability test ( organoleptic , homogeneity and chemical ( pH and dosage in order to obtain a stable dosage formula . The test results obtained on the organoleptic test was no change in the observations made on each preparation before and after storage at room temperature on day - 7 , -14 , and -21 . Then the homogeneity test of the hedonic test results at 95% confidence level ( SNI 01-2346-2006 , concluded that the homogeneity of the preparation in all formulas produced in the category of smooth . Further testing on the pH stability and pH 5.5 to 8.0 to be produced that Formula A and Formula B to pH 7.0 to 7.7 with various concentrations of the extract , after 21 days of storage , inferred pH remains stable and safe dosage for used ( SNI 16-4399-1996 as formula sunscreen preparations made from onion bulb extract dayak . Key words : bulb onions dayak, sunscreen, formulas, test stability, skin cancer ABSTRAK Telah dilakukan penelitian mengenai formulasi dan stabilitas krim tabir surya ekstrak
Directory of Open Access Journals (Sweden)
Cristiano S. de Azevedo
2006-03-01
Full Text Available Human activities have been diminishing greater rhea Rhea americana (Linnaeus, 1758 populations throughout their natural distribution. The reintroductions of captive-born greater rheas have been tried but without success; since the individuals reintroduced were killed by predators. Captive-born animals that have been isolated from predators for many generations can lose their predator recognition abilities. To enhance the survival rates of the reintroduced animals, researchers are now using antipredator training techniques. We studied the response of 15 zoo-borne greater rheas to antipredator training. The animals were divided into three groups: two test groups and one control group. We ran 15 antipredator tests and four control testes with each group. Antipredator tests consisted of pairing a taxidermized predator model or a real predator (domestic dog with a simulation of a capture procedure. Control tests consisted of presenting the predator model (jaguar to the birds, after training but not associating it with an aversive event and recording behavioural responses. All tests were video-recorded and analysed a posteriori. Results showed that the trained rheas responded appropriately to the predators, becoming more vigilant and that there was considerable individual differences in response to antipredator training. The results demonstrated that antipredator training is effective and therefore an invaluable tool for reintroduction projects involving greater rheas. Furthermore, the methods employed in this research project should be applicable to other species of flightless birds.As atividades humanas têm diminuído as populações de emas Rhea americana (Linnaeus, 1758 por toda sua área de distribuição. Reintroduções de emas nascidas em cativeiro têm sido tentadas, mas sem sucesso, uma vez que os indivíduos reintroduzidos são mortos por predadores. Animais nascidos em cativeiro que foram isolados de seus predadores por várias gera
Informação e conhecimento: análise da rede apl têxtil de americana/sp-Brasil
Directory of Open Access Journals (Sweden)
Cibele Roberta Sugahara
2012-08-01
Full Text Available This paper reports on the analysis knowledge building process in the context of networked companies, more specifically in the American Textile Network APL/SP-Brazil (Local Productive Arrangement. To do so, a case study was used to analyze the information exchange for the development of joint activities in the Textile Network APL that incorporates several links of the textile supply chain (Spinning, Processing, Weaving and Tailoring, located in the surrounding of Americana,Sao Paulo. Based on earlier studies regarding the process of knowledge construction developed by Nonaka and Takeuchi (1997, a questionnaire with 7 (seven questions was applied to the experts making up the APL Textile network. The study involved 37 participant companies out of 51. From this instrument, it was possible to collect data to support the research regarding information exchange and knowledge sharing for the development of joint activities among the case study members. The work highlights the importance of sharing tacit knowledge that allows reconstructing and exploiting knowledge more broadly. That is why the externalization of tacit knowledge into explicit knowledge is also required in a networked environment.
Lifescience Database Archive (English)
Full Text Available mal product. 70 4e-29 4 AF480920 |AF480920.1 Nyctotherus ovalis from Periplaneta ...d:none) Nyctotherus ovalis from Periplanet... 229 5e-59 AF401758_1( AF401758 |pid:none) Ethmostigmus rubripe
Restrição hídrica em sementes de Jenipapo (Genipa americana L.
Directory of Open Access Journals (Sweden)
Allívia Rouse Ferreira dos Santos
2011-04-01
Full Text Available O jenipapo, originário da América Latina, pertence à família Rubiaceae e apresenta valor madeireiro e alimentício, sendo explorado sem estratégias de conservação. O objetivo deste trabalho foi avaliar o efeito da restrição hídrica, por meio de duas metodologias, na germinação de sementes de Genipa americana L. A primeira foi realizada com sementes imersas em soluções de polietilenoglicol (PEG 6000 por 18 dias a 0,0; -0,1; -0,3 e -0,4 MPa à 20ºC, simulando condições de alagamento, e após este período as sementes foram colocadas para germinar em placas de Petri com folhas de papel tipo mata-borrão umedecidas em água. A segunda utilizou os mesmos potenciais osmóticos umedecendo-se os papéis tipo mata-borrão, para simular a restrição hídrica. O delineamento utilizado foi o inteiramente casualizado com 4 repetições de 25 sementes. Para as sementes imersas em soluções de PEG, o potencial -0,3MPa permite condicionamento osmótico, enquanto à -0,4MPa interfere no vigor. Para as sementes embebidas em papel, ocorre redução da germinação em função do tempo, até não se observar eventos para potenciais a partir de -0,3 MPa.
Czech Academy of Sciences Publication Activity Database
Čulíková, Věra
2007-01-01
Roč. 59, č. 2 (2007), s. 353-370 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : plant macroremains * medieval time * early modern times * Prague-Hradčany * utility plants * Phytolacca americana Subject RIV: AC - Archeology, Anthropology, Ethnology
International Nuclear Information System (INIS)
Sumakud, M.Y.M.A.
2000-01-01
Soybean needs high radiation intensity for photosynthesis process; therefore 100 percent of the sunlight are needed. Due to increasing the soybean production, the environment factor such as climate, soil and management are needed. One of the environment factor that influence the growth and dry matter production is radiation. This research done was to see the potential production of local variety and Americana variety by observing the total radiation absorption, temperature, rainfall and humidity. Therefore the objective of this research was to know the potential production in tropic area in soybean. If the production is mainly determined by the high growth rate or the length of phase linear or both of them also by the efficiency of radiation that received by the plant. The method of this research was carried out by using completed randomized design, with three replications. The result showed that the growth and the production of soybean are determined by growth rate (Cm) and the length of growth linear (tm). Dry matter of soybean is determined by growth rate instead of the length of growth linear, for efficiency of radiation are not significant. Pod formation is determined by the growth rate, content of pods is determined by the length of linear growth
Xoca-Orozco, Luis-Ángel; Cuellar-Torres, Esther Angélica; González-Morales, Sandra; Gutiérrez-Martínez, Porfirio; López-García, Ulises; Herrera-Estrella, Luis; Vega-Arreguín, Julio; Chacón-López, Alejandra
2017-01-01
Avocado ( Persea americana ) is one of the most important crops in Mexico as it is the main producer, consumer, and exporter of avocado fruit in the world. However, successful avocado commercialization is often reduced by large postharvest losses due to Colletotrichum sp., the causal agent of anthracnose. Chitosan is known to have a direct antifungal effect and acts also as an elicitor capable of stimulating a defense response in plants. However, there is little information regarding the genes that are either activated or repressed in fruits treated with chitosan. The aim of this study was to identify by RNA-seq the genes differentially regulated by the action of low molecular weight chitosan in the avocado-chitosan- Colletotrichum interaction system. The samples for RNA-seq were obtained from fruits treated with chitosan, fruits inoculated with Colletotrichum and fruits both treated with chitosan and inoculated with the fungus. Non-treated and non-inoculated fruits were also analyzed. Expression profiles showed that in short times, the fruit-chitosan system presented a greater number of differentially expressed genes, compared to the fruit-pathogen system. Gene Ontology analysis of differentially expressed genes showed a large number of metabolic processes regulated by chitosan, including those preventing the spread of Colletotrichum . It was also found that there is a high correlation between the expression of genes in silico and qPCR of several genes involved in different metabolic pathways.
