High temperature co-axial winding transformers
Divan, Deepakraj M.; Novotny, Donald W.
1993-01-01
The analysis and design of co-axial winding transformers is presented. The design equations are derived and the different design approaches are discussed. One of the most important features of co-axial winding transformers is the fact that the leakage inductance is well controlled and can be made low. This is not the case in conventional winding transformers. In addition, the power density of co-axial winding transformers is higher than conventional ones. Hence, using co-axial winding transformers in a certain converter topology improves the power density of the converter. The design methodology used in meeting the proposed specifications of the co-axial winding transformer specifications are presented and discussed. The final transformer design was constructed in the lab. Co-axial winding transformers proved to be a good choice for high power density and high frequency applications. They have a more predictable performance compared with conventional transformers. In addition, the leakage inductance of the transformer can be controlled easily to suit a specific application. For space applications, one major concern is the extraction of heat from power apparatus to prevent excessive heating and hence damaging of these units. Because of the vacuum environment, the only way to extract heat is by using a cold plate. One advantage of co-axial winding transformers is that the surface area available to extract heat from is very large compared to conventional transformers. This stems from the unique structure of the co-axial transformer where the whole core surface area is exposed and can be utilized for cooling effectively. This is a crucial issue here since most of the losses are core losses.
Wang, Cuiling; Zhang, Shouheng; Qiao, Shizhu; Du, Honglei; Liu, Xiaomin; Sun, Ruicong; Chu, Xian-Ming; Miao, Guo-Xing; Dai, Youyong; Kang, Shishou; Yan, Shishen; Li, Shandong
2018-05-01
Dual-mode ferromagnetic resonance is observed in FeCoB/Ru/FeCoB trilayer synthetic antiferromagnets with uniaxial in-plane magnetic anisotropy. The optical mode is present in the (0-108 Oe) magnetic field range, where the top and bottom layer magnetizations are aligned in opposite directions. The strong acoustic mode appears, when the magnetic field exceeds the 300 Oe value, which corresponds to the flop transition in the trilayer. Magnetic field and angular dependences of resonant frequencies are studied for both optical (low-field) and acoustic (high field) modes. The low-field mode is found to be anisotropic but insensitive to the magnetic field value. In contrast, the high field mode is quasi-isotropic, but its resonant frequency is tunable by the value of the magnetic field. The coexistence of two modes of ferromagnetic resonance as well as switching between them with the increase in the magnetic field originates from the difference in the sign of interlayer coupling energy at the parallel and antiparallel configurations of the synthetic antiferromagnet. The dual-mode resonance in the studied trilayer structures provides greater flexibility in the design and functionalization of micro-inductors in monolithic microwave integrated circuits.
Directory of Open Access Journals (Sweden)
Wei Hua
2015-12-01
Full Text Available In this paper, a co-axial dual-mechanical ports flux-switching permanent magnet (CADMP-FSPM machine for hybrid electric vehicles (HEVs is proposed and investigated, which is comprised of two conventional co-axial FSPM machines, namely one high-speed inner rotor machine and one low-speed outer rotor machine and a non-magnetic ring sandwiched in between. Firstly, the topology and operation principle of the CADMP-FSPM machine are introduced; secondly, the control system of the proposed electronically-controlled continuously-variable transmission (E-CVT system is given; thirdly, the key design specifications of the CADMP-FSPM machine are determined based on a conventional dual-mechanical ports (DMP machine with a wound inner rotor. Fourthly, the performances of the CADMP-FSPM machine and the normal DMP machine under the same overall volume are compared, and the results indicate that the CADMP-FSPM machine has advantages over the conventional DMP machine in the elimination of brushes and slip rings, improved thermal dissipation conditions for the inner rotor, direct-driven operation, more flexible modes, lower cogging torque and torque ripple, lower total harmonic distortion (THD values of phase PM flux linkage and phase electro-motive force (EMF, higher torque output capability and is suitable for the E-CVT systems. Finally, the pros and cons of the CADMP-FSPM machine are highlighted. This paper lays a theoretical foundation for further research on CADMP-FSPM machines used for HEVs.
Investigation of multipactor breakdown in communication satellite microwave co-axial systems
Nagesh, S. K.; Revannasiddiah, D.; Shastry, S. V. K.
2005-01-01
Multipactor breakdown or multipactor discharge is a form of high frequency discharge that may occur in microwave components operating at very low pressures. Some RF components of multi-channel communication satellites have co-axial geometry and handle high RF power under near-vacuum conditions. The breakdown occurs due to secondary electron resonance, wherein electrons move back and forth in synchronism with the RF voltage across the gap between the inner and outer conductors of the co-axial structure. If the yield of secondary electrons from the walls of the co-axial structure is greater than unity, then the electron density increases with time and eventually leads to the breakdown. In this paper, the current due to the oscillating electrons in the co-axial geometry has been treated as a radially oriented Hertzian dipole. The electric field, due to this dipole, at any point in the coaxial structure, may then be determined by employing the dyadic Green's function technique. This field has been compared with the field that would exist in the absence of multipactor.
Directory of Open Access Journals (Sweden)
Sidan Tian
2016-06-01
Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA
2006-01-01
Intel’s first dual-core Itanium processor, code-named "Montecito" is a major release of Intel's Itanium 2 Processor Family, which implements the Intel Itanium architecture on a dual-core processor with two cores per die (integrated circuit). Itanium 2 is much more powerful than its predecessor. It has lower power consumption and thermal dissipation.
Axially modulated arch resonator for logic and memory applications
Hafiz, Md Abdullah Al
2018-01-17
We demonstrate reconfigurable logic and random access memory devices based on an axially modulated clamped-guided arch resonator. The device is electrostatically actuated and the motional signal is capacitively sensed, while the resonance frequency is modulated through an axial electrostatic force from the guided side of the microbeam. A multi-physics finite element model is used to verify the effectiveness of the axial modulation. We present two case studies: first, a reconfigurable two-input logic gate based on the linear resonance frequency modulation, and second, a memory element based on the hysteretic frequency response of the resonator working in the nonlinear regime. The energy consumptions of the device for both logic and memory operations are in the range of picojoules, promising for energy efficient alternative computing paradigm.
New Sodium Cooled Long-Life Cores with Axially Multi-Driver Regions
International Nuclear Information System (INIS)
Hyun, Hae Ri; Hong, Ser Gi
2014-01-01
In this concept of long-life core (they are sometimes called B-B (Breed and Burn)), tall blanket is placed above the relatively short driver fuel. In the initial stage of burning, the power by fission is mostly generated in the driver region and it moves into the blanket region. The power and flux distributions that are highly peaked in the axial direction propagates slowly from the driver into the blanket region. This concept of long-life core fully utilizes the breeding of blanket in the fast spectra and it can achieve very high burnup of fuel. In this work, we introduce new sodium cooled longlife cores rating 600MWe (1800MWt). In these cores, the driver regions are heterogeneously placed into blanket region so as to achieve stabilized and less peaked axial power distribution as depletion proceeds. At present, our study is focused on only two axial driver regions but this concept can be easily extended onto the multi-driver region concept. The cores designed in this paper have two axial driver regions so as to have stabilized and less peaked axial power distributions as depletion proceeds. The results of the core design and analyses show that the cores have very long-lives longer than -49EFPYs and high discharge burnup higher than 200GWD/kg. Additionally, we considered a long-life core having no blanket. As expected, it was shown that these cores have stabilized and less peaked axial power distribution as the fuel depletes. However, the study shows that the cores having two driver regions still show high initial peaking of the axial power distributions and the core can be optimized by changing the driver fuel height
Synthesis of Axial Power Distribution Using 5-Level Ex-core Detector in a Core Protection System
International Nuclear Information System (INIS)
Koo, Bon-Seung; Lee, Chung-Chan; Zee, Sung-Quun
2007-01-01
In ABB-CE digital plants, Core Protection Calculator System (CPCS) is used for a core protection based on several online measured system parameters including 3- level safety grade ex-core detector signals. The CPCS provides four independent channels for the departure from a nucleate boiling ratio (DNBR) and local power density (LPD) trip signals to the reactor protection system. Each channel consists of a core protection calculator (CPC) and a control element assembly calculator (CEAC). The cubic spline synthesis technique has been used in online calculations of the core axial power distributions using 3-level ex-core detector signals in CPC. The pre-determined cubic spline function sets are used depending on the characteristics of the ex-core detector responses. But this method shows large power distribution errors for the extremely skewed axial shapes due to restrictive function sets and an incorrect SAM value. Especially thus situation is worse at a higher burnup. To solve these problems, the cubic spline function sets are improved and it is demonstrated that the axial power shapes can be synthesized more accurately with the new function sets than those of a conventional CPC. In this paper, synthesis of an axial power distribution using a 5-level ex-core detector is described and the axial power distributions are compared between 3-level and 5-level ex-core detector systems
Kneafsey, T. J.; Nakagawa, S.
2015-12-01
Distribution of supercritical (sc) CO2 has a large impact on its flow behavior as well as on the properties of seismic waves used for monitoring. Simultaneous imaging of scCO2 distribution in a rock core using X-ray computed tomography (CT) and measurements of seismic waves in the laboratory can help understand how the distribution evolves as scCO2 invades through rock, and the resulting seismic signatures. To this end, we performed a series of laboratory scCO2 core-flood experiments in intact and fractured anisotropic Carbon Tan sandstone samples. In these experiments, we monitored changes in the CO2 saturation distribution and sonic-frequency acoustic resonances (yielding both seismic velocity and attenuation) over the course of the floods. A short-core resonant bar test system (Split-Hopkinson Resonant Bar Apparatus) custom fit into a long X-ray transparent pressure vessel was used for the seismic measurements, and a modified General Electric medical CT scanner was used to acquire X-ray CT data from which scCO2 saturation distributions were determined. The focus of the experiments was on the impact of single fractures on the scCO2 distribution and the seismic properties. For this reason, we examined several cases including 1. intact, 2. a closely mated fracture along the core axis, 3. a sheared fracture along the core axis (both vertical and horizontal for examining the buoyancy effect), and 4. a sheared fracture perpendicular to the core axis. For the intact and closely mated fractured cores, Young's modulus declined with increasing CO2 saturation, and attenuation increased up to about 15% CO2 saturation after which attenuation declined. For cores having wide axial fractures, the Young's modulus was lower than for the intact and closely mated cases, however did not change much with CO2 pore saturation. Much lower CO2 pore saturations were achieved in these cases. Attenuation increased more rapidly however than for the intact sample. For the core
Dual-detection confocal fluorescence microscopy: fluorescence axial imaging without axial scanning.
Lee, Dong-Ryoung; Kim, Young-Duk; Gweon, Dae-Gab; Yoo, Hongki
2013-07-29
We propose a new method for high-speed, three-dimensional (3-D) fluorescence imaging, which we refer to as dual-detection confocal fluorescence microscopy (DDCFM). In contrast to conventional beam-scanning confocal fluorescence microscopy, where the focal spot must be scanned either optically or mechanically over a sample volume to reconstruct a 3-D image, DDCFM can obtain the depth of a fluorescent emitter without depth scanning. DDCFM comprises two photodetectors, each with a pinhole of different size, in the confocal detection system. Axial information on fluorescent emitters can be measured by the axial response curve through the ratio of intensity signals. DDCFM can rapidly acquire a 3-D fluorescent image from a single two-dimensional scan with less phototoxicity and photobleaching than confocal fluorescence microscopy because no mechanical depth scans are needed. We demonstrated the feasibility of the proposed method by phantom studies.
FEM analysis of an single stator dual PM rotors axial synchronous machine
Tutelea, L. N.; Deaconu, S. I.; Popa, G. N.
2017-01-01
The actual e - continuously variable transmission (e-CVT) solution for the parallel Hybrid Electric Vehicle (HEV) requires two electric machines, two inverters, and a planetary gear. A distinct electric generator and a propulsion electric motor, both with full power converters, are typical for a series HEV. In an effort to simplify the planetary-geared e-CVT for the parallel HEV or the series HEV we hereby propose to replace the basically two electric machines and their two power converters by a single, axial-air-gap, electric machine central stator, fed from a single PWM converter with dual frequency voltage output and two independent PM rotors. The proposed topologies, the magneto-motive force analysis and quasi 3D-FEM analysis are the core of the paper.
Zhang, Hui; Li, Yu-Hao; Chen, Yang; Wang, Man-Man; Wang, Xue-Sheng; Yin, Xue-Bo
2017-03-01
Phototherapy shows some unique advantages in clinical application, such as remote controllability, improved selectivity, and low bio-toxicity, than chemotherapy. In order to improve the safety and therapeutic efficacy, imaging-guided therapy seems particularly important because it integrates visible information to speculate the distribution and metabolism of the probe. Here we prepare biocompatible core-shell nanocomposites for dual-modality imaging-guided photothermal and photodynamic dual-therapy by the in situ growth of porphyrin-metal organic framework (PMOF) on Fe3O4@C core. Fe3O4@C core was used as T2-weighted magnetic resonance (MR) imaging and photothermal therapy (PTT) agent. The optical properties of porphyrin were well remained in PMOF, and PMOF was therefore selected for photodynamic therapy (PDT) and fluorescence imaging. Fluorescence and MR dual-modality imaging-guided PTT and PDT dual-therapy was confirmed with tumour-bearing mice as model. The high tumour accumulation of Fe3O4@C@PMOF and controllable light excitation at the tumour site achieved efficient cancer therapy, but low toxicity was observed to the normal tissues. The results demonstrated that Fe3O4@C@PMOF was a promising dual-imaging guided PTT and PDT dual-therapy platform for tumour diagnosis and treatment with low cytotoxicity and negligible in vivo toxicity.
Reconstruction of core axial power shapes using the alternating conditional expectation algorithm
International Nuclear Information System (INIS)
Lee, Eun Ki; Kim, Yong Hee; Cha, Kune Ho; Park, Moon Ghu
1999-01-01
We have introduced the alternating conditional expectation (ACE) algorithm in reconstructing 20-node axial core power shapes from five-level in-core detector powers. The core design code, Reactor Operation and Control Simulation (ROCS), calculates 3-dimensional power distributions for various core states, and the reference core-averaged axial power shapes and corresponding simulated detector powers are utilized to synthesize the axial power shape. By using the ACE algorithm, the optimal relationship between a dependent variable, the plane power, and independent variables, five detector powers, is determined without any preprocessing. A total of ∼3490 data sets per each cycle of YongGwang Nuclear (YGN) power plant units 3 and 4 is used for the regression. Continuous analytic function corresponding to each optimal transformation is calculated by simple regression model. The reconstructed axial power shapes of ∼21,200 cases are compared to the original ROCS axial power shapes. Also, to test the validity and accuracy of the new method, its performance is compared with that of the Fourier fitting method (FFM), a typical method of the deterministic approach. For a total of 21,204 data cases, the averages of root mean square (rms) error, axial peak error (ΔF z ), and axial shape index error (ΔASI) of new method are calculated as 0.81%, 0.51% and 0.00204, while those of FFM are 2.29%, 2.37% and 0.00264, respectively. We also evaluated the wide range of axial power profiles from the xenon-oscillation. The results show that the newly developed method is far superior to FFM; average rms and axial peak error are just ∼35 and ∼20% of those of FFM, respectively
Axially modulated arch resonator for logic and memory applications
Hafiz, Md Abdullah Al; Tella, Sherif Adekunle; Alcheikh, Nouha; Fariborzi, Hossein; Younis, Mohammad I.
2018-01-01
We demonstrate reconfigurable logic and random access memory devices based on an axially modulated clamped-guided arch resonator. The device is electrostatically actuated and the motional signal is capacitively sensed, while the resonance frequency
A fast spectrum dual path flow cermet reactor
International Nuclear Information System (INIS)
Anghaie, S.; Feller, G.J.; Peery, S.D.; Parsley, R.C.
1993-01-01
A cermet fueled, dual path fast reactor for space nuclear propulsion applications is conceptually designed. The reactor utilizes an outer annulus core and an inner cylindrical core with radial and axial reflector. The dual path flow minimizes the impact of power peaking near the radial reflector. Basic neutronics and core design aspects of the reactor are discussed. The dual path reactor is integrated into a 25000 lbf thrust nuclear rocket
Energy Technology Data Exchange (ETDEWEB)
Kołtunowicz, Tomasz N., E-mail: t.koltunowicz@pollub.pl [Department of Electrical Devices and High Voltage Technology, Lublin University of Technology, Nadbystrzycka 38a, 20-618 Lublin (Poland); Zukowski, Pawel [Department of Electrical Devices and High Voltage Technology, Lublin University of Technology, Nadbystrzycka 38a, 20-618 Lublin (Poland); Sidorenko, Julia [Department of Semiconductors Physics and Nanoelectronics, Belarusian State University, Independence Av. 4, 220030 Minsk (Belarus); Bayev, Vadim; Fedotova, Julia A. [Institute for Nuclear Problems, Belarusian State University, Bobrujskaya Str. 11, 220030 Minsk (Belarus); Opielak, Marek [Institute of Transport, Combustion Engines and Ecology, Lublin University of Technology, Nadbystrzycka 36, 20-618 Lublin (Poland); Marczuk, Andrzej [Department of Transporting and Agricultural Machinery, University of Life Sciences in Lublin, Głeboka 28, 20-612 Lublin (Poland)
2017-01-01
Ferromagnetic resonance (FMR) spectroscopy is applied for comparative analysis of granular (CoFeZ){sub x}(Al{sub 2}O{sub 3}){sub 100−x}, (31 at%≤x≤47 at%) films containing pure FeCo-based nanoparticles (NPs) or “FeCo-based core – oxide shell” NPs inside Al{sub 2}O{sub 3} matrix when deposited in oxygen-free or oxygen-containing atmosphere, correspondingly. It is established that g-factor extracted from the FMR spectra of films with core–shell NPs decreases with x below the value g =2.0023 for free electron that is untypical for metallic NPs. This effect is associated with the formation of the interface between ferromagnetic core and antiferromagnetic (ferrimagnetic) oxide shell of NPs. - Highlights: • CoFeZr-Al{sub 2}O{sub 3} granular films containing “FeCo core – oxide shell” nanoparticles. • magnetic anisotropy of (CoFeZr){sub x}(Al{sub 2}O{sub 3}){sub 100−x} films is of an easy plane type. • essential difference in dependence of g-factor on metal content in non- and oxidized film. • non-oxidized samples indicates the reduction of the value of films magnetization.
Tunable Clamped–Guided Arch Resonators Using Electrostatically Induced Axial Loads
Alcheikh, Nouha; Ramini, Abdallah; Hafiz, Md Abdullah Al; Younis, Mohammad I.
2017-01-01
We present a simulation and experimental investigation of bi-directional tunable in-plane clamped-guided arch microbeam resonators. Tensile and compressive axial forces are generated from a bi-directional electrostatic actuator, which modulates the microbeam stiffness, and hence changes its natural frequency to lower or higher values from its as-fabricated value. Several devices of various anchor designs and geometries are fabricated. We found that for the fabricated shallow arches, the effect of the curvature of the arch is less important compared to the induced axial stress from the axial load. We have shown that the first mode resonance frequency can be increased up to twice its initial value. Additionally, the third mode resonance frequency can be increased up to 30% of its initial value. These results can be promising as a proof-of-concept for the realization of wide-range tunable microresonators. The experimental results have been compared to finite-element simulations, showing good agreement among them.
Tunable Clamped–Guided Arch Resonators Using Electrostatically Induced Axial Loads
Alcheikh, Nouha
2017-01-04
We present a simulation and experimental investigation of bi-directional tunable in-plane clamped-guided arch microbeam resonators. Tensile and compressive axial forces are generated from a bi-directional electrostatic actuator, which modulates the microbeam stiffness, and hence changes its natural frequency to lower or higher values from its as-fabricated value. Several devices of various anchor designs and geometries are fabricated. We found that for the fabricated shallow arches, the effect of the curvature of the arch is less important compared to the induced axial stress from the axial load. We have shown that the first mode resonance frequency can be increased up to twice its initial value. Additionally, the third mode resonance frequency can be increased up to 30% of its initial value. These results can be promising as a proof-of-concept for the realization of wide-range tunable microresonators. The experimental results have been compared to finite-element simulations, showing good agreement among them.
An axially and radially two-zoned large liquid-metal fast breeder reactor core concept
International Nuclear Information System (INIS)
Kamei, T.; Arie, K.; Moriki, Y.; Suzuki, M.; Yamaoka, M.
1985-01-01
A new core concept that has advantages over conventional homogeneous cores in neutronics characteristics such as power peaking factor, burnup reactivity loss, and reactivity response to the movement of control rods in earthquakes has been evolved. Two options of the new core concept are feasible. One is the so-called axially heterogeneous core, with the internal blanket placed at the lower part of the core. The other concept is similar to the conventional homogeneous core, but has two different plutonium-enriched zones in the axial as well as in the radial direction, so it is a hybrid type of the conventional homogeneous core and the axially heterogeneous core. The new design concept is described and the way that the core characteristics are improved by the chosen key parameters is shown
Chen, M.; Ju, L. Y.; Hao, H. X.
2014-01-01
Small scale thermoacoustic heat engines have advantages in fields like space exploration and domestic applications considering small space occupation and ease of transport. In the present paper, the influence of resonator diameter on the general performance of a small thermoacoustic Stirling engine was experimentally investigated using helium as the working gas. Reducing the diameter of the resonator appropriately is beneficial for lower onset heating temperature, lower frequency and higher pressure amplitude. Based on the pressure distribution in the small thermoacoustic engine, an outlet for the acoustic work transmission was made to combine the engine and a miniature co-axial pulse tube cooler. The cooling performance of the whole refrigeration system without any moving part was tested. Experimental results showed that further efforts are required to optimize the engine performance and its match with the co-axial pulse tube cooler in order to obtain better cooling performance, compared with its original operating condition, driven by a traditional electrical linear compressor.
Axial heterogeneous core concept applied for super phoenix reactor
International Nuclear Information System (INIS)
Batista, J.L.; Renke, C.A.C.; Waintraub, M.; Santos Bastos, W. dos; Brito Aghina, L.O. de.
1991-11-01
Always maintaining the current design rules, this paper presents a parametric study on the type of axial heterogeneous core concept (CHA), utilizing a core of fast reactor Super Phenix type, reaching a maximum thermal burnup rate of 150000 M W d/t and being managed in single batch. (author)
International Nuclear Information System (INIS)
Pazirandeh, A.; Nasiri, S. H.
2012-01-01
Optimization of the fuel burn up is an important issue in nuclear reactor fuel management and technology. Radial enrichment distribution in the reactor core is a conventional method and axial enrichment is constant along the fuel rod. In this article, the effects of axial enrichment distribution variation on neutronic parameters of PWR core are studied. The axial length of the core is divided into ten sections, considering axial enrichment variation and leaving the existing radial enrichment distribution intact. This study shows that the radial and axial power peaking factors are decreased as compared with the typical conventional core. In addition, the first core lifetime lasts 30 days longer than normal PWR core. Moreover, at the same time boric acid density is 0.2 g/kg at the beginning of the cycle. The flux shape is also flat at the beginning of the cycle for the proposed configuration of the axially enrichment distribution.
Axially Modulated Clamped-Guided Arch Resonator for Memory and Logic Applications
Hafiz, Md Abdullah Al; Tella, Sherif Adekunle; Alcheikh, Nouha; Fariborzi, Hossein; Younis, Mohammad I.
2017-01-01
We experimentally demonstrate memory and logic devices based on an axially modulated clamped-guided arch resonator. The device are electrostatically actuated and capacitively sensed, while the resonance frequency modulation is achieved through an axial electrostatic force from the guided side of the clamped-guided arch microbeam. We present two case studies: first, a dynamic memory based on the nonlinear frequency response of the resonator, and second, a reprogrammable two-input logic gate based on the linear frequency modulation of the resonator. These devices show energy cost per memory/logic operation in pJ, are fully compatible with CMOS fabrication processes, have the potential for on-chip system integration, and operate at room temperature.
Axially Modulated Clamped-Guided Arch Resonator for Memory and Logic Applications
Hafiz, Md Abdullah Al
2017-11-03
We experimentally demonstrate memory and logic devices based on an axially modulated clamped-guided arch resonator. The device are electrostatically actuated and capacitively sensed, while the resonance frequency modulation is achieved through an axial electrostatic force from the guided side of the clamped-guided arch microbeam. We present two case studies: first, a dynamic memory based on the nonlinear frequency response of the resonator, and second, a reprogrammable two-input logic gate based on the linear frequency modulation of the resonator. These devices show energy cost per memory/logic operation in pJ, are fully compatible with CMOS fabrication processes, have the potential for on-chip system integration, and operate at room temperature.
Intermediate mass distribution of the dual resonance pomeron
International Nuclear Information System (INIS)
Chiu, C.B.; Matsuda, S.
1978-01-01
The intermediate mass distribution of the dual resonance pomeron is determined at the one-loop level and it is shown that the mass distribution obtained is remarkably similar to a suitably defined mass distribution in the dual multiperipheral model. Thus it is suggestive to identify the intermediate states of the dual resonance pomeron with multiperipheral processes. (Auth.)
Approach to improve the axial power distribution for the application of a core protection system
International Nuclear Information System (INIS)
Koo, Bon Seung; Cho, Jin Young; Song, Jae Seung; Lee, Chung Chan
2008-01-01
A Core Protection Calculator System (CPCS) is a digital computer based on a safety system for generating trip signals based on a calculation of the Departure from Nucleate Boiling Ratio (DNBR) and the Local Power Density (LPD) by using several on-line measured system parameters including 3-level ex-core detector signals. A few approaches to improve the axial power distribution for the application of a core protection system were performed. For the Yonggwang unit 3 (cycle 1), axial power distributions were synthesized by applying the cubic spline method and compared with the neutronics code results. Several new cubic spline function sets were generated for the drastically distorted axial shapes for a 3-level ex-core detector system. In addition, synthesized axial shapes with a 5-level ex-core detector signals were compared with the conventional 3-level detector results. It demonstrates that the newly generated function sets appear to be better than that of the conventional CPC from the aspect of an axial power synthesis, particularly for the heavily distorted shapes. Moreover, synthesis of an axial power distribution using 5-level ex-core detector signals appears to be better than that of the 3-level ex-core detector signals. From the above results, improvement of the thermal margin is expected because of an uncertainty decreasing a core protection system. (authors)
Experimental results of high power dual frequency resonant magnet excitation at TRIUMF
International Nuclear Information System (INIS)
Reiniger, K.W.; Heritier, G.
1988-06-01
We present some results of duel frequency resonant magnet excitation at full power using the old NINA synchrotron dipoles. These tests will simulate a typical resonant cell as proposed for the accelerating rings of the TRIUMF KAON Factory. These test have two main purposes: to verify circuit parameters and component ratings for the dual frequency resonant power supply system; and to measure directly electrical losses in a transverse magnet field, such as eddy current losses in magnet conductors, vacuum tubes and core losses in laminations. These data will be required for the detailed design of the accelerator system components. (Author) (Ref., 9 figs., tab.)
Improvement of Axial Reflector Cross Section Generation Model for PWR Core Analysis
Energy Technology Data Exchange (ETDEWEB)
Shim, Cheon Bo; Lee, Kyung Hoon; Cho, Jin Young [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-10-15
This paper covers the study for improvement of axial reflector XS generation model. In the next section, the improved 1D core model is represented in detail. Reflector XS generated by the improved model is compared to that of the conventional model in the third section. Nuclear design parameters generated by these two XS sets are also covered in that section. Significant of this study is discussed in the last section. Two-step procedure has been regarded as the most practical approach for reactor core designs because it offers core design parameters quite rapidly within acceptable range. Thus this approach is adopted for SMART (System-integrated Modular Advanced Reac- Tor) core design in KAERI with the DeCART2D1.1/ MASTER4.0 (hereafter noted as DeCART2D/ MASTER) code system. Within the framework of the two-step procedure based SMART core design, various researches have been studied to improve the core design reliability and efficiency. One of them is improvement of reflector cross section (XS) generation models. While the conventional FA/reflector two-node model used for most core designs to generate reflector XS cannot consider the actual configuration of fuel rods that intersect at right angles to axial reflectors, the revised model reflects the axial fuel configuration by introducing the radially simplified core model. The significance of the model revision is evaluated by observing HGC generated by DeCART2D, reflector XS, and core design parameters generated by adopting the two models. And it is verified that about 30 ppm CBC error can be reduced and maximum Fq error decreases from about 6 % to 2.5 % by applying the revised model. Error of AO and axial power shapes are also reduced significantly. Therefore it can be concluded that the simplified 1D core model improves the accuracy of the axial reflector XS and leads to the two-step procedure reliability enhancement. Since it is hard for core designs to be free from the two-step approach, it is necessary to find
Song, Zhuonan; Qiu, Fen; Zaia, Edmond W; Wang, Zhongying; Kunz, Martin; Guo, Jinghua; Brady, Michael; Mi, Baoxia; Urban, Jeffrey J
2017-11-08
dual-channel molecular sieving core/shell porous crystals in hybrid membranes thus provides a promising means for CO 2 capture from flue gas.
Design of a Modular E-Core Flux Concentrating Axial Flux Machine: Preprint
Energy Technology Data Exchange (ETDEWEB)
Husain, Tausif; Sozer, Yilmaz; Husain, Iqbal; Muljadi, Eduard
2015-08-24
In this paper a novel E-Core axial flux machine is proposed. The machine has a double-stator, single-rotor configuration with flux-concentrating ferrite magnets and pole windings across each leg of an E-Core stator. E-Core stators with the proposed flux-concentrating rotor arrangement result in better magnet utilization and higher torque density. The machine also has a modular structure facilitating simpler construction. This paper presents a single-phase and a three-phase version of the E-Core machine. Case studies for a 1.1-kW, 400-rpm machine for both the single-phase and three-phase axial flux machines are presented. The results are verified through 3D finite element analysis. facilitating simpler construction. This paper presents a single-phase and a three-phase version of the E-Core machine. Case studies for a 1.1-kW, 400-rpm machine for both the single-phase and three-phase axial flux machines are presented. The results are verified through 3D finite element analysis.
Whole-body magnetic resonance imaging in axial spondyloarthritis
DEFF Research Database (Denmark)
Krabbe, Simon; Østergaard, Mikkel; Eshed, Iris
2018-01-01
Objective. To investigate whether adalimumab (ADA) reduces whole-body (WB-) magnetic resonance imaging (MRI) indices for inflammation in the entheses, peripheral joints, sacroiliac joints, spine, and the entire body in patients with axial spondyloarthritis (axSpA). Methods. An investigator-initia...
Design of a dual linear polarization antenna using split ring resonators at X-band
Ahmed, Sadiq; Chandra, Madhukar
2017-11-01
Dual linear polarization microstrip antenna configurations are very suitable for high-performance satellites, wireless communication and radar applications. This paper presents a new method to improve the co-cross polarization discrimination (XPD) for dual linear polarized microstrip antennas at 10 GHz. For this, three various configurations of a dual linear polarization antenna utilizing metamaterial unit cells are shown. In the first layout, the microstrip patch antenna is loaded with two pairs of spiral ring resonators, in the second model, a split ring resonator is placed between two microstrip feed lines, and in the third design, a complementary split ring resonators are etched in the ground plane. This work has two primary goals: the first is related to the addition of metamaterial unit cells to the antenna structure which permits compensation for an asymmetric current distribution flow on the microstrip antenna and thus yields a symmetrical current distribution on it. This compensation leads to an important enhancement in the XPD in comparison to a conventional dual linear polarized microstrip patch antenna. The simulation reveals an improvement of 7.9, 8.8, and 4 dB in the E and H planes for the three designs, respectively, in the XPD as compared to the conventional dual linear polarized patch antenna. The second objective of this paper is to present the characteristics and performances of the designs of the spiral ring resonator (S-RR), split ring resonator (SRR), and complementary split ring resonator (CSRR) metamaterial unit cells. The simulations are evaluated using the commercial full-wave simulator, Ansoft High-Frequency Structure Simulator (HFSS).
Preliminary study on flexible core design of super FBR with multi-axial fuel shuffling
International Nuclear Information System (INIS)
Sukarman; Yamaji, Akifumi; Someya, Takayuki; Noda, Shogo
2017-01-01
Preliminary study has been conducted on developing a new flexible core design concept for the Supercritical water-cooled Fast Breeder Reactor (Super FBR) with multi-axial fuel shuffling. The proposed new concept focuses on the characteristic large axial coolant density change in supercritical water cooled reactors (SCWRs) when the coolant inlet temperature is below the pseudocritical point and large coolant enthalpy rise is taken in the core for achieving high thermal efficiency. The aim of the concept is to attain both the high breeding performance and good thermal-hydraulic performance at the same time. That is, short Compound System Doubling Time (CSDT) for high breeding, large coolant enthalpy rise for high thermal efficiency, and large core power. The proposed core concept consists of horizontal layers of mixed oxide (MOX) fuels and depleted uranium (DU) blanket layers at different elevation levels. Furthermore, the upper core and the lower core are separated and independent fuel shuffling schemes in these two core regions are considered. The number of fuel batches and fuel shuffling scheme of the upper core were changed to investigate influence of multi-axial fuel shuffling on the core characteristics. The core characteristics are evaluated with-three-dimensional diffusion calculations, which are fully-coupled with thermal-hydraulics calculations based on single channel analysis model. The results indicate that the proposed multi-axial fuel shuffling scheme does have a large influence on CSDT. Further investigations are necessary to develop the core concept. (author)
Dual-band plasmonic resonator based on Jerusalem cross-shaped nanoapertures
Cetin, Arif E.; Kaya, Sabri; Mertiri, Alket; Aslan, Ekin; Erramilli, Shyamsunder; Altug, Hatice; Turkmen, Mustafa
2015-06-01
In this paper, we both experimentally and numerically introduce a dual-resonant metamaterial based on subwavelength Jerusalem cross-shaped apertures. We numerically investigate the physical origin of the dual-resonant behavior, originating from the constituting aperture elements, through finite difference time domain calculations. Our numerical calculations show that at the dual-resonances, the aperture system supports large and easily accessible local electromagnetic fields. In order to experimentally realize the aperture system, we utilize a high-precision and lift-off free fabrication method based on electron-beam lithography. We also introduce a fine-tuning mechanism for controlling the dual-resonant spectral response through geometrical device parameters. Finally, we show the aperture system's highly advantageous far- and near-field characteristics through numerical calculations on refractive index sensitivity. The quantitative analyses on the availability of the local fields supported by the aperture system are employed to explain the grounds behind the sensitivity of each spectral feature within the dual-resonant behavior. Possessing dual-resonances with large and accessible electromagnetic fields, Jerusalem cross-shaped apertures can be highly advantageous for wide range of applications demanding multiple spectral features with strong nearfield characteristics.
Smith, M. C.; Perfit, M. R.; Davis, C.; Kamenov, G. D.
2011-12-01
Three spatially related volcanic eruptions along the CoAxial Segment of the Juan de Fuca Ridge (JdFR) have documented emplacements between 1981 and 1993. Two of the historic flows outcrop at the "Flow Site" and were emplaced within less than 12 years and 500 m from one another. The third was emplaced at the "Floc Site" to the south in the 1980s. Previous studies have documented that CoAxial lavas are among the most incompatible element and isotopically depleted lavas along the entire JdFR, whereas the Axial Seamount segment immediately south of CoAxial has erupted the most chemically enriched lavas south of the Endeavor Segment. Geochemical studies have shown little temporal change in the chemistry of recent Axial Seamount eruptives, whereas CoAxial lavas exhibit distinct chemical differences over short time periods. Significant chemical differences observed among depleted CoAxial lavas emplaced close to one another in space and time are in marked contrast to the relatively constant chemical characteristics of enriched lavas erupted at the magmatically more robust Axial segment only 10's of kilometers to the south and west. New trace element and isotopic (Sr, Nd, Pb) geochemical analyses of historic and older CoAxial lavas have resulted in better documentation of interflow and intraflow chemical variation providing an improved understanding of spatial/temporal chemical variability in lavas, and further insight into JdFR magmatic processes. Modeling of major and trace element abundances suggest that the observed intraflow chemical variation within CoAxial lavas is largely due to shallow-level fractional crystallization but that a single fractional crystallization model cannot account for all interflow chemical variation. In fact, elemental and isotopic data require different parental magmas for each of the three recent CoAxial Segment lava flows suggesting very short-term differences or changes in the chemical character of the mantle source region. In particular
An axial calculation method for accurate two-dimensional PWR core simulation
International Nuclear Information System (INIS)
Grimm, P.
1985-02-01
An axial calculation method, which improves the agreement of the multiplication factors determined by two- and three-dimensional PWR neutronic calculations, is presented. The axial buckling is determined at each time point so as to reproduce the increase of the leakage due to the flattening of the axial power distribution and the effect of the axial variation of the group constants of the fuel on the reactivity is taken into account. The results of a test example show that the differences of k-eff and cycle length between two- and three-dimensional calculations, which are unsatisfactorily large if a constant buckling is used, become negligible if the results of the axial calculation are used in the two-dimensional core simulation. (Auth.)
Development of sustained and dual drug release co-extrusion formulations for individual dosing.
Laukamp, Eva Julia; Vynckier, An-Katrien; Voorspoels, Jody; Thommes, Markus; Breitkreutz, Joerg
2015-01-01
In personalized medicine and patient-centered medical treatment individual dosing of medicines is crucial. The Solid Dosage Pen (SDP) allows for an individual dosing of solid drug carriers by cutting them into tablet-like slices. The aim of the present study was the development of sustained release and dual release formulations with carbamazepine (CBZ) via hot-melt co-extrusion for the use in the SDP. The selection of appropriate coat- and core-formulations was performed by adapting the mechanical properties (like tensile strength and E-modulus) for example. By using different excipients (polyethyleneglycols, poloxamers, white wax, stearic acid, and carnauba wax) and drug loadings (30-50%) tailored dissolution kinetics was achieved showing cube root or zero order release mechanisms. Besides a biphasic drug release, the dose-dependent dissolution characteristics of sustained release formulations were minimized by a co-extruded wax-coated formulation. The dissolution profiles of the co-extrudates were confirmed during short term stability study (six months at 21.0 ± 0.2 °C, 45%r.h.). Due to a good layer adhesion of core and coat and adequate mechanical properties (maximum cutting force of 35.8 ± 2.0 N and 26.4 ± 2.8 N and E-modulus of 118.1 ± 8.4 and 33.9 ± 4.5 MPa for the dual drug release and the wax-coated co-extrudates, respectively) cutting off doses via the SDP was precise. While differences of the process parameters (like the barrel temperature) between the core- and the coat-layer resulted in unsatisfying content uniformities for the wax-coated co-extrudates, the content uniformity of the dual drug release co-extrudates was found to be in compliance with pharmacopoeial specification. Copyright © 2015 Elsevier B.V. All rights reserved.
Cheng, Jinbing; Lu, Yang; Qiu, Kangwen; Yan, Hailong; Xu, Jinyou; Han, Lei; Liu, Xianming; Luo, Jingshan; Kim, Jang-Kyo; Luo, Yongsong
2015-07-01
We report the synthesis of three dimensional (3D) NiCo2O4@NiCo2O4 nanocactus arrays grown directly on a Ni current collector using a facile solution method followed by electrodeposition. They possess a unique 3D hierarchical core-shell structure with large surface area and dual-functionalities that can serve as electrodes for both supercapacitors (SCs) and lithium-ion batteries (LIBs). As the SC electrode, they deliver a remarkable specific capacitance of 1264 F g-1 at a current density of 2 A g-1 and ~93.4% of capacitance retention after 5000 cycles at 2 A g-1. When used as the anode for LIBs, a high reversible capacity of 925 mA h g-1 is achieved at a rate of 120 mA g-1 with excellent cyclic stability and rate capability. The ameliorating features of the NiCo2O4 core/shell structure grown directly on highly conductive Ni foam, such as hierarchical mesopores, numerous hairy needles and a large surface area, are responsible for the fast electron/ion transfer and large active sites which commonly contribute to the excellent electrochemical performance of both the SC and LIB electrodes.
Axial strain in GaAs/InAs core-shell nanowires
Energy Technology Data Exchange (ETDEWEB)
Biermanns, Andreas; Pietsch, Ullrich [Universitaet Siegen, Festkoerperphysik, 57068 Siegen (Germany); Rieger, Torsten; Gruetzmacher, Detlev; Ion Lepsa, Mihail [Peter Gruenberg Institute (PGI-9), Forschungszentrum, 52425 Juelich (Germany); JARA-Fundamentals of Future Information Technology, 52425 Juelich (Germany); Bussone, Genziana [Universitaet Siegen, Festkoerperphysik, 57068 Siegen (Germany); ESRF, 6 rue Jules Horowitz, BP220, F-38043 Grenoble Cedex (France)
2013-01-28
We study the axial strain relaxation in GaAs/InAs core-shell nanowire heterostructures grown by molecular beam epitaxy. Besides a gradual strain relaxation of the shell material, we find a significant strain in the GaAs core, increasing with shell thickness. This strain is explained by a saturation of the dislocation density at the core-shell interface. Independent measurements of core and shell lattice parameters by x-ray diffraction reveal a relaxation of 93% in a 35 nm thick InAs shell surrounding cores of 80 nm diameter. The compressive strain of -0.5% compared to bulk InAs is accompanied by a tensile strain up to 0.9% in the GaAs core.
Directory of Open Access Journals (Sweden)
T. K. Bauska
2014-11-01
Full Text Available An important constraint on mechanisms of past carbon cycle variability is provided by the stable isotopic composition of carbon in atmospheric carbon dioxide (δ13C-CO2 trapped in polar ice cores, but obtaining very precise measurements has proven to be a significant analytical challenge. Here we describe a new technique to determine the δ13C of CO2 at very high precision, as well as measuring the CO2 and N2O mixing ratios. In this method, ancient air is extracted from relatively large ice samples (~400 g with a dry-extraction "ice grater" device. The liberated air is cryogenically purified to a CO2 and N2O mixture and analyzed with a microvolume-equipped dual-inlet IRMS (Thermo MAT 253. The reproducibility of the method, based on replicate analysis of ice core samples, is 0.02‰ for δ13C-CO2 and 2 ppm and 4 ppb for the CO2 and N2O mixing ratios, respectively (1σ pooled standard deviation. Our experiments show that minimizing water vapor pressure in the extraction vessel by housing the grating apparatus in a ultralow-temperature freezer (−60 °C improves the precision and decreases the experimental blank of the method to −0.07 ± 0.04‰. We describe techniques for accurate calibration of small samples and the application of a mass-spectrometric method based on source fragmentation for reconstructing the N2O history of the atmosphere. The oxygen isotopic composition of CO2 is also investigated, confirming previous observations of oxygen exchange between gaseous CO2 and solid H2O within the ice archive. These data offer a possible constraint on oxygen isotopic fractionation during H2O and CO2 exchange below the H2O bulk melting temperature.
Analysis and measurement of the stability of dual-resonator oscillators
Ghaed, Hassan
2012-01-01
This paper investigates the stability of oscillators with dual-resonating tanks. After deriving oscillator models, it is shown that contrary to prior belief, there can be only one stable oscillating state. Sufficient conditions for stable oscillating states are derived and silicon measurement results are used to prove their validity. A fully integrated transmitter for intraocular pressure sensing that leverages the dual-resonator tank is designed and fabricated based on the derived models. An unstable version of the transmitter is also demonstrated to prove the concept of instability in dual-resonator oscillators © 2012 IEEE.
Tutelea, L. N.; Deaconu, S. I.; Boldea, I.; Popa, G. N.
2014-03-01
The actual e - continuously variable transmission (e-CVT) solution for the parallel Hybrid Electric Vehicle (HEV) requires two electric machines, two inverters, and a planetary gear. A distinct electric generator and a propulsion electric motor, both with full power converters, are typical for a series HEV. In an effort to simplify the planetary-geared e-CVT for the parallel HEV or the series HEV we hereby propose to replace the basically two electric machines and their two power converters by a single, axial-air-gap, electric machine central stator, fed from a single PWM converter with dual frequency voltage output and two independent PM rotors, destined for hybrid electric vehicles (HEV) and military vehicles applications. The proposed topologies and the magneto-motive force analysis are the core of the paper.
International Nuclear Information System (INIS)
University of Timisoara, Electrical Engineering Department, Vasile Parvan str., no. 1-2, 300223 Timisoara (Romania))" data-affiliation=" (Politehnica University of Timisoara, Electrical Engineering Department, Vasile Parvan str., no. 1-2, 300223 Timisoara (Romania))" >Tutelea, L N; University of Timisoara, Electrical Engineering Department, Vasile Parvan str., no. 1-2, 300223 Timisoara (Romania))" data-affiliation=" (Politehnica University of Timisoara, Electrical Engineering Department, Vasile Parvan str., no. 1-2, 300223 Timisoara (Romania))" >Boldea, I; University of Timisoara, Department of Electrotechnical Engineering and Industrial Informatics, 5 Revolution Street, Hunedoara, 331128 (Romania))" data-affiliation=" (Politehnica University of Timisoara, Department of Electrotechnical Engineering and Industrial Informatics, 5 Revolution Street, Hunedoara, 331128 (Romania))" >Deaconu, S I; University of Timisoara, Department of Electrotechnical Engineering and Industrial Informatics, 5 Revolution Street, Hunedoara, 331128 (Romania))" data-affiliation=" (Politehnica University of Timisoara, Department of Electrotechnical Engineering and Industrial Informatics, 5 Revolution Street, Hunedoara, 331128 (Romania))" >Popa, G N
2014-01-01
The actual e – continuously variable transmission (e-CVT) solution for the parallel Hybrid Electric Vehicle (HEV) requires two electric machines, two inverters, and a planetary gear. A distinct electric generator and a propulsion electric motor, both with full power converters, are typical for a series HEV. In an effort to simplify the planetary-geared e-CVT for the parallel HEV or the series HEV we hereby propose to replace the basically two electric machines and their two power converters by a single, axial-air-gap, electric machine central stator, fed from a single PWM converter with dual frequency voltage output and two independent PM rotors, destined for hybrid electric vehicles (HEV) and military vehicles applications. The proposed topologies and the magneto-motive force analysis are the core of the paper
Improved methodology for generation of axial flux shapes in digital core protection systems
International Nuclear Information System (INIS)
Lee, G.-C.; Baek, W.-P.; Chang, S.H.
2002-01-01
An improved method of axial flux shape (AFS) generation for digital core protection systems of pressurized water reactors is presented in this paper using an artificial neural network (ANN) technique - a feedforward network trained by backpropagation. It generates 20-node axial power shapes based on the information from three ex-core detectors. In developing the method, a total of 7173 axial flux shapes are generated from ROCS code simulation for training and testing of the ANN. The ANN trained 200 data predicts the remaining data with the average root mean square error of about 3%. The developed method is also tested with the real plant data measured during normal operation of Yonggwang Unit 4. The RMS errors in the range of 0.9∼2.1% are about twice as accurate as the cubic spline approximation method currently used in the plant. The developed method would contribute to solve the drawback of the current method as it shows reasonable accuracy over wide range of core conditions
Compact Dual-Band Bandpass Filter Using Stubs Loaded Ring Resonator
Xu, Jin
2016-01-01
This paper presents a novel second-order dual-band bandpass filter (BPF) by using proposed stubs loaded ring resonator. The resonant behavior of proposed stubs loaded ring resonator is analyzed by even-/odd-mode method, which shows its multiple-mode resonant characteristic. Parameters sweep is done so as to give the design guidelines. As an example, a second-order dual-band BPF operating at 1.8/5.2 GHz for GSM and WLAN applications is designed, fabricated and measured. The fabricated filter has a very compact size of 0.05λg×0.15λg. Measured results also show that the proposed dual-band BPF has a better than 20 dB rejection upper stopband from 5.47 GHz to 12.56 GHz. Good agreement is shown between the simulated and measured results.
Atoche, Alejandro Castillo; Castillo, Javier Vázquez
2012-01-01
A high-speed dual super-systolic core for reconstructive signal processing (SP) operations consists of a double parallel systolic array (SA) machine in which each processing element of the array is also conceptualized as another SA in a bit-level fashion. In this study, we addressed the design of a high-speed dual super-systolic array (SSA) core for the enhancement/reconstruction of remote sensing (RS) imaging of radar/synthetic aperture radar (SAR) sensor systems. The selected reconstructive SP algorithms are efficiently transformed in their parallel representation and then, they are mapped into an efficient high performance embedded computing (HPEC) architecture in reconfigurable Xilinx field programmable gate array (FPGA) platforms. As an implementation test case, the proposed approach was aggregated in a HW/SW co-design scheme in order to solve the nonlinear ill-posed inverse problem of nonparametric estimation of the power spatial spectrum pattern (SSP) from a remotely sensed scene. We show how such dual SSA core, drastically reduces the computational load of complex RS regularization techniques achieving the required real-time operational mode. PMID:22736964
The Co-axial Flow of Injectable Solid Hydrogels with Encapsulated Cells
Stewart, Brandon; Pochan, Darrin; Sathaye, Sameer
2013-03-01
Hydrogels are quickly becoming an important biomaterial that can be used for the safe, localized injection of cancer drugs, the injection of stem cells into areas of interest or other biological applications. Our peptides can be self-assembled in a syringe where they form a gel, sheared by injection and, once in the body, immediately reform a localized pocket of stiff gel. My project has been designed around looking at the possibility of having a co-axial strand, in which one gel can surround another. This co-axial flow can be used to change the physical properties of our gel during injection, such as stiffening our gel using hyaluronic acid or encapsulating cells in the gel and surrounding the gel with growth medium or other biological factors. Rheology on hyaluron stiffened gels and cells encapsulated in gels was performed for comparison to the results from co-axial flow. Confocal microscopy was used to examine the coaxial gels after flow and to determine how the co-axial nature of the gels is affected by the concentration of peptide.
Pang, Rui; Teramura, Kentaro; Tatsumi, Hiroyuki; Asakura, Hiroyuki; Hosokawa, Saburo; Tanaka, Tsunehiro
2018-01-25
A core-shell structure of Ag-Cr dual cocatalyst loaded-Ga 2 O 3 was found to significantly enhance the formation rate of CO and selectivity toward CO evolution for the photocatalytic conversion of CO 2 where H 2 O is used as an electron donor.
Axial SPN and radial MOC coupled whole core transport calculation
International Nuclear Information System (INIS)
Cho, Jin-Young; Kim, Kang-Seog; Lee, Chung-Chan; Zee, Sung-Quun; Joo, Han-Gyu
2007-01-01
The Simplified P N (SP N ) method is applied to the axial solution of the two-dimensional (2-D) method of characteristics (MOC) solution based whole core transport calculation. A sub-plane scheme and the nodal expansion method (NEM) are employed for the solution of the one-dimensional (1-D) SP N equations involving a radial transverse leakage. The SP N solver replaces the axial diffusion solver of the DeCART direct whole core transport code to provide more accurate, transport theory based axial solutions. In the sub-plane scheme, the radial equivalent homogenization parameters generated by the local MOC for a thick plane are assigned to the multiple finer planes in the subsequent global three-dimensional (3-D) coarse mesh finite difference (CMFD) calculation in which the NEM is employed for the axial solution. The sub-plane scheme induces a much less nodal error while having little impact on the axial leakage representation of the radial MOC calculation. The performance of the sub-plane scheme and SP N nodal transport solver is examined by solving a set of demonstrative problems and the C5G7MOX 3-D extension benchmark problems. It is shown in the demonstrative problems that the nodal error reaching upto 1,400 pcm in a rodded case is reduced to 10 pcm by introducing 10 sub-planes per MOC plane and the transport error is reduced from about 150 pcm to 10 pcm by using SP 3 . Also it is observed, in the C5G7MOX rodded configuration B problem, that the eigenvalues and pin power errors of 180 pcm and 2.2% of the 10 sub-planes diffusion case are reduced to 40 pcm and 1.4%, respectively, for SP 3 with only about a 15% increase in the computing time. It is shown that the SP 5 case gives very similar results to the SP 3 case. (author)
Theoretical analysis to investigate thermal performance of co-axial heat pipe solar collector
Azad, E.
2011-12-01
The thermal performance of co-axial heat pipe solar collector which consist of a collector 15 co-axial heat pipes surrounded by a transparent envelope and which heat a fluid flowing through the condenser tubes have been predicted using heat transfer analytical methods. The analysis considers conductive and convective losses and energy transferred to a fluid flowing through the collector condenser tubes. The thermal performances of co-axial heat pipe solar collector is developed and are used to determine the collector efficiency, which is defined as the ratio of heat taken from the water flowing in the condenser tube and the solar radiation striking the collector absorber. The theoretical water outlet temperature and efficiency are compared with experimental results and it shows good agreement between them. The main advantage of this collector is that inclination of collector does not have influence on performance of co-axial heat pipe solar collector therefore it can be positioned at any angle from horizontal to vertical. In high building where the roof area is not enough the co-axial heat pipe solar collectors can be installed on the roof as well as wall of the building. The other advantage is each heat pipe can be topologically disconnected from the manifold.
Theoretical analysis to investigate thermal performance of co-axial heat pipe solar collector
Energy Technology Data Exchange (ETDEWEB)
Azad, E. [Iranian Research Organization for Science and Technology (IROST), Advanced Materials and Renewable Energy Department, Tehran (Iran, Islamic Republic of)
2011-12-15
The thermal performance of co-axial heat pipe solar collector which consist of a collector 15 co-axial heat pipes surrounded by a transparent envelope and which heat a fluid flowing through the condenser tubes have been predicted using heat transfer analytical methods. The analysis considers conductive and convective losses and energy transferred to a fluid flowing through the collector condenser tubes. The thermal performances of co-axial heat pipe solar collector is developed and are used to determine the collector efficiency, which is defined as the ratio of heat taken from the water flowing in the condenser tube and the solar radiation striking the collector absorber. The theoretical water outlet temperature and efficiency are compared with experimental results and it shows good agreement between them. The main advantage of this collector is that inclination of collector does not have influence on performance of co-axial heat pipe solar collector therefore it can be positioned at any angle from horizontal to vertical. In high building where the roof area is not enough the co-axial heat pipe solar collectors can be installed on the roof as well as wall of the building. The other advantage is each heat pipe can be topologically disconnected from the manifold. (orig.)
Multiple Fano resonances in single-layer nonconcentric core-shell nanostructures
DEFF Research Database (Denmark)
Zhang, Jingjing; Zayats, Anatoly
2013-01-01
where the multiple dark modes appear due to the geometrical symmetry breaking induced by axial offset of the core. Both dielectric-core-metal-shell (DCMS) and metal-core-dielectric-shell (MCDS) configurations have been studied. Compared to the MCDS structure, the DCMS configuration provides higher...
Electrospun pH-sensitive core-shell polymer nanocomposites fabricated using a tri-axial process.
Yang, Chen; Yu, Deng-Guang; Pan, Deng; Liu, Xin-Kuan; Wang, Xia; Bligh, S W Annie; Williams, Gareth R
2016-04-15
A modified tri-axial electrospinning process was developed for the generation of a new type of pH-sensitive polymer/lipid nanocomposite. The systems produced are able to promote both dissolution and permeation of a model poorly water-soluble drug. First, we show that it is possible to run a tri-axial process with only one of the three fluids being electrospinnable. Using an electrospinnable middle fluid of Eudragit S100 (ES100) with pure ethanol as the outer solvent and an unspinnable lecithin-diclofenac sodium (PL-DS) core solution, nanofibers with linear morphology and clear core/shell structures can be fabricated continuously and smoothly. X-ray diffraction proved that these nanofibers are structural nanocomposites with the drug present in an amorphous state. In vitro dissolution tests demonstrated that the formulations could preclude release in acidic conditions, and that the drug was released from the fibers in two successive steps at neutral pH. The first step is the dissolution of the shell ES100 and the conversion of the core PL-DS into sub-micron sized particles. This frees some DS into solution, and later the remaining DS is gradually released from the PL-DS particles through diffusion. Ex vivo permeation results showed that the composite nanofibers give a more than twofold uplift in the amount of DS passing through the colonic membrane as compared to pure DS; 74% of the transmitted drug was in the form of PL-DS particles. The new tri-axial electrospinning process developed in this work provides a platform to fabricate structural nanomaterials, and the core-shell polymer-PL nanocomposites we have produced have significant potential applications for oral colon-targeted drug delivery. A modified tri-axial electrospinning is demonstrated to create a new type of core-shell pH-sensitive polymer/lipid nanocomposites, in which an electrospinnable middle fluid is exploited to support the un-spinnable outer and inner fluids. The structural nanocomposites are able
Dual resonant structure for energy harvesting from random vibration sources at low frequency
Directory of Open Access Journals (Sweden)
Shanshan Li
2016-01-01
Full Text Available We introduce a design with dual resonant structure which can harvest energy from random vibration sources at low frequency range. The dual resonant structure consists of two spring-mass subsystems with different frequency responses, which exhibit strong coupling and broad bandwidth when the two masses collide with each other. Experiments with piezoelectric elements show that the energy harvesting device with dual resonant structure can generate higher power output than the sum of the two separate devices from random vibration sources.
International Nuclear Information System (INIS)
Košťál, Michal; Švadlenková, Marie; Baroň, Petr; Rypar, Vojtěch; Milčák, Ján
2016-01-01
Highlights: • Fission density in partly flooded compact core. • Calculation of fission density axial profile. • Significant calculational under prediction of experimental axial profile. - Abstract: Measurement and calculation of the axial power profile near the boundary of a moderated and non-moderated core is used to analyze the suitability of the neutron-physical process description, mainly the angular cross-section of a water-moderated uranium system. This is also an important issue because it affects the radiation situation above the partly flooded core of a water-moderated reactor. Axial power profiles of various fuel pins irradiated on reactor LR-0 were measured and the results were compared with MCNP6 code calculations using the ENDF/B-VII.0 nuclear data library. The calculated power profile in positions above the moderator level significantly underestimates experimental results. This might be caused by an improper description of the angular distribution of scattered neutrons in a water-moderated uranium system.
Calculation of core axial power shapes using alternating conditional expectation algorithm
International Nuclear Information System (INIS)
Lee, Eun Ki; Kim, Yong Hee; Cha, Kune Ho; Park, Moon Kyu
1998-01-01
We have introduced the alternating conditional expectation (ACE) algorithm in the method of reconstructing 20 node axial power shapes from five level detector powers. The ACE algorithm was used to find the optimal relationships between each plane power and normalized five detector powers. The obtained all optimal transformations had simple forms to be represented with polynomials. The reference axial power shapes and simulated detector powers were drawn out of the 3-dimensional results of Reactor Operation and Control Simulation (ROCS) code for various core states. By the ACE algorithm, we obtained the optimal relationship between dependent variable plane power, y, and independent variable detector powers, {Di, i=1,...,5 without any preprocessing, where a total of ≅3490 data sets per each cycle of YongGwang Nuclear (YGN) Power Plant units 3 and 4 are used. To test the validity and accuracy of the new method, about 21,200 cases of reconstructed axial power shapes are compared to original ROCS axial power shapes, and they are also contrasted with those obtained by Fourier fitting method (FFM). The average error of root mean square (rms), axial peak (DFZ), and axial shape index (DASI) of our new method for total 21204 data cases are 0.81%, 0.51% and 0.00204, while FFM 2.29%, 2.37% and 0.00264, respectively. The evaluation results for the data sets not used in the ACE transformations also show that the accuracy of new method is much better than that of FFM
Design and analysis of a novel dual-mass MEMS resonant output gyroscope
Directory of Open Access Journals (Sweden)
Yang Gao
2018-02-01
Full Text Available This paper presents the design and analysis of a novel dual-mass microelectromechanical systems (MEMS resonant output gyroscope (ROG, which can effectively eliminate the influence of common-mode disturbance, such as the linear acceleration, on the gyroscope working mode by the design of dual-mass form, as well as on the frequency outputs of the double-ended tuning fork (DETF resonators by the differential arrangement. The concept of the ROG is introduced first. Then the dynamics of the gyroscope and the force-frequency characteristics of the DETF resonator are theoretically analyzed. By establishing the distribution coefficient of force and the reasonable equivalent of the force-frequency characteristics of the DETF resonator, the accurate expression of the device sensitivity is obtained. Based on the analysis results, the leverage mechanism and the DETF resonator are designed in detail. Then the configuration of the gyroscope, a dual-mass structure, is given. Finally, the validity of the analysis and design are verified by numerical simulations.
DEFF Research Database (Denmark)
Weber, Ulrich; Pedersen, Susanne J; Zubler, Veronika
2014-01-01
To explore whether morphological features of fat infiltration (FI) on sacroiliac joint (SIJ) magnetic resonance imaging (MRI) contribute to diagnostic utility in 2 inception cohorts of patients with nonradiographic axial spondyloarthritis (nr-axSpA).......To explore whether morphological features of fat infiltration (FI) on sacroiliac joint (SIJ) magnetic resonance imaging (MRI) contribute to diagnostic utility in 2 inception cohorts of patients with nonradiographic axial spondyloarthritis (nr-axSpA)....
International Nuclear Information System (INIS)
Graham, K.F.; Gopal, R.
1978-01-01
A method and apparatus for establishing the axial flux distribution of a reactor core from monitored responses obtained exterior of the reactor is described. The monitored responses are obtained from at least three axially spaced flux responsive detectors that are positioned within proximity of the periphery of the reactor core. The detectors provide corresponding electrical outputs representative of the flux monitored. The axial height of the core is figuratively divided at a plurality of space coordinates sufficient to provide reconstruction in point representation of the relative flux shape along the core axis. The relative value of flux at each of the spaced coordinates is then established from a sum of the electrical outputs of the detectors, respectively, algebraically modified by a corresponding preestablished constant
Energy Technology Data Exchange (ETDEWEB)
Alatawneh, Natheer, E-mail: natheer80@yahoo.com [Department of Mining and Materials Engineering, McGill University, QC H3A 0G4 (Canada); Rahman, Tanvir; Lowther, David A. [Department of Electrical and Computer Engineering, McGill University, QC H3A 0E9 (Canada); Chromik, Richard [Department of Mining and Materials Engineering, McGill University, QC H3A 0G4 (Canada)
2017-06-15
Highlights: • Develop a toroidal tester for magnetic measurements under compressive axial stress. • The shape of the toroidal ring has been verified using 3D stress analysis. • The developed design has been prototyped, and measurements were carried out. • Physical explanations for the core loss trend due to stress are provided. - Abstract: Electric machine cores are subjected to mechanical stresses due to manufacturing processes. These stresses include radial, circumferential and axial components that may have significant influences on the magnetic properties of the electrical steel and hence, on the output and efficiencies of electrical machines. Previously, most studies of iron losses due to mechanical stress have considered only radial and circumferential components. In this work, an improved toroidal tester has been designed and developed to measure the core losses and the magnetic properties of electrical steel under a compressive axial stress. The shape of the toroidal ring has been verified using 3D stress analysis. Also, 3D electromagnetic simulations show a uniform flux density distribution in the specimen with a variation of 0.03 T and a maximum average induction level of 1.5 T. The developed design has been prototyped, and measurements were carried out using a steel sample of grade 35WW300. Measurements show that applying small mechanical stresses normal to the sample thickness rises the delivered core losses, then the losses decrease continuously as the stress increases. However, the drop in core losses at high stresses does not go lower than the free-stress condition. Physical explanations for the observed trend of core losses as a function of stress are provided based on core loss separation to the hysteresis and eddy current loss components. The experimental results show that the effect of axial compressive stress on magnetic properties of electrical steel at high level of inductions becomes less pronounced.
International Nuclear Information System (INIS)
Koo, Bon-Seung; Lee, Chung-Chan; Zee, Sung-Quun
2006-01-01
Online digital core protection system(SCOPS) for a system-integrated modular reactor is being developed as a part of a plant protection system at KAERI. SCOPS calculates the minimum CHFR and maximum LPD based on several online measured system parameters including 3-level ex-core detector signals. In conventional ABB-CE digital power plants, cubic spline synthesis technique has been used in online calculations of the core axial power distributions using ex-core detector signals once every 1 second in CPC. In CPC, pre-determined cubic spline function sets are used depending on the characteristics of the ex-core detector responses. But this method shows an unnegligible power distribution error for the extremely skewed axial shapes by using restrictive function sets. Therefore, this paper describes the cubic spline method for the synthesis of an axial power distribution and it generates several new cubic spline function sets for the application of the core protection system, especially for the severely distorted power shapes needed reactor type
Dual Symmetry in Bent-Core Liquid Crystals and Unconventional Superconductors
Directory of Open Access Journals (Sweden)
Vladimir Lorman
2010-01-01
Full Text Available We extend the Landau theory of bent-core mesophases and d-wave high-Tc superconductors by considering additional secondary pseudo-proper order parameters. These systems exhibit a remarkable analogy relating their symmetry groups, lists of phases, and an infinite set of physical tensors. This analogy lies upon an internal dual structure shared by the two theories. We study the dual operator transforming rotations into translations in liquid crystals, and gauge symmetries into rotations in superconductors. It is used to classify the bent-core line defects, and to analyze the electronic gap structure of lamellar d-wave superfluids.
Effect of curing mode on the hardness of dual-cured composite resin core build-up materials
Directory of Open Access Journals (Sweden)
César Augusto Galvão Arrais
2010-06-01
Full Text Available This study evaluated the Knoop Hardness (KHN values of two dual-cured composite resin core build-up materials and one resin cement exposed to different curing conditions. Two dual-cured core build-up composite resins (LuxaCore®-Dual, DMG; and FluoroCore®2, Dentsply Caulk, and one dual-cured resin cement (Rely X ARC, 3M ESPE were used in the present study. The composite materials were placed into a cylindrical matrix (2 mm in height and 3 mm in diameter, and the specimens thus produced were either light-activated for 40 s (Optilux 501, Demetron Kerr or were allowed to self-cure for 10 min in the dark (n = 5. All specimens were then stored in humidity at 37°C for 24 h in the dark and were subjected to KHN analysis. The results were submitted to 2-way ANOVA and Tukey's post-hoc test at a pre-set alpha of 5%. All the light-activated groups exhibited higher KHN values than the self-cured ones (p = 0.00001, regardless of product. Among the self-cured groups, both composite resin core build-up materials showed higher KHN values than the dual-cured resin cement (p = 0.00001. LuxaCore®-Dual exhibited higher KHN values than FluoroCore®2 (p = 0.00001 when they were allowed to self-cure, while no significant differences in KHN values were observed among the light-activated products. The results suggest that dual-cured composite resin core build-up materials may be more reliable than dual-cured resin cements when curing light is not available.
On the quark structure of resonance states in dual models
International Nuclear Information System (INIS)
Volkov, D.V.; Zheltukhin, A.A.; Pashnev, A.I.
1975-01-01
It is shown using as an example the Veneziano dual model, that each particular dual model already contains a certain latent quark structure unambiauously determined by internal properties of the dual model. To prove this degeneration of the resonance state spectrum is studied by introducing an additional disturbing interaction into the model being considered. Induced transitions of particles into a vacuum act as such an additional disturbance. This method complements the known factorization method of Fubini, Gordon and Veneziano and turns out to be free from an essential limitation of the latter connected with implicit assumption about the basence of internal additive laws of conservation in the model. By using the method of induced transitions of particles into a vacuum it has been possible to show that the resonance state spectrum is indeed more degenerated than it should be expected from the factorization theorem, and that the supplementary degeneration corresponds to the quark model with an infinite number of quarks of the increasing mass. Structures of some terms of the dual amplitude expansion over the degrees of the constant of the induced transition of particles to vacuum are considered; it is shown that the summation of this expansion may be reduced to a solution of a certain integral equation. On the basis of the integral equation obtained an integral representation ofr dual amplitudes is established. The problems related with degeneration of resonance states and with determination of additive quantum numbers leading to the quark interpretation of the degeneration being considered are discussed
International Nuclear Information System (INIS)
Cui, Chunxiang; Chen, Fenghua; Yang, Wei; Li, Hongfang; Liu, Qiaozhi; Sun, Jibing
2015-01-01
By utilizing alternate electrochemical reaction, atomic migration and deposition of Fe, Co, Sm and other chemical substances in the electrochemical solution, a large number of Sm 2 Co 17 /Fe 7 Co 3 dual phase nanowire arrays were carried out in the anodic aluminum oxide (AAO) template with highly uniform and orderly. The Sm 2 Co 17 /Fe 7 Co 3 dual phase nanowire arrays with diameter of 50 nm and length of 12 μm have the smooth surface and uniform diameter. The morphology and microstructure of annealed Sm 2 Co 17 /Fe 7 Co 3 dual phase nanowires were observed and analyzed using SEM, TEM and HRTEM. Compared with single-phase nanowires, dual phase magnetic nanowires have higher coercivity and saturation magnetization. In this composite system, both the hard and the soft phases have a high Curie temperature, therefore, we believe that the Sm 2 Co 17 /Fe 7 Co 3 dual phase nanowire arrays is a new type of high-temperature magnetic composites. - Highlights: • Sm 2 Co 17 /Fe 7 Co 3 dual phase nanowires were prepared by electrochemical method. • The interface pinning is the main factor to improve anisotropy field of the nanowires. • The dual phase magnetic nanowires have higher coercivity and saturation magnetization
Role of screening and angular distributions in resonant soft-x-ray emission of CO
Energy Technology Data Exchange (ETDEWEB)
Skytt, P.; Glans, P.; Gunnelin, K. [Uppsala Univ. (Sweden)] [and others
1997-04-01
In the present work the authors focus on two particular properties of resonant X-ray emission, namely core hole screening of the excited electron, and anisotropy caused by the polarization of the exciting synchrotron radiation. The screening of the core hole by the excited electron causes energy shifts and intensity variations in resonant spectra compared to the non-resonant case. The linear polarization of the synchrotron radiation and the dipole nature of the absorption process create a preferential alignment selection of the randomly oriented molecules in the case of resonant excitation, producing an anisotropy in the angular distribution of the emitted X-rays. The authors have chosen CO for this study because this molecule has previously served as a showcase for non-resonant X-ray emission, mapping the valence electronic structure differently according to the local selection rules. With the present work they take interest in how this characteristic feature of the spectroscopy is represented in the resonant case.
Dual resonance models and their currents
International Nuclear Information System (INIS)
Johnson, E.A.
1978-01-01
It is shown how dual resonance models were rederived from the concept of a string tracing out a surface in space-time. Thus, interacting strings reproduce the dual amplitudes. A scheme for tackling the unitarity problem began to develop. As a consistent theory of hadronic processes began to be built, workers at the same time were naturally led to expect that leptons could be included with hadrons in a unified dual theory. Thus, there is a search for dual amplitudes which would describe interactions between hadrons and currents (for example, electrons), as well as interactions involving only hadrons. Such amplitudes, it is believed, will be the correct ones, describing the real world. Such amplitudes will provide valuable information concerning such things as hadronic form factors. The great difficulties in building current-amplitudes with the required properties of proper factorization on a good spectrum, duality, current algebra, and proper asymptotic behavior are described. Dual models at the present time require for consistency, an intercept value of α 0 = 1 and a dimension value of d = 26 (or d = 10). There have been speculations that the unphysical dimension may be made physical by associating the ''extra dimensions'' with certain internal degrees of freedom. However, it is desired that the theory itself, force the dimension d = 4. It is quite possible that the dimension problem and the intercept problem are tied together and that resolving either problem will resolve the other. Order by order, a new dual current is constructed that is manifestly factorizable and which appears to be valid for arbitrary space-time dimension. The fact that this current is not bound at d = 26, leads to interesting speculations on the nature of dual currents
DEFF Research Database (Denmark)
Witting, Nanna; Andersen, Linda K; Vissing, John
2016-01-01
Classically, myopathies are categorized according to limb or cranial nerve muscle affection, but with the growing use of magnetic resonance imaging it has become evident that many well-known myopathies have significant involvement of the axial musculature. New disease entities with selective axial...
Deng, Wei; Wang, Ya
2017-09-01
This paper reports a dual resonant rectilinear-to-rotary oscillation converter (RROC) for low frequency broadband electromagnetic energy harvesting from ambient vibrations. An approximate theoretical model has been established to integrate the electromechanical coupling into a comprehensive electromagnetic-dynamic model of the dual resonant RROC. Numerical simulation has proved the nature of dual resonances by revealing that both the rectilinear resonance and the rotary resonance could be achieved when the stand-alone rectilinear oscillator (RLO) and the stand-alone rotary oscillator (RTO) were excited independently. Simulation on the magnetically coupled RROC has also shown that the rectilinear resonance and the rotary resonance could be obtained simultaneously in the low-frequency region (2-14 Hz) with well-defined restoring torque (M r ) and the initial rotation angle of the RLO (ψ). The magnetic interaction patterns between the rectilinear and the RTOs have been categorized based on aforementioned simulation results. Both simulation and experimental results have demonstrated broadband output attributing from the dual resonances. Experimental results have also indicated that the RROC could have wide bandwidth in a much lower frequency region (2-8 Hz) even without the rotary resonance as long as the system parameters are carefully tuned. Parameter analysis on different values of M r and ψ are experimentally carried out to provide a quantitative guidance of designing the RROC to achieve an optimal power density.
International Nuclear Information System (INIS)
Watanabe, Masaki; Kiryu, Tohru
2011-01-01
The measurement of axial length and the evaluation of three dimensional (3D) form of an eye are essential to evaluate the mechanism of myopia progression. We propose a method of automatic measurement of axial length including adjustment of the pulse sequence of short-term scan which could suppress influence of eyeblink, using a magnetic resonance imaging (MRI) which acquires 3D images noninvasively. Acquiring T 2 -weighted images with 3.0 tesla MRI device and eight-channel phased-array head coil, we extracted left and right eye ball images, and then reconstructed 3D volume. The surface coordinates were calculated from 3D volume, fitting the ellipsoid model coordinates with the surface coordinates, and measured the axial length automatically. Measuring twenty one subjects, we compared the automatically measured values of axial length with the manually measured ones, then confirmed significant elongation in the axial length of myopia compared with that of emmetropia. Furthermore, there were no significant differences (P<0.05) between the means of automatic measurements and the manual ones. Accordingly, the automatic measurement process of axial length could be a tool for the elucidation of the mechanism of myopia progression, which would be suitable for evaluating the axial length easily and noninvasively. (author)
Ionic core effects on the Mie resonance in lithium clusters
International Nuclear Information System (INIS)
Yabana, K.
1994-01-01
We investigate effects of atomic cores on the Mie resonance in lithium metal clusters, perturbing a helium Hamiltonian with zero-range pseudopotentials. The resonance is red-shifted with respect to the classical formula by core effects, most important of which is the increased effective mass due to the core potentials. Much of the large shift seen in lithium clusters is thereby explained if the strength of the Pseudopotentials is taken from band structure calculations. However, such pseudopotentials cause the resonance to be greatly broadened, contrary to observation
Alatawneh, Natheer; Rahman, Tanvir; Lowther, David A.; Chromik, Richard
2017-06-01
Electric machine cores are subjected to mechanical stresses due to manufacturing processes. These stresses include radial, circumferential and axial components that may have significant influences on the magnetic properties of the electrical steel and hence, on the output and efficiencies of electrical machines. Previously, most studies of iron losses due to mechanical stress have considered only radial and circumferential components. In this work, an improved toroidal tester has been designed and developed to measure the core losses and the magnetic properties of electrical steel under a compressive axial stress. The shape of the toroidal ring has been verified using 3D stress analysis. Also, 3D electromagnetic simulations show a uniform flux density distribution in the specimen with a variation of 0.03 T and a maximum average induction level of 1.5 T. The developed design has been prototyped, and measurements were carried out using a steel sample of grade 35WW300. Measurements show that applying small mechanical stresses normal to the sample thickness rises the delivered core losses, then the losses decrease continuously as the stress increases. However, the drop in core losses at high stresses does not go lower than the free-stress condition. Physical explanations for the observed trend of core losses as a function of stress are provided based on core loss separation to the hysteresis and eddy current loss components. The experimental results show that the effect of axial compressive stress on magnetic properties of electrical steel at high level of inductions becomes less pronounced.
Performance analysis of a new radial-axial flux machine with SMC cores and ferrite magnets
Liu, Chengcheng; Wang, Youhua; Lei, Gang; Guo, Youguang; Zhu, Jianguo
2017-05-01
Soft magnetic composite (SMC) is a popular material in designing of new 3D flux electrical machines nowadays for it has the merits of isotropic magnetic characteristic, low eddy current loss and high design flexibility over the electric steel. The axial flux machine (AFM) with the extended stator tooth tip both in the radial and circumferential direction is a good example, which has been investigated in the last years. Based on the 3D flux AFM and radial flux machine, this paper proposes a new radial-axial flux machine (RAFM) with SMC cores and ferrite magnets, which has very high torque density though the low cost low magnetic energy ferrite magnet is utilized. Moreover, the cost of RAFM is quite low since the manufacturing cost can be reduced by using the SMC cores and the material cost will be decreased due to the adoption of the ferrite magnets. The 3D finite element method (FEM) is used to calculate the magnetic flux density distribution and electromagnetic parameters. For the core loss calculation, the rotational core loss computation method is used based on the experiment results from previous 3D magnetic tester.
Dual band metamaterial perfect absorber based on Mie resonances
Energy Technology Data Exchange (ETDEWEB)
Liu, Xiaoming; Lan, Chuwen; Li, Bo; Zhou, Ji, E-mail: zhouji@tsinghua.edu.cn [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Bi, Ke [School of Science, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Zhao, Qian [State Key Lab of Tribology, Department of Precision Instruments and Mechanology, Tsinghua University, Beijing 100084 (China)
2016-08-08
We numerically and experimentally demonstrated a polarization insensitive dual-band metamaterial perfect absorber working in wide incident angles based on the two magnetic Mie resonances of a single dielectric “atom” with simple structure. Two absorption bands with simulated absorptivity of 99% and 96%, experimental absorptivity of 97% and 94% at 8.45 and 11.97 GHz were achieved due to the simultaneous magnetic and electric resonances in dielectric “atom” and copper plate. Mie resonances of dielectric “atom” provide a simple way to design metamaterial perfect absorbers with high symmetry.