De la independencia a la natural barbarie americana. Una lectura del Facundo de Domingo F. Sarmiento
Directory of Open Access Journals (Sweden)
Maura Brighenti
2010-01-01
Full Text Available Se presenta una lectura del "Facundo" de Domingo F. Sarmiento y, en particular, de su más general visión de la historia y de la realidad argentina y latinoamericana a partir del esquema dicotómico de civilización y barbarie que tendrá mucha suerte en las narraciones de los procesos del modernización latinoamericanos por lo menos hasta la segunda mitad del siglo XX. A través del análisis de algunos entre los múltiples niveles narrativos del "Facundo" se quiere mostrar como tal imagen dicotómica se va cristalizando en el texto. Partiendo del espacio infinito y vacío de la pampa y pasando por una antropología del gaucho - de su manera de vivir y de conducir la guerra - Sarmiento conduce el lector hasta la forma típicamente americana de despotismo, el caudillismo, llegado en Argentina a su epopeya final con el régimen de Juan M. de Rosas. En la última parte se intenta injertar el esquema dicotómico del Facundo al interior de la más general reflexión del Occidente sobre la modernidad y sus alteridades, a través por un lado del prisma orientalista y por el otro de las mismas fuentes del pensamiento moderno europeo y en particular de Locke y Hobbes.
Directory of Open Access Journals (Sweden)
Silvia del C. Molina Bertrán
2018-04-01
Full Text Available Context: The synthetic insecticides used to control Diptera are harmful to the environment and humans. Extracts and compounds from plants are a more sustainable source for the development of bio-insecticides. Aims: To evaluate the efficacy of a hydroalcoholic extract of Persea americana Mill seeds as an alternative control of the species Musca domestica. Methods: The extracts were obtained by two methods, the Shaker (S and the Soxhlet extraction (SE method, using 94% ethanol as the solvent. Also, the qualitative chemical composition was determined by phytochemical screening. The effect of the two extracts on the post-embryonic development of the fly as well as the adulticidal effect was evaluated. Results: Phytochemical analysis revealed the presence of metabolites such as alkaloids, coumarins, tannins, flavonoids, sugars and amino acids. The influence on the post-embryonic development of M. domestica was demonstrated, especially on the viability of larvae and neolarvae to adults; however, the effect on the weight and duration of each period was low. The adulticidal effects of the extracts were determined by the lethal concentration 50(LC50 of 2.910 mg/100 mL and 3.944 mg/100 mL for the S and SE extracts, respectively. Conclusions: Both extracts showed their insecticidal effects against Musca domestica, but the extract elaborated by S method showed greater influence diminishing viability and better adulticidal effect.
Directory of Open Access Journals (Sweden)
Reyes Julian C
2011-06-01
Full Text Available Se estudió la biología del ácaro rojo Oligonychus yothersi en condiciones controladas(26 ± 3°C 56 ± 3% HR, sobre hojas maduras de aguacate, Persea americana Mill. cv.Lorena. Las observaciones se realizaron durante una generación del ácaro. La duraciónde todos los estados, a excepción del adulto, fueron los siguientes: huevo 119.06 horas±13.77 (4.96 días; larva 54.09 horas ± 18.48 (2.25 días, protocrisálida 18.22 ± 9.53(0.76 días, protoninfa 50.62 horas ± 13.29 (2.11 días, deutocrisalida 21.66 horas ±7.78 (0.90 días, deutoninfa 62.54 horas ± 12.85 (2.61 días y teliocrisalida 30.79 horas± 13.28 (1.28 días. La duración total de huevo a emergencia de adulto fue estimadaen 344.21 horas (14.34 días. La relación de sexos encontrada fue de 4.8 hembras: 1macho. Los parámetros poblacionales, i.e., longevidad, fecundidad, tasa intrínsecade crecimiento (r m , tiempo de duplicación y tiempo generacional, sugieren un altopotencial reproductivo y de desarrollo del ácaro sobre aguacate cv. Lorena.
Phytochemical Composition And Effect Of Aqueous Extract Of ...
African Journals Online (AJOL)
Phytochemical Composition And Effect Of Aqueous Extract Of Struchium sparganophora (L) On Cockroach Crude Extract – Induced Airway Inflammatory ... Similarly, mean percentages of neutrophils, lymphyocytes, and eosinophils in cockroach crude extract-induced rats administered with S. sparganophora crude extract ...
Injúrias causadas por mosca-das-frutas sul-americana em cultivares de videira
Directory of Open Access Journals (Sweden)
Marcelo Zart
2011-01-01
Full Text Available A mosca-das-frutas sul-americana, Anastrepha fraterculus (Wiedemann (Diptera: Tephritidae, é uma das principais pragas da fruticultura no Brasil. O objetivo deste estudo foi identificar a suscetibilidade quanto à queda e deformação de bagas de diferentes cultivares/espécies de uva pela injúria causada pela oviposição de A. fraterculus. O trabalho foi realizado em vinhedos das cultivares 'Cabernet Sauvignon' (Vitis vinifera, 'Moscato Embrapa' (75% de V. vinifera e 'Isabel' (Vitis labrusca, localizados em Bento Gonçalves (RS, na safra 2006/2007. Dois casais de A. fraterculus foram confinados por cacho, em gaiolas de tecido voile, durante os estádios fenológicos de grão ervilha, início da compactação, início da maturação e maturação plena dos cachos. Queda significativa de bagas devido ao ataque de A. fraterculus foi registrada na cultivar 'Cabernet Sauvignon' quando a infestação foi realizada nos estádios fenológicos de grão ervilha e início da compactação de cacho; estádios de grão ervilha em 'Moscato Embrapa'; e nos estádios de grão ervilha, início da compactação e início da maturação do cacho na cultivar 'Isabel'. Foi registrada deformação de bagas quando as infestações foram realizadas nos estádios de grão ervilha e início da compactação de cacho em 'Cabernet Sauvignon', 'Moscato Embrapa' e 'Isabel'. O desenvolvimento larval até a fase de pupa foi observado somente na cultivar 'Moscato Embrapa'.
Terpenoid variations within and among half-sibling avocado trees, Persea americana Mill. (Lauraceae.
Directory of Open Access Journals (Sweden)
Jerome Niogret
Full Text Available Chemical analyses were conducted to determine the qualitative and quantitative differences in monoterpenes and sesquiterpenes in plant material from avocado trees, Persea americana Mill. (Lauraceae. The initial study analyzed plant material sampled from the trunk to the leaves through different branch diameters to quantify proximo-distal spatial differences within a tree. All trees were seedlings initiated from a single maternal tree. Two-way analysis of variance was conducted on 34 chemicals that comprised at least 3% of the total chemical content of at least one tree and/or location within a tree. There were significant interactions between genotype and location sampled for most chemicals. Parentage analysis using microsatellite molecular markers (SSR's determined that the four trees had three fathers and that they represented two full-siblings and two half-sibling trees. Descriptive discriminant analysis found that both genotype and location within a tree could be separated based on chemical content, and that the chemical content from full-siblings tended to be more similar than chemical content from half-siblings. To further explore the relationship between genetic background and chemical content, samples were analyzed from leaf material from 20 trees that included two sets of full-sibling seedling trees, the maternal tree and the surviving paternal tree. Descriptive discriminant analysis found good separation between the two full-sibling groups, and that the separation was associated with chemistry of the parental trees. Six groups of chemicals were identified that explained the variation among the trees. We discuss the results in relation to the discrimination process used by wood-boring insects for site-selection on host trees, for tree selection among potential host trees, and the potential use of terpenoid chemical content in chemotaxonomy of avocado trees.
Experimental study of convective coefficient of mass transfer of avocado (Persia americana Mill.)