Axial power distribution calculation using a neural network in the nuclear reactor core
Energy Technology Data Exchange (ETDEWEB)
Kim, Y H; Cha, K H; Lee, S H [Korea Electric Power Research Institute, Taejon (Korea, Republic of)
1998-12-31
This paper is concerned with an algorithm based on neural networks to calculate the axial power distribution using excore detector signals in the nuclear reactor core. The fundamental basis of the algorithm is that the detector response can be fairly accurately estimated using computational codes. In other words, the training set, which represents relationship between detector signals and axial power distributions, for the neural network can be obtained through calculations instead of measurements. Application of the new method to the Yonggwang nuclear power plant unit 3 (YGN-3) shows that it is superior to the current algorithm in place. 7 refs., 4 figs. (Author)
Axial power distribution calculation using a neural network in the nuclear reactor core
Energy Technology Data Exchange (ETDEWEB)
Kim, Y. H.; Cha, K. H.; Lee, S. H. [Korea Electric Power Research Institute, Taejon (Korea, Republic of)
1997-12-31
This paper is concerned with an algorithm based on neural networks to calculate the axial power distribution using excore detector signals in the nuclear reactor core. The fundamental basis of the algorithm is that the detector response can be fairly accurately estimated using computational codes. In other words, the training set, which represents relationship between detector signals and axial power distributions, for the neural network can be obtained through calculations instead of measurements. Application of the new method to the Yonggwang nuclear power plant unit 3 (YGN-3) shows that it is superior to the current algorithm in place. 7 refs., 4 figs. (Author)
Directory of Open Access Journals (Sweden)
Billy W. Day
2010-11-01
Full Text Available Biosensors have been used extensively in the scientific community for several purposes, most notably to determine association and dissociation kinetics, protein-ligand, protein-protein, or nucleic acid hybridization interactions. A number of different types of biosensors are available in the field, each with real or perceived benefits over the others. This review discusses the basic theory and operational arrangements of four commercially available types of optical biosensors: surface plasmon resonance, resonant mirror, resonance waveguide grating, and dual polarization interferometry. The different applications these techniques offer are discussed from experiments and results reported in recently published literature. Additionally, recent advancements or modifications to the current techniques are also discussed.
Zhang, Kunhao; Zhao, Ziyan; Wu, Zhonghua; Zhou, Ying
2015-01-01
In this paper, the Co@SiO2 core-shell nanoparticles were prepared by the sol-gel method. The oxidization of Co core nanoparticles was studied by the synchrotron radiation-based techniques including in situ X-ray diffraction (XRD) and X-ray absorption fine structure (XAFS) up to 800°C in air and N2 protection conditions, respectively. It was found that the oxidization of Co cores is undergoing three steps regardless of being in air or in N2 protection condition. In the first step ranging from room temperature to 200°C, the Co cores were dominated by Co(0) state as well as small amount of Co(2+) ions. When temperature was above 300°C, the interface between Co cores and SiO2 shells was gradually oxidized into Co(2+), and the CoO layer was observed. As the temperature increasing to 800°C, the Co cores were oxidized to Co3O4 or Co3O4/CoO. Nevertheless, the oxidization kinetics of Co cores is different for the Co@SiO2 in air and N2 gas conditions. Generally, the O2 in the air could get through the SiO2 shells easily onto the Co core surface and induce the oxidization of the Co cores due to the mesoporous nature of the SiO2 shells. However, in N2 gas condition, the O atoms can only be from the SiO2 shells, so the diffusion effect of O atoms in the interface between Co core and SiO2 shell plays a key role.
Ellipsoidal all-dielectric Fano resonant core-shell metamaterials
Reena, Reena; Kalra, Yogita; Kumar, Ajeet
2018-06-01
In this paper, ellipsoidal core (Si) and shell (SiO2) metamaterial has been proposed for highly directional properties. At the wavelength of magnetic resonance, Fano dip occurs in the backward scattering cross section and forward scattering enhancement takes place at the same wavelength so that there is an increment in the directivity. Effect on the directivity by changing the length of ellipsoidal nanoparticle along semi-axes has been analyzed. Two Fano resonances have been observed by decreasing the length of the nanoparticle along the semi-axis having electric polarization, where first and second Fano resonances are attributed to the dipole and quadrupole moments, respectively. These Fano resonant wavelengths in ellipsoidal nanoparticle exhibit higher directivity than the Kerker's type scattering or forward scattering shown by symmetrical structures like sphere. So, this core-shell metamaterial can act as an efficient directional nanoantenna.
Interacting-string picture of dual-resonance models
International Nuclear Information System (INIS)
Mandelstam, S.
1985-01-01
Dual-resonance models are an alyzed by means of operators which act within the physical Hilbert space of positive-metric states. The basis of the method is to extend the relativistic-string picture of a previous study to interacting particles. Functional methods are used, but their relation to the operator is evident, and factorization is maintained. An expression is given for the N-point amplitude in terms of physical-particle operators. For the three-point function the Neumann functions which occur in this expression are evaluated, so that we have a formula for the on- and off-energy-shell vertex. The authors assume that the string has no longitudinal degrees of freedom, and their results are Lorentz invariant and dual only if d=26
Gong, Jianxiao; Zhou, Fei; Li, Zhiyuan; Tang, Zhiyong
2012-06-19
We have synthesized Au@Ag core-shell nanocubes containing Au cores with varying shapes and sizes through modified seed-mediated methods. Bromide ions are found to be crucial in the epitaxial growth of Ag atoms onto Au cores and in the formation of the shell's cubic shape. The Au@Ag core-shell nanocubes exhibit very abundant and distinct localized surface plasmon resonance (LSPR) properties, which are core-shape and size-dependent. With the help of theoretical calculation, the physical origin and the resonance mode profile of each LSPR peak are identified and studied. The core-shell nanocrystals with varying shaped cores offer a new rich category for LSPR control through the plasmonic coupling effect between core and shell materials.
Song, Hyon-Min; Wei, Qingshan; Ong, Quy K; Wei, Alexander
2010-09-28
Plasmon-resonant gold nanostars (NSTs) with magnetic cores were synthesized by a multistep sequence from superparamagnetic Fe3O4 nanoparticles (NPs) and evaluated as optical contrast agents under magnetomotive (MM) imaging conditions. Core-shell Fe3O4@Au NPs were prepared in nonpolar organic solvents with nanometer control over shell thickness and with good epitaxy to the Fe3O4 surface. Anisotropic growth was performed in micellar solutions of cetyltrimethylammonium bromide (CTAB) under mildly reducing conditions, resulting in NSTs with physical features similar to those produced from colloidal gold seeds. NSTs could be produced below 100 nm from tip to tip, but seed size had a significant impact on growth habit, with larger seed particles producing submicrometer-sized "morning stars". Both NSTs and aggregated core-shell NPs are responsive to in-plane magnetic field gradients and can provide enhanced near-infrared (NIR) contrast under MM conditions, but do so by different mechanisms. NSTs can modulate polarized NIR scattering with minimal translational motion, giving the appearance of a periodic but stationary "blinking", whereas core-shell NP aggregates require lateral displacement for signal modulation. The polarization-sensitive MM imaging modality offers the dual advantage of enhanced signal quality and reduced background signal and can be applied toward the detection of magnetomotive NSTs in heterogeneous biological samples, as illustrated by their detection inside of granular cells such as macrophages.
Sound attenuations of axial fan blade tones using flow-driven tunable resonator arrays
Gorny, Lee James
Flow-excited, tunable quarter-wavelength resonators can be integrated into the shrouds of ducted subsonic axial fans. This study explores their effectiveness in reducing propagations of tonal noise by means of acoustic wave cancellation. Resonators are a non-intrusive method of generating a secondary sound field near the plane of a rotor. As they can be strategically tuned to reduce radiated noise at the blade passage frequency (BPF) and its harmonics, resonators can be useful for a variety of applications to quiet existing and future turbomachinery. Experiments have demonstrated that a single quarter wave resonator is effective in reducing unidirectional plane wave propagations for long wavelength ducted applications while an array is effective for shorter wavelength or un-ducted facilities where shrouded fans are used. Testing conducted at Center for Acoustics and Vibrations (CAV) at the Pennsylvania State University the Deutsches Zentrum fur Luft und Raumfahrt (DLR) in Berlin, Germany demonstrated that resonator arrays were effective in attenuating shorter wavelength plane-wave and higher order modal propagations of blade tone noise. A chiller fan enclosure, constructed in the CAV laboratory emulated an industrial chiller in its operation. Using this facility, resonators were observed to attenuate blade tone noise from a non-ideal ducted geometry. The approaches used in this study evolved from Helmholtz resonators to conventional quarter wave tubes, to mouth tunable resonators, and finally to back-wall tunable resonators. These developments in tuning allowed for independent control of a resonator's magnitude and phase of the secondary sound field produced by the resonators. It was demonstrated that the use of two tunable resonator chambers oriented axially on either side of the blade region enables a dipole-like secondary sound field to be passively generated and bi-directional attenuations of plane wave noise to be achieved. Tonal attenuations of 28 dB were
Nakagawa, S.; Kneafsey, T. J.; Chang, C.; Harper, E.
2014-12-01
During geological sequestration of CO2, fractures are expected to play a critical role in controlling the migration of the injected fluid in reservoir rock. To detect the invasion of supercritical (sc-) CO2 and to determine its saturation, velocity and attenuation of seismic waves can be monitored. When both fractures and matrix porosity connected to the fractures are present, wave-induced dynamic poroelastic interactions between these two different types of rock porosity—high-permeability, high-compliance fractures and low-permeability, low-compliance matrix porosity—result in complex velocity and attenuation changes of compressional waves as scCO2 invades the rock. We conducted core-scale laboratory scCO2 injection experiments on small (diameter 1.5 inches, length 3.5-4 inches), medium-porosity/permeability (porosity 15%, matrix permeability 35 md) sandstone cores. During the injection, the compressional and shear (torsion) wave velocities and attenuations of the entire core were determined using our Split Hopkinson Resonant Bar (short-core resonant bar) technique in the frequency range of 1-2 kHz, and the distribution and saturation of the scCO2 determined via X-ray CT imaging using a medical CT scanner. A series of tests were conducted on (1) intact rock cores, (2) a core containing a mated, core-parallel fracture, (3) a core containing a sheared core-parallel fracture, and (4) a core containing a sheared, core-normal fracture. For intact cores and a core containing a mated sheared fracture, injections of scCO2 into an initially water-saturated sample resulted in large and continuous decreases in the compressional velocity as well as temporary increases in the attenuation. For a sheared core-parallel fracture, large attenuation was also observed, but almost no changes in the velocity occurred. In contrast, a sample containing a core-normal fracture exhibited complex behavior of compressional wave attenuation: the attenuation peaked as the leading edge of
A Dual-Core System Solution for Wearable Health Monitors
Santana Arnaiz, O.A.; Bouwens, F.; Huisken, J.A.; De Groot, H.; Bennebroek, M.T.; Van Meerbergen, J.L.; Abbo, A.A.; Fraboulet, A.
2011-01-01
This paper presents a system design study for wearable sensor devices intended for healthcare and lifestyle applications based on ECG,EEG and activity monitoring. In order to meet the low-power requirement of these applications, a dual-core signal processing system is proposed which combines an
Dey, Soumyajit; Rath, Sankar Prasad
2014-02-07
The syn-anti conformational switching has been demonstrated in the ethane-bridged dicobalt(II)bisporphyrin which is present in the syn-form only. The addition of either perylene or axial ligands to Co(II)(bisporphyrin) completely transforms the syn form into the anti because of strong π-π interaction and axial coordination, respectively. The complex undergoes four 1e-oxidations in CH2Cl2 which are indicative of strong through space interactions between the two cofacial Co-porphyrins at 295 K. The first oxidation is a metal centered one and occurs at a potential much lower than that of the monomeric analog. However, the second oxidation, which is again metal centered, was at a significantly higher potential. The large difference between the first two oxidations, as observed here, is due to much stronger inter-porphyrin interactions. The step-wise oxidations have been performed both chemically and electro-chemically while the progress of the reactions was monitored by UV-visible and (1)H NMR spectroscopy. After 1e-oxidation, a very broad (1)H NMR signal results with increased difference between two meso resonances, which indicates that the two macrocycles are in the syn-form with lesser interplanar separation as also observed by DFT. However, 2e-oxidation results in the stabilization of the anti form. The addition of axial ligands to Co(II)(bisporphyrin) also completely transforms the syn form into the anti form. While additions of THF and I2/I(-) both result in the formation of five-coordinate complexes, Co(II) is oxidized to Co(III) in the case of the latter. However, additions of 1-methylimidazole, pyridine and pyrazine as axial ligands result in the formation of a six-coordinate complex in which Co(II) is spontaneously oxidized to Co(III) in air.
Design of ultrathin dual-resonant reflective polarization converter with customized bandwidths
Kundu, Debidas; Mohan, Akhilesh; Chakrabarty, Ajay
2017-10-01
In this paper, an ultrathin dual-resonant reflective polarization converter is proposed to obtain customized bandwidths using precise space-filling technique to its top geometry. The unit cell of the dual-resonant prototype consists of conductive square ring with two diagonally arranged slits, supported by metal-backed thin dielectric layer. It offers two narrow bands with fractional bandwidths of 3.98 and 6.65% and polarization conversion ratio (PCR) of 97.16 and 98.87% at 4.52 and 6.97 GHz, respectively. The resonances are brought in proximity to each other by changing the length of surface current paths of the two resonances. By virtue of this mechanism, two polarization converters with two different types of bandwidths are obtained. One polarization converter produces a full-width at half-maxima PCR bandwidth of 34%, whereas another polarization converter produces a 90% PCR bandwidth of 19%. All the proposed polarization converters are insensitive to wide variations of incident angle for both TE- and TM-polarized incident waves. Measured results show good agreement with the numerically simulated results.
Directory of Open Access Journals (Sweden)
Youssef Emam Youssef
2010-04-01
Full Text Available The Bain's co-axial circuit system is fully established in general anaesthesia practice. It is favoured for its light weight and suitability for head and neck surgery. However, there are numerous published reports of malfunction of the inner tube of the Bain's co-axial circuit, with potentially lethal complications for the patient. This report presents a case in which a patient connected to a reused Bain's circuit (Datex-Ohmeda developed severe hypercapnia in the early intraoperative period due to unusual defect of the inner tube. This report tests and outlines the integrity of co-axial circuits and also reviews the available literature.
International Nuclear Information System (INIS)
Chan, S.H.; Cho, D.H.
1984-01-01
A reactor core filled with an emitting-absorbing mixture (like steam, hydrogen gas and fission gases) is considered. Analysis is provided to evaluate axial radiative heat exchange of a rod bundle with a nonuniform axial temperature distribution. The necessary radiation exchange shape factors (geometric mean absorptance, emittance and transmittance) between segments of the complex rod bundle arrangement are presented. They are applicable to arbitrary sizes of segments, well suited for numerical computations
Magnetic properties of Co-ferrite-doped hydroxyapatite nanoparticles having a core/shell structure
International Nuclear Information System (INIS)
Petchsang, N.; Pon-On, W.; Hodak, J.H.; Tang, I.M.
2009-01-01
The magnetic properties of Co-ferrite-doped hydroxyapatite (HAP) nanoparticles of composition Ca 10-3x Fe 2x Co x (PO 4 ) 6 (OH) 2 (where x=0, 0.1, 0.2, 0.3, 0.4 and 0.5% mole) are studied. Transmission electron microscope micrograms show that the 90 nm size nanoparticles annealed at 1250 o C have a core/shell structure. Their electron diffraction patterns show that the shell is composed of the hydroxyapatite and the core is composed of the Co-ferrite, CoFe 2 O 4 . Electron spin resonance measurements indicate that the Co 2+ ions are being substituted into the Ca(1) sites in HAP lattice. X-ray diffraction studies show the formation of impurity phases as higher amounts of the Fe 3+ /Co 2+ ions which are substituted into the HAP host matrix. The presence of two sextets (one for the A-site Fe 3+ and the other for the B-site Fe 3+ ) in the Moessbauer spectrum for all the doped samples clearly indicates that the CoFe 2 O 4 .cores are in the ferromagnetic state. Evidence of the impurity phases is seen in the appearance of doublet patterns in the Moessbauer spectrums for the heavier-doped (x=0.4 and 0.5) specimens. The decrease in the saturation magnetizations and other magnetic properties of the nanoparticles at the higher doping levels is consistent with some of the Fe 3+ and Co 2+ which being used to form the CoO and Fe 2 O 3 impurity phase seen in the XRD patterns.
International Nuclear Information System (INIS)
Ahn, Tae-Joon; Lee, Sang-Ho; Choi, Gun; Ahn, Yong; Liu, Wei-Chiang; Kim, Ho-Jin; Lee, Ho-Yeon
2009-01-01
Magnetic resonance (MR) imaging with axial loading can simulate the physiological standing state and disclose spinal stenosis undetected or underestimated in the conventional position. Intervertebral disk degeneration may be an important factor in spinal stenosis. This study investigated whether intervertebral disk degeneration increases spinal stenosis during axial loading. MR imaging with and without axial loading was obtained in 51 patients with neurogenic intermittent claudication and/or sciatica and reviewed retrospectively. The grade of disk degeneration was rated in four disk spaces from L2-3 to L5-S1. The dural sac cross-sectional area (DCSA) was measured on MR images taken in both conventional and axial loading positions, and the change in the DCSA was calculated. The effect of disk degeneration on the DCSA was statistically analyzed. Significant decreases in the DCSA occurred with grade 4 disk degeneration (mean±standard deviation, 20.1±14.1 mm 2 ), followed by grade 3 (18.3±15.1 mm 2 ) and grade 2 (8.9±13.1 mm 2 ). DCSA decreased considerably with increased severity of disk degeneration with axial loading, except for grade 5 disk degeneration. More accurate diagnosis of stenosis can be achieved using MR imaging with axial loading, especially if grade 2 to 4 disk degeneration is present. (author)
Magnetic resonance imaging of the lumbar spine with axial loading: A review of 120 cases
International Nuclear Information System (INIS)
Kinder, Andre; Palma Filho, Fernando; Ribeiro, Elisio; Domingues, Romeu C.; Domingues, Roberto C.; Marchiori, Edson; Gasparetto, Emerson
2012-01-01
Purpose: To evaluate the imaging findings of patients with clinical symptoms of lower back pain who underwent magnetic resonance imaging (MRI) of the lumbar spine with axial loading. Materials and methods: We examined 120 patients by MRI, before and after axial loading, using a compression device that applied 50% of their body weight for a load time of 5 min. The dural sac cross area (DSCA) was examined by two experienced radiologists before and after axial load, and their findings were compared. Degenerative abnormalities within and adjacent to the spinal canal were also analyzed. Results: A reduction in DSCA greater than 15 mm 2 after axial load was defined as significant, and was found in 81 patients (67.5%) and 138 disc spaces (38.3%). Reduction was most frequent at L4-L5 (n = 55). For other disorders, a 9% increase in cases of bulging disc was seen during axial loading, and seven disc spaces showed protrusion/extrusion only after load. Facet joint synovial cysts, foraminal stenosis, and hypertrophy of the flavum ligaments showed almost no differences, pre- and post-load. Conclusion: For adequate evaluation of lumbar symptoms, examination should be performed with axial loading, especially in cases of suspected spinal stenosis.
Cho, Chahee Peter
1995-01-01
Until recently, brush dc motors have been the dominant drive system because they provide easily controlled motor speed over a wide range, rapid acceleration and deceleration, convenient control of position, and lower product cost. Despite these capabilities, the brush dc motor configuration does not satisfy the design requirements for the U.S. Navy's underwater propulsion applications. Technical advances in rare-earth permanent magnet materials, in high-power semiconductor transistor technology, and in various rotor position-sensing devices have made using brushless permanent magnet motors a viable alternative. This research investigates brushless permanent magnet motor technology, studying the merits of dual-air gap, axial -field, brushless, permanent magnet motor configuration in terms of power density, efficiency, and noise/vibration levels. Because the design objectives for underwater motor applications include high-power density, high-performance, and low-noise/vibration, the traditional, simplified equivalent circuit analysis methods to assist in meeting these goals were inadequate. This study presents the development and verification of detailed finite element analysis (FEA) models and lumped parameter circuit models that can calculate back electromotive force waveforms, inductance, cogging torque, energized torque, and eddy current power losses. It is the first thorough quantification of dual air-gap, axial -field, brushless, permanent magnet motor parameters and performance characteristics. The new methodology introduced in this research not only facilitates the design process of an axial field, brushless, permanent magnet motor but reinforces the idea that the high-power density, high-efficiency, and low-noise/vibration motor is attainable.
Soliton-based ultrafast multi-wavelength nonlinear switching in dual-core photonic crystal fibre
International Nuclear Information System (INIS)
Stajanca, P; Pysz, D; Michalka, M; Bugar, I; Andriukaitis, G; Balciunas, T; Fan, G; Baltuska, A
2014-01-01
Systematic experimental study of ultrafast multi-wavelength all-optical switching performance in a dual-core photonic crystal fibre is presented. The focus is on nonlinearly induced switching between the two output ports at non-excitation wavelengths, which are generated during nonlinear propagation of femtosecond pulses in the anomalous dispersion region of a dual-core photonic crystal fibre made of multicomponent glass. Spatial and spectral characteristics of the fibre output radiation were measured separately for both fibre cores under various polarization and intensity conditions upon selective, individual excitation of each fibre core. Polarization-controlled nonlinear switching performance at multiple non-excitation wavelengths was demonstrated in the long-wavelength optical communication bands and beyond. Depending on the input pulse polarization, narrowband switching operation at 1560 nm and 1730 nm takes place with double core extinction ratio contrasts of 9 dB and 14.5 dB, respectively. Moreover, our approach allows switching with simultaneous wavelength shift from 1650 to 1775 nm with extinction ratio contrast larger than 18 dB. In addition, non-reciprocal behaviour of the soliton fission process under different fibre core excitations was observed and its effect on the multi-wavelength nonlinear switching performance was explained, taking into account the slight dual-core structure asymmetry. The obtained results represent ultrafast all-optical switching with an extended dimension of wavelength shift, controllable with both the input radiation intensity and the polarization by simple propagation along a 14 mm long fibre. (paper)
Possibility study of gasifier with axial circulating flue gas for reducing Tar
Poowadin, T.; Polsongkram, M.; Khantikomol, P.
2018-01-01
This present research article aims to study the possibility of gasification by axial core flue gas circulating kiln and find the efficiency of syngas production. An axial core flue gas circulating tube was installed in the center of the updraft gasifier in purposing of tar reducing. In the present study, the eucalyptus wood chip 4, 8, and 10 kg with the moisture content 16% were examined. Several type-K thermocouples were employed to measure the temperatures at preheat, combustion, reduction, pyrolysis, drying, and gas outlet zone. The results showed that the temperatures in the combustion and the reduction zone of the kiln with the axial core flue gas recirculating were lower than the kiln without the core owing to installing the core would reduce the combustion zone area in biomass burning. Obviously, the temperature in the pyrolysis and drying zone were nearly the same as both with and without the core. In consideration of syngas components, it was found that CO production from the gasifier with the core was higher than the gasifier without the core about 25%. Other gases, however, were almost same. The syngas production efficiency obtained from the gasifier with the core decreased with increasing the mass of biomass. It showed that the highest efficiency was 30% at 4 kg supplying biomass. In comparison, the efficiencies of both the kilns with and without the core were not different. For liquid product, the amount of liquid decreased about 47.23% comparing with the gasifier without the core.
360° tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator
DEFF Research Database (Denmark)
Pu, Minhao; Xue, Weiqi; Liu, Liu
2010-01-01
We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained......We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained...
Tensile properties of a dual-axial forged Ti–Fe–Cu alloy containing boron
Energy Technology Data Exchange (ETDEWEB)
Zadorozhnyy, V.Yu., E-mail: zadorozhnyyvlad@gmail.com [National University of Science and Technology “MISIS”, Leninsky prospect, 4, Moscow 119049 (Russian Federation); Institute for Materials Research, Tohoku University, Katahira 2-1-1, Aoba-Ku, Sendai 980-8577 (Japan); Shchetinin, I.V.; Chirikov, N.V. [National University of Science and Technology “MISIS”, Leninsky prospect, 4, Moscow 119049 (Russian Federation); Louzguine-Luzgin, D.V. [WPI Advanced Institute for Materials Research, Tohoku University, Katahira 2-1-1, Aoba-Ku, Sendai 980-8577 (Japan)
2014-09-22
In the present work we introduce a micro/nano-structured α+β Ti-based low-alloy produced by the tilt-casting method and subjected to subsequent thermo-mechanical treatment. After hot dual-axial forging at 900 °C, subsequent heating at 700 °C and water quenching a Ti{sub 94}Fe{sub 3}Cu{sub 3}+1000 ppm of boron alloy, containing inexpensive alloying elements, showed an ultimate tensile strength value of about 950 MPa and percentage elongation of about 5.2%. It is shown that the intensive forging treatment and subsequent heat treatment are leading to significantly improved mechanical properties of such an alloy compared to the as-cast state.
The early years of string theory: The dual resonance model
International Nuclear Information System (INIS)
Ramond, P.
1987-10-01
This paper reviews the past quantum mechanical history of the dual resonance model which is an early string theory. The content of this paper is listed as follows: historical review, the Veneziano amplitude, the operator formalism, the ghost story, and the string story
Widely tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator
DEFF Research Database (Denmark)
Pu, Minhao; Liu, Liu; Xue, Weiqi
2010-01-01
We propose and demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator microring resonators. The phase-shifting range and the RF-power variation are analyzed. A maximum phase-shifting range of 0~600° is achieved by utilizing a dual-microring resonator...
Hydro-geophysical responses to the injection of CO2 in core plugs of Berea sandstone
Song, I.; Park, K. G.
2017-12-01
We have built a laboratory-scale core flooding system to measure the relative permeability of a core sample and the acoustic response to the CO2 saturation degree at in situ condition of pressure and temperature down to a few kilometer depths. The system consisted of an acoustic velocity core holder (AVC model from the Core Laboratories) between upstream where CO2 and H2O were injected separately and downstream where the mixed fluids came out of a core sample. Core samples with 4 cm in diameter and 5 cm in length of Berea sandstone were in turn placed in the core holder for confining and axial pressures. The flooding operations of the multiphase fluids were conducted through the sample at 40ºC in temperature and 8 MPa in backpressure. CO2 and H2O in the physical condition were injected separately into a sample at constant rate with various ratios. The two phases were mixed during flowing through the sample. The mixed fluids out of the sample were separated again by their different densities in a chamber equipped with a level gauge of the interface. From the level change of the water in the separator, we measured the volume of water coming out of the sample for each test with a constant ratio of the injection rates. Then it was possible to calculate the saturation degree of CO2 from the difference between input volume and output volume of water. The differential pressure between upstream and downstream was directly measured to calculate the relative permeability as a function of the CO2 saturation degree. We also conducted ultrasonic measurements using piezoelectric sensors on the end plugs. An electric pulse was given to a sensor on one end of sample, and then ultrasonic waves were recorded from the other end. The various ratios of injection rate of CO2 and H2O into Berea sandstone yielded a range of 0.1-0.7 in CO2 saturation degree. The relative permeability was obtained at the condition of steady-state flow for given stages from the velocity of each phase and
Energy Technology Data Exchange (ETDEWEB)
Cui, Chunxiang, E-mail: hutcui@hebut.edu.cn [Key Lab. for New Type of Functional Materials in Hebei Province, Hebei University of Technology, No.8, Road No.1, Dingzigu, Hongqiao District, Tianjin 300130 (China); Chen, Fenghua [Tianjin Sanhuan Lucky New Materials Inc., Tianjin Economical-Technological Development Area (TEDA), Tianjin 300457 (China); Yang, Wei; Li, Hongfang; Liu, Qiaozhi; Sun, Jibing [Key Lab. for New Type of Functional Materials in Hebei Province, Hebei University of Technology, No.8, Road No.1, Dingzigu, Hongqiao District, Tianjin 300130 (China)
2015-06-15
By utilizing alternate electrochemical reaction, atomic migration and deposition of Fe, Co, Sm and other chemical substances in the electrochemical solution, a large number of Sm{sub 2}Co{sub 17}/Fe{sub 7}Co{sub 3} dual phase nanowire arrays were carried out in the anodic aluminum oxide (AAO) template with highly uniform and orderly. The Sm{sub 2}Co{sub 17}/Fe{sub 7}Co{sub 3} dual phase nanowire arrays with diameter of 50 nm and length of 12 μm have the smooth surface and uniform diameter. The morphology and microstructure of annealed Sm{sub 2}Co{sub 17}/Fe{sub 7}Co{sub 3} dual phase nanowires were observed and analyzed using SEM, TEM and HRTEM. Compared with single-phase nanowires, dual phase magnetic nanowires have higher coercivity and saturation magnetization. In this composite system, both the hard and the soft phases have a high Curie temperature, therefore, we believe that the Sm{sub 2}Co{sub 17}/Fe{sub 7}Co{sub 3} dual phase nanowire arrays is a new type of high-temperature magnetic composites. - Highlights: • Sm{sub 2}Co{sub 17}/Fe{sub 7}Co{sub 3} dual phase nanowires were prepared by electrochemical method. • The interface pinning is the main factor to improve anisotropy field of the nanowires. • The dual phase magnetic nanowires have higher coercivity and saturation magnetization.
Dual Phase Membrane for High Temperature CO2 Separation
Energy Technology Data Exchange (ETDEWEB)
Jerry Lin
2007-06-30
This project aimed at synthesis of a new inorganic dual-phase carbonate membrane for high temperature CO{sub 2} separation. Metal-carbonate dual-phase membranes were prepared by the direct infiltration method and the synthesis conditions were optimized. Permeation tests for CO{sub 2} and N{sub 2} from 450-750 C showed very low permeances of those two gases through the dual-phase membrane, which was expected due to the lack of ionization of those two particular gases. Permeance of the CO{sub 2} and O{sub 2} mixture was much higher, indicating that the gases do form an ionic species, CO{sub 3}{sup 2-}, enhancing transport through the membrane. However, at temperatures in excess of 650 C, the permeance of CO{sub 3}{sup 2-} decreased rapidly, while predictions showed that permeance should have continued to increase with temperature. XRD data obtained from used membrane indicated that lithium iron oxides formed on the support surface. This lithium iron oxide layer has a very low conductivity, which drastically reduces the flow of electrons to the CO{sub 2}/O{sub 2} gas mixture; thus limiting the formation of the ionic species required for transport through the membrane. These results indicated that the use of stainless steel supports in a high temperature oxidative environment can lead to decreased performance of the membranes. This revelation created the need for an oxidation resistant support, which could be gained by the use of a ceramic-type membrane. Work was extended to synthesize a new inorganic dual-phase carbonate membrane for high temperature CO{sub 2} separation. Helium permeance of the support before and after infiltration of molten carbonate are on the order of 10{sup -6} and 10{sup -10} moles/m{sup 2} {center_dot} Pa {center_dot} s respectively, indicating that the molten carbonate is able to sufficiently infiltrate the membrane. It was found that La{sub 0.6}Sr{sub 0.4}Co{sub 0.8}Fe{sub 0.2}O{sub 3-{delta}} (LSCF) was a suitable candidate for the support
Okwuosa, Tochukwu C; Pereira, Beatriz C; Arafat, Basel; Cieszynska, Milena; Isreb, Abdullah; Alhnan, Mohamed A
2017-02-01
Individualizing gastric-resistant tablets is associated with major challenges for clinical staff in hospitals and healthcare centres. This work aims to fabricate gastric-resistant 3D printed tablets using dual FDM 3D printing. The gastric-resistant tablets were engineered by employing a range of shell-core designs using polyvinylpyrrolidone (PVP) and methacrylic acid co-polymer for core and shell structures respectively. Filaments for both core and shell were compounded using a twin-screw hot-melt extruder (HME). CAD software was utilized to design a capsule-shaped core with a complementary shell of increasing thicknesses (0.17, 0.35, 0.52, 0.70 or 0.87 mm). The physical form of the drug and its integrity following an FDM 3D printing were assessed using x-ray powder diffractometry (XRPD), thermal analysis and HPLC. A shell thickness ≥0.52 mm was deemed necessary in order to achieve sufficient core protection in the acid medium. The technology proved viable for incorporating different drug candidates; theophylline, budesonide and diclofenac sodium. XRPD indicated the presence of theophylline crystals whilst budesonide and diclofenac sodium remained amorphous in the PVP matrix of the filaments and 3D printed tablets. Fabricated tablets demonstrated gastric resistant properties and a pH responsive drug release pattern in both phosphate and bicarbonate buffers. Despite its relatively limited resolution, FDM 3D printing proved to be a suitable platform for a single-process fabrication of delayed release tablets. This work reveals the potential of dual FDM 3D printing as a unique platform for personalising delayed release tablets to suit an individual patient's needs.
International Nuclear Information System (INIS)
Frazão, O; Silva, S F; Viegas, J; Baptista, J M; Santos, J L; Roy, P
2010-01-01
A hybrid Fabry–Perot/Michelson interferometer sensor using a dual asymmetric core microstructured fiber is demonstrated. The hybrid interferometer presents three waves. Two parallel Fabry–Perot cavities with low finesse are formed between the splice region and the end of a dual-core microstructured fiber. A Michelson configuration is obtained by the two small cores of the microstructured fiber. The spectral response of the hybrid interferometer presents two pattern fringes with different frequencies due to the respective optical path interferometers. The hybrid interferometer was characterized in strain and temperature presenting different sensitivity coefficients for each topology. Due to these characteristics, this novel sensing head is able to measure strain and temperature, simultaneously
Enhanced CO_2 capture on graphene via N, S dual-doping
International Nuclear Information System (INIS)
Li, Jieyuan; Hou, Meiling; Chen, Yanqiu; Cen, Wanglai; Chu, Yinghao; Yin, Shi
2017-01-01
Highlights: • Sluggish conjugated π bonds of graphene should be weakened to promote adsorption activity. • A charge delivery channel along S → N → CO_2 path should be prior responsible for the enhancement of CO_2 capture on graphene. • Applicative temperature range of graphene-based adsorbents for CO_2 capture is extend to about 100 °C via N, S dual-doping. - Abstract: N, S doped graphene-based materials have been recently recognized as promising adsorbents for CO_2 capture, but understanding of the adsorption mechanism at the atomic level is still limited. Herein, the local structures and promotion mechanism of CO_2 capture by N, S doped graphene were investigated by combining density functional theory and ab initio thermodynamics. A single vacancy defected graphene involving N, S dual-doping was found to be a superior adsorbent for CO_2 capture under mild conditions (<100 °C, 1 atm). The enhanced CO_2 adsorption performance should be ascribed to a charge delivery channel along the S → N → CO_2 path, leading to extra charge transfer from graphene to CO_2. It is worth mentioning that the extra charge transfer was stimulated by the unique sp"2 hybridization of pyridine N and further enhanced by S in N, S dual-doped graphene. A possible mechanism has been proposed to explain the high adsorption performance of CO_2 by N, S dual-doped graphene, which offers insights for the design of new graphene-based adsorbents.
DEFF Research Database (Denmark)
Weber, Ulrich; Zhao, Zheng; Rufibach, Kaspar
2015-01-01
OBJECTIVE: A recent consensus statement has suggested ≥3 corner inflammatory lesions (CILs) or several corner fatty lesions (CFLs) as candidate criteria indicative of axial spondyloarthritis (SpA) on magnetic resonance imaging (MRI) of the spine. The aim of this study was to evaluate the diagnostic...
CO and CO2 dual-gas detection based on mid-infrared wideband absorption spectroscopy
Dong, Ming; Zhong, Guo-qiang; Miao, Shu-zhuo; Zheng, Chuan-tao; Wang, Yi-ding
2018-03-01
A dual-gas sensor system is developed for CO and CO2 detection using a single broadband light source, pyroelectric detectors and time-division multiplexing (TDM) technique. A stepper motor based rotating system and a single-reflection spherical optical mirror are designed and adopted for realizing and enhancing dual-gas detection. Detailed measurements under static detection mode (without rotation) and dynamic mode (with rotation) are performed to study the performance of the sensor system for the two gas samples. The detection period is 7.9 s in one round of detection by scanning the two detectors. Based on an Allan deviation analysis, the 1σ detection limits under static operation are 3.0 parts per million (ppm) in volume and 2.6 ppm for CO and CO2, respectively, and those under dynamic operation are 9.4 ppm and 10.8 ppm for CO and CO2, respectively. The reported sensor has potential applications in various fields requiring CO and CO2 detection such as in the coal mine.
Experimental evidence for dual diffractive resonances in nucleon-nucleus scattering
International Nuclear Information System (INIS)
Ion, D.B.; Ion-Mihai, R.
1981-09-01
Experimental data on nucleon-nucleus scattering for laboratory momenta between 0.9:10 GeV/c are analysed in terms of the dual diffractive resonance (DDR) mechanism. The experimental data for all the nuclei are found to agree well with the predictions of the collective DDR states dominance. (authors)
Compact Microstrip Triple-Mode Bandpass Filters Using Dual-Stub-Loaded Spiral Resonators
Directory of Open Access Journals (Sweden)
K. D. Xu
2017-04-01
Full Text Available Two new microstrip triple-mode resonators loaded with T-shaped open stubs using axially and centrally symmetric spiral structures, respectively, are presented. Spiraled for circuit size reduction, these two half-wavelength resonators can both generate three resonant modes over a wide frequency band by loading two T-stubs with different lengths. Due to the structural symmetry, they can be analyzed by odd- and even-mode method. To validate the design concept, two compact bandpass filters (BPFs using these two novel resonators with center frequencies of 1.76 GHz and 2.44 GHz for the GSM1800 and WLAN/Zigbee applications, respectively, have been designed, fabricated and tested. The center frequencies and bandwidths can be tunable through the analysis of resonant frequency responses, fractional bandwidths and external quality factor versus the resonator parameters. The final measured results have achieved good consistence with the simulations of these two BPFs.
Modelling and simulation of a thermally induced optical transparency in a dual micro-ring resonator.
Lydiate, Joseph
2017-07-01
This paper introduces the simulation and modelling of a novel dual micro-ring resonator. The geometric configuration of the resonators, and the implementation of a simulated broadband excitation source, results in the realization of optical transparencies in the combined through port output spectrum. The 130 nm silicon on insulator rib fabrication process is adopted for the simulation of the dual-ring configuration. Two titanium nitride heaters are positioned over the coupling regions of the resonators, which can be operated independently, to control the spectral position of the optical transparency. A third heater, centrally located above the dual resonator rings, can be used to red shift the entire spectrum to a required reference resonant wavelength. The free spectral range with no heater currents applied is 4.29 nm. For a simulated heater current of 7 mA (55.7 mW heater power) applied to one of the through coupling heaters, the optical transparency exhibits a red shift of 1.79 nm from the reference resonant wavelength. The ring-to-ring separation of approximately 900 nm means that it can be assumed that there is a zero ring-to-ring coupling field in this model. This novel arrangement has potential applications as a gas mass airflow sensor or a gas species identification sensor.
Dual and tri-band bandpass filters based on novel Π-shaped resonator
Xiao, Jian-Kang; Zhu, Wen-Jun; Zhao, Wei
2014-05-01
A novel Π-shaped resonator is proposed, and compact dual-band and tri-band bandpass filters that meet IEEE 802.11 application requirements by using the new resonator are designed. The dual-band bandpass filter centres at 2.45 and 5.6 GHz with a simulated passband insertion loss of no more than 0.8 dB, and the tri-band bandpass filter which is got by two-path coupling achieves simulated passband insertion loss of no more than 1.1 dB. The new designs are demonstrated by experiment. The new filters have advantages of simple and compact structures, low passband insertion losses, good frequency selectivity and miniature circuit sizes. All these have prospect to be applied in future wireless communication systems.
Reduced thermal sensitivity of hybrid air-core photonic band-gap fiber ring resonator
Feng, Li-shuang; Wang, Kai; Jiao, Hong-chen; Wang, Jun-jie; Liu, Dan-ni; Yang, Zhao-hua
2018-01-01
A novel hybrid air-core photonic band-gap fiber (PBF) ring resonator with twin 90° polarization-axis rotated splices is proposed and demonstrated. Frist, we measure the temperature dependent birefringence coefficient of air-core PBF and Panda fiber. Experimental results show that the relative temperature dependent birefringence coefficient of air-core PBF is 1.42×10-8/°C, which is typically 16 times less than that of Panda fiber. Then, we extract the geometry profile of air-core PBF from scanning electron microscope (SEM) images. Numerical modal is built to distinguish the fast axis and slow axis in the fiber. By precisely setting the length difference in air-core PBF and Panda fiber between two 90° polarization-axis rotated splicing points, the hybrid air-core PBF ring resonator is constructed, and the finesse of the resonator is 8.4. Environmental birefringence variation induced by temperature change can be well compensated, and experimental results show an 18-fold reduction in thermal sensitivity, compared with resonator with twin 0° polarization-axis rotated splices.
Core rotational dynamics and geological events
Greff-Lefftz; Legros
1999-11-26
A study of Earth's fluid core oscillations induced by lunar-solar tidal forces, together with tidal secular deceleration of Earth's axial rotation, shows that the rotational eigenfrequency of the fluid core and some solar tidal waves were in resonance around 3.0 x 10(9), 1.8 x 10(9), and 3 x 10(8) years ago. The associated viscomagnetic frictional power at the core boundaries may be converted into heat and would destabilize the D" thermal layer, leading to the generation of deep-mantle plumes, and would also increase the temperature at the fluid core boundaries, perturbing the core dynamo process. Such phenomena could account for large-scale episodes of continental crust formation, the generation of flood basalts, and abrupt changes in geomagnetic reversal frequency.
NMR evidence for Co-Al-Co molecular groups trapped in cages of Co4Al13
International Nuclear Information System (INIS)
Jeglic, P.; Heggen, M.; Feuerbacher, M.; Bauer, B.; Gille, P.; Haarmann, F.
2009-01-01
We present the results of 27 Al nuclear magnetic resonance (NMR) experiments on the phase Co 4 Al 13 . These results are compared to a recent structure model [1], which demonstrates a unique bonding for Al atoms in the Co-Al-Co molecular groups. In our measurement, two 27 Al signals were identified. The first one originates from Al atoms forming cages. The second signal corresponds to Al sites with exceptionally large almost axially symmetric quadrupole coupling. This finding is in perfect agreement with isolated Co-Al-Co molecular groups in accordance to Ref. [1].
Energy Technology Data Exchange (ETDEWEB)
Cao Liji; Breithaupt, Mathies; Peter, Joerg [Division of Medical Physics in Radiology, German Cancer Research Center, Im Neuenheimer Feld 280, 69120 Heidelberg (Germany)], E-mail: l.cao@dkfz.de
2010-03-21
A mathematical approach for geometric co-calibration of a dual-modal small-animal imaging system is presented. The system comprises an optical imaging setup for in vivo bioluminescence and fluorescence detection, as well as an x-ray CT, both mounted on a common rotatable gantry enabling fully simultaneous imaging at axially overlapping fields-of-view. Geometric co-calibration is performed once by imaging a single cylindrical light-emitting source with both modalities over 360 deg. at two axial positions, respectively. Given the three-dimensional coordinates of the source positions in the reconstructed CT volume data along with their two-dimensional locations projected at the optical detector plane, the following intrinsic system parameters are calculated: (i) the intrinsic geometric parameters of the optical detection system-five parameters for each view and (ii) the relative positional relationship between the optical and CT systems-two parameters for each view. After co-calibration is performed, experimental studies using phantoms demonstrate the high degree of intrinsic positional accuracy between the optical and CT measurements. The most important advantage of this approach is that dual-modal data fusion is accomplished without any post-registration strategies.
Sliding-Mode Control to Compensate PVT Variations in Dual Core Systems
Pourshaghaghi, H.R.; Fatemi, S.H.; Pineda de Gyvez, J.
2012-01-01
In this paper, we present a novel robust sliding-mode controller for stabilizing supply voltage and clock frequency of dual core processors determined by dynamic voltage and frequency scaling (DVFS) methods in the presence of systematic and random variations. We show that maximum rejection for
Modelling and analysis of the transformer current resonance in dual active bridge converters
DEFF Research Database (Denmark)
Qin, Zian; Shen, Zhan; Blaabjerg, Frede
2017-01-01
Due to the parasitic capacitances of the transformer and inductor in Dual Active Bridge (DAB) converters, resonance happens in the transformer currents. This high frequency resonant current flowing into the full bridges will worsen their soft-switching performance and thereby reduce its efficiency....... In order to study the generation mechanism of this current resonance, the impedance of the transformer and inductor with parasitic components is modelled in this digest. Then, based on the impedance model, an approach is proposed to mitigate the current resonance. Finally, both the impedance model...
Breaking of axial symmetry in excited heavy nuclei as identified in giant dipole resonance data
Energy Technology Data Exchange (ETDEWEB)
Grosse, E.; Massarczyk, R. [Technische Universitaet Dresden, Institute of Nuclear and Particle Physics, Dresden (Germany); Junghans, A.R. [Helmholtz-Zentrum Dresden-Rossendorf, Institute of Radiation Physics, Dresden (Germany)
2017-11-15
A recent theoretical prediction of a breaking of axial symmetry in quasi all heavy nuclei is confronted to a new critical analysis of photon strength functions of nuclei in the valley of stability. For the photon strength in the isovector giant dipole resonance (IVGDR) regime a parameterization of GDR shapes by the sum of three Lorentzians (TLO) is extrapolated to energies below and above the IVGDR. The impact of non-GDR modes adding to the low energy slope of photon strength is discussed including recent data on photon scattering and other radiative processes. These are shown to be concentrated in energy regions where various model calculations predict intermediate collective strength; thus they are obviously separate from the IVGDR tail. The triple Lorentzian (TLO) ansatz for giant dipole resonances is normalized in accordance to the dipole sum rule. The nuclear droplet model with surface dissipation accounts well for positions and widths without local, nuclide specific, parameters. Very few and only global parameters are needed when a breaking of axial symmetry already in the valley of stability is admitted and hence a reliable prediction for electric dipole strength functions also outside of it is expected. (orig.)
Enhanced CO{sub 2} capture on graphene via N, S dual-doping
Energy Technology Data Exchange (ETDEWEB)
Li, Jieyuan; Hou, Meiling [College of Architecture and Environment, Sichuan University (China); Chen, Yanqiu [Institute of New Energy and Low Carbon Technology, Sichuan University (China); Cen, Wanglai [Institute of New Energy and Low Carbon Technology, Sichuan University (China); National Engineering Research Center for Flue Gas Desulfurization (China); Chu, Yinghao, E-mail: chuyinghao@scu.edu.cn [College of Architecture and Environment, Sichuan University (China); National Engineering Research Center for Flue Gas Desulfurization (China); Yin, Shi, E-mail: yinshi_scu@foxmail.com [College of Architecture and Environment, Sichuan University (China)
2017-03-31
Highlights: • Sluggish conjugated π bonds of graphene should be weakened to promote adsorption activity. • A charge delivery channel along S → N → CO{sub 2} path should be prior responsible for the enhancement of CO{sub 2} capture on graphene. • Applicative temperature range of graphene-based adsorbents for CO{sub 2} capture is extend to about 100 °C via N, S dual-doping. - Abstract: N, S doped graphene-based materials have been recently recognized as promising adsorbents for CO{sub 2} capture, but understanding of the adsorption mechanism at the atomic level is still limited. Herein, the local structures and promotion mechanism of CO{sub 2} capture by N, S doped graphene were investigated by combining density functional theory and ab initio thermodynamics. A single vacancy defected graphene involving N, S dual-doping was found to be a superior adsorbent for CO{sub 2} capture under mild conditions (<100 °C, 1 atm). The enhanced CO{sub 2} adsorption performance should be ascribed to a charge delivery channel along the S → N → CO{sub 2} path, leading to extra charge transfer from graphene to CO{sub 2}. It is worth mentioning that the extra charge transfer was stimulated by the unique sp{sup 2} hybridization of pyridine N and further enhanced by S in N, S dual-doped graphene. A possible mechanism has been proposed to explain the high adsorption performance of CO{sub 2} by N, S dual-doped graphene, which offers insights for the design of new graphene-based adsorbents.
Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation
Energy Technology Data Exchange (ETDEWEB)
Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P. [Hospital for Special Surgery, Department of Radiology and Imaging, New York, NY (United States); Feinberg, Joseph H. [Physical Medicine and Rehabilitation, Hospital for Special Surgery, New York, NY (United States); Amber, Ian [MedStar Georgetown University Hospital, Department of Radiology, DC, Washington (United States)
2017-12-15
Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)
Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation
International Nuclear Information System (INIS)
Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P.; Feinberg, Joseph H.; Amber, Ian
2017-01-01
Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)
International Nuclear Information System (INIS)
Friedt, J.M.
1976-01-01
The change in the hyperfine line intensities is discussed for various Moessbauer transitions in cases involving axial vibrational lattice anisotropy and axial electric field gradient at the resonant nucleus. The change in the relative intensities of the spectral components has been calculed numerically for the different types of Moessbauer transitions. Polynomial expansions are given to describe the functional dependence of the relative intensities on the magnitude of the vibration anisotropy. They may be used to extract the relevant parameters from experimental data without requiring the numerical integrations implied in the description of the Goldanskii-Karyagin effect [fr
Giant exchange bias and its angular dependence in Co/CoO core-shell nanowire assemblies
Energy Technology Data Exchange (ETDEWEB)
Gandha, Kinjal; Chaudhary, Rakesh P.; Mohapatra, Jeotikanta; Koymen, Ali R.; Liu, J. Ping, E-mail: pliu@uta.edu
2017-07-12
The exchange-bias field (H{sub EB}) and its angular dependence are systematically investigated in Co/CoO core-shell nanowire assemblies (∼15 nm in diameter and ∼200 nm in length) consisting of single-crystalline Co core and polycrystalline CoO shell. Giant exchange-bias field (H{sub EB}) up to 2.4 kOe is observed below a blocking temperature (T{sub EB} ∼150 K) in the aligned Co/CoO nanowire assemblies. It is also found that there is an angular dependence between the H{sub EB} and the applied magnetization direction. The H{sub EB} showed a peak at 30° between the applied field and the nanowire aligned direction, which may be attributed to the noncollinear spin orientations at the interface between the ferromagnetic core and the antiferromagnetic shell. This behavior is quantitatively supported by an analytical calculation based on Stoner–Wohlfarth model. This study underlines the importance of the competing magnetic anisotropies at the interface of Co/CoO core-shell nanowires. - Highlights: • Giant exchange bias is observed in oriented Co/CoO core-shell nanowire assemblies. • Study of angular and temperature dependence of the exchange bias effect. • Competing magnetic anisotropies at the interface of Co/CoO core-shell nanowires. • Effect of misaligned spins in FM/AFM interface on angular dependence of exchange bias. • We explain the analytical model that accounts for experimental results.
Giant exchange bias and its angular dependence in Co/CoO core-shell nanowire assemblies
International Nuclear Information System (INIS)
Gandha, Kinjal; Chaudhary, Rakesh P.; Mohapatra, Jeotikanta; Koymen, Ali R.; Liu, J. Ping
2017-01-01
The exchange-bias field (H EB ) and its angular dependence are systematically investigated in Co/CoO core-shell nanowire assemblies (∼15 nm in diameter and ∼200 nm in length) consisting of single-crystalline Co core and polycrystalline CoO shell. Giant exchange-bias field (H EB ) up to 2.4 kOe is observed below a blocking temperature (T EB ∼150 K) in the aligned Co/CoO nanowire assemblies. It is also found that there is an angular dependence between the H EB and the applied magnetization direction. The H EB showed a peak at 30° between the applied field and the nanowire aligned direction, which may be attributed to the noncollinear spin orientations at the interface between the ferromagnetic core and the antiferromagnetic shell. This behavior is quantitatively supported by an analytical calculation based on Stoner–Wohlfarth model. This study underlines the importance of the competing magnetic anisotropies at the interface of Co/CoO core-shell nanowires. - Highlights: • Giant exchange bias is observed in oriented Co/CoO core-shell nanowire assemblies. • Study of angular and temperature dependence of the exchange bias effect. • Competing magnetic anisotropies at the interface of Co/CoO core-shell nanowires. • Effect of misaligned spins in FM/AFM interface on angular dependence of exchange bias. • We explain the analytical model that accounts for experimental results.
Nazari, Tavakol; Khazaeinezhad, Reza; Jung, Woohyun; Joo, Boram; Kong, Byung-Joo; Oh, Kyunghwan
2015-07-13
Dual resonant bands in UV and the visible range were simultaneously observed in the enhanced optical transmission (EOT) through star-shaped plasmonic structures. EOTs through four types of polygonal bull's eyes with a star aperture surrounded by the concentric star grooves were analyzed and compared for 3, 4, 5, and 6 corners, using finite difference time domain (FDTD) method. In contrast to plasmonic resonances in the visible range, the UV-band resonance intensity was found to scale with the number of corners, which is related with higher order multipole interactions. Spectral positions and relative intensities of the dual resonances were analyzed parametrically to find optimal conditions to maximize EOT in UV-visible dual bands.
Zhang, Yulong; Wang, Tianyang; Zhang, Ai; Peng, Zhuoteng; Luo, Dan; Chen, Rui; Wang, Fei
2016-12-01
In this paper, we present design and test of a broadband electrostatic energy harvester with a dual resonant structure, which consists of two cantilever-mass subsystems each with a mass attached at the free edge of a cantilever. Comparing to traditional devices with single resonant frequency, the proposed device with dual resonant structure can resonate at two frequencies. Furthermore, when one of the cantilever-masses is oscillating at resonance, the vibration amplitude is large enough to make it collide with the other mass, which provides strong mechanical coupling between the two subsystems. Therefore, this device can harvest a decent power output from vibration sources at a broad frequency range. During the measurement, continuous power output up to 6.2-9.8 μW can be achieved under external vibration amplitude of 9.3 m/s 2 at a frequency range from 36.3 Hz to 48.3 Hz, which means the bandwidth of the device is about 30% of the central frequency. The broad bandwidth of the device provides a promising application for energy harvesting from the scenarios with random vibration sources. The experimental results indicate that with the dual resonant structure, the vibration-to-electricity energy conversion efficiency can be improved by 97% when an external random vibration with a low frequency filter is applied.
International Nuclear Information System (INIS)
Nakano, M.; Iijima, S.; Shirakata, K.; Hirota, J.
1980-01-01
To investigate physics properties of the heterogeneous LMFBR core and to examine the reliability of the current data and method for heterogeneous core configuration, an experimental study has been made on FCA VII-3 assemblies which have an internal blanket (IB) at midplane of the cylindrical core. Systematic experiments were carried out on the heterogeneous cores whose IBs were different in composition and thickness. A homogeneous core was also built to compare the results with those obtained on the heterogeneous cores. The sodium-void worth is not sensitive to the composition of IB. The positive void worth in the core of the 40 cm IB is lowered by about 40% compared with that in the homogeneous core. The analysis was made using the JAERI-Fast Set Version II and the diffusion code CITATION. Directional diffusion coefficients were used to take account of the axial streaming. To evaluate transport effects, the S 4 calculation was made. Comparison between the calculated and experimental results reveals the following: ksub(eff) and Pu worth in the core are not well predicted for the heterogeneous core, although they are represented satisfactorily for the homogeneous core. Reaction rates sensitive to the low-energy neutron are underestimated in the IB when they are normalized in the core. Sodium-void worths are fairly well predicted. However, the positive void worth in the heterogeneous core is underestimated, while that in the homogeneous core is overestimated. (author)
SIMULATION OF CHARACTERISTICS OF DUAL-CORE PHASE SHIFTING TRANSFORMER
Directory of Open Access Journals (Sweden)
Kalinin L.P.
2014-04-01
Full Text Available The role and importance of phase shifting transformers are increased as a result of the further development of integrated power systems. This gives the rise to new technical solutions which entails the necessity of comparison of new developments with existing. The article consider the technical characteristics of dual-core phase shifting transformer which later will be used as a basis for comparison with other competing options and assess of their technical efficiency.
Directory of Open Access Journals (Sweden)
Topor Marcel
2017-01-01
Full Text Available This paper introduces a novel brushless, single winding and single stator, dual PM rotor axial-air-gap machine capable to deliver independently torque at the two rotors by adequate dual vector control. The proposed topologies, the circuit model, controlled dynamics simulation and preliminary 3D FEM torque production on a case study constitute the core of the paper. The proposed dual mechanical port system should be instrumental in parallel (with planetary gears or series hybrid electric vehicles (HEV aiming at a more compact and efficient electric propulsion system solution.
Energy Dissipation in Sandwich Structures During Axial Compression
DEFF Research Database (Denmark)
Urban, Jesper
2002-01-01
The purpose of this paper is to investigate the energy dissipation in sandwich structures during axial crushing. Axial crushing tests on six sandwich elements are described. The sandwich elements consist of a polyurethane core and E-glass/Polyester skin. The elements compare to full-scale structu......The purpose of this paper is to investigate the energy dissipation in sandwich structures during axial crushing. Axial crushing tests on six sandwich elements are described. The sandwich elements consist of a polyurethane core and E-glass/Polyester skin. The elements compare to full...
Efficient primary and parametric resonance excitation of bistable resonators
Ramini, Abdallah
2016-09-12
We experimentally demonstrate an efficient approach to excite primary and parametric (up to the 4th) resonance of Microelectromechanical system MEMS arch resonators with large vibrational amplitudes. A single crystal silicon in-plane arch microbeam is fabricated such that it can be excited axially from one of its ends by a parallel-plate electrode. Its micro/nano scale vibrations are transduced using a high speed camera. Through the parallel-plate electrode, a time varying electrostatic force is applied, which is converted into a time varying axial force that modulates dynamically the stiffness of the arch resonator. Due to the initial curvature of the structure, not only parametric excitation is induced, but also primary resonance. Experimental investigation is conducted comparing the response of the arch near primary resonance using the axial excitation to that of a classical parallel-plate actuation where the arch itself forms an electrode. The results show that the axial excitation can be more efficient and requires less power for primary resonance excitation. Moreover, unlike the classical method where the structure is vulnerable to the dynamic pull-in instability, the axial excitation technique can provide large amplitude motion while protecting the structure from pull-in. In addition to primary resonance, parametrical resonances are demonstrated at twice, one-half, and two-thirds the primary resonance frequency. The ability to actuate primary and/or parametric resonances can serve various applications, such as for resonator based logic and memory devices. (C) 2016 Author(s). All article content, except where otherwise noted, is licensed under a Creative Commons Attribution (CC BY) license
International Nuclear Information System (INIS)
Jang, Haeyun; Lee, Chaedong; Nam, Gi-Eun; Quan, Bo; Choi, Hyuck Jae; Yoo, Jung Sun; Piao, Yuanzhe
2016-01-01
The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex ® with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.
Energy Technology Data Exchange (ETDEWEB)
Jang, Haeyun; Lee, Chaedong [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Nam, Gi-Eun [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Quan, Bo [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Choi, Hyuck Jae [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Yoo, Jung Sun [Seoul National University, Department of Transdisciplinary Studies, Graduate School of Convergence Science and Technology, Smart Humanity Convergence Center (Korea, Republic of); Piao, Yuanzhe, E-mail: parkat9@snu.ac.kr [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of)
2016-02-15
The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex{sup ®} with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.
Dual-mode plasmonic nanorod type antenna based on the concept of a trapped dipole.
Panaretos, Anastasios H; Werner, Douglas H
2015-04-06
In this paper we theoretically investigate the feasibility of creating a dual-mode plasmonic nanorod antenna. The proposed design methodology relies on adapting to optical wavelengths the principles of operation of trapped dipole antennas, which have been widely used in the low MHz frequency range. This type of antenna typically employs parallel LC circuits, also referred to as "traps", which are connected along the two arms of the dipole. By judiciously choosing the resonant frequency of these traps, as well as their position along the arms of the dipole, it is feasible to excite the λ/2 resonance of both the original dipole as well as the shorter section defined by the length of wire between the two traps. This effectively enables the dipole antenna to have a dual-mode of operation. Our analysis reveals that the implementation of this concept at the nanoscale requires that two cylindrical pockets (i.e. loading volumes) be introduced along the length of the nanoantenna, inside which plasmonic core-shell particles are embedded. By properly selecting the geometry and constitution of the core-shell particle as well as the constitution of the host material of the two loading volumes and their position along the nanorod, the equivalent effect of a resonant parallel LC circuit can be realized. This effectively enables a dual-mode operation of the nanorod antenna. The proposed methodology introduces a compact approach for the realization of dual-mode optical sensors while at the same time it clearly illustrates the inherent tuning capabilities that core-shell particles can offer in a practical framework.
Fast globally optimal segmentation of 3D prostate MRI with axial symmetry prior.
Qiu, Wu; Yuan, Jing; Ukwatta, Eranga; Sun, Yue; Rajchl, Martin; Fenster, Aaron
2013-01-01
We propose a novel global optimization approach to segmenting a given 3D prostate T2w magnetic resonance (MR) image, which enforces the inherent axial symmetry of the prostate shape and simultaneously performs a sequence of 2D axial slice-wise segmentations with a global 3D coherence prior. We show that the proposed challenging combinatorial optimization problem can be solved globally and exactly by means of convex relaxation. With this regard, we introduce a novel coupled continuous max-flow model, which is dual to the studied convex relaxed optimization formulation and leads to an efficient multiplier augmented algorithm based on the modern convex optimization theory. Moreover, the new continuous max-flow based algorithm was implemented on GPUs to achieve a substantial improvement in computation. Experimental results using public and in-house datasets demonstrate great advantages of the proposed method in terms of both accuracy and efficiency.
International Nuclear Information System (INIS)
Lau, Cheuk Wah; Dykin, Victor; Nylén, Henrik; Björk, Klara Insulander; Sandberg, Urban
2014-01-01
Highlights: • Thorium–plutonium mixed oxide to improve nuclear reactors load-following capability. • SIMULATE-3 was the main calculation tool. • The Ringhals-3 PWR unit in Sweden was used as a reference. • Lower xenon poisoning and shorter reactor dead time. - Abstract: The increased share of renewable energy, such as wind and solar power, will increase the demand for load-following power sources, and nuclear reactors could be one option. However, during rapid load-following events, traditional UOX cores could be restricted by the volatile oscillation of the power distribution. Therefore, a conceptual study on stability properties of Th-MOX PWR concerning axial offset power excursion during load-following events are investigated and discussed. The study is performed in SIMULATE-3 for a realistic PWR core (Ringhals-3) at the end of cycle, where the largest amplitude of the axial offset oscillations is expected. It is shown that the Th-MOX core possesses much better stability characteristics and shorter reactor dead time compared with a traditional UOX core, and the main reasons are the lower sensitivity to perturbations in the neutron spectrum, lower xenon poisoning and lower thermal neutron flux
DEFF Research Database (Denmark)
Rudwaleit, M; Jurik, A G; Hermann, K-G A
2009-01-01
BACKGROUND: Magnetic resonance imaging (MRI) of sacroiliac joints has evolved as the most relevant imaging modality for diagnosis and classification of early axial spondyloarthritis (SpA) including early ankylosing spondylitis. OBJECTIVES: To identify and describe MRI findings in sacroiliitis and...... relevant for sacroiliitis have been defined by consensus by a group of rheumatologists and radiologists. These definitions should help in applying correctly the imaging feature "active sacroiliitis by MRI" in the new ASAS classification criteria for axial SpA.......BACKGROUND: Magnetic resonance imaging (MRI) of sacroiliac joints has evolved as the most relevant imaging modality for diagnosis and classification of early axial spondyloarthritis (SpA) including early ankylosing spondylitis. OBJECTIVES: To identify and describe MRI findings in sacroiliitis...... conditions which may mimic SpA. Descriptions of the pathological findings and technical requirements for the appropriate acquisition were formulated. In a consensual approach MRI findings considered to be essential for sacroiliitis were defined. RESULTS: Active inflammatory lesions such as bone marrow oedema...
International Nuclear Information System (INIS)
Fan Zhen-Kai; Li Shu-Guang; Fan Yu-Qiu; Zhang Wan; An Guo-Wen; Bao Ya-Jie
2014-01-01
We design a novel kind of polarization beam splitter based on a gold-filled dual-core photonic crystal fiber (DC-PCF). Owing to filling with two gold wires in this DC-PCF, its coupling characteristics can be changed greatly by the second-order surface plasmon polariton (SPP) and the resonant coupling between the surface plasmon modes and the fiber-core guided modes can enhance the directional power transfer in the two fiber-cores. Numerical results by using the finite element method show the extinction ratio at the wavethlengths of 1.327 μm and 1.55 μm can reach −58 dB and −60 dB and the bandwidths as the extinction ratio better than −12 dB are about 54 nm and 47 nm, respectively. Compared with the gold-unfilled DC-PCF, a 1.746-mm-long gold-filled DC-PCF is better applied to the polarization beam splitter in the two communication bands of λ = 1.327 μm and 1.55 μm. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
Curvature and position of nested tubes in hollow-core anti-resonant fibers
DEFF Research Database (Denmark)
Habib, Md Selim; Markos, Christos; Bang, Ole
2017-01-01
Hollow-core anti-resonant (HC-AR) fibers where a symmetric distribution of cladding tubes compose a “negative-curvature” core boundary have extraordinary optical properties, such as low transmission loss, wide transmission bands and weak power overlap between the core modes and the silica parts [1...
A new strategy of axial power distribution control based on three axial offsets concept
International Nuclear Information System (INIS)
Shimazu, Yoichiro
2009-01-01
We have proposed a very simple control procedure for axial xenon oscillation control based on a characteristic trajectory. The trajectory is drawn by three offsets of power distributions, namely, AOp, AOi and AOx. They are defined as the offset of axial power distribution, the offset of the power distribution under which the current iodine distribution is obtained as the equilibrium and that for xenon distribution, respectively. When these offsets are plotted on X-Y plane for (AOp-AOx, AOi-AOx) the trajectory draws a quite characteristic ellipse (or an elliptic spiral). On the other hands, Constant Axial Offset Control (CAOC) procedure is adopted as axial power distribution control strategy during both base load and load following operations in domestic PWRs. In the previous paper, we have presented an innovative procedure of axial power distribution control during load following in PWRs based on this trajectory such that the AOp-AOx is to be controlled to zero when the value deviates the pre-determined limiting values. In this paper we propose a modified control strategy to get more stability of axial power distributions. In this strategy, we control the trajectory to be close to the major axis of the ellipse when the power distribution reaches the limiting values. In other words, the plot is not controlled only to reduce AOp-AOx but also AOi-AOx is taken into account at the same time. It is known that when the plot is controlled to the major axis, it means that the point gives the peak position of axial xenon oscillation. Therefore xenon oscillation will not increase its amplitude any more. Thus more stable axial power distribution control is attained. This kind of design concept is quite important especially for the future PWRs with elongated fuel length and longer core life. Because in a longer effective core and also the longer core life, it has been known that the stability of axial xenon oscillation becomes more unstable. In this paper, some simulation
International Nuclear Information System (INIS)
Bora, B.; Bhuyan, H.; Favre, M.; Wyndham, E.; Chuaqui, H.
2012-01-01
Plasma series resonance (PSR) effect is well known in geometrically asymmetric capacitively couple radio frequency plasma. However, plasma series resonance effect in geometrically symmetric plasma has not been properly investigated. In this work, a theoretical approach is made to investigate the plasma series resonance effect and its influence on Ohmic and stochastic heating in geometrically symmetric discharge. Electrical asymmetry effect by means of dual frequency voltage waveform is applied to excite the plasma series resonance. The results show considerable variation in heating with phase difference between the voltage waveforms, which may be applicable in controlling the plasma parameters in such plasma.
International Nuclear Information System (INIS)
Gumhalter, B.
1985-07-01
The physical origin of the peculiar relaxation shifts and spectral shapes appearing in x-ray induced core-to-valence excitation and core level photoemission spectra of CO chemisorbed on Ni(111) are discussed and interpreted within a unique framework. Within the model presented the electronic transitions in core-to-valence excitation spectroscopy and XPS are shown to give rise to drastic electronic rearrangements within the adsorption system and to the charge shake-up in the CO 2π* derived resonance partly filled via the backdonation mechanism. Such singular relaxation processes, common to both spectroscopies, are closely related and can be treated on the same footing. This makes possible to establish unique relaxation shifts and spectral characteristics for two seemingly different experimental situations. The use of this formalism in analysing the experimental data enables one to estimate and distinguish between the extra-adsorbate (image or nonbonding) and intra-adsorbate (chemically induced) screening of the core holes created either by x-ray induced core-to-valence electronic transitions or core level photoionization in CO/Ni(111). (author)
Modulational Instability in Linearly Coupled Asymmetric Dual-Core Fibers
Directory of Open Access Journals (Sweden)
Arjunan Govindarajan
2017-06-01
Full Text Available We investigate modulational instability (MI in asymmetric dual-core nonlinear directional couplers incorporating the effects of the differences in effective mode areas and group velocity dispersions, as well as phase- and group-velocity mismatches. Using coupled-mode equations for this system, we identify MI conditions from the linearization with respect to small perturbations. First, we compare the MI spectra of the asymmetric system and its symmetric counterpart in the case of the anomalous group-velocity dispersion (GVD. In particular, it is demonstrated that the increase of the inter-core linear-coupling coefficient leads to a reduction of the MI gain spectrum in the asymmetric coupler. The analysis is extended for the asymmetric system in the normal-GVD regime, where the coupling induces and controls the MI, as well as for the system with opposite GVD signs in the two cores. Following the analytical consideration of the MI, numerical simulations are carried out to explore nonlinear development of the MI, revealing the generation of periodic chains of localized peaks with growing amplitudes, which may transform into arrays of solitons.
Little, J P; Pearcy, M J; Izatt, M T; Boom, K; Labrom, R D; Askin, G N; Adam, C J
2016-02-01
Segmental biomechanics of the scoliotic spine are important since the overall spinal deformity is comprised of the cumulative coronal and axial rotations of individual joints. This study investigates the coronal plane segmental biomechanics for adolescent idiopathic scoliosis patients in response to physiologically relevant axial compression. Individual spinal joint compliance in the coronal plane was measured for a series of 15 idiopathic scoliosis patients using axially loaded magnetic resonance imaging. Each patient was first imaged in the supine position with no axial load, and then again following application of an axial compressive load. Coronal plane disc wedge angles in the unloaded and loaded configurations were measured. Joint moments exerted by the axial compressive load were used to derive estimates of individual joint compliance. The mean standing major Cobb angle for this patient series was 46°. Mean intra-observer measurement error for endplate inclination was 1.6°. Following loading, initially highly wedged discs demonstrated a smaller change in wedge angle, than less wedged discs for certain spinal levels (+2,+1,-2 relative to the apex, (pbiomechanical data on in vivo spinal biomechanics of the scoliotic spine, for analysis of deformity progression and surgical planning. Copyright © 2015 Elsevier Ltd. All rights reserved.
Supercharging an internal combustion engine by aid of a dual-rotor bi-flux axial compressor
Grǎdinariu, Andrei Cristian; Mihai, Ioan
2016-12-01
Internal combustion engines can be supercharged in order to enhance their performances [1-3]. Engine power is proportional to the quantity of fresh fluid introduced into the cylinder. At present, the general tendency is to try to obtain actual specific powers as high as possible, for as small as possible cylinder capacity, without increasing the generated pollution hazards. The present paper investigates the impact of replacing a centrifugal turbo-compressor with an axial double-rotor bi-flux one [4]. The proposed method allows that for the same number of cylinders, an increase in discharged airflow, accompanied by a decrease in fuel consumption. Using a program developed under the MathCad environment, the present work was aimed at studying the way temperature modifies at the end of isentropic compression under supercharging conditions. Taking into account a variation between extreme limits of the ambient temperature, its influence upon the evolution of thermal load coefficient was analyzed considering the air pressure at the compressor cooling system outlet. This analysis was completed by an exergetical study of the heat evacuated through cylinder walls in supercharged engine conditions. The conducted investigation allows verification of whether significant differences can be observed between an axial, dual-rotor, bi-flux compressor and centrifugal compressors.
Observation of the Earth liquid core resonance by extensometers
Bán, Dóra; Mentes, Gyula
2016-04-01
The axis of the fluid outer core of the Earth and the rotation axis of the mantle do not coincide therefore restoring forces are set up at the core-mantle boundary which try to realign the two axes causing a resonance effect. In celestial reference system it is called the "Free Core Nutation" (FCN), which can be characterized by a period of 432 days while in the Earth reference system it is called the "Nearly Diurnal Free Wobble" (NDFW). The frequency of this phenomenon is near to the diurnal tidal frequencies, especially to P1 and K1 waves. Due to its resonance effect this phenomenon can be detected also by quartz tube extensometers suitable for Earth tides recording. In this study data series measured in several extensometric stations were used to reveal the presence of the FCN resonance. In the Pannonian Basin there are five observatories where extensometric measurements were carried out in different lengths of time. Four stations in Hungary: Sopronbánfalva Geodynamical Observatory (2000-2014), Budapest Mátyáshegy Gravity and Geodynamic Observatory (2005-2012), Pécs uranium mine (1991-1999), Bakonya, near to Pécs (2004-2005) and in Slovakia: Vyhne Earth Tide Observatory (2001-2013). Identical instrumentation in different observatories provides the opportunity to compare measurements with various topography, geology and environmental parameters. The results are also compared to values inferred from extensometric measurements in other stations.
International Nuclear Information System (INIS)
Huffer, J.
2004-01-01
The purpose of this calculation is to develop axial profiles for estimating the axial variation in burnup of a boiling water reactor (BWR) assembly spent nuclear fuel (SNF) given the average burnup of an assembly. A discharged fuel assembly typically exhibits higher burnup in the center and lower burnup at the ends of the assembly. Criticality safety analyses taking credit for SNF burnup must account for axially varying burnup relative to calculations based on uniformly distributed assembly average burnup due to the under-burned tips. Thus, accounting for axially varying burnup in criticality analyses is also referred to as accounting for the ''end effect'' reactivity. The magnitude of the reactivity change due to ''end effect'' is dependent on the initial assembly enrichment, the assembly average burnup, and the particular axial profile characterizing the burnup distribution. The set of bounding axial profiles should incorporate multiple BWR core designs and provide statistical confidence (95 percent confidence that 95 percent of the population is bound by the profile) that end nodes are conservatively represented. The profiles should also conserve the overall burnup of the fuel assembly. More background on BWR axial profiles is provided in Attachment I
Enhanced antiferromagnetic coupling in dual-synthetic antiferromagnet with Co2FeAl electrodes
International Nuclear Information System (INIS)
Zhang, D.L.; Xu, X.G.; Wu, Y.; Li, X.Q.; Miao, J.; Jiang, Y.
2012-01-01
We study dual-synthetic antiferromagnets (DSyAFs) using Co 2 FeAl (CFA) Heusler electrodes with a stack structure of Ta/CFA/Ru/CFA/Ru/CFA/Ta. When the thicknesses of the two Ru layers are 0.45 nm, 0.65 nm or 0.45 nm, 1.00 nm, the CFA-based DSyAF has a strong antiferromagnetic coupling between adjacent CFA layers at room temperature with a saturation magnetic field of ∼11,000 Oe, a saturation magnetization of ∼710 emu/cm 3 and a coercivity of ∼2.0 Oe. Moreover, the DSyAF has a good thermal stability up to 400 °C, at which CFA films show B2-ordered structure. Therefore, the CFA-based DSyAFs are favorable for applications in future spintronic devices. - Graphical abstract: Display Omitted Highlights: ► Co 2 FeAl can be applied in room temperature dual-synthetic antiferromagnets. ► Co 2 FeAl dual-synthetic antiferromagnets have a good thermal stability up to 400 °C. ► The Co 2 FeAl has B2-ordered structure in annealed dual-synthetic antiferromagnets.
Curilla, L.; Astrauskas, I.; Pugzlys, A.; Stajanca, P.; Pysz, D.; Uherek, F.; Baltuska, A.; Bugar, I.
2018-05-01
We demonstrate ultrafast soliton-based nonlinear balancing of dual-core asymmetry in highly nonlinear photonic crystal fiber at sub-nanojoule pulse energy level. The effect of fiber asymmetry was studied experimentally by selective excitation and monitoring of individual fiber cores at different wavelengths between 1500 nm and 1800 nm. Higher energy transfer rate to non-excited core was observed in the case of fast core excitation due to nonlinear asymmetry balancing of temporal solitons, which was confirmed by the dedicated numerical simulations based on the coupled generalized nonlinear Schrödinger equations. Moreover, the simulation results correspond qualitatively with the experimentally acquired dependences of the output dual-core extinction ratio on excitation energy and wavelength. In the case of 1800 nm fast core excitation, narrow band spectral intensity switching between the output channels was registered with contrast of 23 dB. The switching was achieved by the change of the excitation pulse energy in sub-nanojoule region. The performed detailed analysis of the nonlinear balancing of dual-core asymmetry in solitonic propagation regime opens new perspectives for the development of ultrafast nonlinear all-optical switching devices.
Dual-band reflective polarization converter based on slotted wire resonators
Li, Fengxia; Zhang, Linbo; Zhou, Peiheng; Chen, Haiyan; Zhao, Rui; Zhou, Yang; Liang, Difei; Lu, Haipeng; Deng, Longjiang
2018-02-01
A dual-band and high-efficiency reflective linear polarization converter composed of a layer of slotted metal wires has been proposed. Both the simulated and experimental results indicate that the structure can convert a linearly polarized wave to its cross-polarized state for two distinct frequency bands under normal incidence: 9.8-15.1 and 19.2-25.7 GHz. This phenomenon is attributed to a resonance that corresponds to the "trapped mode" at 15.8 GHz. This mode is stable with structural parameters and incident angle at a relatively wide range, and thus becomes promising for dual-band (also multiband) devices design. By surface current distribution and electric field analysis, the operation mechanism has been illuminated, especially for the "trapped mode", identified by the equally but also oppositely directed currents in each unit cell.