Energy Technology Data Exchange (ETDEWEB)
Alves, Suerda Bezerra; Luiz, Marcia Ramos; Amorim, Joselma Araujo de; Gusmao, Rennam Pereira de; Gurgel, Jose Mauricio [Universidade Federal da Paraiba (LES/UFPB), Joao Pessoa, PB (Brazil). Lab. de Energia Solar
2010-07-01
Most of all energy consumed worldwide comes from fossil fuels derived from petroleum. With the petroleum crisis in the 70 were sought new energy sources, among them renewable. One such source is biodiesel energy, organic matter originated from animal and/or vegetable. Among the various plant species is the avocado (Persia americana Mill.) showing great potential in the production of petroleum extracted from the pulp and the alcohol removed from the seed. The main obstacle for obtaining the petroleum is the high humidity found in the pulp, being necessary to the drying process, which involves the transfer of heat and mass. The aim of this study was to use the mathematical model represented by Newton's Law of Cooling to simulate the mass transfer on the surface of the avocado pulp during the drying process. The equation of the mathematical model was solved numerically and the method of least squares was identified convective coefficient of Mass Transfer. The dryer used in the experimental process was operated with air flow in the vertical, air flow average fixed 3m/s and temperatures of 50, 60 and 70 deg C. The scheme of the dryer used in the research is composed of the following equipment: centrifugal fan, which drives the air-drying; valve, which allows control of airflow; electrical resistance, used for heating air; the drying chamber, where enables measurement of temperature and relative humidity; support for smaller trays; trays smaller, where the samples of the pulp of the avocado are placed; exit of the air of drying for the environment. The result presented shows the ratio of moisture content as a function of temperature over time, where it is possible to also observe that how much bigger the temperature of drying, greater will be the convective coefficient of mass transfer of the avocado. (author)
Niogret, Jerome; Epsky, Nancy D; Schnell, Raymond J; Boza, Edward J; Kendra, Paul E; Heath, Robert R
2013-01-01
Chemical analyses were conducted to determine the qualitative and quantitative differences in monoterpenes and sesquiterpenes in plant material from avocado trees, Persea americana Mill. (Lauraceae). The initial study analyzed plant material sampled from the trunk to the leaves through different branch diameters to quantify proximo-distal spatial differences within a tree. All trees were seedlings initiated from a single maternal tree. Two-way analysis of variance was conducted on 34 chemicals that comprised at least 3% of the total chemical content of at least one tree and/or location within a tree. There were significant interactions between genotype and location sampled for most chemicals. Parentage analysis using microsatellite molecular markers (SSR's) determined that the four trees had three fathers and that they represented two full-siblings and two half-sibling trees. Descriptive discriminant analysis found that both genotype and location within a tree could be separated based on chemical content, and that the chemical content from full-siblings tended to be more similar than chemical content from half-siblings. To further explore the relationship between genetic background and chemical content, samples were analyzed from leaf material from 20 trees that included two sets of full-sibling seedling trees, the maternal tree and the surviving paternal tree. Descriptive discriminant analysis found good separation between the two full-sibling groups, and that the separation was associated with chemistry of the parental trees. Six groups of chemicals were identified that explained the variation among the trees. We discuss the results in relation to the discrimination process used by wood-boring insects for site-selection on host trees, for tree selection among potential host trees, and the potential use of terpenoid chemical content in chemotaxonomy of avocado trees.
Directory of Open Access Journals (Sweden)
Montserrat Manzaneque Lizano
2013-01-01
Full Text Available Los cambios introducidos en la FAS 141(R (2007 americana y en la IFRS 3 (R (2008, con el fin de armonizar los aspectos contables de las operaciones referentes a la combinación de negocios, han puesto de manifiesto la existencia de determinadas transacciones que no forman parte de la propia combinación y a las que se denomina transacciones separadas, cuya delimitación de la combinación de negocios queda dispersa en ambas normas, por lo que en ocasiones resulta poco clarificador. Así, este trabajo pretende facilitar al lector la comprensión de su tratamiento contable abordando la problemática de identificar las transacciones que se producen, y las que no, como consecuencia de la combinación de negocios, el tratamiento contable de esta disyuntiva y su efecto sobre el reconocimiento y valoración del fondo de comercio (cuenta de crédito mercantil.
Directory of Open Access Journals (Sweden)
Rafael Souza Antunes
2018-05-01
Full Text Available In this work, an innovative polyphenol oxidase biosensor was developed from Jenipapo (Genipa americana L. fruit and used to assess phenolic compounds in industrial effluent samples obtained from a textile industry located in Jaraguá-GO, Brasil. The biosensor was prepared and optimized according to: the proportion of crude vegetal extract, pH and overall voltammetric parameters for differential pulse voltammetry. The calibration curve presented a linear interval from 10 to 310 µM (r2 = 0.9982 and a limit of detection of 7 µM. Biosensor stability was evaluated throughout 15 days, and it exhibited 88.22% of the initial response. The amount of catechol standard recovered post analysis varied between 87.50% and 96.00%. Moreover, the biosensor was able to detect phenolic compounds in a real sample, and the results were in accordance with standard spectrophotometric assays. Therefore, the innovatively-designed biosensor hereby proposed is a promising tool for phenolic compound detection and quantification when environmental contaminants are concerned.
Directory of Open Access Journals (Sweden)
Nelson A. de Araújo Filho
1981-12-01
Full Text Available Durante um surto de Leishmaniose Tegumentar Americana (LTA na Praia Vermelha, Ilha Grande, município de Angra dos Reis, Rio de Janeiro, foram coletados 4.192 exemplares de flebotomíneos em ambiente domiciliar e silvestre, com isca animal e outros abrigos naturais, durante o período de janeiro de 1976 a abril de 1977. Entre o total de 11 espécies coletadas encontraram-se 2.493 exemplares de Lutzomyia intermedia, 1.594 de Lutzomyia migonei e 105 exemplares de outras espécies. A L. intermedia apresentou densidade mais elevada no domicílio humano, enquanto a L. migonei apresentou coletas mais rendosas com iscas animais e galinheiros. O sinantropismo e a elevada densidade no ambiente domiciliar incriminam as espécies L. intermedia e L. migonei como as prováveis vetoras da LTA na Ilha Grande.
Coccidian Parasites and Conservation Implications for the Endangered Whooping Crane (Grus americana.
Directory of Open Access Journals (Sweden)
Miranda R Bertram
Full Text Available While the population of endangered whooping cranes (Grus americana has grown from 15 individuals in 1941 to an estimated 304 birds today, the population growth is not sufficient to support a down-listing of the species to threatened status. The degree to which disease may be limiting the population growth of whooping cranes is unknown. One disease of potential concern is caused by two crane-associated Eimeria species: Eimeria gruis and E. reichenowi. Unlike most species of Eimeria, which are localized to the intestinal tract, these crane-associated species may multiply systemically and cause a potentially fatal disease. Using a non-invasive sampling approach, we assessed the prevalence and phenology of Eimeria oocysts in whooping crane fecal samples collected across two winter seasons (November 2012-April 2014 at the Aransas National Wildlife Refuge along the Texas Gulf coast. We also compared the ability of microscopy and PCR to detect Eimeria in fecal samples. Across both years, 26.5% (n = 328 of fecal samples were positive for Eimeria based on microscopy. Although the sensitivity of PCR for detecting Eimeria infections seemed to be less than that of microscopy in the first year of the study (8.9% vs. 29.3%, respectively, an improved DNA extraction protocol resulted in increased sensitivity of PCR relative to microscopy in the second year of the study (27.6% and 20.8%, respectively. The proportion of positive samples did not vary significantly between years or among sampling sites. The proportion of Eimeria positive fecal samples varied with date of collection, but there was no consistent pattern of parasite shedding between the two years. We demonstrate that non-invasive fecal collections combined with PCR and DNA sequencing techniques provides a useful tool for monitoring Eimeria infection in cranes. Understanding the epidemiology of coccidiosis is important for management efforts to increase population growth of the endangered whooping
Desidratação osmótica do jenipapo (Genipa americana L.
Directory of Open Access Journals (Sweden)
Andrade Samara Alvachian Cardoso
2003-01-01
Full Text Available O processo de desidratação osmótica foi aplicado ao Jenipapo (Genipa americana L., para reduzir as perdas pós-colheita, diversificar o seu aproveitamento industrial e obter um produto com boas características organolépticas e boa estabilidade microbiológica. Os frutos foram adquiridos na feira livre de Afogados, na região metropolitana do Recife, nas condições em que são comercializados, subdivididos em cubos e submetidos a diversas condições de processamento, segundo planejamento fatorial 2³ de modo a determinar a influência das variáveis independentes: temperatura, tipo de açúcar e concentração do agente osmótico sobre a perda de umidade, ganho de açúcar e redução de peso. O processo foi complementado por secagem em estufa, com ventilação forçada a 60ºC±5ºC, por 3h±10', seguida do acondicionamento do produto em embalagem de polietileno e armazenamento à temperatura ambiente (28ºC±3ºC, por 90 dias. Os resultados demonstraram que: os produtos obtidos apresentaram significativa incorporação de sólidos; nenhuma das respostas foi influenciada pelo tipo de açúcar empregado, diferentemente da concentração do agente osmótico que além de refletir sobre todas elas, interagiu com a temperatura influindo sobre a perda de umidade; durante o armazenamento, os produtos apresentaram-se microbiologicamente estáveis, sem diferenças significativas, no que concerne às características organolépticas, embora os escores demonstrem uma preferência pelo produto obtido a partir de 60ºBrix, 60ºC e mistura de açúcar demerara e cristal. A elevada incorporação de sólidos ocorrida aponta para necessidade de proceder à otimização do produto com vista a sua redução.
Orchidaceae Americanae Orchidaceae Americanae
Directory of Open Access Journals (Sweden)
Jones H. G.
1970-09-01
Full Text Available The following paper continues the series of nomenclatural notes and adjustments commenced under the title "Studies in Neotropical Orchidology" in Acta Botanica Academiae Scientiarum Hungaricae, Vol. 14: pp. 63-70 (1968. As in the previous contribution, the genera considered in the present study are Brassavola R. Br., Schomburgkia Lindl, and HoffmannseggellaH. G. Jones. The notes which comprise this series of studieshave been accumulated during the course of collecting materials for a taxonomic revision of the three genera concerned.The following paper continues the series of nomenclatural notes and adjustments commenced under the title "Studies in Neotropical Orchidology" in Acta Botanica Academiae Scientiarum Hungaricae, Vol. 14: pp. 63-70 (1968. As in the previous contribution, the genera considered in the present study are Brassavola R. Br., Schomburgkia Lindl, and HoffmannseggellaH. G. Jones. The notes which comprise this series of studieshave been accumulated during the course of collecting materials for a taxonomic revision of the three genera concerned.
Directory of Open Access Journals (Sweden)
Vicente Arturo Lara-Valencia
Full Text Available This paper reports the use of polysaccharides extracted from seed of Persea americana var. Hass in the synthesis of acrylic hydrogels. The effects of the chemical composition (acrylamide/acrylic acid, the concentration of crosslinking agent (glycerol diacrylate and the type of initiation (redox, photoinitiation of the hydrogels were evaluated with and without polysaccharides. Xerogels were characterized by FTIR spectroscopy, differential scanning calorimetry (DSC and scanning electron microscopy (SEM, while for the swollen hydrogels the swelling kinetic and mechanical properties were evaluated. The kinetic parameters were obtained using the second order equation proposed by Schott, where it is reported that by increasing the concentration of the crosslinking agent, the degree of swelling is reduced because of the greater structural level. The increase of the amount of acrylamide and the amount of polysaccharides causes also a decrease in the swelling degree. The type of initiation also affected the hydrogels swelling kinetic, the photoinitiated hydrogels were the ones that captured less water. Moreover, the increasing of the glass transition temperature and the compression modulus with the crosslinking agent concentration and molar ratio AAm/AAc are observed for hydrogels with and without polysaccharides. The results demonstrate a successful incorporation of polysaccharides into the polymeric network.
International Nuclear Information System (INIS)
Purwanto, Z.I.; Maha, Munsiah
1987-01-01
Effects of heat treatment, gamma irradiation, and combined treatments on the shelf-life of fresh avocados (Persea americana L.). Experiments to determine the effective irradiation conditions to prolong the shelf-life of fresh avocados were conducted at the centre for the Application of Isotopes washed and dried, then divided into 4 groups, namely for control (A), dipped in hot water at 40 0 C for 20 minutes (heat treatment, B), irradiated at a dose of 25 Gy (C), and combination of hot water dipping (40 0 C for 20 minutes) and irradiation at a 25 Gy (D). The samples were stored at room temperature. Evaluation on physical and chemical properties of the samples was done daily up to 10 days' storage. Parameters observed were texture, moisture and fat contents, percentage of weight loss, percentage of mature fruit, and subjective organoleptic evaluation. It was found that treated samples with and without combination treatment were still in good condition until 10 days of storage. It could be concluded that dipping in hot water, either alone or in combination with irradiation at a dose of 25 Gy could extend the shelf-life of fresh avocado up to 10 days at room temperature compared to only 5 days of the control. (author). 2 figs, 8 refs
Vasoconstrictive effect of Xinmailong injection in rat aorta | Yang ...
African Journals Online (AJOL)
Background: Cockroach has been traditionally utilized in China for the therapy of cardiovascular disorders, such as heart failure. The present study was aimed to assess the vasoconstrictive effect of Xinmailong Injection (XML), a bioactive composite from American cockroach. Methodology: The isometric tensions of rat aortic ...
Yang, Haiwei; Chen, Hao; Jin, Min; Xie, Hua; He, Shaoheng; Wei, Ji-Fu
2016-01-01
Per a 9 is a major allergen of the American cockroach (CR), which has been recognized as an important cause of imunoglobulin E-mediated type I hypersensitivity worldwide. However, it is not neasy to obtain a substantial quantity of this allergen for use in functional studies. In the present study, the Per a 9 gene was cloned and expressed in Escherichia coli (E. coli) systems. It was found that 13/16 (81.3%) of the sera from patients with allergies caused by the American CR reacted to Per a 9, as assessed by enzyme-linked immunosorbent assay, confirming that Per a 9 is a major allergen of CR. The induction of the expression of CD63 and CCR3 in passively sensitized basophils (from sera of patients with allergies caused by the American CR) by approximately 4.2-fold indicated that recombinant Per a 9 was functionally active. Three immunoinformatics tools, including the DNASTAR Protean system, Bioinformatics Predicted Antigenic Peptides (BPAP) system and the BepiPred 1.0 server were used to predict the potential B cell epitopes, while Net-MHCIIpan-2.0 and NetMHCII-2.2 were used to predict the T cell epitopes of Per a 9. As a result, we predicted 11 peptides (23–28, 39–46, 58–64, 91–118, 131–136, 145–154, 159–165, 176–183, 290–299, 309–320 and 338–344) as potential B cell linear epitopes. In T cell prediction, the Per a 9 allergen was predicted to have 5 potential T cell epitope sequences, 119–127, 194–202, 210–218, 239–250 and 279–290. The findings of our study may prove to be useful in the development of peptide-based vaccines to combat CR-induced allergies. PMID:27840974
Rodríguez-Carpena, Javier-Germán; Morcuende, David; Andrade, María-Jesús; Kylli, Petri; Estévez, Mario
2011-05-25
The first aim of the present work (study 1) was to analyze ethyl acetate, 70% acetone, and 70% methanol extracts of the peel, pulp, and seed from two avocado (Persea americana Mill.) varieties, namely, 'Hass' and 'Fuerte', for their phenolic composition and their in vitro antioxidant activity using the CUPRAC, DPPH, and ABTS assays. Their antimicrobial potential was also studied. Peels and seeds had higher amounts of phenolics and a more intense in vitro antioxidant potential than the pulp. Peels and seeds were rich in catechins, procyanidins, and hydroxycinnamic acids, whereas the pulp was particularly rich in hydroxybenzoic and hydroxycinnamic acids and procyanidins. The total phenolic content and antioxidant potential of avocado phenolics was affected by the extracting solvent and avocado variety. The avocado materials also displayed moderate antimicrobial effects against Gram-positive bacteria. Taking a step forward (study 2), extracts (70% acetone) from avocado peels and seeds were tested as inhibitors of oxidative reactions in meat patties. Avocado extracts protected meat lipids and proteins against oxidation with the effect on lipids being dependent on the avocado variety.
Contreras-Gutiérrez, Paulina K; Hurtado-Fernández, Elena; Gómez-Romero, María; Ignacio Hormaza, José; Carrasco-Pancorbo, Alegría; Fernández-Gutiérrez, Alberto
2013-10-01
A CZE method with two different MS detection conditions (MRM and Full Scan) was developed to determine qualitative and quantitative changes in the metabolic profile of avocado fruits (Persea americana). LODs in MRM approach were found between 20.1 and 203.0 ppb for abscisic acid and perseitol, respectively, whilst in Full Scan, varied within the range 0.22–1.90 ppm for the same metabolites. The RSDs for reproducibility test did not exceed 11.45%. The two MS approaches were used to quantify 10 metabolites (phenolic acids, flavonoids, a carbohydrate, an organic acid, a vitamin and a phytohormone) in 18 samples of avocado at different ripening states, and the achieved results were compared. Perseitol, quinic, chlorogenic, trans-cinnamic, pantothenic and abscisic acids, as well as epicatechin and catechin decreased during the ripening process, whereas ferulic and p-coumaric acids showed the opposite trend. Moreover, some other unknown compounds whose concentration changed largely during ripening were also studied by MS/MS and QTOF MS to get a tentative identification.