Valenti, Giovanni; Boni, Alessandro; Melchionna, Michele; Cargnello, Matteo; Nasi, Lucia; Bertoni, Giovanni; Gorte, Raymond J.; Marcaccio, Massimo; Rapino, Stefania; Bonchio, Marcella; Fornasiero, Paolo; Prato, Maurizio; Paolucci, Francesco
2016-12-01
Considering the depletion of fossil-fuel reserves and their negative environmental impact, new energy schemes must point towards alternative ecological processes. Efficient hydrogen evolution from water is one promising route towards a renewable energy economy and sustainable development. Here we show a tridimensional electrocatalytic interface, featuring a hierarchical, co-axial arrangement of a palladium/titanium dioxide layer on functionalized multi-walled carbon nanotubes. The resulting morphology leads to a merging of the conductive nanocarbon core with the active inorganic phase. A mechanistic synergy is envisioned by a cascade of catalytic events promoting water dissociation, hydride formation and hydrogen evolution. The nanohybrid exhibits a performance exceeding that of state-of-the-art electrocatalysts (turnover frequency of 15000 H2 per hour at 50 mV overpotential). The Tafel slope of ~130 mV per decade points to a rate-determining step comprised of water dissociation and formation of hydride. Comparative activities of the isolated components or their physical mixtures demonstrate that the good performance evolves from the synergistic hierarchical structure.
Directory of Open Access Journals (Sweden)
Sun Rong
2013-08-01
Full Text Available Equatorial flattening of the core were previously estimated to be 5 × 10−4 by using seismically derived density anomaly, and 1.7748280 × 10−5 by assuming that the ratio of polar flattening to equatorial flattening of the core is the same as that of the whole Earth. In this study, we attempted to explain the difference by applying a density-contrast stripping process to the crust in the second method. We use the CRUST2.0 model to estimate the inertia-moment contribution resulted from the density-contrast structure in the crust to a tri-axial Earth. The contribution of the density contrast in the crust was removed layer by layer. The layers include topography, bathymetry, ice, soft sediment, hard sediment, upper crust, middle crust, lower crust and the reference crust. For the boundaries of the topography and bathymetry layers, we used ETOPO5 values with a resolution of 5'. For boundaries of other layers, we used values from the CRUST2.0 model with a resolution of 2°. After the contribution of density contrast is stripped, the equatorial flattening of the core was found to be 6.544 × 10−5, which is still one order of magnitude smaller than the result given by the first method. This suggests that at least one of the methods is not correct. The influence of the uncertainty in the equatorial flattening of the core on the Free Core Nutation frequency is small, but its effect on the gravitational torque acting on the tri-axial inner core cannot be ignored. So an accurate determination of the equatorial flattening of the core is still necessary.
The Co59 nuclear magnetic resonances in (Ysub(1-x)Gdsub(x))2Co17
International Nuclear Information System (INIS)
Nagai, Hiroyuki; Yoshie, Hiroshi; Unate, Takao; Tsujimura, Akira; Deportes, J.
1976-01-01
The nuclear magnetic resonances of Co 59 in (Ysub(1-x)Gdsub(x)) 2 Co 17 have been observed at 77 K as a function of x (0 2 Co 17 and Gd 2 Co 17 is at most 7 kOe in magnitude, which is comparable to that obtained in GdCo 5 . The sign of the obtained difference depends on the Co sites. The difference is qualitatively explained as the contribution of 4f electrons of Gd atoms to the hyperfine field. The temperature dependence of the resonance frequencies in Gd 2 Co 17 has also been measured. (auth.)
Watson, Brett; Yeo, Leslie; Friend, James
2010-06-01
Making use of mechanical resonance has many benefits for the design of microscale devices. A key to successfully incorporating this phenomenon in the design of a device is to understand how the resonant frequencies of interest are affected by changes to the geometric parameters of the design. For simple geometric shapes, this is quite easy, but for complex nonlinear designs, it becomes significantly more complex. In this paper, two novel modeling techniques are demonstrated to extract the axial and torsional resonant frequencies of a complex nonlinear geometry. The first decomposes the complex geometry into easy to model components, while the second uses scaling techniques combined with the finite element method. Both models overcome problems associated with using current analytical methods as design tools, and enable a full investigation of how changes in the geometric parameters affect the resonant frequencies of interest. The benefit of such models is then demonstrated through their use in the design of a prototype piezoelectric ultrasonic resonant micromotor which has improved performance characteristics over previous prototypes.
Assessment of CO2 Storage Potential in Naturally Fractured Reservoirs With Dual-Porosity Models
March, Rafael; Doster, Florian; Geiger, Sebastian
2018-03-01
Naturally Fractured Reservoirs (NFR's) have received little attention as potential CO2 storage sites. Two main facts deter from storage projects in fractured reservoirs: (1) CO2 tends to be nonwetting in target formations and capillary forces will keep CO2 in the fractures, which typically have low pore volume; and (2) the high conductivity of the fractures may lead to increased spatial spreading of the CO2 plume. Numerical simulations are a powerful tool to understand the physics behind brine-CO2 flow in NFR's. Dual-porosity models are typically used to simulate multiphase flow in fractured formations. However, existing dual-porosity models are based on crude approximations of the matrix-fracture fluid transfer processes and often fail to capture the dynamics of fluid exchange accurately. Therefore, more accurate transfer functions are needed in order to evaluate the CO2 transfer to the matrix. This work presents an assessment of CO2 storage potential in NFR's using dual-porosity models. We investigate the impact of a system of fractures on storage in a saline aquifer, by analyzing the time scales of brine drainage by CO2 in the matrix blocks and the maximum CO2 that can be stored in the rock matrix. A new model to estimate drainage time scales is developed and used in a transfer function for dual-porosity simulations. We then analyze how injection rates should be limited in order to avoid early spill of CO2 (lost control of the plume) on a conceptual anticline model. Numerical simulations on the anticline show that naturally fractured reservoirs may be used to store CO2.
Directory of Open Access Journals (Sweden)
Li Guo
2018-06-01
Full Text Available In this paper, a circular polarizer comprising dual semicircular split-rings (DSSRs is presented. By placing it above an elliptical radiator that radiates linearly polarized (LP waves, dual-layer patch antennas capable of radiating right-hand (RH or left-hand (LH circularly polarized (CP waves are achieved in terms of the different offset direction of the bottom splits of the DSSRs. Because of both the capacitive coupling to the radiator and the degenerate modes existing in the excited DSSRs, the DSSRs collaboratively result in a circularly polarized radiation, successfully converting incident LP waves into CP ones. Simulated results show that the impedance, axial ratio (AR, and gain frequency response of both proposed CP antennas are identical, with a simulated 3-dB AR bandwidth of 72 MHz covering 2.402–2.474 GHz and a gain enhanced by 3.9 dB. The proposed antennas were fabricated and measured, revealing an operational bandwidth of 65 MHz (2.345–2.41 GHz and a peak gain up to 9 dBi. Moreover, a low profile of 0.063λ0 is maintained. The proposed CP antennas could be as a candidate for wireless target detection applications in terms of their identical frequency response property.
Mastery of Content Representation (CoRes) Related TPACK High School Biology Teacher
Nasution, W. R.; Sriyati, S.; Riandi, R.; Safitri, M.
2017-09-01
The purpose of this study was to determine the mastery of Content Representation (CoRes) teachers related to the integration of technology and pedagogy in teaching Biology (TPACK). This research uses a descriptive method. The data were taken using instruments CoRes as the primary data and semi-structured interviews as supporting data. The subjects were biology teacher in class X MIA from four schools in Bandung. Teachers raised CoRes was analyzed using a scoring rubric CoRes with coding 1-3 then categorized into a group of upper, middle, or lower. The results showed that the two teachers in the lower category. This results means that the control of teachers in defining the essential concept in the CoRes has not been detailed and specific. Meanwhile, two other teachers were in the middle category. This means that the ability of teachers to determine the essential concepts in the CoRes are still inadequate so that still needs to be improved.
Xenon-induced axial power oscillations in the 400 MW PBMR
International Nuclear Information System (INIS)
Strydom, Gerhard
2008-01-01
The redistribution of the spatial xenon concentration in the 400 MW Pebble Bed Modular Reactor (PBMR) core has a non-linear, time-dependent feedback effect on the spatial power density during several types of operational transient events. Due to the inherent weak coupling that exists between the iodine and xenon formation and destruction rates, as well as the complicating effect of spatial variance in the thermal flux field, reactor cores have been analyzed for a number of decades for the occurrence and severity of xenon-induced axial power oscillations. Of specific importance is the degree of oscillation damping exhibited by the core during transients, which involves axial variations in the local power density. In this paper the TINTE reactor dynamics code is used to assess the stability of the current 400 MW PBMR core design with regard to axial xenon oscillations. The focus is mainly on the determination of the inherent xenon and power oscillation damping properties by utilizing a set of hypothetical control rod insertion transients at various power levels. The oscillation damping properties of two 100%-50%-100% load-follow transients, one of which includes the de-stabilizing axial effects of moving control rods, are also discussed in some detail. The study shows that, although first axial mode oscillations do occur in the 400 MW PBMR core, the inherent damping of these oscillations is high, and that none of the investigated load-follow transients resulted in diverging oscillations. It is also shown that the PBMR core exhibits no radial oscillation components for these xenon-induced axial power oscillations
Amaritsakul, Yongyut; Chao, Ching-Kong; Lin, Jinn
2014-09-01
Pedicle screws are used for treating several types of spinal injuries. Although several commercial versions are presently available, they are mostly either fully cylindrical or fully conical. In this study, the bending strengths of seven types of commercial pedicle screws and a newly designed double dual core screw were evaluated by finite element analyses and biomechanical tests. All the screws had an outer diameter of 7 mm, and the biomechanical test consisted of a cantilever bending test in which a vertical point load was applied using a level arm of 45 mm. The boundary and loading conditions of the biomechanical tests were applied to the model used for the finite element analyses. The results showed that only the conical screws with fixed outer diameter and the new double dual core screw could withstand 1,000,000 cycles of a 50-500 N cyclic load. The new screw, however, exhibited lower stiffness than the conical screw, indicating that it could afford patients more flexible movements. Moreover, the new screw produced a level of stability comparable to that of the conical screw, and it was also significantly stronger than the other screws. The finite element analysis further revealed that the point of maximum tensile stress in the screw model was comparable to the point at which fracture occurred during the fatigue test. Copyright © 2014 IPEM. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Chen, Jia Nen; Liu, Jun [Tianjin Key Laboratory of the Design and Intelligent Control of the Advanced Mechatronical System, Tianjin University of Technology, Tianjin (China); Zhang, Wei; Yao, Ming Hui [College of Mechanical Engineering, Beijing University of Technology, Beijing (China); Sun, Min [School of Science, Tianjin Chengjian University, Tianjin (China)
2016-09-15
Nonlinear vibrations of carbon fiber reinforced composite sandwich plate with pyramidal truss core are investigated. The governing equation of motion for the sandwich plate is derived by using a Zig-Zag theory under consideration of geometrically nonlinear. The natural frequencies of sandwich plates with different dimensions are calculated and compared with those obtained from the classic laminated plate theory and Reddy's third-order shear deformation plate theory. The frequency responses and waveforms of the sandwich plate when 1:3 internal resonance occurs are obtained, and the characteristics of the internal resonance are discussed. The influences of layer number of face sheet, strut radius, core height and inclination angle on the nonlinear responses of the sandwich plate are analyzed. The results demonstrate that the strut radius and inclination angle mainly affect the resonance frequency band of the sandwich plate, and the layer number and core height not only influence the resonance frequency band but also significantly affect the response amplitude.
Label-free biosensing with high sensitivity in dual-core microstructured polymer optical fibers
DEFF Research Database (Denmark)
Markos, Christos; Yuan, Wu; Vlachos, Kyriakos
2011-01-01
We present experimentally feasible designs of a dual-core microstructured polymer optical fiber (mPOF), which can act as a highly sensitive, label-free, and selective biosensor. An immobilized antigen sensing layer on the walls of the holes in the mPOF provides the ability to selectively capture...
A dual resonance model for high energy electroweak reactions
International Nuclear Information System (INIS)
Picard, Jean-Francois
1995-01-01
The aim of this work is to propose an original model for the weak interaction at high energy (about 1 TeV) that is inspired from resonance dual models established for hadron physics. The first chapter details the basis and assumptions of the standard model. The second chapter deals with various scenarios that go beyond the standard model and that involve a strong interaction and a perturbative approach to assess coupling. The third chapter is dedicated to the main teachings of hadron physics concerning resonances, the model of Regge poles and the concept of duality. We present our new model in the fourth chapter, we build a scenario in which standard fermions and the 3 massive gauge bosons would have a sub-structure alike that of hadrons. In order to give non-null values to the width of resonances we use the K matrix method, we describe this method in the last chapter and we apply it for the computation of the width of the Z 0 boson. Our model predicts a large spectra of states particularly with the 143-up-lets of ff-bar states. The K matrix method has allowed us to compute amplitudes for helicity, then to collapse them in amplitudes invariant with SU(2) and to project these amplitudes in partial waves of helicity. For most resonances partial widths are very low compared to their mass
Thermodynamic analysis of a new dual evaporator CO2 transcritical refrigeration cycle
Abdellaoui, Ezzaalouni Yathreb; Kairouani, Lakdar Kairouani
2017-03-01
In this work, a new dual-evaporator CO2 transcritical refrigeration cycle with two ejectors is proposed. In this new system, we proposed to recover the lost energy of condensation coming off the gas cooler and operate the refrigeration cycle ejector free and enhance the system performance and obtain dual-temperature refrigeration simultaneously. The effects of some key parameters on the thermodynamic performance of the modified cycle are theoretically investigated based on energetic and exergetic analysis. The simulation results for the modified cycle indicate more effective system performance improvement than the single ejector in the CO2 vapor compression cycle using ejector as an expander ranging up to 46%. The exergetic analysis for this system is made. The performance characteristics of the proposed cycle show its promise in dual-evaporator refrigeration system.
Thermodynamic analysis of a new dual evaporator CO2 transcritical refrigeration cycle
Directory of Open Access Journals (Sweden)
Abdellaoui Ezzaalouni Yathreb
2017-03-01
Full Text Available In this work, a new dual-evaporator CO2 transcritical refrigeration cycle with two ejectors is proposed. In this new system, we proposed to recover the lost energy of condensation coming off the gas cooler and operate the refrigeration cycle ejector free and enhance the system performance and obtain dual-temperature refrigeration simultaneously. The effects of some key parameters on the thermodynamic performance of the modified cycle are theoretically investigated based on energetic and exergetic analysis. The simulation results for the modified cycle indicate more effective system performance improvement than the single ejector in the CO2 vapor compression cycle using ejector as an expander ranging up to 46%. The exergetic analysis for this system is made. The performance characteristics of the proposed cycle show its promise in dual-evaporator refrigeration system.
Li, Na; Takagaki, Tomohiro; Sadr, Alireza; Waidyasekera, Kanchana; Ikeda, Masaomi; Chen, Jihua; Nikaido, Toru; Tagami, Junji
2011-12-01
To evaluate the microtensile bond strength (μTBS) and acid-base resistant zone (ABRZ) of two dualcuring core systems to dentin using four curing modes. Sixty-four caries-free human molars were randomly divided into two groups according to two dual-curing resin core systems: (1) Clearfil DC Core Automix; (2) Estelite Core Quick. For each core system, four different curing modes were applied to the adhesive and core resin: (1) dual-cured and dual-cured (DD); (2) chemically cured and dual-cured (CD); (3) dual-cured and chemically cured (DC); (4) chemically cured and chemically cured (CC). The specimens were sectioned into sticks (n = 20 for each group) for the microtensile bond test. μTBS data were analyzed using two-way ANOVA and the Dunnett T3 test. Failure patterns were examined with scanning electron microscopy (SEM) to determine the proportion of each mode. Dentin sandwiches were produced and subjected to an acid-base challenge. After argon-ion etching, the ultrastructure of ABRZ was observed using SEM. For Clearfil DC Core Automix, the μTBS values in MPa were as follows: DD: 29.1 ± 5.4, CD: 21.6 ± 5.6, DC: 17.9 ± 2.8, CC: 11.5 ± 3.2. For Estelite Core Quick, they were: DD: 48.9 ±5.7, CD: 20.5 ± 4.7, DC: 41.4 ± 8.3, CC: 19.1 ± 6.0. The bond strength was affected by both material and curing mode, and the interaction of the two factors was significant (p < 0.001). Within both systems, there were significant differences among groups, and the DD group showed the highest μTBS (p < 0.05). ABRZ morphology was not affected by curing mode, but it was highly adhesive-material dependent. The curing mode of dual-curing core systems affects bond strength to dentin, but has no significant effect on the formation of ABRZ.
Reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning.
Song, Ying; Zhu, Zhen; Lu, Yang; Liu, Qiegen; Zhao, Jun
2014-03-01
To improve the magnetic resonance imaging (MRI) data acquisition speed while maintaining the reconstruction quality, a novel method is proposed for multislice MRI reconstruction from undersampled k-space data based on compressed-sensing theory using dictionary learning. There are two aspects to improve the reconstruction quality. One is that spatial correlation among slices is used by extending the atoms in dictionary learning from patches to blocks. The other is that the dictionary-learning scheme is used at two resolution levels; i.e., a low-resolution dictionary is used for sparse coding and a high-resolution dictionary is used for image updating. Numerical experiments are carried out on in vivo 3D MR images of brains and abdomens with a variety of undersampling schemes and ratios. The proposed method (dual-DLMRI) achieves better reconstruction quality than conventional reconstruction methods, with the peak signal-to-noise ratio being 7 dB higher. The advantages of the dual dictionaries are obvious compared with the single dictionary. Parameter variations ranging from 50% to 200% only bias the image quality within 15% in terms of the peak signal-to-noise ratio. Dual-DLMRI effectively uses the a priori information in the dual-dictionary scheme and provides dramatically improved reconstruction quality. Copyright © 2013 Wiley Periodicals, Inc.
Sound Transmission Loss Through a Corrugated-Core Sandwich Panel with Integrated Acoustic Resonators
Schiller, Noah H.; Allen, Albert R.; Zalewski, Bart F; Beck, Benjamin S.
2014-01-01
The goal of this study is to better understand the effect of structurally integrated resonators on the transmission loss of a sandwich panel. The sandwich panel has facesheets over a corrugated core, which creates long aligned chambers that run parallel to the facesheets. When ports are introduced through the facesheet, the long chambers within the core can be used as low-frequency acoustic resonators. By integrating the resonators within the structure they contribute to the static load bearing capability of the panel while also attenuating noise. An analytical model of a panel with embedded resonators is derived and compared with numerical simulations. Predictions show that acoustic resonators can significantly improve the transmission loss of the sandwich panel around the natural frequency of the resonators. In one configuration with 0.813 m long internal chambers, the diffuse field transmission loss is improved by more than 22 dB around 104 Hz. The benefit is achieved with no added mass or volume relative to the baseline structure. The embedded resonators are effective because they radiate sound out-of-phase with the structure. This results in destructive interference, which leads to less transmitted sound power.
Energy Technology Data Exchange (ETDEWEB)
Savander, V. I.; Shumskiy, B. E., E-mail: borisshumskij@yandex.ru [National Research Nuclear University MEPhI (Russian Federation); Pinegin, A. A. [National Research Center Kurchatov Institute (Russian Federation)
2016-12-15
The possibility of decreasing the vapor fraction at the VVER-1200 fuel assembly outlet by shaping the axial power density field is considered. The power density field was shaped by axial redistribution of the concentration of the burnable gadolinium poison in the Gd-containing fuel rods. The mathematical modeling of the VVER-1200 core was performed using the NOSTRA computer code.
Directory of Open Access Journals (Sweden)
Javier Tomás-Juan
2015-04-01
Full Text Available Presbyopia occurs in the aging eye due to changes in the ciliary muscle, zonular fibers, crystalline lens, and an increased lens sclerosis. As a consequence, the capacity of accommodation decreases, which hampers to focus near objects. With the aim of restoring near vision, different devices that produce multiple focuses have been developed and introduced. However, these devices are still unable to restore accommodation. In order to achieve that goal, dual-optic accommodating Intraocular Lenses have been designed, whose anterior optic displaces axially to increase ocular power, and focus near objects. Although dual-optic accommodating IOLs are relatively new, their outcomes are promising, as they provide large amplitudes of accommodation and a greater IOL displacement than single-optic accommodating IOLs. The outcomes show comfortable near vision, higher patients’ satisfaction rates, and minimal postoperative complications like Posterior Capsular Opacification and Anterior Capsular Opacification, due to their design and material.
GR712RC- Dual-Core Processor- Product Status
Sturesson, Fredrik; Habinc, Sandi; Gaisler, Jiri
2012-08-01
The GR712RC System-on-Chip (SoC) is a dual core LEON3FT system suitable for advanced high reliability space avionics. Fault tolerance features from Aeroflex Gaisler’s GRLIB IP library and an implementation using Ramon Chips RadSafe cell library enables superior radiation hardness.The GR712RC device has been designed to provide high processing power by including two LEON3FT 32- bit SPARC V8 processors, each with its own high- performance IEEE754 compliant floating-point-unit and SPARC reference memory management unit.This high processing power is combined with a large number of serial interfaces, ranging from high-speed links for data transfers to low-speed control buses for commanding and status acquisition.
Starch/PCL composite nanofibers by co-axial electrospinning technique for biomedical applications.
Komur, B; Bayrak, F; Ekren, N; Eroglu, M S; Oktar, F N; Sinirlioglu, Z A; Yucel, S; Guler, O; Gunduz, O
2017-03-29
In this study, starch and polycaprolactone (PCL), composite nanofibers were fabricated by co-axial needle electrospinning technique. Processing parameters such as polymer concentration, flow rate and voltage had a marked influence on the composite fiber diameter. Fourier transform infrared spectroscopy, scanning electron microscopy (SEM), mechanical and physical properties (such as density, viscosity and electrical conductivity) of the composite fibres were evaluated. Moreover, a cell culture test was performed in order to determine their cytotoxicity for wound dressing application. The effect of starch ratio in the solution on the properties and morphological structure of the fibers produced was presented. With lower starch concentration values, the fibers have greater ultimate tensile strength characteristic (mostly 4 and 5 wt%). According to SEM results, it can be figured out that the nanofibers fabricated have good spinnability and morphology. The mean diameter of the fibers is about 150 nm. According to results of cell culture study, the finding can be determined that the increase of starch in the fiber also increases the cell viability. Composite nanofibers of starch/PCL have been prepared using a co-axial needle electrospinning technique. PCL was successfully encapsulated within starch. Fiber formation was observed for different ratio of starch. With several test, analysis and measurement performed, some important parameters such as quality and effectuality of each fiber obtained for wound dressing applications were discussed in detail.
Thin Co films with tunable ferromagnetic resonance frequency
International Nuclear Information System (INIS)
Maklakov, Sergey S.; Maklakov, Sergey A.; Ryzhikov, Ilya A.; Rozanov, Konstantin N.; Osipov, Alexey V.
2012-01-01
The tailored production of thin Co films of 50 nm thick with ferromagnetic resonance frequency in a range from 2.9 to 7.3 GHz using the DC magnetron sputtering is reported. The ferromagnetic resonance frequency, coercivity, effective magnetic field and nanocrystalline structure parameters are shown to be governed by the Co deposition rate. For this investigation, FMR, VSM and TEM techniques were used. - Highlights: ► Thin Co films with FMR frequency in a range from 2.9 to 7.3 GHz are obtained. ► The films' properties are governed by the deposition rate during DC magnetron sputtering. ► FMR, VSM and TEM techniques were used during the study.
Analysis of a basic core performance for FBR core nuclear design. 3
International Nuclear Information System (INIS)
Kaneko, Kunio
1999-03-01
The spatial distribution of reaction rates in the ZPPR-13A, having an axially heterogeneous core, has been analyzed. The ZPPR-13A core is treated as a 2-dimensional RZ configuration consisting of a homogeneous core. The analysis is performed by utilizing both probabilistic and deterministic treatments. The probabilistic treatment is performed with the Monte Carlo Code MVP running with continuous energy variable. By comparing the results obtained by both treatments and reviewing the calculation method of effective resonance cross sections, for deterministic treatment, utilized for the reaction rate distributions, it is revealed that the present treatment of effective resonance cross sections is not accurate, since there are observed effects due to dependence on energy group number or energy group width, and on anisotropic scattering. To utilize multi-band method for calculating effective resonance cross sections, widely used by the European researchers, the computer code GROUPIE is installed and the performance of the code is confirmed. Although, in order to improve effective resonance cross sections accuracy, the thermal neutron reactor standard code system SRAC-95 was introduced last year in which the ultra-fine group spectrum calculation module PEACO worked specially under the restriction that number of nuclei having resonance cross section, in any zone, should be less than three, because collision probabilities were obtained by an interpolation method. This year, the module is improved so that these collision probabilities are directly calculated, and by this improvement the highly accurate effective resonance cross sections below the energy of 40.868 keV can be calculated for whole geometrical configurations considered. To extend the application range of the module PEACO, the cross sections of sodium and structure material nuclei are prepared so that they are also represented as ultra-fine group cross sections. By such modifications of cross section library
The effects of initial rise and axial loads on MEMS arches
Tella, Sherif Adekunle
2017-04-07
Arch microbeams have been utilized and proposed for many uses over the past few years due to their large tunability and bistability. However, recent experimental data have shown different mechanical behavior of arches when subjected to axial loads. This paper aims to investigate in depth the influence of the competing effects of initial rise and axial loads on the mechanical behavior of micromachined arches; mainly their static deflection and resonant frequencies. Based on analytical solutions, the static response and eigenvalue problems are analyzed for various values of initial rises and axial loads. Universal curves showing the variation of the first three resonance frequencies of the arch are generated for various values of initial rise under both tensile and compressive axial loads. This study shows that increasing the tensile or compressive axial loads for different values of initial rise may lead to either increase in the stiffness of the beam or initial decrease in the stiffness, which later increases as the axial load is increased depending on the dominant effect of the initial rise of the arch and the axial load. The obtained universal curves represent useful design tools to predict the tunability of arches under axial loads for various values of initial rises. The use of the universal curves is demonstrated with an experimental case study. Analytical formulation is developed to predict the point of minimum where the trend of the resonance frequency versus axial loads changes qualitatively due to the competing effects of axial loads and initial curvature.
Laterally Driven Resonant Pressure Sensor with Etched Silicon Dual Diaphragms and Combined Beams
Directory of Open Access Journals (Sweden)
Xiaohui Du
2016-01-01
Full Text Available A novel structure of the resonant pressure sensor is presented in this paper, which tactfully employs intercoupling between dual pressure-sensing diaphragms and a laterally driven resonant strain gauge. After the resonant pressure sensor principle is introduced, the coupling mechanism of the diaphragms and resonator is analyzed and the frequency equation of the resonator based on the triangle geometry theory is developed for this new coupling structure. The finite element (FE simulation results match the theoretical analysis over the full scale of the device. This pressure sensor was first fabricated by dry/wet etching and thermal silicon bonding, followed by vacuum-packaging using anodic bonding technology. The test maximum error of the fabricated sensor is 0.0310%F.S. (full scale in the range of 30 to 190 kPa, its pressure sensitivity is negative and exceeding 8 Hz/kPa, and its Q-factor reaches 20,000 after wafer vacuum-packaging. A novel resonant pressure sensor with high accuracy is presented in this paper.
Rudwaleit, M.; Jurik, A. G.; Hermann, K.-G. A.; Landewé, R.; van der Heijde, D.; Baraliakos, X.; Marzo-Ortega, H.; Ostergaard, M.; Braun, J.; Sieper, J.
2009-01-01
Magnetic resonance imaging (MRI) of sacroiliac joints has evolved as the most relevant imaging modality for diagnosis and classification of early axial spondyloarthritis (SpA) including early ankylosing spondylitis. To identify and describe MRI findings in sacroiliitis and to reach consensus on
Core concepts for ''zero-sodium-void-worth core'' in metal fuelled fast reactor
International Nuclear Information System (INIS)
Chang, Y.I.; Hill, R.N.; Fujita, E.K.; Wade, D.C.; Kumaoka, Y.; Suzuki, M.; Kawashima, M.; Nakagawa, H.
1991-01-01
Core design options to reduce the sodium void worth in metal fueled LMRs are investigated. Two core designs which achieve a zero sodium void worth are analyzed in detail. The first design is a ''pancaked'' and annular core with enhanced transuranic burning capabilities; the high leakage in this design yields a low breeding ratio and small void worth. The second design is an axially multilayered annular core which is fissile self-sufficient; in this design, the upper and lower core regions are neutronically decoupled for reduced void worth while fissile self-sufficiency is achieved using internal axial blankets plus external radial and axial blanket zones. The neutronic performance characteristics of these low void worth designs are assessed here; their passive safety properties are discussed in a companion paper. 16 refs., 2 figs., 3 tabs
Core concepts for 'zero-sodium-void-worth core' in metal fuelled fast reactor
International Nuclear Information System (INIS)
Chang, Y.I.; Hill, R.N.; Fujita, E.K.; Wade, D.C.; Kumaoka, Y.; Suzuki, M.; Kawashima, M.; Nakagawa, H.
1991-01-01
Core design options to reduce the sodium void worth in metal fuelled LMRs are investigated. Two core designs which achieve a zero sodium void worth are analyzed in detail. The first design is a 'pancaked' and annular core with enhanced transuranic burning capabilities; the high leakage in this design yields a low breeding ratio and small void worth. The second design is an axially multilayered annular core which is fissile self-sufficient; in this design, the upper and lower core regions are neutronically decoupled for reduced void worth while fissile self-sufficiency is achieved using internal axial blankets plus external radial and axial blanket-zones. The neutronic performance characteristics of these low void worth designs are assessed here; their passive safety properties are discussed in a companion paper. (author)
Multi-core MgO NPs(at)C core-shell nanospheres for selective CO2 capture under mild conditions
International Nuclear Information System (INIS)
Tae Kyung Kim; Kyung Joo Lee; Hoi Ri Moon; Junhan Yuh; Sang Kyu Kwak
2014-01-01
The core-shell structures have attracted attention in catalysis, because the outer shells isolate the catalytically active NP cores and prevent the possibility of sintering of core particles during catalytic reaction under physically and chemically harsh conditions. We aimed to adopt this core-shell system for CO 2 sorption materials. In this study, a composite material of multi-core 3 nm-sized magnesium oxide nanoparticles embedded in porous carbon nanospheres (MgO NPs(at)C) was synthesized by a gas phase reaction via a solvent-free process. It showed selective CO 2 adsorption capacity over N 2 under mild regeneration conditions. (authors)
Tian, Yu; Zhang, Jing; Liu, Si-Si; Yang, Shengyang; Yin, Su-Na; Wang, Cai-Feng; Chen, Li; Chen, Su
2016-07-01
An operable strategy for the construction of dual-reflex optical code materials from bilayer or Janus-structure colloidal photonic crystals (CPCs) has been established in this work. In this process, monodispersed submicrometer polystryene@poly(2-hydroxyethyl methacrylate-co-acrylic acid) hydrogel microspheres with soft-shell/hard-core structure and monodispersed colloidal silica spheres were fabricated. These two kinds of colloidal units can be facilely integrated into a single material without optical signal interference because they are well isolated for the immiscibility between water and ethoxylated trimethylolpropane triacrylate (TMPTA) and the upper layer of SiO2-TMPTA is a kind of transparent. Moreover, diverse optical code series with different dual photonic bandgaps can be obtained via tuning the colloid sizes. Compared to the conventional single-reflex CPCs, the as-prepared dual-reflex optical code materials represented high information capacity in encoding process. More interesting, delicate code pattern has been also achieved on the optical film via the silk-screen printing technique, which will greatly extend the dual-reflex optical code materials to practical uses in areas containing bio-encoding, anti-counterfeiting, and flexible displays.
Adjustable ferromagnetic resonance frequency in CoO/CoFeB system
Energy Technology Data Exchange (ETDEWEB)
Bonneau-Brault, A. [CEA Le Ripault, BP16, 37260 Monts (France); GREMAN, CNRS UMR 7347, University of Tours, 37200 Tours (France); Dubourg, S. [CEA Le Ripault, BP16, 37260 Monts (France); Thiaville, A. [LPS, CNRS UMR 8502, University of Paris-Sud, 91405 Orsay Cedex (France); Rioual, S. [LMB EA4522, University of Brest, 6 av. Le Gorgeu, 29238 Brest Cedex 3 (France); Valente, D. [GREMAN, CNRS UMR 7347, University of Tours, 37200 Tours (France)
2015-01-21
Static and dynamic properties of (CoO/CoFeB){sub n} multilayers have been investigated. An anisotropy field enhancement was evidenced when the CoO layer was deposited under the CoFeB layer. Tuning the relative CoFeB and CoO layers thicknesses, high ferromagnetic resonance frequencies up to 4 GHz were achieved. The coupling effect between the CoO and CoFeB layers was induced by a dipolar coupling due to the anisotropic roughness topology of the CoO layer. This anisotropic roughness was induced by the deposition geometry and evidenced by atomic force microscopy. The strength of the dipolar interfacial coupling was calculated thanks to Schlömann's model. Multilayer stacks were fabricated and the magnetic properties observed for the trilayers could be maintained.
Adjustable ferromagnetic resonance frequency in CoO/CoFeB system
International Nuclear Information System (INIS)
Bonneau-Brault, A.; Dubourg, S.; Thiaville, A.; Rioual, S.; Valente, D.
2015-01-01
Static and dynamic properties of (CoO/CoFeB) n multilayers have been investigated. An anisotropy field enhancement was evidenced when the CoO layer was deposited under the CoFeB layer. Tuning the relative CoFeB and CoO layers thicknesses, high ferromagnetic resonance frequencies up to 4 GHz were achieved. The coupling effect between the CoO and CoFeB layers was induced by a dipolar coupling due to the anisotropic roughness topology of the CoO layer. This anisotropic roughness was induced by the deposition geometry and evidenced by atomic force microscopy. The strength of the dipolar interfacial coupling was calculated thanks to Schlömann's model. Multilayer stacks were fabricated and the magnetic properties observed for the trilayers could be maintained
Peng, Yung-Kang; Lui, Cathy N. P.; Chen, Yu-Wei; Chou, Shang-Wei; Chou, Pi-Tai; Yung, Ken K. L.; Edman Tsang, S. C.
2018-01-01
Tagging recognition group(s) on superparamagnetic iron oxide is known to aid localisation (imaging), stimulation and separation of biological entities using magnetic resonance imaging (MRI) and magnetic agitation/separation (MAS) techniques. Despite the wide applicability of iron oxide nanoparticles in T 2-weighted MRI and MAS, the quality of the images and safe manipulation of the exceptionally delicate neural cells in a live brain are currently the key challenges. Here, we demonstrate the engineered manganese oxide clusters-iron oxide core-shell nanoparticle as an MR dual-modal contrast agent for neural stem cells (NSCs) imaging and magnetic manipulation in live rodents. As a result, using this engineered nanoparticle and associated technologies, identification, stimulation and transportation of labelled potentially multipotent NSCs from a specific location of a live brain to another by magnetic means for self-healing therapy can therefore be made possible.
Tomás-Juan, Javier; Murueta-Goyena Larrañaga, Ane
2015-01-01
Presbyopia occurs in the aging eye due to changes in the ciliary muscle, zonular fibers, crystalline lens, and an increased lens sclerosis. As a consequence, the capacity of accommodation decreases, which hampers to focus near objects. With the aim of restoring near vision, different devices that produce multiple focuses have been developed and introduced. However, these devices are still unable to restore accommodation. In order to achieve that goal, dual-optic accommodating Intraocular Lenses have been designed, whose anterior optic displaces axially to increase ocular power, and focus near objects. Although dual-optic accommodating IOLs are relatively new, their outcomes are promising, as they provide large amplitudes of accommodation and a greater IOL displacement than single-optic accommodating IOLs. The outcomes show comfortable near vision, higher patients' satisfaction rates, and minimal postoperative complications like Posterior Capsular Opacification and Anterior Capsular Opacification, due to their design and material. Copyright © 2014. Published by Elsevier Espana.
Hybrid design method for air-core solenoid with axial homogeneity
Energy Technology Data Exchange (ETDEWEB)
Huang, Li; Lee, Sang Jin [Uiduk University, Gyeongju (Korea, Republic of); Choi, Suk Jin [Institute for Basic Science, Daejeon (Korea, Republic of)
2016-03-15
In this paper, a hybrid method is proposed to design an air-core superconducting solenoid system for 6 T axial uniform magnetic field using Niobium Titanium (NbTi) superconducting wire. In order to minimize the volume of conductor, the hybrid optimization method including a linear programming and a nonlinear programming was adopted. The feasible space of solenoid is divided by several grids and the magnetic field at target point is approximated by the sum of magnetic field generated by an ideal current loop at the center of each grid. Using the linear programming, a global optimal current distribution in the feasible space can be indicated by non-zero current grids. Furthermore the clusters of the non-zero current grids also give the information of probable solenoids in the feasible space, such as the number, the shape, and so on. Applying these probable solenoids as the initial model, the final practical configuration of solenoids with integer layers can be obtained by the nonlinear programming. The design result illustrates the efficiency and the flexibility of the hybrid method. And this method can also be used for the magnet design which is required the high homogeneity within several ppm (parts per million)
Ultrasmall Dual-Band Metamaterial Antennas Based on Asymmetrical Hybrid Resonators
Directory of Open Access Journals (Sweden)
Ji-Xu Zhu
2016-01-01
Full Text Available A new type of hybrid resonant circuit model is investigated theoretically and experimentally. The resonant model consists of a right hand (RH patch part and a composite right and left handed (CRLH part (RH + CRLH, which determines a compact size and also a convenient frequency modulation characteristic for the proposed antennas. For experimental demonstration, two antennas are fabricated. The former dual-band antenna operating at f-1=3.5 GHz (Wimax and f+1=5.25 GHz (WLAN occupies an area of 0.21λ0×0.08λ0, and two dipolar radiation patterns are obtained with comparable gains of about 6.1 and 6.2 dB, respectively. The latter antenna advances in many aspects such as an ultrasmall size of only 0.16λ0×0.08λ0, versatile radiation patterns with a monopolar pattern at f0=2.4 GHz (Bluetooth, and a dipole one at f+1=3.5 GHz (Wimax and also comparable antenna gains. Circuit parameters are extracted and researched. Excellent performances of the antennas based on hybrid resonators predict promising applications in multifunction wireless communication systems.
Jia, Bao-Rui; Qin, Ming-Li; Li, Shu-Mei; Zhang, Zi-Li; Lu, Hui-Feng; Chen, Peng-Qi; Wu, Hao-Yang; Lu, Xin; Zhang, Lin; Qu, Xuan-Hui
2016-06-22
A new class of mesoporous single crystalline (MSC) material, Co(OH)2 nanoplates, is synthesized by a soft template method, and it is topotactically converted to dual-pore MSC Co3O4. Most mesoporous materials derived from the soft template method are reported to be amorphous or polycrystallined; however, in our synthesis, Co(OH)2 seeds grow to form single crystals, with amphiphilic block copolymer F127 colloids as the pore producer. The single-crystalline nature of material can be kept during the conversion from Co(OH)2 to Co3O4, and special dual-pore MSC Co3O4 nanoplates can be obtained. As the anode of lithium-ion batteries, such dual-pore MSC Co3O4 nanoplates possess exceedingly high capacity as well as long cyclic performance (730 mAh g(-1) at 1 A g(-1) after the 350th cycle). The superior performance is because of the unique hierarchical mesoporous structure, which could significantly improve Li(+) diffusion kinetics, and the exposed highly active (111) crystal planes are in favor of the conversion reaction in the charge/discharge cycles.