1912-IJBCS-Article-Brown Charles
African Journals Online (AJOL)
hp
MATERIALS AND METHODS. Sampling sites and sample collection. Cockroaches were collected, from the main kitchen of the hospital and the balconies of the hostel rooms from May-June, 2011, using sugar-baited traps placed overnight at suitable positions at the sampling sites. Each trapped cockroach was transferred, ...
Castro-Mercado, E; Martinez-Diaz, Y; Roman-Tehandon, N; Garcia-Pineda, E
2009-03-01
We analyzed the production of reactive oxygen species (ROS) and of detoxifying enzymes and enzymes of the ascorbate (ASC) acid cycle in avocado fruit (Pesea Americana Mill cv Hass) in response to wounding. The levels of superoxide anion (O(2-), hydroxyl radicals (OH.) and hydrogen peroxide (H(2)O(2)) increased at 15 min and 2 and 15 h post-wounding. Peroxidase (POD) activity had increased to high levels 24 h after wounding; in contrast, catalase and superoxide dismutase (SOD) levels hat decreased significantly at 24 h post-treatment. Basic POD was the major POD form induced, and the levels of at least three apoplastic POD isozymes -increased following wounding. Using specific inhibitors, we characterized one MnSOD and two CuZnSOD isozymes. CuZnSOD activities decreased notably 12 h after treatment. The activities of dehydroascorbate reductase and glutathione reductase increased dramatically following the wounding treatment, possibly as a means to compensate for the redox changes due to ROS production.
Directory of Open Access Journals (Sweden)
Jasinski, Lisa
2016-01-01
Full Text Available Este artigo examina fundações privadas dos Estados Unidos que fazem doações às organizações não governamentais – ONGs e instituições educacionais no Brasil, durante e após a recessão global (2006-2012. Usando dados americanos, os autores identificam as fundações privadas americanas que destinam mais dinheiro para o Brasil, nomeiam as razões das instituições que recebem o maior apoio internacional e identificam como as fundações brasileiras têm sido impactadas pela crise financeira mundial. O artigo apresenta seções que descrevem a história do financiamento da educação, a literatura de pesquisas sobre filantropia global, a metodologia, os resultados e recomendações para estudiosos brasileiros da forma mais eficaz de concretizar subvenções
Emoções e guerras: da Micronésia às bases militares americanas
Directory of Open Access Journals (Sweden)
Clara Saraiva
2007-11-01
Full Text Available Catherine Lutz tem um PhD em antropologia cultural da Universidade de Harvard, é professora do Departamento de Antropologia da Brown University, e investigadora do Watson Institute for International Studies da mesma universidade. Os seus temas de pesquisa debruçam-se sobre a antropologia das emoções, construção do género e da noção de raça, teoria crítica, mudanças na democracia e, mais recentemente, guerra, grupos militares e sociedade, nomeadamente através do estudo de bases militares americanas e do retorno de militares americanos dissidentes da guerra do Iraque. Lutz conduziu igualmente pesquisa para organizações activistas e todas estas temáticas se relacionam com a vontade de compreender as articulações socais e culturais das construções de poder e de desigualdade. Algumas das suas obras, influentes no campo da antropologia das emoções, da antropologia cognitiva e da história política são Unnatural Emotions: Everyday Sentiments on a Micronesian Atoll and their Challenge to Western Theory; Language and the Politics of Emotion(com Abu-Lughod; Reading National Geographic; Homefront: a Military City and the American 20th Century; Local Democracy under Siege: Activism, Public Interests, and Private Politics; The Bases of the Empire. The Struggle against US Military Posts, além de vários artigos como "Empire is in the details" e "Making war at home in the United States: militarization and the current crisis". Nesta entrevista Lutz fala sobre o que tem sido o seu trabalho e as suas preocupações académicas mas também sociais e interventivas.
Pistil starch reserves at anthesis correlate with final flower fate in avocado (Persea americana.
Directory of Open Access Journals (Sweden)
María Librada Alcaraz
Full Text Available A common observation in different plant species is a massive abscission of flowers and fruitlets even after adequate pollination, but little is known as to the reason for this drop. Previous research has shown the importance of nutritive reserves accumulated in the flower on fertilization success and initial fruit development but direct evidence has been elusive. Avocado (Persea americana is an extreme case of a species with a very low fruit to flower ratio. In this work, the implications of starch content in the avocado flower on the subsequent fruit set are explored. Firstly, starch content in individual ovaries was analysed from two populations of flowers with a different fruit set capacity showing that the flowers from the population that resulted in a higher percentage of fruit set contained significantly more starch. Secondly, in a different set of flowers, the style of each flower was excised one day after pollination, once the pollen tubes had reached the base of the style, and individually fixed for starch content analysis under the microscope once the fate of its corresponding ovary (that remained in the tree was known. A high variability in starch content in the style was found among flowers, with some flowers having starch content up to 1,000 times higher than others, and the flowers that successfully developed into fruits presented significantly higher starch content in the style at anthesis than those that abscised. The relationship between starch content in the ovary and the capacity of set of the flower together with the correlation found between the starch content in the style and the fate of the ovary support the hypothesis that the carbohydrate reserves accumulated in the flower at anthesis are related to subsequent abscission or retention of the developing fruit.
Pistil starch reserves at anthesis correlate with final flower fate in avocado (Persea americana).
Alcaraz, María Librada; Hormaza, José Ignacio; Rodrigo, Javier
2013-01-01
A common observation in different plant species is a massive abscission of flowers and fruitlets even after adequate pollination, but little is known as to the reason for this drop. Previous research has shown the importance of nutritive reserves accumulated in the flower on fertilization success and initial fruit development but direct evidence has been elusive. Avocado (Persea americana) is an extreme case of a species with a very low fruit to flower ratio. In this work, the implications of starch content in the avocado flower on the subsequent fruit set are explored. Firstly, starch content in individual ovaries was analysed from two populations of flowers with a different fruit set capacity showing that the flowers from the population that resulted in a higher percentage of fruit set contained significantly more starch. Secondly, in a different set of flowers, the style of each flower was excised one day after pollination, once the pollen tubes had reached the base of the style, and individually fixed for starch content analysis under the microscope once the fate of its corresponding ovary (that remained in the tree) was known. A high variability in starch content in the style was found among flowers, with some flowers having starch content up to 1,000 times higher than others, and the flowers that successfully developed into fruits presented significantly higher starch content in the style at anthesis than those that abscised. The relationship between starch content in the ovary and the capacity of set of the flower together with the correlation found between the starch content in the style and the fate of the ovary support the hypothesis that the carbohydrate reserves accumulated in the flower at anthesis are related to subsequent abscission or retention of the developing fruit.
Bertram, Miranda R; Hamer, Gabriel L; Hartup, Barry K; Snowden, Karen F; Medeiros, Matthew C; Hamer, Sarah A
2017-04-01
The population growth of endangered whooping cranes (Grus americana) is not consistent with species recovery goals, and the impact of parasite infection on whooping crane populations is largely unknown. Disease ecology and epidemiology research of endangered species is often hindered by limited ability to conduct invasive sampling on the target taxa. Accordingly, we hypothesized that sandhill cranes (Grus canadensis) would be a useful surrogate species to investigate the health impacts of Haemosporida infection in whooping cranes. Our goal was to compare the prevalence and diversity of Haemosporida infection between whooping cranes and sandhill cranes. We detected an overall infection prevalence of 83·6% (n = 61) in whooping cranes and 59·6% (n = 47) and 63·6 (n = 22) in two sympatric sandhill crane populations captured in Texas. Prevalence was significantly lower in allopatric sandhill cranes captured in New Mexico (12·1%, n = 33). Haemoproteus antigonis was the most abundant haemoparasite in cranes, present in 57·4% of whooping cranes and 39·2% of sandhill cranes; Plasmodium and Leucocytozoon were present at significantly lower levels. The high prevalence of Haemosporida in whooping cranes and sympatric sandhill cranes, with shared parasite lineages between the two species, supports sandhill cranes as a surrogate species for understanding health threats to endangered whooping cranes.
Directory of Open Access Journals (Sweden)
Antônio Lopes de Sá
2002-11-01
Full Text Available Como entender a matéria contábil, o método que se emprega para estudá-la, o respeito às tradições históricas como conquistas já feitas, as grandes finalidades desse conhecimento, em suma, como possuir uma visão realista e verdadeira sobre os fenômenos da riqueza individualizada é o que caracteriza uma "escola científica de Contabilidade". Diversos desses núcleos se formaram e ainda se formam, não só no setor contábil, mas, em todas as ciências, sempre em torno de lideranças, quer de pensadores, quer de grupos interessados em manipular idéias. Algumas escolas, todavia, basearam-se apenas no consenso de grupos e se ataram a um raciocínio pragmático. Por serem diferentes as concepções e os efeitos do tratamento que se tem dado à Contabilidade, as principais distinções de entendimento encontram-se, na atualidade, entre as escolas norte-americanas, pragmáticas e as européias, científicas. No Brasil a corrente científica do neopatrimonialismo oferece novas propostas em suas bases, mas, mantendo a fidelidade com as raízes latinas do conhecimento contábil.
Directory of Open Access Journals (Sweden)
Oliver Betz
2017-05-01
Full Text Available Two different measurement techniques were applied to study the attachment of the smooth foot pads of the Madagascar hissing cockroach Gromphadorhina portentosa. The attachment of the non-manipulated adhesive organs was compared with that of manipulated ones (depletion or substitution by artificial secretions. From measurements of the friction on a centrifuge, it can be concluded that on nanorough surfaces, the insect appears to benefit from employing emulsions instead of pure oils to avoid excessive friction. Measurements performed with a nanotribometer on single attachment organs showed that, in the non-manipulated euplantulae, friction was clearly increased in the push direction, whereas the arolium of the fore tarsus showed higher friction in the pull direction. The surface of the euplantulae shows an imbricate appearance, whereupon the ledges face distally, which might contribute to the observed frictional anisotropy in the push direction. Upon depletion of the tarsal adhesion-mediating secretion or its replacement by oily fluids, in several cases, the anisotropic effect of the euplantula disappeared due to the decrease of friction forces in push-direction. In the euplantulae, adhesion was one to two orders of magnitude lower than friction. Whereas the tenacity was slightly decreased with depleted secretion, it was considerably increased after artificial application of oily liquids. In terms of adhesion, it is concluded that the semi-solid consistence of the natural adhesion-mediating secretion facilitates the detachment of the tarsus during locomotion. In terms of friction, on smooth to nanorough surfaces, the insects appear to benefit from employing emulsions instead of pure oils to avoid excessive friction forces, whereas on rougher surfaces the tarsal fluid rather functions in improving surface contact by keeping the cuticle compliable and compensating surface asperities of the substratum.
Jiménez, Paula; García, Paula; Bustamante, Andrés; Barriga, Andrés; Robert, Paz
2017-04-15
Effect of the addition of avocado (Persea americana cv. Hass) or olive (Olea europaea cv. Arbequina) hydroalcoholic leaf extracts (AHE and OHE, respectively) on thermal stability of canola oil (CO) and high oleic sunflower oil (HOSO) during French potatoes frying at 180°C was studied. The extracts were characterized by the total phenolic content, phenol chromatographic profiles and antioxidant activity. B-type trimer procyanidins were the major phenolic compounds identified in AHE. OHE showed higher phenol content, antioxidant activity regarding AHE. CO+OHE and HOSO+OHE decreased the formation of polar compounds and showed an anti-polymeric effect with respect to oils without extracts, whereas AHE extract showed a prooxidant effect on HOSO. Therefore, OHE showed an antioxidant effect on HOSO and CO under the studied conditions. In addition, all systems (CO+AHE, HOSO+AHE, CO+OHE and HOSO+OHE) increased the retention of tocopherols. These results demonstrate the potential utility of OHE as natural antioxidant for oils. Copyright © 2016 Elsevier Ltd. All rights reserved.
Entre Debates e Embates: uma reflexão sobre epistemologias feministas latino-americanas
Directory of Open Access Journals (Sweden)
Renata Araújo Matos
2017-04-01
Full Text Available Resumo O presente texto objetiva discutir proposições elaboradas por parte de pensadoras feministas latino-americanas, pautando sua contribuição para os estudos teóricos que buscam compreender a construção dos padrões coloniais que ainda persistem na análise social da região. Entende-se que é pertinente fazer referência aos debates e confrontos internos aos movimentos e ao pensamento feminista para, dessa forma, evitar o caminho simplificador de não-reconhecimento, sem exceções, das contribuições do pensamento social já institucionalizado. Palavras-chaves: mulheres; feminismos latino-americanos; epistemologias feministas. Between Debates and Blocks: a Reflection on Latin American Feminists Epistemologies Abstract The present article aims to discuss Latin American thinkers propositions and how their contributions impact on the regional decolonial studies. It is understood that it is pertinent to refer to debates and internal confrontations with feminist movements and thinking. In this way, one can avoid the simplistic path of non-recognition, without exceptions, of the contributions of already institutionalized social thought. Keywords: Women, Latin American Feminists, Feminists Epistemologies Entre Debates y Embates: una reflexión sobre epistemologías feministas latinoamericanas Resumen El presente texto tiene como objetivo discutir proposiciones elaboradas por parte de pensadoras feministas latinoamericanas, pautando su contribución para los estudios teóricos que buscan comprender la construcción de los estándares coloniales que aún persisten en el análisis social de la región. Se considera pertinente hacer referencia a los debates y confrontaciones internos a los movimientos y al pensamiento feminista para, de esa forma, evitar el camino simplificador de no-reconocimiento, sin excepciones, de las contribuciones del pensamiento social ya institucionalizado. Palabras-clave: mujeres; feminismos
Goel, Chhavi; Gaur, S N; Bhati, Gaurav; Arora, Naveen
2015-10-01
Cockroach proteases are important risk factors for asthma development in predisposed individuals. In the present study, effect of allergic status of patients on DCs polarization in response to protease allergen Per a 10 was investigated. Cockroach-allergic, other-allergic patients and healthy individuals were selected following the guidelines of ATS/ARIA. Monocyte-derived dendritic cells (DCs) were generated from the selected individuals and stimulated with Per a 10. Flow cytometric analysis showed a significantly high expression of CD80 and CD86 on DCs from cockroach-allergic patients after Per a 10 stimulation as compared to healthy individuals or other-allergic patients (PPer a 10 induced comparable level of CD83 expression on DCs from all the 3 groups, showing it was irrespective of the allergic status. CD40 expression was significantly low (PPer a 10 induced lower CD40 expression on DCs than the heat-inactivated Per a 10 (PPer a 10 stimulated DC cultures was significantly higher than in heat-inactivated Per a 10 (PPer a 10-stimulated DCs than heat-inactivated Per a 10-stimulated DCs. Per a 10-stimulated DCs from cockroach-allergic patients secreted high levels of IL-5, IL-6, TNF-α than that from healthy individuals or other-allergic patients (PPer a 10-stimulated DCs from cockroach-allergic patients induced increased secretions of IL-4, IL-5, IL-6, TNF-α and low IL-12 by T cells as compared to those from other groups (PPer a 10 allergen, polarization of DCs shifts toward type 2 in cockroach-allergic patients but not in the healthy individuals or other-allergic patients. In conclusion, both allergic status of the individual and protease activity of Per a 10 are important parameters that participate in DCs polarization. Copyright © 2015 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
ANTÔNIO CARLOS SILVA DE ANDRADE
2000-03-01
Full Text Available O presente trabalho teve como objetivos definir o tipo de substrato e a temperatura mais adequados à germinação de sementes de jenipapo (Genipa americana L., conhecer a morfologia das sementes e seu desenvolvimento pós-seminal, caracterizando as plântulas normais, o tipo de germinação e os padrões de anormalidade. Para tanto, realizou-se um experimento colocando-se as sementes sobre os seguintes substratos: papel, vermiculita e solo, nas temperaturas constantes de 20°C, 25°C, 30°C, e 35°C e alternada de 20°C-30°C. O delineamento estatístico empregado foi o inteiramente casualizado (5 x 3, com quatro repetições de 50 sementes. Foram analisados os parâmetros germinação normal (% e velocidade de germinação. Os melhores resultados foram obtidos nas temperaturas constantes de 25°C, 30°C e 35°C, e nos substratos vermiculita e solo.This study aimed to define the best substrate and temperature for germination of genipap (Genipa americana L. - Rubiaceae seeds, and to describe the morphology of its seeds, post-seminal development, normal and abnormal seedlings. The experiment was designed according to a 5 x 3 factorial with constant temperatures of 20°C, 25°C, 30°C and 35°C and alternated 20°C-30°C in filter paper, vermiculite and soil substrates. The following parameters were analyzed: normal percentage germination and speed of germination. The 25°C, 30°C and 35°C temperatures and vermiculite and soil substrates were the best conditions for seed germination.