Energy Technology Data Exchange (ETDEWEB)
Luo, Huixia
2012-07-19
The combustion of fossil fuels in power stations with pure oxygen following the oxy-fuel process allows the Sequestration of CO{sub 2}. The pure oxygen needed can be separated from air by oxygen transporting ceramics like single phase perovskites. However, most of the so far developed single phase perovskites have stability problems in a CO{sub 2} containing atmosphere. Dual phase membranes are micro-scale mixtures of an electron conducting phase and an oxygen ion conducting phase and their compositions can be tailored according to practical requirements, which are considered to be promising substitutes for the single phase perovskite materials. In my thesis the issues of phase stability for perovskite-type material with the common composition Ba{sub 0.5}Sr{sub 0.5}Co{sub 0.8}Fe{sub 3-{delta}} (BSCF) as weil as the development of a series of novel CO{sub 2}-stable dual phase membranes were studied. In Chapter 2, the phase stability and permeation behavior of a dead-end BSCF tube membrane in high-purity oxygen at temperatures below 750 C, were elucidated using powder X-ray diffraction (XRD), energy dispersive X-ray spectroscopy (EDXS), high-angle annular dark-field (HAADF) and scanning transmission electron microscopy (STEM). lt was found that parts of the cubic perovskite BSCF transformed into a hexagonal perovskite Ba{sub 0.5{+-}x}Sr{sub 0.5{+-}x}CoO{sub 3-{delta}} (x {approx} 0.1) and a trigonal mixed oxide Ba{sub 1-x}Sr{sub x}CO{sub 2-y}Fe{sub y}O{sub 5{+-}{delta}} (x {approx} 0.15, y {approx} 0.25) in high-purity oxygen at 750 C. On the other hand, it was found that the partial degradation of cubic BSCF perovskite at 750 C was more pronounced under the strongly oxidizing conditions on the oxygen supply (feed) side than on the oxygen release (permeate) side of the membrane. The structural instability of BSCF is attributed to an oxidation of cobalt from Co{sup 2+} to Co{sup 3+} and Co{sup 4+}, which exhibits an ionic radius that is too small to be tolerated by
Semi-analytical model for hollow-core anti-resonant fibers
Directory of Open Access Journals (Sweden)
Wei eDing
2015-03-01
Full Text Available We detailedly describe a recently-developed semi-analytical method to quantitatively calculate light transmission properties of hollow-core anti-resonant fibers (HC-ARFs. Formation of equiphase interface at fiber’s outermost boundary and outward light emission ruled by Helmholtz equation in fiber’s transverse plane constitute the basis of this method. Our semi-analytical calculation results agree well with those of precise simulations and clarify the light leakage dependences on azimuthal angle, geometrical shape and polarization. Using this method, we show investigations on HC-ARFs having various core shapes (e.g. polygon, hypocycloid with single- and multi-layered core-surrounds. The polarization properties of ARFs are also studied. Our semi-analytical method provides clear physical insights into the light guidance in ARF and can play as a fast and useful design aid for better ARFs.
High-precision efficiency calibration of a high-purity co-axial germanium detector
Energy Technology Data Exchange (ETDEWEB)
Blank, B., E-mail: blank@cenbg.in2p3.fr [Centre d' Etudes Nucléaires de Bordeaux Gradignan, UMR 5797, CNRS/IN2P3, Université de Bordeaux, Chemin du Solarium, BP 120, 33175 Gradignan Cedex (France); Souin, J.; Ascher, P.; Audirac, L.; Canchel, G.; Gerbaux, M.; Grévy, S.; Giovinazzo, J.; Guérin, H.; Nieto, T. Kurtukian; Matea, I. [Centre d' Etudes Nucléaires de Bordeaux Gradignan, UMR 5797, CNRS/IN2P3, Université de Bordeaux, Chemin du Solarium, BP 120, 33175 Gradignan Cedex (France); Bouzomita, H.; Delahaye, P.; Grinyer, G.F.; Thomas, J.C. [Grand Accélérateur National d' Ions Lourds, CEA/DSM, CNRS/IN2P3, Bvd Henri Becquerel, BP 55027, F-14076 CAEN Cedex 5 (France)
2015-03-11
A high-purity co-axial germanium detector has been calibrated in efficiency to a precision of about 0.15% over a wide energy range. High-precision scans of the detector crystal and γ-ray source measurements have been compared to Monte-Carlo simulations to adjust the dimensions of a detector model. For this purpose, standard calibration sources and short-lived online sources have been used. The resulting efficiency calibration reaches the precision needed e.g. for branching ratio measurements of super-allowed β decays for tests of the weak-interaction standard model.
Development of cutting technique of reactor core internals by CO laser
International Nuclear Information System (INIS)
Takano, G.; Beppu, S.; Matsumoto, O.; Sakamoto, N.; Onozawa, T.; Sugihara, M.; Miya, K.
1995-01-01
The CO laser is superior in the absorption characteristic to materials to the CO 2 laser due to its shorter wavelength. In consideration of this characteristic Nuclear Power Engineering Corporation is studying this applicability sponsored by the Ministry of International Trade Industry of Japan to cutting of reactor core internals of commercial nuclear power plant. In decommissioning of reactor core internals it is necessary to cut stainless steel plates of 305 mm thick. The authors cut stainless steel plates of up to 310mm thick in air and those of up to 150 mm thick underwater with a 20kW class laser. Further, models simulating key structural elements of PWR core internals were cut and secondary products to clarify the applicability of the CO laser cutting to reactor core internals were evaluated. (author)
Resonance and nuclear relaxation in GdCo2
International Nuclear Information System (INIS)
Barata, A.C.
1988-04-01
A study of the 59 Co nuclear magnetic resonance and relaxation was made on the intermetallic compound GdCo 2 from 4,2 k to 330 k using the spin echo technique. An oscillatory behaviour of the primary echo was observed in the whole range of temperatures studied. This is due to the electronic quadrupole interaction of the 59 Co nuclei. (A.C.A.S.) [pt
Energy Technology Data Exchange (ETDEWEB)
Satoh, Kei; Takagi, Yuta; Narahashi, Shoichi [Research Laboratories, NTT DOCOMO, INC., 3-6 Hikari-no-oka Yokosuka, Kanagawa 239-8536 Japan (Japan); Nojima, Toshio, E-mail: satokei@nttdocomo.co.j [Graduate School of Information Science and Technology, Hokkaido University, Kita 14, Nishi 9, Kita-ku, Sapporo, Hokkaido 060-0814 Japan (Japan)
2010-06-01
This paper presents a high-temperature superconducting coplanar-waveguide quarter-wavelength resonator that has two different resonant modes for use in a dual-band bandpass filter (DBPF). An RF filter with multiple passbands such as the DBPF is a basic element that is expected to achieve broadband transmission by using separated frequency bands aggregately and simultaneously in future mobile communication systems. The proposed resonator has a folded center conductor and two open stubs that are aligned close to it. The odd- and even-mode resonant frequencies are configured using the space between the folded center conductor and the open stubs. It is easy to configure the odd- and even-mode coupling coefficients independently because the two resonant modes have different current density distributions. Consequently, a DBPF with two different bandwidths can be easily designed. This paper presents three design examples for a four-pole Chebyshev DBPF with different combinations of fractional bandwidths in order to investigate the validity of the proposed resonator. This paper also presents measured results of the DBPF based on the design examples from the standpoint of experimental investigation. The designed and measured frequency responses confirm that the proposed resonator is effective in achieving DBPFs not only with two of the same bandwidths but also with two different bandwidths.
Covariant introduction of quark spin into the dual resonance model
International Nuclear Information System (INIS)
Iroshnikov, G.S.
1979-01-01
A very simple method of insertion of a quark spin into the dual resonance model of hadron interaction is proposed. The method is suitable for amplitudes with an arbitrary number of particles. The amplitude of interaction of real particles is presented as a product of contribution of oscillatory excitations in the (q anti q) system and of a spin factor. The latter is equal to the trace of the product of the external particle wave functions constructed from structural quarks and satisfying the relativistic Bargman-Wigner equations. Two examples of calculating the meson interaction amplitudes are presented
Dielectric Meta-Holograms Enabled with Dual Magnetic Resonances in Visible Light.
Li, Zile; Kim, Inki; Zhang, Lei; Mehmood, Muhammad Q; Anwar, Muhammad S; Saleem, Murtaza; Lee, Dasol; Nam, Ki Tae; Zhang, Shuang; Luk'yanchuk, Boris; Wang, Yu; Zheng, Guoxing; Rho, Junsuk; Qiu, Cheng-Wei
2017-09-26
Efficient transmission-type meta-holograms have been demonstrated using high-index dielectric nanostructures based on Huygens' principle. It is crucial that the geometry size of building blocks be judiciously optimized individually for spectral overlap of electric and magnetic dipoles. In contrast, reflection-type meta-holograms using the metal/insulator/metal scheme and geometric phase can be readily achieved with high efficiency and small thickness. Here, we demonstrate a general platform for design of dual magnetic resonance based meta-holograms based on the geometric phase using silicon nanostructures that are quarter wavelength thick for visible light. Significantly, the projected holographic image can be unambiguously observed without a receiving screen even under the illumination of natural light. Within the well-developed semiconductor industry, our ultrathin magnetic resonance-based meta-holograms may have promising applications in anticounterfeiting and information security.
Hemoglobin structural dynamics as monitored by resonance Raman spectroscopy
International Nuclear Information System (INIS)
Spiro, T.G.
1981-01-01
Resonance Raman spectra of the heme group are now understood at a level sufficient to provide a useful monitor of several heme structural features. Some porphyrin vibrational frequencies are sensitive to Fe oxidation state, or π-electron distribution, and give insight into the electronic structure of O 2 , CO and NO hemes. Others are sensitive to Fe spin-state, via the associated geometry variation, and provide an accurate index of the porphyrin core size. When examined during the photolysis of CO-hemoglobin via short laser pulses, these frequencies indicate that conversion from low- to h+gh-spin Fe 11 takes place within 30 ps of photolysis, presumably via intersystem-crossing in the excited state, but that the subsequent relaxation of the Fe atom out of the heme plane takes longer than 20 ns, probably because of restraint by the protein. Axial ligand modes have been identified for several heme derivatives. The Fe-imidazole frequency in deoxyhemoglobin is appreciably lowered in the T quaternary structure, as determined in both static and kinetic experiments, suggesting molecular tension or proximal imidazole H-bond weakening in the T state. (author)
Wang, Wenqiang; Wang, Fenglong; Cao, Cuimei; Li, Pingping; Yao, Jinli; Jiang, Changjun
2018-04-01
CoZr/Ru/CoZr synthetic antiferromagnetic trilayers with strong antiferromagnetic interlayer coupling were fabricated by an oblique sputtering method that induced in-plane uniaxial magnetic anisotropy. A microstrip method using a vector network analyzer was applied to investigate the magnetic resonance modes of the trilayers, including the acoustic modes (AMs) and the optical modes (OMs). At zero magnetic field, the CoZr/Ru/CoZr trilayers showed OMs with resonance frequencies of up to 7.1 GHz. By increasing the applied external magnetic field, the magnetic resonance mode can be tuned to various OMs, mixed modes, and AMs. Additionally, the magnetic resonance mode showed an angular dependence between the magnetization and the microwave field, which showed similar switching of the magnetic modes with variation of the angle. Our results provide important information that will be helpful in the design of multifunctional microwave devices.
On aspects of vibration of axially moving continua
Hageraats-Ponomareva, S.
2009-01-01
In axially moving structures like conveyor belt systems, magnetic tapes, and so on, vibrations occur due to the presence of different kinds of imperfections in the systems. For these structures internal resonances can lead to severe vibrations. Resonance free conveyor belt systems can be constructed
Axial temperatures and fuel management models for a HTR system
Energy Technology Data Exchange (ETDEWEB)
Hansen, U
1971-11-12
In the HTR system, there is a large difference in temperature between different parts of the reactor core. The softer neutron spectrum in the upper colder core regions tends to shift the power productions in the fresh fuel upwards. As uranium 235 depletes and plutonium with its higher cross sections in the lower hot regions is built-up, an axial power flattening takes place. These effects have been studied in detail for a single column in an equilibrium environment. The aim of this paper is to relate these findings to a whole reactor core and to investigate the influence of axial temperatures on the overall performance and in particular, the fuel management scheme chosen for the reference design. A further objective has been to calculate the reactivity requirements for different part load conditions and for various daily and weekly load diagrams. As the xenon cross section changes significantly with temperature these investigations are performed for an equilibrium core with due representation of axial temperature zones.
Wahr, J. M.; Sasao, T.
1981-01-01
The effects of the oceans, which are subject to a resonance due to a free rotational eigenmode of an elliptical, rotating earth with a fluid outer core having an eigenfrequency of (1 + 1/460) cycle/day, on the body tide and nutational response of the earth to the diurnal luni-tidal force are computed. The response of an elastic, rotating, elliptical, oceanless earth with a fluid outer core to a given load distribution on its surface is first considered, and the tidal sea level height for equilibrium and nonequilibrium oceans is examined. Computations of the effects of equilibrium and nonequilibrium oceans on the nutational and deformational responses of the earth are then presented which show small but significant perturbations to the retrograde 18.6-year and prograde six-month nutations, and more important effects on the earth body tide, which is also resonant at the free core notation eigenfrequency.
Hwang, Hyeyoun; Kwon, Taehyun; Kim, Ho Young; Park, Jongsik; Oh, Aram; Kim, Byeongyoon; Baik, Hionsuck; Joo, Sang Hoon; Lee, Kwangyeol
2018-01-01
The development of highly active electrocatalysts is crucial for the advancement of renewable energy conversion devices. The design of core-shell nanoparticle catalysts represents a promising approach to boost catalytic activity as well as save the use of expensive precious metals. Here, a simple, one-step synthetic route is reported to prepare hexagonal nanosandwich-shaped Ni@Ru core-shell nanoparticles (Ni@Ru HNS), in which Ru shell layers are overgrown in a regioselective manner on the top and bottom, and around the center section of a hexagonal Ni nanoplate core. Notably, the synthesis can be extended to NiCo@Ru core-shell nanoparticles with tunable core compositions (Ni 3 Co x @Ru HNS). Core-shell HNS structures show superior electrocatalytic activity for the oxygen evolution reaction (OER) to a commercial RuO 2 black catalyst, with their OER activity being dependent on their core compositions. The observed trend in OER activity is correlated to the population of Ru oxide (Ru 4+ ) species, which can be modulated by the core compositions. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Reactor core in FBR type reactor
International Nuclear Information System (INIS)
Masumi, Ryoji; Kawashima, Katsuyuki; Kurihara, Kunitoshi.
1989-01-01
In a reactor core in FBR type reactors, a portion of homogenous fuels constituting the homogenous reactor core is replaced with multi-region fuels in which the enrichment degree of fissile materials is lower nearer to the axial center. This enables to condition the composition such that a reactor core having neutron flux distribution either of a homogenous reactor core or a heterogenous reactor core has substantially identical reactivity. Accordingly, in the transfer from the homogenous reactor core to the axially heterogenous reactor core, the average reactivity in the reactor core is substantially equal in each of the cycles. Further, by replacing a portion of the homogenous fuels with a multi-region fuels, thereby increasing the heat generation near the axial center, it is possiable to reduce the linear power output in the regions above and below thereof and, in addition, to improve the thermal margin in the reactor core. (T.M.)
Intra-uterine exposure to dual fetal programming sequences among surviving co-twins.
Salihu, Hamisu M; Ibrahimou, Boubakari; Dagne, Getachew A
2011-01-01
The dynamics of fetal programming following in utero demise of a co-twin are poorly understood. The authors examined fetal programming using a unique application of the change-point analysis method, and identified two types of fetal programming that occurred when a viable twin sibling died in utero, while the co-twin survived. In one type, the initial twin fetal programming trajectory was maintained while in a subset of surviving co-twins a "switch" from a twin to a singleton fetal program (dual fetal programming exposure) was observed. The results suggest that the timing in utero of conversion from a twin to a singleton programming pattern occurred slightly earlier among opposite-sex than in same-sex surviving co-twins. For the conversion from a twin to a singleton program to happen, the surviving co-twin must have attained a "critical mass" when the twin sibling died. Whereas, for same-sex surviving co-twins the critical mass for conversion was the 80th percentile of gestational-age specific birth weight, opposite-sex surviving co-twins converted at a lower critical mass (70th percentile). These novel findings warrant further study to confirm the new hithertofore unknown phenomenon of dual fetal programming sequence, and to determine the implications in terms of subsequent morbidity or mortality during infancy, childhood and adult life.
Synthesis of magnetic CoPt/SiO{sub 2} core-shell nanoparticles
Energy Technology Data Exchange (ETDEWEB)
Seto, Takafumi [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Koga, Kenji [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Takano, Fumiyoshi [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Akinaga, Hiroyuki [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Orii, Takaaki [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Hirasawa, Makoto [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Murayama, Mitsuhiro [National Institute for Material Science, 1-2-1 Sengen, Tsukuba 305-0047 (Japan)
2007-04-15
Core-shell nanoparticles composed of ferromagnetic cobalt platinum cores covered by non-magnetic silica shells were synthesized by laser ablating a composite target in a helium background gas. The average diameter of the CoPt core was controlled by adjusting the CoPt/SiO{sub 2} ratio of the ablation target. The particles were also classified in the gas phase using an electrical mobility classifier. The present method successfully synthesized nearly monodispersed nanoparticles with an average core diameter of 2.5nm. This article describes the synthesis of the core-shell nanoparticles and investigates their magnetic properties.
Qiu, Wei; Liu, Jianjun; Wang, Yuda; Yang, Yujing; Gao, Yuan; Lv, Pin; Jiang, Qiuli
2018-04-01
In this paper, a general theory of coherent population oscillation effect in an Er3+ -doped fiber under the dual-frequency pumping laser with counter-propagation and co-propagation at room temperature is presented. Using the numerical simulation, in case of dual frequency light waves (1480 nm and 980 nm) with co-propagation and counter-propagation, we analyze the effect of the pump optical power ratio (M) on the group speed of light. The group velocity of light can be varied with the change of M. We research the time delay and fractional delay in an Er3+-doped fiber under the dual-frequency pumping laser with counter-propagation and co-propagation. Compared to the methods of the single pumping, the larger time delay can be got by using the technique of dual-frequency laser pumped fiber with co-propagation and counter-propagation.
Lifetime-vibrational interference effects in resonantly excited x-ray emission spectra of CO
Energy Technology Data Exchange (ETDEWEB)
Skytt, P.; Glans, P.; Gunnelin, K. [Uppsala Univ. (Sweden)] [and others
1997-04-01
The parity selection rule for resonant X-ray emission as demonstrated for O{sub 2} and N{sub 2} can be seen as an effect of interference between coherently excited degenerate localized core states. One system where the core state degeneracy is not exact but somewhat lifted was previously studied at ALS, namely the resonant X-ray emission of amino-substituted benzene (aniline). It was shown that the X-ray fluorescence spectrum resulting from excitation of the C1s at the site of the {open_quotes}aminocarbon{close_quotes} could be described in a picture separating the excitation and the emission processes, whereas the spectrum corresponding to the quasi-degenerate carbons could not. Thus, in this case it was necessary to take interference effects between the quasi-degenerate intermediate core excited states into account in order to obtain agreement between calculations and experiment. The different vibrational levels of core excited states in molecules have energy splittings which are of the same order of magnitude as the natural lifetime broadening of core excitations in the soft X-ray range. Therefore, lifetime-vibrational interference effects are likely to appear and influence the band shapes in resonant X-ray emission spectra. Lifetime-vibrational interference has been studied in non-resonant X-ray emission, and in Auger spectra. In this report the authors discuss results of selectively excited soft X-ray fluorescence spectra of molecules, where they focus on lifetime-interference effects appearing in the band shapes.
Wang, Zhongxian; Liu, Yiping; Wei, Yonggeng; Song, Yilin
2018-01-01
The resonant coil design is taken as the core technology in the magnetic coupling resonant wireless power transmission system, which achieves energy transmission by the coupling of the resonant coil. This paper studies the effect of the resonant coil on energy transmission and the efficiency of the system. Combining a two-coil with a three-coil system, the optimum design method for the resonant coil is given to propose a novel coil structure. First, the co-simulation methods of Pspice and Maxwell are used. When the coupling coefficient of the resonant coil is different, the relationship between system transmission efficiency, output power, and frequency is analyzed. When the self-inductance of the resonant coil is different, the relationship between the performance and frequency of the system transmission is analyzed. Then, two-coil and three-coil structure models are built, and the parameters of the magnetic field of the coils are calculated and analyzed using the finite element method. In the end, a dual E-type simulation circuit model is used to optimize the design of the novel resonance coil. The co-simulation results show that the coupling coefficients of the two-coil, three-coil, and novel coil systems are 0.017, 0.17 and 0.0126, respectively. The power loss of the novel coil is 16.4 mW. There is an obvious improvement in the three-coil system, which shows that the magnetic leakage of the field and the energy coupling are relatively small. The new structure coil has better performance, and the load loss is lower; it can improve the system output power and transmission efficiency.
International Nuclear Information System (INIS)
Ikeda, Hidematsu; Suzuki, Atsuyuki.
1991-01-01
The effects of operation mode and perforated-plate type on axial mixing of mixer-settler region in both dispersed and continuous phases were studied for a 5 cm I.D. pulsed perforated-plate extraction column of pulser-feeder type. The axial mixing coefficient was simultaneously measured to both phases by using the 'dynamic tracer co-injection method' proposed by the authors. The characteristics of both phases are observed obviously. Relatively to what it was in the continuous phase, the dispersed phase had short reaching time and long retardation time. The superficial axial mixing coefficient for dispersed phase becomes smaller than for the continuous phase. And experimental results showed that a backflow took place only in dispersed phase at a test section of 50 cm in axial length. The values of backflow ratio are observed from 0.5 to 1.8% of the dispersed net flow. (author)
International Nuclear Information System (INIS)
Bai, Tao; Yan, Gang; Yu, Jianlin
2015-01-01
In this paper, a modified dual-evaporator CO 2 transcritical refrigeration cycle with two-stage ejector (MDRC) is proposed. In MDRC, the two-stage ejector are employed to recover the expansion work from cycle throttling processes and enhance the system performance and obtain dual-temperature refrigeration simultaneously. The effects of some key parameters on the thermodynamic performance of the modified cycle are theoretically investigated based on energetic and exergetic analyses. The simulation results for the modified cycle show that two-stage ejector exhibits more effective system performance improvement than the single ejector in CO 2 dual-temperature refrigeration cycle, and the improvements of the maximum system COP (coefficient of performance) and system exergy efficiency could reach 37.61% and 31.9% over those of the conventional dual-evaporator cycle under the given operating conditions. The exergetic analysis for each component at optimum discharge pressure indicates that the gas cooler, compressor, two-stage ejector and expansion valves contribute main portion to the total system exergy destruction, and the exergy destruction caused by the two-stage ejector could amount to 16.91% of the exergy input. The performance characteristics of the proposed cycle show its promise in dual-evaporator refrigeration system. - Highlights: • Two-stage ejector is used in dual-evaporator CO 2 transcritical refrigeration cycle. • Energetic and exergetic methods are carried out to analyze the system performance. • The modified cycle could obtain dual-temperature refrigeration simultaneously. • Two-stage ejector could effectively improve system COP and exergy efficiency
Performance Improvement of Polymer Solar Cells by Surface-Energy-Induced Dual Plasmon Resonance.
Yao, Mengnan; Shen, Ping; Liu, Yan; Chen, Boyuan; Guo, Wenbin; Ruan, Shengping; Shen, Liang
2016-03-09
The surface plasmon resonance (SPR) effect of metal nanoparticles (MNPs) is effectively applied on polymer solar cells (PSCs) to improve power conversion efficiency (PCE). However, universality of the reported results mainly focused on utilizing single type of MNPs to enhance light absorption only in specific narrow wavelength range. Herein, a surface-energy-induced dual MNP plasmon resonance by thermally evaporating method was presented to achieve the absorption enhancement in wider range. The differences of surface energy between silver (Ag), gold (Au), and tungsten trioxide (WO3) compared by contact angle images enable Ag and Au prefer to respectively aggregate into isolated islands rather than films at the initial stage of the evaporation process, which was clearly demonstrated in the atomic force microscopy (AFM) measurement. The sum of plasmon-enhanced wavelength range induced by both Ag NPs (350-450 nm) and Au NPs (450-600 nm) almost cover the whole absorption spectra of active layers, which compatibly contribute a significant efficiency improvement from 4.57 ± 0.16 to 6.55 ± 0.12% compared to the one without MNPs. Besides, steady state photoluminescence (PL) measurements provide strong evidence that the SPR induced by the Ag-Au NPs increase the intensity of light absorption. Finally, ultraviolet photoelectron spectroscopy (UPS) reveals that doping Au and Ag causes upper shift of both the work function and valence band of WO3, which is directly related to hole collection ability. We believe the surface-energy-induced dual plasmon resonance enhancement by simple thermally evaporating technique might pave the way toward higher-efficiency PSCs.
Energy Technology Data Exchange (ETDEWEB)
Sekiya, N., E-mail: nsekiya@yamanashi.ac.jp; Sugiyama, S.
2014-09-15
Highlights: • We have developed a HTS five-pole dual-band bandpass filter using stub-loaded hair-pin resonators. • The proposed dual-band BPF can independently control of the center frequency. • Flexibly adjustment of the bandwidth can be achieved by the H-shaped waveguide. • The proposed BPF is evaluated by simulation and measurement with good agreement. - Abstract: A HTS dual-band bandpass filter is developed to obtain sharp-cut off characteristics for mobile communication systems. The filter is composed of five stub-loaded hair-pin resonators with H-shaped waveguides between them. The main advantage of the proposed filter is to allow independent control of the center frequency of the first and second bands. The bandwidths can be flexibly adjusted using the H-shaped waveguide. An electromagnetic simulator was used to design and analyze the filter, which have a 3.5-GHz center frequency and a 70-MHz (2%) bandwidth for the first band and a 5.0-GHz center frequency and a 100-MHz (2%) bandwidth for the second band. The filter was fabricated using YBa{sub 2}Cu{sub 3}O{sub y} thin film on an Al{sub 2}O{sub 3} substrate. Ground plane was fabricated using Au thin film. The measured frequency responses of the filter tally well with the simulated ones.
Tuned dynamics stabilizes an idealized regenerative axial-torsional model of rotary drilling
Gupta, Sunit K.; Wahi, Pankaj
2018-01-01
We present an exact stability analysis of a dynamical system idealizing rotary drilling. This system comprises lumped parameter axial-torsional modes of the drill-string coupled via the cutting forces and torques. The kinematics of cutting is modeled through a functional description of the cut surface which evolves as per a partial differential equation (PDE). Linearization of this model is straightforward as opposed to the traditional state-dependent delay (SDDE) model and both the approaches result in the same characteristic equation. A systematic study on the key system parameters influencing the stability characteristics reveals that torsional damping is very critical and stable drilling is, in general, not possible in its absence. The stable regime increases as the natural frequency of the axial mode approaches that of the torsional mode and a 1:1 internal resonance leads to a significant improvement in the system stability. Hence, from a practical point of view, a drill-string with 1:1 internal resonance is desirable to avoid vibrations during rotary drilling. For the non-resonant case, axial damping reduces the stable range of operating parameters while for the resonant case, an optimum value of axial damping (equal to the torsional damping) results in the largest stable regime. Interestingly, the resonant (tuned) system has a significant parameter regime corresponding to stable operation even in the absence of damping.
The Hagedorn Spectrum and the Dual Resonance Model: An Old Love Affair
Veneziano, Gabriele
2016-01-01
In this contribution I recall how people working in the late 1960s on the dual resonance model came to the surprising discovery of a Hagedorn-like spectrum, and why they should not have been surprised. I will then turn to discussing the Hagedorn spectrum from a string theory viewpoint (which adds a huge degeneracy to the exponential spectrum). Finally, I will discuss how all this can be reinterpreted in the new incarnation of string theory through the properties of quantum black holes.
2012-01-01
Background Real-time cardiovascular magnetic resonance (rtCMR) is considered attractive for guiding TAVI. Owing to an unlimited scan plane orientation and an unsurpassed soft-tissue contrast with simultaneous device visualization, rtCMR is presumed to allow safe device navigation and to offer optimal orientation for precise axial positioning. We sought to evaluate the preclinical feasibility of rtCMR-guided transarterial aortic valve implatation (TAVI) using the nitinol-based Medtronic CoreValve bioprosthesis. Methods rtCMR-guided transfemoral (n = 2) and transsubclavian (n = 6) TAVI was performed in 8 swine using the original CoreValve prosthesis and a modified, CMR-compatible delivery catheter without ferromagnetic components. Results rtCMR using TrueFISP sequences provided reliable imaging guidance during TAVI, which was successful in 6 swine. One transfemoral attempt failed due to unsuccessful aortic arch passage and one pericardial tamponade with subsequent death occurred as a result of ventricular perforation by the device tip due to an operating error, this complication being detected without delay by rtCMR. rtCMR allowed for a detailed, simultaneous visualization of the delivery system with the mounted stent-valve and the surrounding anatomy, resulting in improved visualization during navigation through the vasculature, passage of the aortic valve, and during placement and deployment of the stent-valve. Post-interventional success could be confirmed using ECG-triggered time-resolved cine-TrueFISP and flow-sensitive phase-contrast sequences. Intended valve position was confirmed by ex-vivo histology. Conclusions Our study shows that rtCMR-guided TAVI using the commercial CoreValve prosthesis in conjunction with a modified delivery system is feasible in swine, allowing improved procedural guidance including immediate detection of complications and direct functional assessment with reduction of radiation and omission of contrast media. PMID:22453050
Kahlert, Philipp; Parohl, Nina; Albert, Juliane; Schäfer, Lena; Reinhardt, Renate; Kaiser, Gernot M; McDougall, Ian; Decker, Brad; Plicht, Björn; Erbel, Raimund; Eggebrecht, Holger; Ladd, Mark E; Quick, Harald H
2012-03-27
Real-time cardiovascular magnetic resonance (rtCMR) is considered attractive for guiding TAVI. Owing to an unlimited scan plane orientation and an unsurpassed soft-tissue contrast with simultaneous device visualization, rtCMR is presumed to allow safe device navigation and to offer optimal orientation for precise axial positioning. We sought to evaluate the preclinical feasibility of rtCMR-guided transarterial aortic valve implatation (TAVI) using the nitinol-based Medtronic CoreValve bioprosthesis. rtCMR-guided transfemoral (n = 2) and transsubclavian (n = 6) TAVI was performed in 8 swine using the original CoreValve prosthesis and a modified, CMR-compatible delivery catheter without ferromagnetic components. rtCMR using TrueFISP sequences provided reliable imaging guidance during TAVI, which was successful in 6 swine. One transfemoral attempt failed due to unsuccessful aortic arch passage and one pericardial tamponade with subsequent death occurred as a result of ventricular perforation by the device tip due to an operating error, this complication being detected without delay by rtCMR. rtCMR allowed for a detailed, simultaneous visualization of the delivery system with the mounted stent-valve and the surrounding anatomy, resulting in improved visualization during navigation through the vasculature, passage of the aortic valve, and during placement and deployment of the stent-valve. Post-interventional success could be confirmed using ECG-triggered time-resolved cine-TrueFISP and flow-sensitive phase-contrast sequences. Intended valve position was confirmed by ex-vivo histology. Our study shows that rtCMR-guided TAVI using the commercial CoreValve prosthesis in conjunction with a modified delivery system is feasible in swine, allowing improved procedural guidance including immediate detection of complications and direct functional assessment with reduction of radiation and omission of contrast media.
Directory of Open Access Journals (Sweden)
Kahlert Philipp
2012-03-01
Full Text Available Abstract Background Real-time cardiovascular magnetic resonance (rtCMR is considered attractive for guiding TAVI. Owing to an unlimited scan plane orientation and an unsurpassed soft-tissue contrast with simultaneous device visualization, rtCMR is presumed to allow safe device navigation and to offer optimal orientation for precise axial positioning. We sought to evaluate the preclinical feasibility of rtCMR-guided transarterial aortic valve implatation (TAVI using the nitinol-based Medtronic CoreValve bioprosthesis. Methods rtCMR-guided transfemoral (n = 2 and transsubclavian (n = 6 TAVI was performed in 8 swine using the original CoreValve prosthesis and a modified, CMR-compatible delivery catheter without ferromagnetic components. Results rtCMR using TrueFISP sequences provided reliable imaging guidance during TAVI, which was successful in 6 swine. One transfemoral attempt failed due to unsuccessful aortic arch passage and one pericardial tamponade with subsequent death occurred as a result of ventricular perforation by the device tip due to an operating error, this complication being detected without delay by rtCMR. rtCMR allowed for a detailed, simultaneous visualization of the delivery system with the mounted stent-valve and the surrounding anatomy, resulting in improved visualization during navigation through the vasculature, passage of the aortic valve, and during placement and deployment of the stent-valve. Post-interventional success could be confirmed using ECG-triggered time-resolved cine-TrueFISP and flow-sensitive phase-contrast sequences. Intended valve position was confirmed by ex-vivo histology. Conclusions Our study shows that rtCMR-guided TAVI using the commercial CoreValve prosthesis in conjunction with a modified delivery system is feasible in swine, allowing improved procedural guidance including immediate detection of complications and direct functional assessment with reduction of radiation and omission of contrast media.
Development of Core Simulator (CoSi) for APR1400 And Analysis of LPPT Result using APR1400-CoSi
International Nuclear Information System (INIS)
Moon, Sang-Rae; Kim, Yong-Bae; Lee, Eun-Ki
2014-01-01
According to NRC guidelines, Low Power Physics Test (LPPT) is required to be performed in low temperature/low pressure (160 .deg. C/42.2 kg/cm 2 ) as well as NOT/NOP (291.3 .deg. C/158.2 kg/cm 2 ) because Shin-Kori Unit 3 is FOAK nuclear power plant. Low Power Physics Test (LPPT) is essential to verify the nuclear design and robustness of reactor safety. LPPT consists of initial criticality, Point of Adding Heat (POAH), All Rod Out (ARO) Boron Concentration, Isothermal Temperature Coefficient (ITC), Control Rod Worth measurements and so on. KHNP-CRI has developed the Core Simulator for APR1400 (APR1400-CoSi) in order to improve the ability performing the LPPT. Especially, APR1400-CoSi has enhanced capability to calculate the full Core neutronic parameters by revising RAST-K that is three dimensional real time core kinetic program. APR1400-CoSi has been developed for education-training of Low Power Physics Test(LPPT). Particularly, APR1400-CoSi has an enhanced capability to calculate the full core neutronic parameters by revising RAST-K which is a three dimensional real time core kinetics program. Low Power Physics Test (LPPT) was performed using APR1400-CoSi and the results showed very similar values with the predicted ones. In other words, the initial core model of Shin-Kori Unit 3 in APR1400-CoSi system has been verified to be appropriate enough. Also, it was confirmed that the test range of Low Power Physics Test (LPPT) reamains effective even though the largest incremental bank reactivity is inserted in core by analyzing the power change during the rod SWAP test
Energy Technology Data Exchange (ETDEWEB)
Nagao, Hideo (Ehime Univ., Matsuyama (Japan). Faculty of Education); Morimoto, Takehiko; Sano, Nozomi; Takahashi, Mitsugi; Nagai, Hironao; Tawa, Ritsuko; Yoshimatsu, Makoto; Woo Young-Jong; Matsuda, Hiroshi
1991-01-01
Magnetic resonance imaging of skeletal muscles in thirteen patients with Duchenne muscular dystrophy was performed to estimate pathological changes. Serial axial and sagittal sections of the right lower extremity were recorded. In the early stage, the T{sub 1} values of gastrocnemius and soleus muscles were slightly lower than the control values, and in the late stage, the values were much lower in all muscles examined. In sagittal sections, the gastrocnemius muscle in the early stage showed a high density area at the distal region adjacent to soleus muscle, and the soleus muscle showed a high density area adjacent to the gestrocnemius muscle. In serial axial sections, high density areas of the anterior and posterior tibialis muscles appeared first at their proximal and peripheral regions. It was concluded that the sequence of appearance of pathological changes was different not only among individual muscles but also among various regions of each muscle; the high density changes appeared first at myotendon junctions. (author).
A New In-core Production Method of Co-60 in CANDU Reactors
Energy Technology Data Exchange (ETDEWEB)
Lyu, Jinqi; Kim, Woosong; Kim, Yonghee [KAIST, Daejeon (Korea, Republic of); Park, Younwon [BEES Inc, Daejeon (Korea, Republic of)
2016-05-15
This study introduces an innovative method for Co-60 production in the CANDU6 core. In this new scheme, the central fuel element is replaced by a Co-59 target and Co-60 is obtained after the fuel bundle is discharged. It has been shown that the new method can produce significantly higher amount of Co-60 than the conventional Co production method in CANDU6 reactors without compromising the fuel burnup by removing some (<50%) of the adjuster rods in the whole core. The coolant void reactivity is noticeably reduced when a Co-59 target is loaded into the central pin of the fuel bundle. Meanwhile, the peak power in a fuel bundle is just a little higher due to the central Co-59 target than in conventional CANDU6 fuel design. The basic technology for Co-60 producing was developed by MDS Nordion and Atomic Energy of Canada Limited (AECL) in 1946 and the same technology was adapted and applied in CANDU6 power reactors. The standard CANDU6 reactor has 21 adjuster rods which are fully inserted into the core during normal operation. The stainless steel adjuster rods are replaced with neutronically-equivalent Co-59 adjusters to produce Co-60. Nowadays, the roles of the adjuster rods are rather vague since nuclear reactors cannot be quickly restarted after a sudden reactor trip due to more stringent regulations. In some Canadian CANDU6 reactors, some or all the adjuster rods are removed from the core to maximize the uranium utilization.
Abbasi Pour, Sajjad; Shaterian, Hamid Reza; Afradi, Mojgan; Yazdani-Elah-Abadi, Afshin
2017-09-01
We synthesized Co0.25Cu0.25Mn0.5Fe2O4@CMC (CCMFe2O4@CMC) nanorods as a new dual-modal simultaneous for magnetic resonance imaging contrast agent and nanocarrier for drug delivery system. Impact of CCMFe2O4@CMC nanorods were investigated on the longitudinal (T1), transverse (T2) and transverse (T2∗) relaxation times for in vitro MRI contrast agent in water and also for drug delivery system, L-dopa was coated on CCMFe2O4@CMC nanorods and then in vitro drug release test was carried out at three PHs values and different temperatures. In vitro MR imaging demonstrated that r2 value of CCMFe2O4@CMC nanorods is 138.33 mM-1 s-1, CCMFe2O4@CMC is useful as T2 contrast agent relative to other T2 contrast agants. In vitro drug release test shows the amount of released L-dopa from CCMFe2O4@CMC nanorods at medium with pH = 1.2 is more than pH = 5.3 and 7.4.