Cárdenas-Rodríguez, Noemí; González-Trujano, María Eva; Aguirre-Hernández, Eva; Ruíz-García, Matilde; Sampieri, Aristides; Coballase-Urrutia, Elvia; Carmona-Aparicio, Liliana
2014-01-01
Tilia genus is commonly used around the world for its central nervous system properties; it is prepared as tea and used as tranquilizing, anticonvulsant, and analgesic. In this study, anticonvulsant activity of the Tilia americana var. mexicana inflorescences and leaves was investigated by evaluating organic and aqueous extracts (100, 300, and 600 mg/kg, i.p.) and some flavonoids in the pentylenetetrazole-induced seizures in mice. Moreover, antioxidant effect of these extracts and flavonoids was examined in an in vitro study by using spectrophotometric technique. Significant activity was observed in the methanol extract from inflorescences. An HPLC analysis of the methanol extract from inflorescences and leaves of Tilia allowed demonstrating the respective presence of some partial responsible flavonoid constituents: quercetin (20.09 ± 1.20 μg/mg and 3.39 ± 0.10 μg/mg), rutin (3.52 ± 0.21 μg/mg and 8.94 ± 0.45 μg/mg), and isoquercitrin (1.74 ± 0.01 μg/mg and 1.24 ± 0.13 μg/mg). In addition, significant but different antioxidant properties were obtained among the flavonoids and the extracts investigated. Our results provide evidence of the anticonvulsant activity of Tilia reinforcing its utility for central nervous system diseases whose mechanism of action might involve partial antioxidant effects due to the presence of flavonoids. PMID:25197430
Directory of Open Access Journals (Sweden)
H. Ferrer Pereira
2017-08-01
Full Text Available The avocado (Persea americana Mill. is the most important species of Lauraceae in America due to its exploitation as food for pre-Columbian and modern cultures. It is a very important seasonal crop in Venezuela based on a perennial fruit tree management. From a selection of 76 accessions (45 cultivars of avocados cultivated at the Germplasm Bank of INIA-CENIAP, a morphoanatomical analysis was performed to identify attributes of taxonomic resolution (diagnostic characters which allow to characterize sets and / or culta. Morphological study was carried out from each accession herborized sample. Information was obtained by freehand transverse leaf sections (epidermis, mesophyll and midvein as well as paradermic preparations, and observed data was recorded in DELTA System. New morphoanatomical characters and discriminating attributes between cultivars were identified and described, especially to discriminate the Mexican group, and a close relationship within West Indian and Guatemalan cultivars was observed due to the variability identified from the latter group. Indument- related attributes were highly informative to discriminate among cultivars, along with the outline, apical angle and projections at the base of the leaf blades, stem cross section and presence of anise odor, progress and joining of the secondary nerve branches, tertiary venation pattern, abaxial contour and thickness of the sclerenchymatous sheath and compaction of the phloem in the vascular bundle, adaxial contour of the median nerve, and thickness, outline and uniformity of the anticlinal walls of adaxial and abaxial epidermal cells.
Gallagher, Brian K.; Piccoli, Philip M.; Secor, David H.
2018-01-01
Partial migration in complex life cycles allows environmental conditions experienced during one life-stage to interact with genetic thresholds and produce divergent spatial behaviors in the next stage. We evaluated partial migration over the entire life cycle of white perch, (Morone americana) within the Hudson River Estuary, combining otolith microchemistry, population demographics and environmental data analysis. Ecological carryover effects were used as a framework to test how environmental variation during the larval period influenced migration behaviors and growth characteristics in subsequent life-stages. Two annual cohorts of juveniles were classified based on whether they persisted in natal habitats (freshwater resident contingent) or dispersed into non-natal habitats (brackish water migratory contingent) as juveniles. The migratory contingent tended to hatch earlier and experience cooler temperatures as larvae, while the availability of zooplankton prey during the larval period appeared to influence growth dynamics before and after metamorphosis. Juvenile migration behaviors were reversible but usually persisted into adulthood. As juveniles, the consequences of partial migration on growth appeared to be modified by river flow, as demonstrated by the influence of a large storm event on feeding conditions in one of the study years. Migratory adults grew faster and attained larger maximum sizes, but may also experience higher rates of mortality. The interplay uncovered between life-stage transitions, conditional migration behaviors and habitat productivity throughout the life cycle shapes white perch population dynamics and will likely play an important role in responses to long-term environmental change.
Rodriguez-Sanchez, Dariana Graciela; Flores-García, Mirthala; Silva-Platas, Christian; Rizzo, Sheryl; Torre-Amione, Guillermo; De la Peña-Diaz, Aurora; Hernández-Brenes, Carmen; García-Rivas, Gerardo
2015-01-01
Platelets play a pivotal role in physiological hemostasis. However, in coronary arteries damaged by atherosclerosis, enhanced platelet aggregation, with subsequent thrombus formation, is a precipitating factor in acute ischemic events. Avocado pulp (Persea americana) is a good source of bioactive compounds, and its inclusion in the diet as a source of fatty acid has been related to reduced platelet aggregability. Nevertheless, constituents of avocado pulp with antiplatelet activity remain unknown. The present study aims to characterize the chemical nature of avocado constituents with inhibitory effects on platelet aggregation. Centrifugal partition chromatography (CPC) was used as a fractionation and purification tool, guided by an in vitro adenosine diphosphate (ADP), arachidonic acid or collagen-platelet aggregation assay. Antiplatelet activity was initially linked to seven acetogenins that were further purified, and their dose-dependent effects in the presence of various agonists were contrasted. This process led to the identification of Persenone-C (3) as the most potent antiplatelet acetogenin (IC₅₀=3.4 mM) among the evaluated compounds. In vivo evaluations with Persenone A (4) demonstrated potential protective effects against arterial thrombosis (25 mg kg⁻¹ of body weight), as coagulation times increased (2-fold with respect to the vehicle) and thrombus formation was attenuated (71% versus vehicle). From these results, avocado may be referred to as a functional food containing acetogenin compounds that inhibit platelet aggregation with a potential preventive effect on thrombus formation, such as those that occur in ischaemic diseases.
Transforming insect electromyograms into pneumatic muscle control
Rutter, Brandon; Mu, Laiyong; Ritzmann, Roy; Quinn, Roger
2006-05-01
Robots can serve as hardware models for testing biological hypotheses. Both for this reason and to improve the state of the art of robotics, we strive to incorporate biological principles of insect locomotion into robotic designs. Previous research has resulted in a line of robots with leg designs based on walking and climbing movements of the cockroach Blaberus discoidalis. The current version, Robot V, uses muscle-like Braided Pneumatic Actuators (BPAs). In this paper, we use recorded electromyograms (EMGs) to drive robot joint motion. A muscle activation model was developed that transforms EMGs recorded from behaving cockroaches into appropriate commands for the robot. The transform is implemented by multiplying the EMG by an input gain thus generating an input pressure signal, which is used to drive a one-way closed loop pressure controller. The actuator then can be modeled as a capacitance with input rectification. The actuator exhaust valve is given a leak rate, making the transform a leaky integrator for air pressure, which drives the output force of the actuator. We find parameters of this transform by minimizing the difference between the robot motion produced and that observed in the cockroach. Although we have not reproduced full-amplitude cockroach motion using this robot, results from evaluation on reduced-amplitude cockroach angle data strongly suggest that braided pneumatic actuators can be used as part of a physical model of a biological system.
International Nuclear Information System (INIS)
Moore, C.J.; Fuller, S.L.H.; Burton, D.T.
1975-01-01
Analysis of the stomach contents of 97 white perch, Morone americana, taken from the effluent canal of a steam electric station (S.E.S.) and 106 white perch from adjacent Patuxent River waters indicated similar food habits from September 1970 through August 1971. However, 35 percent of all white perch taken from the heated effluent canal contained small pieces of coal and cinders, whereas only 3 percent of the river specimens contained such items in their stomachs. Fly ash and coal dust are present on the bottom of the S.E.S. canal, whereas little such material, if any, can be found on the river bottom in the study area. This suggests the canal fish were actively feeding in the heated effluent and not simply moving into the canal after feeding in the river. No significant difference (P greater than 0.05) was found between the average wet weight stomach contents of the river and canal fish within the same month
Schweitzer, C.E.; Feldmann, R.M.; Stringer, G.L.