Experimental results of core-concrete interactions using molten steel with zirconium
International Nuclear Information System (INIS)
Copus, E.R.; Blose, R.E.; Brockmann, J.E.; Gomez, R.D.; Lucero, D.A.
1990-07-01
Four inductively sustained experiments, QT-D, QT-E, SURC-3, and SURC-3A, were performed in order to investigate the additional effects of zirconium metal oxidation on core debris-concrete interactions using molten stainless steel as the core debris simulant. The QT-D experiment ablated 18 cm of concrete axially during 50 minutes of interaction on limestone-common sand concrete using a 10 kg charge of 304 stainless steel to which 2 kg of zirconium metal was added subsequent to the onset of erosion. The QT-E experiment ablated 10 cm of limestone-common sand concrete axially and 10 cm radially during 35 minutes of sustained interaction using 50 kg of stainless steel and 10 kg of zirconium. The SURC-3 experiment had a 45 kg charge of stainless steel to which 1.1 kg of zirconium was subsequently added. SURC-3 axially eroded 33 cm of limestone concrete during two hours of interaction. The fourth experiment, SURC-3A, eroded 25 cm of limestone concrete axially and 9 cm radially during 90 minutes of sustained interaction. It utilized 40 kg of stainless steel and 2.2 kg of added zirconium as the charge material. All four experiments showed in a large increase in erosion rate, gas production, and aerosol release following the addition of Zr metal to the melt. In the SURC-3 and SURC-3A tests the measured erosion rates increased from 14 cm/hr to 27 cm/hr, gas release increased from 50 slpm to 100 slpm, and aerosol release increased from .02 q/sec to .04 q/sec. The effluent gas was composed of 80% CO, 10% CO 2 , and 2% H 2 before Zr addition and 92% CO, 4% CO 2 , 4% H 2 during the Zr interactions which lasted 10--20 minutes. Addition measurements indicated that the melt pool temperature ranged from 1600 degree C--1800 degree and that the aerosols produced were comprised primarily of Te and Fe oxides. 21 refs., 120 figs., 51 tabs
Experimental results of core-concrete interactions using molten steel with zirconium
Energy Technology Data Exchange (ETDEWEB)
Copus, E.R.; Blose, R.E.; Brockmann, J.E.; Gomez, R.D.; Lucero, D.A. (Sandia National Labs., Albuquerque, NM (USA))
1990-07-01
Four inductively sustained experiments, QT-D, QT-E, SURC-3, and SURC-3A, were performed in order to investigate the additional effects of zirconium metal oxidation on core debris-concrete interactions using molten stainless steel as the core debris simulant. The QT-D experiment ablated 18 cm of concrete axially during 50 minutes of interaction on limestone-common sand concrete using a 10 kg charge of 304 stainless steel to which 2 kg of zirconium metal was added subsequent to the onset of erosion. The QT-E experiment ablated 10 cm of limestone-common sand concrete axially and 10 cm radially during 35 minutes of sustained interaction using 50 kg of stainless steel and 10 kg of zirconium. The SURC-3 experiment had a 45 kg charge of stainless steel to which 1.1 kg of zirconium was subsequently added. SURC-3 axially eroded 33 cm of limestone concrete during two hours of interaction. The fourth experiment, SURC-3A, eroded 25 cm of limestone concrete axially and 9 cm radially during 90 minutes of sustained interaction. It utilized 40 kg of stainless steel and 2.2 kg of added zirconium as the charge material. All four experiments showed in a large increase in erosion rate, gas production, and aerosol release following the addition of Zr metal to the melt. In the SURC-3 and SURC-3A tests the measured erosion rates increased from 14 cm/hr to 27 cm/hr, gas release increased from 50 slpm to 100 slpm, and aerosol release increased from .02 q/sec to .04 q/sec. The effluent gas was composed of 80% CO, 10% CO{sub 2}, and 2% H{sub 2} before Zr addition and 92% CO, 4% CO{sub 2}, 4% H{sub 2} during the Zr interactions which lasted 10--20 minutes. Addition measurements indicated that the melt pool temperature ranged from 1600{degree}C--1800{degree} and that the aerosols produced were comprised primarily of Te and Fe oxides. 21 refs., 120 figs., 51 tabs.
International Nuclear Information System (INIS)
Hu Yong; Li Jing-Chao; Shen Ming-Wu; Shi Xiang-Yang
2014-01-01
Recent advances with iron oxide/gold (Fe 3 O 4 /Au) composite nanoparticles (CNPs) in dual-modality magnetic resonance (MR) and computed tomography (CT) imaging applications are reviewed. The synthesis and assembly of “dumbbelllike” and “core/shell” Fe 3 O 4 /Au CNPs is introduced. Potential applications of some developed Fe 3 O 4 /Au CNPs as contrast agents for dual-mode MR/CT imaging applications are described in detail. (topical review - magnetism, magnetic materials, and interdisciplinary research)
Directory of Open Access Journals (Sweden)
Gao X
2012-07-01
Full Text Available Xin Gao,1,* Yun Luo,1,* Yuanyuan Wang,1,* Jun Pang,1 Chengde Liao,2 Hanlun Lu,3 Youqiang Fang11Department of Urology, The Third Affiliated Hospital, 2Department of Radiology, The Second Affiliated Hospital, Sun Yat-Sen University, 3Materials Science Institute of Zhongshan University, Guangzhou, China*These authors contributed equally to this workBackground: We designed dual-functional nanoparticles for in vivo application using a modified electrostatic and covalent layer-by-layer assembly strategy to address the challenge of assessment and treatment of hormone-refractory prostate cancer.Methods: Core-shell nanoparticles were formulated by integrating three distinct functional components, ie, a core constituted by poly(D,L-lactic-co-glycolic acid, docetaxel, and hydrophobic superparamagnetic iron oxide nanocrystals (SPIONs, a multilayer shell formed by poly(allylamine hydrochloride and two different sized poly(ethylene glycol molecules, and a single-chain prostate stem cell antigen antibody conjugated to the nanoparticle surface for targeted delivery.Results: Drug release profiles indicated that the dual-function nanoparticles had a sustained release pattern over 764 hours, and SPIONs could facilitate the controlled release of the drug in vitro. The nanoparticles showed increased antitumor efficiency and enhanced magnetic resonance imaging in vitro through targeted delivery of docetaxel and SPIONs to PC3M cells. Moreover, in nude mice bearing PC3M xenografts, the nanoparticles provided MRI negative contrast enhancement, as well as halting and even reversing tumor growth during the 76-day study duration, and without significant systemic toxicity. The lifespan of the mice treated with these targeted dual-function nanoparticles was significantly increased (Chi-square = 22.514, P < 0.0001.Conclusion: This dual-function nanomedical platform may be a promising candidate for tumor imaging and targeted delivery of chemotherapeutic agents in vivo
Preliminary Validation and Verification of TURBO{sub D}ESIGN for S-CO{sub 2} Axial Compressor
Energy Technology Data Exchange (ETDEWEB)
Lee, Je Kyoung; Lee, Jeong Ik; Ahn, Yoon Han; Kim, Seong Gu [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Yoon, Ho Joon; Addad, Yacine [Khalifa University of Science, Technology and Research, Abu Dhabi (United Arab Emirates)
2012-05-15
To use the advantages of Supercritical CO{sub 2}(S-CO{sub 2}) Brayton cycle for nuclear power plant, KAIST-Khalifa University joint research team has been focusing on S-CO{sub 2} turbomachinery development. TURBO{sub D}ESIGN code is one of the products of our researches to design a turbomachinery. The major feature of TURBO{sub D}ESIGN is that the formulation is based on the real gas and none of the ideal gas assumption was applied to the code. Thus, TURBO{sub D}ESIGN has high flexibility regarding the type of gases. In this paper, preliminary code validation and verification of TURBO{sub D}ESIGN will be discussed for axial type compressor design
Vanarthos, W J; Pope, T L; Monu, J U
1994-12-01
To test the diagnostic value of T1 spin-echo and T1 fat-saturated magnetic resonance images (MRIs), we reviewed axial T1-weighted images with and without fat saturation in 20 patients with clinically suspected chondromalacia of the patella. All scans were obtained on 1.5-MR units. The scans were randomly ordered and reviewed independently at different times by two radiologists without knowledge of the arthroscopy results. The sensitivity of the individual techniques for detecting grade 3 or 4 chondromalacia patellae was 92% for fat-saturated axial T1-weighted images alone, and 67% for axial T1-weighted images without fat saturation. The sensitivity of the combined techniques was 100% for grades 3 and 4 and 90% for all grades (0 to 4). Chondromalacia patellae is diagnosed more accurately by using T1 fat saturation than by using T1 spin-echo images. With a combination of the two techniques, accuracy is 90% to 100%.
Wang, Zhijuan; Li, Bing; Ge, Xiaoming; Goh, F W Thomas; Zhang, Xiao; Du, Guojun; Wuu, Delvin; Liu, Zhaolin; Andy Hor, T S; Zhang, Hua; Zong, Yun
2016-05-01
Durable electrocatalysts with high catalytic activity toward oxygen reduction reaction (ORR) are crucial to high-performance primary zinc-air batteries (ZnABs) and direct methanol fuel cells (DMFCs). An efficient composite electrocatalyst, Co@Co3 O4 core@shell nanoparticles (NPs) embedded in pyrolyzed polydopamine (PPD) is reported, i.e., in Co@Co3 O4 @PPD core@bishell structure, obtained via a three-step sequential process involving hydrothermal synthesis, high temperature calcination under nitrogen atmosphere, and gentle heating in air. With Co@Co3 O4 NPs encapsulated by ultrathin highly graphitized N-doped carbon, the catalyst exhibits excellent stability in aqueous alkaline solution over extended period and good tolerance to methanol crossover effect. The integration of N-doped graphitic carbon outer shell and ultrathin nanocrystalline Co3 O4 inner shell enable high ORR activity of the core@bishell NPs, as evidenced by ZnABs using catalyst of Co@Co3 O4 @PPD in air-cathode which delivers a stable voltage profile over 40 h at a discharge current density of as high as 20 mA cm(-2) . © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
A Dual-Bridge LLC Resonant Converter with Fixed-Frequency PWM Control for Wide Input Applications
DEFF Research Database (Denmark)
Xiaofeng, Sun; Li, Xiaohua; Shen, Yanfeng
2017-01-01
This paper proposes a dual-bridge (DB) LLC resonant converter for wide input applications. The topology is an integration of a half-bridge (HB) LLC circuit and a full-bridge (FB) LLC circuit. The fixed-frequency PWM control is employed and a range of twice the minimum input voltage can be covered....... Compared with the traditional pulse frequency modulation (PFM) controlled HB/FB LLC resonant converter, the voltage gain range is independent of the quality factor and the magnetizing inductor has little influence on the voltage gain, which can simplify the parameter selection process and benefit...
Double U-Core Switched Reluctance Machine
DEFF Research Database (Denmark)
2016-01-01
The present invention relates to an electrical machine stator comprising a plurality of stator segments (131,132,133), each segment comprises a first U-core and a second U-core wound with a winding, where the winding being arranged with at least one coil turn, each coil turn comprises a first axial......(s), wherein the first U-core and the second U-core are located adjacent to each other, whereby the winding spans the first and second U-cores. The invention also relates to a SRM machine with a stator mentioned above and a rotor....
Slow light based on plasmon-induced transparency in dual-ring resonator-coupled MDM waveguide system
International Nuclear Information System (INIS)
Zhan, Shiping; Li, Hongjian; He, Zhihui; Li, Boxun; Yang, Hui; Cao, Guangtao
2014-01-01
We report a theoretical and numerical investigation of the plasmon-induced transparency (PIT) effect in a dual-ring resonator-coupled metal–dielectric–metal waveguide system. A transfer matrix method (TMM) is introduced to analyse the transmission and dispersion properties in the transparency window. A tunable PIT is realized in a constant separation design. The phase dispersion and slow-light effect are discussed in both the resonance and non-resonance conditions. Finally, a propagation constant based on the TMM is derived for the periodic system. It is found that the group index in the transparency window of the proposed structure can be easily tuned by the period p, which provides a new understanding, and a group index ∼51 is achieved. The quality factor of resonators can also be effective in adjusting the dispersion relation. These observations could be helpful to fundamental research and applications for integrated plasmonic devices. (paper)
DEFF Research Database (Denmark)
Hinge, Mogens; Keiding, Kristian
2006-01-01
the morphology of the material for an specific application is going on. It is known from SFEP of styrene that the final colloidal size can be controlled by adjusting the ionic strength of the synthesis feed [1] and it is suggested that adding acrylic acid to the synthesis will result in a change...... in polymerization locus from the core to the surface [2]. There is at present not performed a systematically investigation in controlling the core size and shell thickness of poly(styrene-co-acrylic acid) core-shell colloids (poly(ST-co-AA)). Poly(ST-co-AA) colloids were synthesized by free-radical surfactant......-free emulsion co-polymerization (SFECP) at 70°C, using styrene as monomer and acrylic acid as co-monomer. Different batches of poly(ST-co-AA) colloids were synthesized with varying ionic strength and acrylic acid concentrations in the synthesis feed. The produced poly(ST-co-AA) colloids were analysed...
Xu, Chen; Zhang, Cheng; Wang, Yingxi; Li, Liu; Li, Ling; Whittaker, Andrew K.
2017-12-01
In this study, novel magnetic core-shell nanoparticles Fe3O4@La-BTC/GO have been synthesized by the layer-by-layer self-assembly (LBL) method and further modified by attachment of amino-modified PEG chains. The nanoparticles were thoroughly characterized by x-ray diffraction, FTIR, scanning electron microscopy and transmission electron microscopy. The core-shell structure was shown to be controlled by the LBL method. The drug loading of doxorubicin (DOX) within the Fe3O4@La-BTC/GO-PEG nanoparticles with different numbers of deposited layers was investigated. It was found that DOX loading increased with increasing number of metal organic framework coating layers, indicating that the drug loading can be controlled through the controllable LBL method. Cytotoxicity assays indicated that the Fe3O4@La-BTC/GO-PEG nanoparticles were biocompatible. The DOX was released rapidly at pH 3.8 and pH 5.8, but at pH 7.4 the rate and extent of release was greatly attenuated. The nanoparticles therefore demonstrate an excellent pH-triggered drug release. In addition, the particles could be tracked by magnetic resonance imaging (MRI) and fluorescence optical imaging (FOI). A clear dose-dependent contrast enhancement in T 2-weighted MR images and fluorescence images indicate the potential of these nanoparticles as dual-mode MRI/FOI contrast agents.
Low-loss single-mode hollow-core fiber with anisotropic anti-resonant elements
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
A hollow-core fiber using anisotropic anti-resonant tubes in thecladding is proposed for low loss and effectively single-mode guidance. We show that the loss performance and higher-order mode suppression is significantly improved by using symmetrically distributed anisotropic antiresonant tubes i...
Resonant Tidal Excitation of Internal Waves in the Earth's Fluid Core
Tyler, Robert H.; Kuang, Weijia
2014-01-01
It has long been speculated that there is a stably stratified layer below the core-mantle boundary, and two recent studies have improved the constraints on the parameters describing this stratification. Here we consider the dynamical implications of this layer using a simplified model. We first show that the stratification in this surface layer has sensitive control over the rate at which tidal energy is transferred to the core. We then show that when the stratification parameters from the recent studies are used in this model, a resonant configuration arrives whereby tidal forces perform elevated rates of work in exciting core flow. Specifically, the internal wave speed derived from the two independent studies (150 and 155 m/s) are in remarkable agreement with the speed (152 m/s) required for excitation of the primary normal mode of oscillation as calculated from full solutions of the Laplace Tidal Equations applied to a reduced-gravity idealized model representing the stratified layer. In evaluating this agreement it is noteworthy that the idealized model assumed may be regarded as the most reduced representation of the stratified dynamics of the layer, in that there are no non-essential dynamical terms in the governing equations assumed. While it is certainly possible that a more realistic treatment may require additional dynamical terms or coupling, it is also clear that this reduced representation includes no freedom for coercing the correlation described. This suggests that one must accept either (1) that tidal forces resonantly excite core flow and this is predicted by a simple model or (2) that either the independent estimates or the dynamical model does not accurately portray the core surface layer and there has simply been an unlikely coincidence between three estimates of a stratification parameter which would otherwise have a broad plausible range.
Yeh, S. I.; Huang, Y. C.; Cheng, C. H.; Cheng, C. M.; Yang, J. T.
2016-07-01
In this study, we investigated a fluidic system that adheres to new concepts of energy production. To improve efficiency, cost, and ease of manufacture, a millimetrically scaled device that employs a droplet-based co-axial fluidic system was devised to complete alkali-catalyzed transesterification for biodiesel production. The large surface-to-volume ratio of the droplet-based system, and the internal circulation induced inside the moving droplets, significantly enhanced the reaction rate of immiscible liquids used here - soybean oil and methanol. This device also decreased the molar ratio between methanol and oil to near the stoichiometric coefficients of a balanced chemical equation, which enhanced the total biodiesel volume produced, and decreased the costs of purification and recovery of excess methanol. In this work, the droplet-based co-axial fluidic system performed better than other methods of continuous-flow production. We achieved an efficiency that is much greater than that of reported systems. This study demonstrated the high potential of droplet-based fluidic chips for energy production. The small energy consumption and low cost of the highly purified biodiesel transesterification system described conforms to the requirements of distributed energy (inexpensive production on a moderate scale) in the world.
Isobaric analogue resonances in the 56Fe(rho,γ)57Co reaction
International Nuclear Information System (INIS)
Elkateb, M.S.
1974-01-01
The excitation function for the reaction 56 Fe(rho,γ) 57 Co has been measured from 1200-3000 KeV proton energy using enriched 56 Fe targets. The resonance strength, ωsub(γ), has been determined for the studied resonances. The absence of the isobaric analogue resonance corresponding to the ground state in 57 Fe is discussed as a result of the present study. A coulomb displacement energy for 57 Co- 57 Fe of 8876 +- 6 KeV is deduced from these measurements. (author)
Millan, Mark J
2009-01-01
The past decade of efforts to find improved treatment for major depression has been dominated by genome-driven programs of rational drug discovery directed toward highly selective ligands for nonmonoaminergic agents. Selective drugs may prove beneficial for specific symptoms, for certain patient subpopulations, or both. However, network analyses of the brain and its dysfunction suggest that agents with multiple and complementary modes of action are more likely to show broad-based efficacy against core and comorbid symptoms of depression. Strategies for improved multitarget exploitation of monoaminergic mechanisms include triple inhibitors of dopamine, serotonin (5-HT) and noradrenaline reuptake, and drugs interfering with feedback actions of monoamines at inhibitory 5-HT(1A), 5-HT(1B) and possibly 5-HT(5A) and 5-HT(7) receptors. Specific subsets of postsynaptic 5-HT receptors mediating antidepressant actions are under study (e.g., 5-HT(4) and 5-HT(6)). Association of a clinically characterized antidepressant mechanism with a nonmonoaminergic component of activity is an attractive strategy. For example, agomelatine (a melatonin agonist/5-HT(2C) antagonist) has clinically proven activity in major depression. Dual neurokinin(1) antagonists/5-HT reuptake inhibitors (SRIs) and melanocortin(4) antagonists/SRIs should display advantages over their selective counterparts, and histamine H(3) antagonists/SRIs, GABA(B) antagonists/SRIs, glutamatergic/SRIs, and cholinergic agents/SRIs may counter the compromised cognitive function of depression. Finally, drugs that suppress 5-HT reuptake and blunt hypothalamo-pituitary-adrenocorticotrophic axis overdrive, or that act at intracellular proteins such as GSK-3beta, may abrogate the negative effects of chronic stress on mood and neuronal integrity. This review discusses the discovery and development of dual- and triple-acting antidepressants, focusing on novel concepts and new drugs disclosed over the last 2 to 3 years.
Measurement for cobalt target activity and its axial distribution
International Nuclear Information System (INIS)
Li Xingyuan; Chen Zigen.
1985-01-01
Cobalt target activity and its axial distribution are measured in process of producing radioactive isotopes 60 Co by irradiation in HFETR. Cobalt target activity is obtained with measured data at 3.60 m and 4.60 m, relative axial distribution of cobalt target activity is obtained with one at 30 cm, and axial distribution of cobalt target activity(or specific activity) is obtained with both of data. The difference between this specific activity and measured result for 60 Co teletherapy sources in the end is less than +- 5%
Vertically-Integrated Dual-Continuum Models for CO2 Injection in Fractured Aquifers
Tao, Y.; Guo, B.; Bandilla, K.; Celia, M. A.
2017-12-01
Injection of CO2 into a saline aquifer leads to a two-phase flow system, with supercritical CO2 and brine being the two fluid phases. Various modeling approaches, including fully three-dimensional (3D) models and vertical-equilibrium (VE) models, have been used to study the system. Almost all of that work has focused on unfractured formations. 3D models solve the governing equations in three dimensions and are applicable to generic geological formations. VE models assume rapid and complete buoyant segregation of the two fluid phases, resulting in vertical pressure equilibrium and allowing integration of the governing equations in the vertical dimension. This reduction in dimensionality makes VE models computationally more efficient, but the associated assumptions restrict the applicability of VE model to formations with moderate to high permeability. In this presentation, we extend the VE and 3D models for CO2 injection in fractured aquifers. This is done in the context of dual-continuum modeling, where the fractured formation is modeled as an overlap of two continuous domains, one representing the fractures and the other representing the rock matrix. Both domains are treated as porous media continua and can be modeled by either a VE or a 3D formulation. The transfer of fluid mass between rock matrix and fractures is represented by a mass transfer function connecting the two domains. We have developed a computational model that combines the VE and 3D models, where we use the VE model in the fractures, which typically have high permeability, and the 3D model in the less permeable rock matrix. A new mass transfer function is derived, which couples the VE and 3D models. The coupled VE-3D model can simulate CO2 injection and migration in fractured aquifers. Results from this model compare well with a full-3D model in which both the fractures and rock matrix are modeled with 3D models, with the hybrid VE-3D model having significantly reduced computational cost. In
Xenon oscillation tests in four-loop PWR cores
International Nuclear Information System (INIS)
Aoki, Norihiko; Osaka, Kenichi; Shimada, Shoichiro; Tochihara, Hiroshi; Machii, Seigo
1980-01-01
The Kansai Electric Power Co.'s OHI Unit 1 and 2 are the first 4-loop PWRs in Japan which use 17 x 17 fuel assemblies and have essentially the same plant parameters. A 4-loop core has larger core radius and higher power density than those of 2- or 3-loop cores, and is less stable for Xe oscillation. It is therefore important to confirm that Xe oscillations in radial direction are sufficiently stable in a 4-loop core. Radial and axial Xe oscillation tests were performed during the startup physics tests of OHI Unit 1 and 2; Xe oscillation was induced by perturbation of control rods and the Xe effect on power distribution observed periodically. The test results show that the transverse Xe oscillation in the 4-loop core is sufficiently stable and that the agreement between the measurement and the calculated prediction is good. (author)
Aryabhala and Axial Rotation of Earth
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 3. Aryabhata and Axial Rotation of Earth - Khagola (The Celestial Sphere). Amartya Kumar Dutta. General Article Volume 11 Issue 3 March 2006 pp 51-68. Fulltext. Click here to view fulltext PDF. Permanent link:
International Nuclear Information System (INIS)
Kim, Jooncheol; Kim, Minsoo; Herrault, Florian; Kim, Jung-Kwun; Allen, Mark G
2015-01-01
This paper presents a rectangular, anisotropic nanolaminated CoNiFe core that possesses a magnetically hard axis in the long geometric axis direction. Previously, we have developed nanolaminated cores comprising tens to hundreds of layers of 300–1000 nm thick metallic alloys (i.e. Ni 80 Fe 20 or Co 44 Ni 37 Fe 19 ) based on sequential electrodeposition, demonstrating suppressed eddy-current losses at MHz frequencies. In this work, magnetic anisotropy was induced to the nanolaminated CoNiFe cores by applying an external magnetic field (50–100 mT) during CoNiFe film electrodeposition. The fabricated cores comprised tens to hundreds of layers of 500–1000 nm thick CoNiFe laminations that have the hard-axis magnetic property. Packaged in a 22-turn solenoid test inductor, the anisotropic core showed 10% increased effective permeability and 25% reduced core power losses at MHz operation frequency, compared to an isotropic core of the identical geometry. Operating the anisotropic nanolaminated CoNiFe core in a step-down dc–dc converter (15 V input to 5 V output) demonstrated 81% converter efficiency at a switching frequency of 1.1 MHz and output power of 6.5 W. A solenoid microinductor with microfabricated windings integrated with the anisotropic nanolaminated CoNiFe core was fabricated, demonstrating a constant inductance of 600 nH up to 10 MHz and peak quality factor exceeding 20 at 4 MHz. The performance of the microinductor with the anisotropic nanolaminated CoNiFe core is compared with other previously reported microinductors. (fast track communication)
International Nuclear Information System (INIS)
Lee, Dong Uk; Lee, Byoung Oon; Kim, Young Kyun; Hong, Ser Gi; Chang, Jin Wook; Lee, Ki Bok; Kim, Young Il
2003-03-01
In this study, material properties such as coolant specific heat, film heat transfer coefficient, cladding thermal conductivity, surface diffusion coefficient of the multi-bubble are improved in MACSIS-Mod1. The axial power and flux profile module was also incorporated with irradiation history. The performance and feasibility of the driver fuel pin have been analyzed for nominal parameters based on the conceptual design for the KALIMER breakeven core by MACSIS-MOD1 code. The fuel slug centerline temperature takes the maximum at 700mm from the bottom of the slug in spite of the nearly symmetric axial power distribution. The cladding mid-wall and coolant temperatures take the maximum at the top of the pin. Temperature of the fuel slug surface over the entire irradiation life is much lower than the fuel-clad eutectic reaction temperature. The fission gas release of the driver fuel pin at the End Of Life(EOL) is predicted to be 68.61% and plenum pressure is too low to cause cladding yielding. The probability that the fuel pin would fail is estimated to be much less than that allowed in the design criteria. The maximum radial deformation of the fuel pin is 1.928%, satisfying the preliminary design criterion (3%) for fuel pin deformation. Therefore the conceptual design parameters of the driver fuel pin for the KALIMER breakeven core are expected to satisfy the preliminary criteria on temperature, fluence limit, deformation limit etc
Energy Technology Data Exchange (ETDEWEB)
Lee, Dong Uk; Lee, Byoung Oon; Kim, Young Kyun; Hong, Ser Gi; Chang, Jin Wook; Lee, Ki Bok; Kim, Young Il
2003-03-01
In this study, material properties such as coolant specific heat, film heat transfer coefficient, cladding thermal conductivity, surface diffusion coefficient of the multi-bubble are improved in MACSIS-Mod1. The axial power and flux profile module was also incorporated with irradiation history. The performance and feasibility of the driver fuel pin have been analyzed for nominal parameters based on the conceptual design for the KALIMER breakeven core by MACSIS-MOD1 code. The fuel slug centerline temperature takes the maximum at 700mm from the bottom of the slug in spite of the nearly symmetric axial power distribution. The cladding mid-wall and coolant temperatures take the maximum at the top of the pin. Temperature of the fuel slug surface over the entire irradiation life is much lower than the fuel-clad eutectic reaction temperature. The fission gas release of the driver fuel pin at the End Of Life(EOL) is predicted to be 68.61% and plenum pressure is too low to cause cladding yielding. The probability that the fuel pin would fail is estimated to be much less than that allowed in the design criteria. The maximum radial deformation of the fuel pin is 1.928%, satisfying the preliminary design criterion (3%) for fuel pin deformation. Therefore the conceptual design parameters of the driver fuel pin for the KALIMER breakeven core are expected to satisfy the preliminary criteria on temperature, fluence limit, deformation limit etc.
Studies of axial-leakage simulations for homogeneous and heterogeneous EBR-II core configurations
International Nuclear Information System (INIS)
Grimm, K.N.; Meneghetti, D.
1985-08-01
When calculations of flux are done in less than three dimensions, leakage-absorption cross sections are normally used to model leakages (flows) in the dimensions for which the flux is not calculated. Since the neutron flux is axially dependent, the leakages, and hence the leakage-absorption cross sections, are also axially dependent. Therefore, to obtain axial flux profiles (or reaction rates) for individual subassemblies, an XY-geometry calculation delineating each subassembly has to be done at several axial heights with space- and energy-dependent leakage-absorption cross sections that are appropriate for each height. This report discusses homogeneous and heterogeneous XY-geometry calculations at various axial locations and using several differing assumptions for the calculation of the leakage-absorption cross section. The positive (outward) leakage-absorption cross sections are modeled as actual leakage absorptions, but the negative (inward) leakage-absorption cross sections are modeled as either negative leakage absorptions (+-B 2 method) or positive downscatter cross sections [the Σ/sub s/(1 → g) method]. 3 refs., 52 figs., 10 tabs
Aryabha~ and Axial Rotation of Earth
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 4. Aryabhata and Axial Rotation of Earth - Naksatra Dina (the Sidereal Day). Amartya Kumar Dutta. General Article Volume 11 Issue 4 April 2006 pp 56-74. Fulltext. Click here to view fulltext PDF. Permanent link:
Hu, Lingzhi; Hockett, Frank D; Chen, Junjie; Zhang, Lei; Caruthers, Shelton D; Lanza, Gregory M; Wickline, Samuel A
2011-07-01
To propose and test a universal strategy for building (19) F/(1) H dual-frequency RF coil that permits multiple coil geometries. The feasibility to design (19) F/(1) H dual-frequency RF coil based on coupled resonator model was investigated. A series capacitive matching network enables robust impedance matching for both harmonic oscillating modes of the coupled resonator. Two typical designs of (19) F/(1) H volume coils (birdcage and saddle) at 4.7T were implemented and evaluated with electrical bench test and in vivo (19) F/(1) H dual-nuclei imaging. For various combinations of internal resistances of the sample coil and secondary resonator, numerical solutions for the tunable capacitors to optimize impedance matching were obtained using a root-seeking program. Identical and homogeneous B1 field distribution at (19) F and (1) H frequencies were observed in bench test and phantom image. Finally, in vivo mouse imaging confirmed the sensitivity and homogeneity of the (19) F/(1) H dual-frequency coil design. A generalized strategy for designing (19) F/(1) H dual-frequency coils based on the coupled resonator approach was developed and validated. A unique feature of this design is that it preserves the B1 field homogeneity of the RF coil at both resonant frequencies. Thus it minimizes the susceptibility effect on image co-registration. Copyright © 2011 Wiley-Liss, Inc.
International Nuclear Information System (INIS)
Haverkort, Maurits W.
2016-01-01
Depending on the material and edge under consideration, core level spectra manifest themselves as local excitons with multiplets, edge singularities, resonances, or the local projected density of states. Both extremes, i.e., local excitons and non-interacting delocalized excitations are theoretically well under control. Describing the intermediate regime, where local many body interactions and band-formation are equally important is a challenge. Here we discuss how Quanty , a versatile quantum many body script language, can be used to calculate a variety of different core level spectroscopy types on solids and molecules, both in the frequency as well as the time domain. The flexible nature of Quanty allows one to choose different approximations for different edges and materials. For example, using a newly developed method merging ideas from density renormalization group and quantum chemistry [1-3], Quanty can calculate excitons, resonances and band-excitations in x-ray absorption, photoemission, x-ray emission, fluorescence yield, non-resonant inelastic x-ray scattering, resonant inelastic x-ray scattering and many more spectroscopy types. Quanty can be obtained from: http://www.quanty.org. (paper)
Alfaro, Cristina; Durán, Richard; Hunt, Alexandra; Aragón, María José
2014-01-01
Recent education reforms have begun to reframe academic discussion and teacher practice surrounding bilingual educational approaches for preparing "21st century, college and career ready" citizens. Given this broader context, in this article we examine ways that we might join implementation of dual language programs, Common Core State…
Low-loss hollow-core silica fibers with adjacent nested anti-resonant tubes
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2015-01-01
We report on numerical design optimization of hollow-core antiresonant fibers with the aim of reducing transmission losses. We show that re-arranging the nested anti-resonant tubes in the cladding to be adjacent has the effect of significantly reducing leakage as well as bending losses, and for r...
Wang, Qing; Qin, Xuefeng; Jiang, Pengcheng; Dai, Jianfeng; Li, Weixue; Gao, Haoran
2018-03-01
Core/shell structure NiCo2O4@MnCo2O4 nanofibers (NiCo2O4@MnCo2O4 NFs) were prepared by a facile co-electrospinning method and heat treatment. The composites annealed at 500 °C have a complete, continuously obvious core/shell structure, and clear interface of composites with good morphology, while annealed at 600 °C were stacked on each other and were unable to sustain three-dimensional network structures and 700 °C calcination have completely lost one-dimensional structure. The core NiCo2O4 is about 70 nm in diameter and the MnCo2O4 shell behaves a thickness about 60 nm. When investigated as an electrode material for supercapacitors, the NiCo2O4@MnCo2O4 NFs annealed at 500 °C exihibited the specific capacitance of 463 F g-1 (0.926 F cm-2) at 1 A g-1, higher than that annealed at 600 °C 362 F g-1, 1 A g-1 (0.724 F cm-2, 1 A g-1) and 700 °C 283 F g-1, 1 A g-1 (0.566 F cm-2, 1 A g-1). These results suggest that core/shell NiCo2O4@MnCo2O4 NFs annealed at 500 °C have formed a good morphology with continuously complete core/shell structure which lead to good properties would be potential electrodes for supercapacitors.
Fuel assembly and reactor core
International Nuclear Information System (INIS)
Yuchi, Yoko; Aoyama, Motoo; Haikawa, Katsumasa; Yamanaka, Akihiro; Koyama, Jun-ichi.
1996-01-01
In a fuel assembly of a BWR type reactor, a region substantially containing burnable poison is divided into an upper region and a lower region having different average concentrations of burnable poison along a transverse cross section perpendicular to the axial direction. The ratio of burnable poison contents of both regions is determined to not more than 80%, and the average concentration of the burnable poison in the lower region is determined to not less than 9% by weight. An infinite multiplication factor at an initial stage of the burning of the fuel assembly is controlled effectively by the burnable poisons. Namely, the ratio of the axial power can be controlled by the distribution of the enrichment degree of uranium fuels and the distribution of the burnable poison concentration in the axial direction. Since the average enrichment degree of the reactor core has to be increased in order to provide an initially loaded reactor core at high burnup degree. Distortion of the power distribution in the axial direction of the reactor core to which fuel assemblies at high enrichment degree are loaded is flattened to improve thermal margin, to extend continuous operation period and increase a burnup degree upon take-out thereby improving fuel economy without worsening the reactor core characteristics of the initially loaded reactor core. (N.H.)
Design and construction of wave guide CO2 laser
International Nuclear Information System (INIS)
Al-Ali, M.S.
1989-01-01
This thesis describes the design, construction and operation of a countinous wave (CW) CO2 waveguide laser with axial gas flow in which the multi-electrode technique was used to achieve uniform volume of ionized gas using two and four pairs of electrodes. Resonators of lengths ( 26 - 47.5 ) cm with inside diameter ( 3 - 4 ) mm were used with discharge taking place between four pairs of electordes 8.25 cm long each, in axial direction of the tube. The avearge flow at the tube outlet was ( 5 - 6.5 ) L/min at different gas pressures. ( 4 tabs., 74 figs., 58 refs. )
Foley, W Dennis; Shuman, William P; Siegel, Marilyn J; Sahani, Dushyant V; Boll, Daniel T; Bolus, David N; De Cecco, Carlo N; Kaza, Ravi K; Morgan, Desiree E; Schoepf, U Joseph; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L
This is the second of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography. This paper, part 2, addresses radiation dose and iodine sensitivity in dual-energy computed tomography.
A complete fuel development facility utilizing a dual core TRIGA reactor system
Energy Technology Data Exchange (ETDEWEB)
Middleton, A; Law, G C [General Atomic Co., San Diego, CA (United States)
1974-07-01
A TRIGA Dual Core Reactor System has been chosen by the Romanian Government as the heart of a new fuel development facility which will be operated by the Romanian Institute for Nuclear Technologies. The Facility, which will be operational in 1976, is an integral part of the Romanian National Program for Power Reactor Development, with particular emphasis being placed on fuel development. The unique combination of a new 14 MW steady state TRIGA reactor, and the well-proven TRIGA Annular Core Pulsing Reactor (ACPR) in one below-ground reactor pool resulted in a substantial construction cost savings and gives the facility remarkable experimental flexibility. The inherent safety of the TRIGA fuel elements in both reactor cores means that a secondary containment building is not necessary, resulting in further construction cost savings. The 14 MW steady state reactor gives acceptably high neutron fluxes for long- term testing of various prototype fuel-cladding-coolant combinations; and the TRIGA ACPR high pulse capability allows transient testing of fuel specimens, which is so important for accurate prediction of the performance of power reactor fuel elements under postulated failure conditions. The 14 MW steady state reactor has one large and three small in-core irradiation loop positions, two large irradiation loop positions adjacent to the core face, and twenty small holes in the beryllium reflector for small capsule irradiation. The power level of 14 MW will yield peak unperturbed thermal neutron fluxes in the central experiment position approaching 3.0 x 10{sup 14} n/cm{sup 2}-sec. The ACPR has one large dry central experimental cavity which can be loaded at pool level through a shielded offset loading tube; a small diameter in-core flux trap; and an in-core pneumatically-operated capsule irradiation position. A peak pulse of 15,000 MW will yield a peak fast neutron flux in the central experimental cavity of about 1.5 x 10{sup 17} n/cm{sup 2}-sec. The pulse width at
Kwak, Byeong Sub; Kim, Kang Min; Park, Sun-Min; Kang, Misook
2017-06-01
This study focused on the development of a catalyst for converting carbon dioxide, the main cause of global warming, into a beneficial energy source. Core@shell structured particles, BF@ZnO and BF@Zn1-xMgxO, are synthesized in order to selectively obtain CO gas from the photoreduction of CO2. A modified sol-gel process is used to synthesize the core@shell structures with a three-dimensional microstructure, which are subsequently characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive spectrometry (EDAX), ultraviolet (UV)-vis absorption, photoluminescence (PL), and photocurrent density analysis. The CO2 adsorption abilities of the core@shell particles are estimated through CO2-temperature programmed desorption (TPD). The core@shell structured BF@Zn1-xMgxO particles including the Mg ingredient significantly increased the adsorption of CO2 gas at the microfiber/nanoparticle interface. Both the BF@ZnO and BF@Zn1-xMgxO particles selectively reduce the carbon dioxide to carbon monoxide, with almost no other reduced products being observed. These results are attributed to the effective adsorption of CO2 gas and inhibited recombination of the photogenerated electron-hole pairs. BF@Zn0.75Mg0.25O exhibited superior photocatalytic behavior and selectively produced 5.0 μmolgcat-1 L-1 of CO gas after 8 h of reaction.