2014-01-01
A large collection of Neozanthopsis americana (Rathbun, 1928) from the Middle Eocene (Lutetian) Cane River Formation in Louisiana, USA, represents the first opportunity to describe the species in detail. Detailed analysis of associated teleost otoliths and other vertebrate remains documents a
Brai, Bartholomew I C; Adisa, Rahmat A; Odetola, Adebimpe A
2014-01-01
Natural products from plants have received considerable attention in recent years due to their diverse pharmacological properties, including antioxidants and hepatoprotective activities. The protective effects of aqueous extract of Persea americana (AEPA) against carbon tetrachloride (CCl4)-induced hepatotoxicity in male albino rats was investigated. Liver damage was induced in rats by administering a 1:1 (v/v) mixture of CCl4 and olive oil [3 ml/kg, subcutaneously (sc)] after pre-treatment for 7 days with AEPA. Hepatoprotective effects of AEPA was evaluated by estimating the activities of alanine aminotransferase (ALT), aspartate aminotransferase (AST), alkaline phosphatase (ALP) and levels of total bilirubin (TBL). The effects of AEPA on biomarkers of oxidative damage (lipid peroxidation) and antioxidant enzymes namely, catalase (CAT), superoxide dismutase (SOD), glutathione peroxidase (GPx) and glutathione S-transferase (GST) were measured in liver post mitochondrial fraction. AEPA and Reducdyn® showed significant (p<0.05) hepatoprotective activity by decreasing the activities of ALT, AST, ALP and reducing the levels of TBL. The activities of antioxidant enzymes, levels of malondialdehyde and protein carbonyls were also decreased dose-dependently in the AEPA-treated rats. Pre-treatment with AEPA also decreased the serum levels of glutathione significantly. These data revealed that AEPA possesses significant hepatoprotective effects against CCl4-induced toxicity attributable to its constituent phytochemicals. The mechanism of hepatoprotection seems to be through modulation of antioxidant enzyme system.
Brauch, J E; Zapata-Porras, S P; Buchweitz, M; Aschoff, J K; Carle, R
2016-11-01
Due to consumers' increasing health awareness, food industry aims at replacing synthetic dyes by natural counterparts. The substitution of blue synthetic dyes is particularly challenging since current natural alternatives such as phycocyanin (Spirulina) suffer from poor stability. Jagua blue (produced from Genipa americana L. fruit) might represent a potential novel blue pigment source. However, only little is known about its color properties, and application in food systems. Therefore, the blue color and the stability of Jagua blue were assessed for the first time and compared to commonly used colorants, namely, Spirulina, brilliant blue FCF (Blue no. 1), and indigo carmine (Blue no. 2). The reaction rate of Jagua blue was independent of its concentration, confirming thermal degradation to follow first-order kinetics. Between pH 3.6 and 5.0, the color hue of Jagua blue solutions was similar to that of Blue no. 2. However, Jagua blue revealed markedly higher storage stabilities (t 1/2 =86-105days) than Blue no. 2 (t 1 /2 ≤9days) and was less susceptible to acidic pH of 3.6 (t 1 /2 =86days) than Spirulina (t 1 /2 =70days). High negative b* values (blueness) of colored gelatin gels were only obtained for Jagua blue and Spirulina, and the former exhibited higher light stabilities (t 1 /2 =15days) than Spirulina gels (t 1 /2 =4days). Our findings indicate Jagua blue to be a most promising alternative to synthetic dyes, providing relevant information regarding potential food applications. Copyright © 2016 Elsevier Ltd. All rights reserved.
Variabilidade genética de Genipa americana L. pertencente ao baixo curso do rio São Francisco
Directory of Open Access Journals (Sweden)
Allívia Rouse Carregosa Rabbani
2012-06-01
Full Text Available A utilização de marcadores genéticos em estudos de caracterização de ecossistemas florestais permite avanços no entendimento genético das populações naturais, bem como auxilia na definição de estratégias de recuperação ou restauração florestal. Este trabalho foi realizado com o objetivo de avaliar a diversidade genética entre 18 indivíduos de Jenipapo (Genipa americana L. procedentes da região do Baixo São Francisco sergipano por meio de marcadores RAPD. Para a amplificação do material genético foram utilizados 12 oligonucleotídeos para análise da diversidade. Pelo índice de Jaccard, a similaridade genética média (Sgm entre os indivíduos foi de 60,4% sendo que, a maior obtida foi identificada entre os indivíduos G11 e G12 (83,6%±0,03 e a menor entre os indivíduos G4 e G18 (36,5%, ±0,02. Com base na Sgm (78,4%, sete pares indivíduos foram considerados geneticamente semelhantes. A partir destas análises, os indivíduos podem ser utilizados como matrizes fornecedoras de sementes em combinação com outros indivíduos em programas de restauração de áreas degradadas, porém devem compor áreas distantes.
Georgin, Jordana; da Silva Marques, Bianca; da Silveira Salla, Julia; Foletto, Edson Luiz; Allasia, Daniel; Dotto, Guilherme Luiz
2018-03-01
The treatment of colored effluents containing Procion Red dye (PR) was investigated using H 2 SO 4 and HNO 3 modified avocado shells (Persea americana) as adsorbents. The adsorbent materials (AS-H 2 SO 4 and AS-HNO 3 ) were properly characterized. The adsorption study was carried out considering the effects of adsorbent dosage and pH. Kinetic, equilibrium, and thermodynamic aspects were also evaluated. Finally, the adsorbents were tested to treat simulated dye house effluents. For both materials, the adsorption was favored using 0.300 g L -1 of adsorbent at pH 6.5, where, more than 90% of PR was removed from the solution. General order model was able to explain the adsorption kinetics for both adsorbents. The Sips model was adequate to represent the isotherm data, being the maximum adsorption capacities of 167.0 and 212.6 mg g -1 for AS-H 2 SO 4 and AS-HNO 3 , respectively. The adsorption processes were thermodynamically spontaneous, favorable (- 17.0 Avocado shells, after a simple acid treatment, can be a low-cost option to treat colored effluents.
Directory of Open Access Journals (Sweden)
Nurimar C. Fernandes
2004-08-01
Full Text Available FUNDAMENTOS: A leishmaniose tegumentar americana distribui-se amplamente no Brasil, e o Estado do Rio de Janeiro (capital e interior constitui área endêmica onde o vetor é encontrado dentro e ao redor das habitações. OBJETIVOS: Análise prospectiva de 48 casos de leishmaniose tegumentar americana atendidos no Hospital Universitário Clementino Fraga Filho/UFRJ, no período de 1990 a 2002. MÉTODOS: Todos os pacientes foram submetidos à biópsia de pele ou mucosa, teste de Montenegro e exame otorrinolaringológico; SbV (10 a 20mg/kg, no total de 10, 30 e 90 doses. foi empregado em 44 pacientes; em quatro casos, anfotericina B (0,5mg/kg/dose até dose cumulativa de 30mg/kg. RESULTADOS: 28 homens e 20 mulheres na faixa etária de 10 a 89 anos, dos quais 38 (79,1% infectados no Rio de Janeiro, apresentaram úlcera de membro inferior e comprometimento de mucosa nasal como manifestações mais freqüentes; 41 casos (85,4% foram reatores à intradermorreação de Montenegro (5mm; 17 casos (35,4% foram positivos para o achado de amastigotas em macrófagos no infiltrado inflamatório dérmico; predominou o processo inflamatório crônico granulomatoso; cura clínica foi observada em 47 casos; um caso evoluiu para óbito no décimo dia de tratamento. CONCLUSÕES: O estudo da leishmaniose tegumentar (HUCFF/UFRJ no período 1990/2002 evidenciou padrão conhecido nos aspectos epidemiológicos, clínicos e de resposta terapêutica ao antimonial (SbV e anfotericina B.BACKGROUND: American tegumentary Leishmaniasis is widely found in Brazil; the state of Rio de Janeiro (capital and hinterland is an endemic area where the vector is found inside and outside houses. OBJECTIVES: prospective study of 48 cases attended at the Teaching Hospital Clementino Fraga Filho - UFRJ, between 1990 - 2002. METHODS: All patients were submitted to skin or mucosa biopsy, Montenegro skin test and otorhinolaryngologic examination; SbV (10 - 20 mg/kg with 10, 30 and 90 doses was