International Nuclear Information System (INIS)
Pearce, Julie K.; Golab, Alexandra; Dawson, Grant K.W.; Knuefing, Lydia; Goodwin, Carley; Golding, Suzanne D.
2016-01-01
Reservoir and cap-rock core samples with variable lithology's representative of siliciclastic reservoirs used for CO_2 storage have been characterized and reacted at reservoir conditions with an impure CO_2 stream and low salinity brine. Cores from a target CO_2 storage site in Queensland, Australia were tested. Mineralogical controls on the resulting changes to porosity and water chemistry have been identified. The tested siliciclastic reservoir core samples can be grouped generally into three responses to impure CO_2-brine reaction, dependent on mineralogy. The mineralogically clean quartzose reservoir cores had high porosities, with negligible change after reaction, in resolvable porosity or mineralogy, calculated using X-ray micro computed tomography and QEMSCAN. However, strong brine acidification and a high concentration of dissolved sulphate were generated in experiments owing to minimal mineral buffering. Also, the movement of kaolin has the potential to block pore throats and reduce permeability. The reaction of the impure CO_2-brine with calcite-cemented cap-rock core samples caused the largest porosity changes after reaction through calcite dissolution; to the extent that one sample developed a connection of open pores that extended into the core sub-plug. This has the potential to both favor injectivity but also affect CO_2 migration. The dissolution of calcite caused the buffering of acidity resulting in no significant observable silicate dissolution. Clay-rich cap-rock core samples with minor amounts of carbonate minerals had only small changes after reaction. Created porosity appeared mainly disconnected. Changes were instead associated with decreases in density from Fe-leaching of chlorite or dissolution of minor amounts of carbonates and plagioclase. The interbedded sandstone and shale core also developed increased porosity parallel to bedding through dissolution of carbonates and reactive silicates in the sandy layers. Tight interbedded cap
Investigation of Ni@CoO core-shell nanoparticle films synthesized by sequential layer deposition
International Nuclear Information System (INIS)
Spadaro, M.C.; Luches, P.; Benedetti, F.; Valeri, S.; Turchini, S.; Bertoni, G.; Ferretti, A.M.; Capetti, E.; Ponti, A.; D’Addato, S.
2017-01-01
Highlights: • We studied Ni/CoO core-shell nanoparticles (NP) obtained with a gas aggregation source. • The NP oxide shells were produced bye reactive deposition of Co in Oxygen atmosphere (p_O_2 ≈ 10"−"7 mbar). • XPS, SEM, STEM were used to obtain information on Ni chemical state and NP structure and morphology. • XMCD result showed evidence of remanent magnetization at room temperature. • We interpret XMCD results as due to stabilization induced by exchange bias due to AFM/FM coupling at the core/shell interface. - Abstract: Films of Ni@CoO core-shell nanoparticles (NP Ni core size d ≈ 11 nm) have been grown on Si/SiO_x and lacey carbon supports, by a sequential layer deposition method: a first layer of CoO was evaporated on the substrate, followed by the deposition of a layer of pre-formed, mass-selected Ni NPs, and finally an overlayer of CoO was added. The Ni NPs were formed by a magnetron gas aggregation source, and mass selected with a quadrupole mass filter. The morphology of the films was investigated with Scanning Electron Microscopy and Scanning Transmission Electron Microscopy. The Ni NP cores have a shape compatible with McKay icosahedron, caused by multitwinning occurring during their growth in the source, and the Ni NP layer shows the typical random paving growth mode. After the deposition of the CoO overlayer, CoO islands are observed, gradually extending and tending to merge with each other, with the formation of shells that enclose the Ni NP cores. In situ X-ray Photoelectron Spectroscopy showed that a few Ni atomic layers localized at the core-shell interface are oxidized, hinting at the possibility of creating an intermediate NiO shell between Ni and CoO, depending on the deposition conditions. Finally, X-ray Magnetic Circular Dichroism at the Ni L_2_,_3 absorption edge showed the presence of magnetization at room temperature even at remanence, revealing the possibility of magnetic stabilization of the NP film.
Thermoelectric performance of co-doped SnTe with resonant levels
Energy Technology Data Exchange (ETDEWEB)
Zhou, Min; Han, Yemao; Li, Laifeng, E-mail: laifengli@mail.ipc.ac.cn, E-mail: wangheng83@gmail.com [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Gibbs, Zachary M. [Division of Chemistry and Chemical Engineering, California Institute of Technology, 1200 E. California Blvd. Pasadena, California 91125 (United States); Wang, Heng, E-mail: laifengli@mail.ipc.ac.cn, E-mail: wangheng83@gmail.com [Materials Science, California Institute of Technology, 1200 California Blvd., Pasadena, California 91125 (United States); Snyder, G. Jeffrey [Materials Science, California Institute of Technology, 1200 California Blvd., Pasadena, California 91125 (United States); TMO University, Saint Petersburg 197101 (Russian Federation)
2016-07-25
Some group III elements such as Indium are known to produce the resonant impurity states in IV-VI compounds. The discovery of these impurity states has opened up new ways for engineering the thermoelectric properties of IV-VI compounds. In this work, resonant states in SnTe were studied by co-doping with both resonant (In) and extrinsic (Ag, I) dopants. A characteristic nonlinear relationship was observed between the Hall carrier concentration (n{sub H}) and extrinsic dopant concentration (N{sub I}, N{sub Ag}) in the stabilization region, where a linear increase of dopant concentration does not lead to linear response in the measured n{sub H}. Upon substituting extrinsic dopants beyond a certain amount, the n{sub H} changed proportionally with additional dopants (Ag, I) (the doping region). The Seebeck coefficients are enhanced as the resonant impurity is introduced, whereas the use of extrinsic doping only induces minor changes. Modest zT enhancements are observed at lower temperatures, which lead to an increase in the average zT values over a broad range of temperatures (300–773 K). The improved average zT obtained through co-doping indicates the promise of fine carrier density control in maximizing the favorable effect of resonant levels for thermoelectric materials.
Energy Technology Data Exchange (ETDEWEB)
Alcalá, Olgi [Laboratorio de Física de la Materia Condensada, Centro de Física, Instituto Venezolano de Investigaciones Científicas (IVIC), Apartado 20632, Caracas, 1020-A (Venezuela, Bolivarian Republic of); Briceño, Sarah [Laboratorio de Materiales, Centro de Ingenieria de Materiales y Nanotecnología, Instituto Venezolano de Investigaciones Científicas (IVIC), Apartado 20632, Caracas, 1020-A (Venezuela, Bolivarian Republic of); Brämer-Escamilla, Werner [Laboratorio de Física de la Materia Condensada, Centro de Física, Instituto Venezolano de Investigaciones Científicas (IVIC), Apartado 20632, Caracas, 1020-A (Venezuela, Bolivarian Republic of); Silva, Pedro, E-mail: pejosi@gmail.com [Laboratorio de Física de la Materia Condensada, Centro de Física, Instituto Venezolano de Investigaciones Científicas (IVIC), Apartado 20632, Caracas, 1020-A (Venezuela, Bolivarian Republic of)
2017-05-01
In this work, we study the electrical response of toroidal coils with cores of mixed ferrites magnetic nanoparticles (MNPs) embedded in a polyacrylamide matrix (Mn{sub x}Co{sub 1−x}Fe{sub 2}O{sub 4}/PAA, 0 ≤ x ≤ 1). The MNPs were synthesized by thermal decomposition of molecular precursors and Mn{sub x}Co{sub 1−x}Fe{sub 2}O{sub 4}/PAA toroidal cores were constructed by using the method of copolymerization of MNPs with acrylamide and bis-acrylamide. X-Ray Diffraction (XRD) patterns of MNPs correspond to the cubic spinel phase. The MNPs average size obtained by using Transmission Electron Microscopy (TEM) ranges from 6 to 12 nm. In order to compare our results we measure the characteristics of a commercial toroidal coil and we found that the impedance curves show a resonance peak for each configuration (commercial and Laboratory-made coils) around 75 MHz; the signal intensity of the Laboratory-made coil increases by one order of magnitude with respect to the commercial coil. We found that both, magnetic and electrical measurements, are related to the manganese concentration. The advantage of the designed Mn{sub x}Co{sub 1−x}Fe{sub 2}O{sub 4}/PAA toroidal coils system lies in the fact that versatile combinations of Mn{sup 2+} and Co{sup 2+} components can bring facile tuning of the electrical and magnetic properties to optimize the impedance of the coils. - Highlights: • We prepare Mn{sub x}Co{sub 1−x}Fe{sub 2}O{sub 4} nanoparticles (MNPs) using a thermal decomposition method. • Mn{sub x}Co{sub 1−x}Fe{sub 2}O{sub 4}/PAA nanocomposite were prepared embedding the MNPs in a Polyacrylamide matrix. • Toroidal coils with cores of the Mn{sub x}Co{sub 1−x}Fe{sub 2}O{sub 4}/PAA nanocomposite were prepared. • We Compare Impedance measurements in our cores with that of a commercial core T50. • The intensity peak around 75 MHz was one order of magnitude greater in our cores.
Grover, D.; Seth, R. K.
2018-05-01
Analysis and numerical results are presented for the thermoelastic dissipation of a homogeneous isotropic, thermally conducting, Kelvin-Voigt type circular micro-plate based on Kirchhoff's Love plate theory utilizing generalized viscothermoelasticity theory of dual-phase-lagging model. The analytical expressions for thermoelastic damping of vibration and frequency shift are obtained for generalized dual-phase-lagging model and coupled viscothermoelastic plates. The scaled thermoelastic damping has been illustrated in case of circular plate and axisymmetric circular plate for fixed aspect ratio for clamped and simply supported boundary conditions. It is observed that the damping of vibrations significantly depend on time delay and mechanical relaxation times in addition to thermo-mechanical coupling in circular plate under resonance conditions and plate dimensions.
Toward single-mode UV to near-IR guidance using hollow-core anti-resonant silica fiber
DEFF Research Database (Denmark)
Habib, Md Selim; Antonio-Lopez, Jose Enrique; Van Newkirk, Amy
2017-01-01
Hollow-core anti-resonant (HC-AR) fibers with a “negative-curvature” of the core-cladding boundary have been extensively studied over the past few years owing to their low loss and wide transmission bandwidths. The key unique feature of the HC-AR fiber is that the coupling between the core and cl...... a silica HC-AR fiber having a single ring of 7 non-touching capillaries, designed to have effectively single-mode operation and low loss from UV to near-IR....
International Nuclear Information System (INIS)
Ansarifar, G.R.; Ebrahimian, M.
2016-01-01
Highlights: • The change in neutronic parameters to the use of nanofluid as coolant is presented. • Nanoparticle deposition on fuel clad is investigated. • Radial and axial local power peaking factors are presented. • ZrO 2 and Al 2 O 3 have the lowest rate of K eff drop off. - Abstract: Nowadays, many efforts have been made to improve the efficiency of nuclear power plants. One of which is use of the dual cooled annular fuel which is an internally and externally cooled annular fuel with many advantages in heat transfer characteristics. Another is the use of nanoparticle/water (nanofluid) as coolant. In this paper, by combining these two methods, the change in neutronic parameters of the VVER-1000 nuclear reactor core with dual cooled annular fuel attributable to the use of nanoparticle/water (nanofluid) as coolant is presented. Optimization of type and volume fraction of nanoparticles in water that affect the safety enhancement of core primary parameters is intended in this study. Reactivity change, radial and axial local power peaking factors (LPPF), and the consequence of nanoparticle deposition on fuel clad are investigated. As a result of changing the effective multiplication factor and PPF calculations for six types of nanoparticles which have been studied extensively for their heat transfer properties including Alumina, Aluminum, Copper oxide, Copper, Titania, and Zirconia with different volume fractions, it can be concluded that at low concentration (0.03 volume fraction), Zirconia and Alumina are the optimum nanoparticles for normal operation. The maximum radial and axial PPF are found to be invariant to the type of nanofluid at low volume fractions. With an increase in nanoparticle deposition thickness on the outer and inner clad, a flux and K eff depression occurred and ZrO 2 and Al 2 O 3 have the lowest rate of drop off.
Study of loading by beam of dual-resonator structure of linear electron accelerator
International Nuclear Information System (INIS)
Milovanov, O.S.; Smirnov, I.A.
1988-01-01
Loading by the beam of the accelerating structure of an Argus dual-resonator linear electron accelerator with a kinetic energy of ∼ 1 MeV and a pulsed beam current of up to 0.5 A is studied experimentally. It is shown that the conditions for stable single-frequency operation of the magnetron are disrupted and the acceleration process is cut off at certain electron-beam currents. Experimental curves of the maximum beam current and maximum electron efficiency of the Argus linear electron accelerator as functions of rf power are given
Smart worm-like micelles responsive to CO2/N2 and light dual stimuli.
Jiang, Jianzhong; Wang, Guozheng; Ma, Yuxuan; Cui, Zhenggang; Binks, Bernard P
2017-04-12
CO 2 /N 2 and light dual stimuli-responsive worm-like micelles (WLMs) were obtained by addition of a relatively small amount of a switchable surfactant, 4-butyl-4'-(4-N,N-dimethylhexyloxy-amine) azobenzene bicarbonate (AZO-B6-CO 2 ), sensitive to the same triggers to a binary aqueous solution of cetyltrimethylammonium bromide (CTAB) and sodium salicylate (NaSal).
Sirenko, Kostyantyn
2011-01-01
An accurate and efficient finite-difference time-domain (FDTD) method for characterizing transient waves interactions on axially symmetric structures is presented. The method achieves its accuracy and efficiency by employing localized and/or fast Fourier transform (FFT) accelerated exact absorbing conditions (EACs). The paper details the derivation of the EACs, discusses their implementation and discretization in an FDTD method, and proposes utilization of a blocked-FFT based algorithm for accelerating the computation of temporal convolutions present in nonlocal EACs. The proposed method allows transient analyses to be carried for long time intervals without any loss of accuracy and provides reliable numerical data pertinent to physical processes under resonant conditions. This renders the method highly useful in characterization of high-Q microwave radiators and energy compressors. Numerical results that demonstrate the accuracy and efficiency of the method are presented.
DEFF Research Database (Denmark)
Yin, Chungen; Kær, Søren Knudsen; Rosendahl, Lasse
2010-01-01
This paper presents a comprehensive computational fluid dynamics (CFD) modelling study of co-firing wheat straw with coal in a 150 kW swirl-stabilized dual-feed burner flow reactor, in which the pulverized straw particles (mean diameter of 451μm) and coal particles (mean diameter of 110.4μm...... conversion. It is found that for pulverized biomass particles of a few hundred microns in diameter the intra-particle heat and mass transfer is a secondary issue at most in their conversion, and the global four-step mechanism of Jones and Lindstedt may be better used in modelling volatiles combustion......-lean core zone; whilst the coal particles are significantly affected by secondary air jet and swirled into the oxygen-rich outer radius with increased residence time (in average, 8.1s for coal particles vs. 5.2s for straw particles in the 3m high reactor). Therefore, a remarkable difference in the overall...
International Nuclear Information System (INIS)
Ma Ye-Wan; Wu Zhao-Wang; Zhang Li-Hua; Liu Wan-Fang; Zhang Jie
2015-01-01
The local surface plasmon resonances (LSPRs) of dielectric-Ag core-shell nanospheres are studied by the discretedipole approximation method. The result shows that LSPRs are sensitive to the surrounding medium refractive index, which shows a clear red-shift with the increasing surrounding medium refractive index. A dielectric-Ag core-shell nanosphere exhibits a strong coupling between the core and shell plasmon resonance modes. LSPRs depend on the shell thickness and the composition of dielectric-core and metal-shell. LSPRs can be tuned over a longer wavelength range by changing the ratio of core to shell value. The lower energy mode ω_− shows a red-shift with the increasing dielectric-core value and the inner core radius, while blue-shifted with the increasing outer shell thickness. The underlying mechanisms are analyzed with the plasmon hybridization theory and the phase retardation effect. (paper)
Radiation of electrons in an electromagnetic axial trap
International Nuclear Information System (INIS)
Toropova, A.I.
1998-01-01
The version of a trap. wherein particles move in a homogeneous constant magnetic field and electrostatic field, formed by two equipotential planes and rotation axial surface, is proposed. The solution of canonic equations is found. It is shown that interaction of electrons with the radiation field leads to damping parametric resonance. The trap model, accounting for the finite conductivity of the resonator walls and losses by collisions with gas, is studied
Temperature study of magnetic resonance spectra of co-modified (Co,N-TiO2 nanocomposites
Directory of Open Access Journals (Sweden)
Guskos Nikos
2016-06-01
Full Text Available The (nCo,N-TiO2 (n = 1, 5 and 10 wt.% of Co nanocomposites were investigated by magnetic resonance spectroscopy in 4 K to 290 K range. Analyses of ferromagnetic/electron paramagnetic resonance (FMR/EPR spectra in terms of four Callen lineshape components revealed the existence of two types of magnetic centers, one derived from metallic cobalt nanoparticles in superparamagnetic (SPM phase and the other from cobalt clusters in the TiO2 lattice. Additionally, at low temperature the EPR spectrum arising from Ti3+ ions was also registered. Both relaxations of the Landau-Lifshitz type and the Bloch-Bloembergen type played an important role at high temperature in determining the linewidths and the latter relaxation was prevailing at low temperature. Analysis of the integrated intensity showed that the SPM signal is due to small size FM cobalt nanoparticles while the paramagnetic signal from Co clusters originates from those nanoparticles in which the concentration of magnetic polarons is below the percolation threshold.
Schmidt, Rita; Webb, Andrew
2017-10-11
Magnetic resonance imaging and spectroscopy (MRI and MRS) are both widely used techniques in medical diagnostics and research. One of the major thrusts in recent years has been the introduction of ultrahigh-field magnets in order to boost the sensitivity. Several MRI studies have examined further potential improvements in sensitivity using metamaterials, focusing on single frequency applications. However, metamaterials have yet to reach a level that is practical for routine MRI use. In this work, we explore a new metamaterial implementation for MRI, a dual-nuclei resonant structure, which can be used for both proton and heteronuclear magnetic resonance. Our approach combines two configurations, one based on a set of electric dipoles for the low frequency band, and the second based on a set of magnetic dipoles for the high frequency band. We focus on the implementation of a dual-nuclei metamaterial for phosphorus and proton imaging and spectroscopy at an ultrahigh-field strength of 7 T. In vivo scans using this flexible and compact structure show that it locally enhances both the phosphorus and proton transmit and receive sensitivities.
Intensity-modulated radiation therapy: overlapping co-axial modulated fields
International Nuclear Information System (INIS)
Metcalfe, P; Tangboonduangjit, P; White, P
2004-01-01
The Varian multi-leaf collimator has a 14.5 cm leaf extension limit from each carriage. This means the target volumes in the head and neck region are sometimes too wide for standard width-modulated fields to provide adequate dose coverage. A solution is to set up asymmetric co-axial overlapping fields. This protects the MLC carriage while in return the MLC provides modulated dose blending in the field overlap region. Planar dose maps for coincident fields from the Pinnacle radiotherapy treatment planning system are compared with planar dose maps reconstructed from radiographic film and electronic portal images. The film and portal images show small leaf-jaw matchlines at each field overlap border. Linear profiles taken across each image show that the observed leaf-jaw matchlines from the accelerator images are not accounted for by the treatment planning system. Dose difference between film reconstructed electronic portal images and planning system are about 2.5 cGy in a modulated field at d max . While the magnitude of the dose differences are small improved round end leaf modelling combined with a finer dose calculation grid may minimize the discrepancy between calculated and delivered dose
Research on SEU hardening of heterogeneous Dual-Core SoC
Huang, Kun; Hu, Keliu; Deng, Jun; Zhang, Tao
2017-08-01
The implementation of Single-Event Upsets (SEU) hardening has various schemes. However, some of them require a lot of human, material and financial resources. This paper proposes an easy scheme on SEU hardening for Heterogeneous Dual-core SoC (HD SoC) which contains three techniques. First, the automatic Triple Modular Redundancy (TMR) technique is adopted to harden the register heaps of the processor and the instruction-fetching module. Second, Hamming codes are used to harden the random access memory (RAM). Last, a software signature technique is applied to check the programs which are running on CPU. The scheme need not to consume additional resources, and has little influence on the performance of CPU. These technologies are very mature, easy to implement and needs low cost. According to the simulation result, the scheme can satisfy the basic demand of SEU-hardening.
Lee, Sang Seok; Seo, Hyeon Jin; Kim, Yun Ho; Kim, Shin-Hyun
2017-06-01
Photonic microcapsules with onion-like topology are microfluidically designed to have cholesteric liquid crystals with opposite handedness in their core and shell. The microcapsules exhibit structural colors caused by dual photonic bandgaps, resulting in a rich variety of color on the optical palette. Moreover, the microcapsules can switch the colors from either core or shell depending on the selection of light-handedness. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
EPR dating CO2- sites in tooth enamel apatites by ENDOR and triple resonance
International Nuclear Information System (INIS)
Vugman, N.V.; Rigby, S.E.J.
1995-01-01
In this work we combine electron paramagnetic resonance (EPR), high-resolution electron nucleus double resonance (ENDOR) and general triple resonance (GTR) spectroscopies, to study the local environment of the CO 2 - groups created by ionizing radiation in fossil tooth enamel. We demonstrate that the CO 2 - groups occupy slightly modified phosphate sites in the hydroxyapatite lattice. In quaternary shark enamel we found these groups to be interacting with water molecules in the apatite channels. The absence of water molecules as first neighbours in mammalian samples indicate, however, that these molecules are not significantly responsible for the stabilization of CO 2 - dating centers in enamel. (author)
Synthesis and properties MFe2O4 (M = Fe, Co) nanoparticles and core-shell structures
Yelenich, O. V.; Solopan, S. O.; Greneche, J. M.; Belous, A. G.
2015-08-01
Individual Fe3-xO4 and CoFe2O4 nanoparticles, as well as Fe3-xO4/CoFe2O4 core/shell structures were synthesized by the method of co-precipitation from diethylene glycol solutions. Core/shell structure were synthesized with CoFe2O4-shell thickness of 1.0, 2.5 and 3.5 nm. X-ray diffraction patterns of individual nanoparticles and core/shell are similar and indicate that all synthesized samples have a cubic spinel structure. Compares Mössbauer studies of CoFe2O4, Fe3-xO4 nanoparticles indicate superparamagnetic properties at 300 K. It was shown that individual magnetite nanoparticles are transformed into maghemite through oxidation during the synthesis procedure, wherein the smallest nanoparticles are completely oxidized while a magnetite core does occur in the case of the largest nanoparticles. The Mössbauer spectra of core/shell nanoparticles with increasing CoFe2O4-shell thickness show a gradual decrease in the relative intensity of the quadrupole doublet and significant decrease of the mean isomer shift value at both RT and 77 K indicating a decrease of the superparamagnetic relaxation phenomena. Specific loss power for the prepared ferrofluids was experimentally calculated and it was determined that under influence of ac-magnetic field magnetic fluid based on individual CoFe2O4 and Fe3-xO4 particles are characterized by very low heating temperature, when magnetic fluids based on core/shell nanoparticles demonstrate higher heating effect.
Investigation of novel inverted NiO@NixCo1-xO core-shell nanoparticles
Hasan, Samiul; Mayanovic, R. A.; Benamara, Mourad
2018-05-01
Inverse core-shell nanoparticles, comprised of an antiferromagnetic (AFM) core covered by a ferromagnetic (FM) or ferrimagnetic (FiM) shell, are of current interest due to their different potential application and due to the tunability of their magnetic properties. The antiferromagnetic nature of NiO and high Néel temperature (523 K) makes this material well suited for inverse core-shell nanoparticle applications. Our primary objective in this project has been to synthesize and characterize inverted core-shell nanoparticles (CSNs) comprised of a NiO (AFM) core and a shell consisting of a NixCo1-xO (FiM) compound. The synthesis of the CSNs was made using a two-step process. The NiO nanoparticles were synthesized using a chemical reaction method. Subsequently, the NiO nanoparticles were used to grow the NiO@NixCo1-xO CSNs using our hydrothermal nano-phase epitaxy method. XRD structural characterization shows that the NiO@NixCo1-xO CSNs have the rock salt cubic crystal structure. SEM-EDS data indicates the presence of Co in the CSNs. Magnetic measurements show that the CSNs exhibit AFM/FiM characteristics with a small coercivity field of 30 Oe at 5 K. The field cooled vs zero field cooled hysteresis loop measurements show a magnetization axis shift which is attributed to the exchange bias effect between the AFM NiO core and an FiM NixCo1-xO shell of the CSNs. Our ab initio based calculations of the NixCo1-xO rock salt structure confirm a weak FiM character and a charge transfer insulator property of the compound.
Investigation of novel inverted NiO@NixCo1-xO core-shell nanoparticles
Directory of Open Access Journals (Sweden)
Samiul Hasan
2018-05-01
Full Text Available Inverse core-shell nanoparticles, comprised of an antiferromagnetic (AFM core covered by a ferromagnetic (FM or ferrimagnetic (FiM shell, are of current interest due to their different potential application and due to the tunability of their magnetic properties. The antiferromagnetic nature of NiO and high Néel temperature (523 K makes this material well suited for inverse core-shell nanoparticle applications. Our primary objective in this project has been to synthesize and characterize inverted core-shell nanoparticles (CSNs comprised of a NiO (AFM core and a shell consisting of a NixCo1-xO (FiM compound. The synthesis of the CSNs was made using a two-step process. The NiO nanoparticles were synthesized using a chemical reaction method. Subsequently, the NiO nanoparticles were used to grow the NiO@NixCo1-xO CSNs using our hydrothermal nano-phase epitaxy method. XRD structural characterization shows that the NiO@NixCo1-xO CSNs have the rock salt cubic crystal structure. SEM-EDS data indicates the presence of Co in the CSNs. Magnetic measurements show that the CSNs exhibit AFM/FiM characteristics with a small coercivity field of 30 Oe at 5 K. The field cooled vs zero field cooled hysteresis loop measurements show a magnetization axis shift which is attributed to the exchange bias effect between the AFM NiO core and an FiM NixCo1-xO shell of the CSNs. Our ab initio based calculations of the NixCo1-xO rock salt structure confirm a weak FiM character and a charge transfer insulator property of the compound.
Dual roles for CoAA and its counterbalancing isoform CoAM in human kidney cell tumorigenesis
Kang, Yun Kyoung; Schiff, Rachel; Ko, Lan; Wang, Tao; Tsai, Sophia Y.; Tsai, Ming-Jer; W. O’Malley, Bert
2008-01-01
Co-Activator Activator (CoAA) has been reported to be a coactivator that regulates steroid receptor-mediated transcription and alternative RNA splicing. Herein we show that CoAA is a dual-function coregulator that inhibits G1/S transition in human kidney cells and suppresses anchorage independent growth and xenograft tumor formation. Suppression occurs in part by downregulating c-myc and its downstream effectors ccnd1 and skp2, and causing accumulation of p27/Kip1 protein. In this cellular setting, CoAA directly represses the proto-oncogene, c-myc by recruiting HDAC3 protein and decreasing both the acetylation of histone H3 and the presence of RNA polymerase II on the c-myc promoter. Interestingly, a splicing isoform of CoAA, Coactivator Modulator (CoAM), antagonizes CoAA-induced G1/S transition and growth inhibition by negatively regulating the mRNA levels of the endogenous CoAA isoform. In addition, we found that expression of CoAA protein is significantly decreased in human renal cell carcinoma as compared to normal kidney. Our study presents evidence that CoAA is a potential tumor suppressor in renal carcinoma and that CoAM is a counterbalancing splice-isoform. This is so far the only example of a nuclear receptor coregulator involved in suppression of kidney cancer, and suggests potentially significant new roles for coregulators in renal cancer biology. PMID:18829545
Investigation of Ni@CoO core-shell nanoparticle films synthesized by sequential layer deposition
Energy Technology Data Exchange (ETDEWEB)
Spadaro, M.C., E-mail: mariachiara.spadaro@unimore.it [CNR-NANO, via G. Campi 213/a, 41125 Modena (Italy); Dipartimento FIM, Università di Modena e Reggio Emilia, via G. Campi 213/a, 41125 Modena (Italy); Luches, P. [Dipartimento FIM, Università di Modena e Reggio Emilia, via G. Campi 213/a, 41125 Modena (Italy); Benedetti, F.; Valeri, S. [CNR-NANO, via G. Campi 213/a, 41125 Modena (Italy); Dipartimento FIM, Università di Modena e Reggio Emilia, via G. Campi 213/a, 41125 Modena (Italy); Turchini, S. [CNR-ISM, Via Fosso del Cavaliere 100, 00133 Roma (Italy); Bertoni, G. [CNR-IMEM, Parco Area delle Scienze 37/a, 43124 Parma (Italy); Ferretti, A.M.; Capetti, E.; Ponti, A. [Laboratorio di Nanotecnologie, Istituto di Scienze e Tecnologie Molecolari, Consiglio Nazionale delle Ricerche, via G. Fantoli 16/15, 20138 Milano (Italy); D’Addato, S. [CNR-NANO, via G. Campi 213/a, 41125 Modena (Italy); Dipartimento FIM, Università di Modena e Reggio Emilia, via G. Campi 213/a, 41125 Modena (Italy)
2017-02-28
Highlights: • We studied Ni/CoO core-shell nanoparticles (NP) obtained with a gas aggregation source. • The NP oxide shells were produced bye reactive deposition of Co in Oxygen atmosphere (p{sub O2} ≈ 10{sup −7} mbar). • XPS, SEM, STEM were used to obtain information on Ni chemical state and NP structure and morphology. • XMCD result showed evidence of remanent magnetization at room temperature. • We interpret XMCD results as due to stabilization induced by exchange bias due to AFM/FM coupling at the core/shell interface. - Abstract: Films of Ni@CoO core-shell nanoparticles (NP Ni core size d ≈ 11 nm) have been grown on Si/SiO{sub x} and lacey carbon supports, by a sequential layer deposition method: a first layer of CoO was evaporated on the substrate, followed by the deposition of a layer of pre-formed, mass-selected Ni NPs, and finally an overlayer of CoO was added. The Ni NPs were formed by a magnetron gas aggregation source, and mass selected with a quadrupole mass filter. The morphology of the films was investigated with Scanning Electron Microscopy and Scanning Transmission Electron Microscopy. The Ni NP cores have a shape compatible with McKay icosahedron, caused by multitwinning occurring during their growth in the source, and the Ni NP layer shows the typical random paving growth mode. After the deposition of the CoO overlayer, CoO islands are observed, gradually extending and tending to merge with each other, with the formation of shells that enclose the Ni NP cores. In situ X-ray Photoelectron Spectroscopy showed that a few Ni atomic layers localized at the core-shell interface are oxidized, hinting at the possibility of creating an intermediate NiO shell between Ni and CoO, depending on the deposition conditions. Finally, X-ray Magnetic Circular Dichroism at the Ni L{sub 2,3} absorption edge showed the presence of magnetization at room temperature even at remanence, revealing the possibility of magnetic stabilization of the NP film.
Taylor, June S.; Mushak, Paul; Coleman, Joseph E.
1970-01-01
Electron spin resonance (esr) spectra of Cu(II) and Co(II) carbonic anhydrase, and a spin-labeled sulfonamide complex of the Zn(II) enzyme, are reported. The coordination geometry of Cu(II) bound in the enzyme appears to have approximately axial symmetry. Esr spectra of enzyme complexes with metal-binding anions also show axial symmetry and greater covalency, in the order ethoxzolamide cyanide complex suggests the presence of two, and probably three, equivalent nitrogen ligands from the protein. Esr spectra of the Co(II) enzyme and its complexes show two types of Co(II) environment, one typical of the native enzyme and the 1:1 CN- complex, and one typical of a 2:1 CN- complex. Co(II) in the 2:1 complex appears to be low-spin and probably has a coordination number of 5. Binding of a spin-labeled sulfonamide to the active center immobilizes the free radical. The similarity of the esr spectra of spin-labeled Zn(II) and Co(II) carbonic anhydrases suggests that the conformation at the active center is similar in the two metal derivatives. PMID:4320976
(FeCo)3Si-SiOx core-shell nanoparticles fabricated in the gas phase
International Nuclear Information System (INIS)
Bai Jianmin; Xu Yunhao; Thomas, John; Wang Jianping
2007-01-01
A method of fabricating core-shell nanoparticles by using an integrated nanoparticle deposition technique in the gas phase is reported. The principle of the method is based on nanoparticle growth from the vapour phase, during which elements showing lower surface energies prefer to form the shells and elements showing higher surface energies prefer to stay in the cores. This method was applied successfully to the Fe-Co-Si ternary system to fabricate core-shell-type nanoparticles. The nanoparticles were exposed in air after collection to achieve oxidation. The analysis results based on transmission electron microscopy (TEM), Auger electron spectroscopy (AES), x-ray diffraction (XRD), and a superconducting quantum interference device (SQUID) showed that the core parts are magnetic materials of body-centred cubic (bcc) structured (FeCo) 3 Si of 15 nm in diameter, and the shell parts are amorphous SiO x of 2 nm in thickness. These core-shell-type nanoparticles show a magnetic anisotropy constant of about 7 x 10 5 erg cm -3 and a saturation magnetization of around 1160 emu cm -3 , which is much higher than that of iron oxide. After annealing at 300 deg. C in air (FeCo) 3 Si-SiO x core-shell-type nanoparticles showed a little bit of a drop in magnetic moment, while pure FeCo nanopariticles totally lost their magnetic moment. This means that the shells of SiO x are dense enough to prevent the magnetic cores from oxidation
Dual-Resonant Implantable Circular Patch Antenna for Biotelemetry Communication
Directory of Open Access Journals (Sweden)
Rongqiang Li
2016-01-01
Full Text Available A compact broadband implantable circular patch antenna is designed and experimentally demonstrated for Medical Implant Communications Service (MICS band (402–405 MHz. Compared with other similar implantable antennas, the proposed antenna incorporates three advantages for biotelemetry communication. First, it can realize a broad impedance bandwidth by exhibiting dual resonances. Second, it can obtain a compact structure by introducing two arc-shaped slots, a rectangular slot and a circular slot on metal radiating patch. Finally, it can display a friendly shape by using a circular structure. The proposed antenna occupies a volume of about 431.5 mm3 (10.42 × 1.27π mm3, which is a compromise between miniaturization and bandwidth. The measured −10 dB impedance bandwidth is 55 MHz (385–440 MHz. Furthermore, the radiation performance and human body safety consideration of the antenna are examined and characterized.
Thongnoppakun, Warangkana; Yuenyong, Chokchai
2018-01-01
Pedagogical content knowledge (PCK) is an essential kind of knowledge that teacher have for teaching particular content to particular students for enhance students' understanding, therefore, teachers with adequate PCK can give content to their students in an understandable way rather than transfer subject matter knowledge to learner. This study explored science student teachers' PCK for teaching science using Content representation base methodology. Research participants were 68 4th year science student teachers from department of General Science, faculty of Education, Phuket Rajabhat University. PCK conceptualization for teaching science by Magnusson et al. (1999) was applied as a theoretical framework in this study. In this study, Content representation (CoRe) by Loughran et al. (2004) was employed as research methodology in the lesson preparation process. In addition, CoRe consisted of eight questions (CoRe prompts) that designed to elicit and portray teacher's PCK for teaching science. Data were collected from science student teachers' CoRes design for teaching a given topic and student grade. Science student teachers asked to create CoRes design for teaching in topic `Motion in one direction' for 7th grade student and further class discussion. Science student teachers mostly created a same group of science concepts according to subunits of school science textbook rather than planned and arranged content to support students' understanding. Furthermore, they described about the effect of student's prior knowledge and learning difficulties such as students' knowledge of Scalar and Vector quantity; and calculating skill. These responses portrayed science student teacher's knowledge of students' understanding of science and their content knowledge. However, they still have inadequate knowledge of instructional strategies and activities for enhance student learning. In summary, CoRes design can represented holistic overviews of science student teachers' PCK related
International Nuclear Information System (INIS)
Clement, Simon
2014-01-01
The present study is in the scope of pressurized water reactors (PWR) core response to earthquakes. The goal of this thesis is to measure the coupling between fuel assemblies caused an axial water flow. The design, production and installation a new test facility named ICARE EXPERIMENTAL are presented. ICARE EXPERIMENTAL was built in order to measure simultaneously the vibrations of four fuel assemblies (2 x 2) under an axial flow. Vibrations are produced by imposing the dynamic of one of the fuel assemblies and the displacements of the three others, induced by the fluid, are measured in the horizontal plane at grids level. A new data analysis method combining time-frequency analysis and orthogonal mode decomposition (POD) is described. This method, named Sliding Window POD (SWPOD), allows analysing multicomponent data, of which spatial repartition of energy and frequency content are time dependent. In the case of mechanical systems (linear and nonlinear), the link between the proper orthogonal modes obtained through SWPOD and the normal modes (linear and nonlinear) is studied. The SWPOD is applied to experimental tests of a steam generators U-tube, showing the appearance of internal resonances. The method is also applied to dynamic experimental tests of a fuel assembly under axial flow, the evolution of its normal modes is obtained as a function of the fluid velocity. The measures acquired with the ICARE EXPERIMENTAL installation are analysed using the SWPOD. The first results show characteristic behavior of the free fuel assemblies at their resonances. The coupling between fuel assemblies, induced by the fluid, is reproduced by simulations performed using the COEUR3D code. This code is based on a porous media model in order to simulate a fuel assemblies network under axial flow. (author) [fr
Anisotropic anti-resonant elements gives broadband single-mode low-loss hollow-core fibers
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
Hollow-core fibers with node-free anisotropic anti-resonant elements give broadband low-loss fibers that are also single-moded. At 1.06 μm silica-based fiber designs show higher-order-mode extinction-ratio >1000 and losses below 10 dB/km over a broad wavelength range....
Grinding efficiency of abutment tooth with both dentin and core composite resin on axial plane.
Miho, Otoaki; Sato, Toru; Matsukubo, Takashi
2015-01-01
The purpose of this study was to evaluate grinding efficiency in abutment teeth comprising both dentin and core composite resin in the axial plane. Grinding was performed over 5 runs at two loads (0.5 or 0.25 N) and two feed rates (1 or 2 mm/sec). The grinding surface was observed with a 3-D laser microscope. Tomographic images of the grinding surfaces captured perpendicular to the feed direction were also analyzed. Using a non-ground surface as a reference, areas comprising only dentin, both dentin and core composite resin, or only core composite resin were analyzed to determine the angle of the grinding surface. Composite resins were subjected to the Vickers hardness test and scanning electron microscopy. Data were statistically analyzed using a one-way analysis of variance and multiple comparison tests. Multiple regression analysis was performed for load, feed rate, and Vickers hardness of the build-up material depending on number of runs. When grinding was performed at a constant load and feed rate, a greater grinding angle was observed in areas comprising both dentin and composite resin or only composite resin than in areas consisting of dentin alone. A correlation was found between machinability and load or feed rate in areas comprising both dentin and composite resin or composite resin alone, with a particularly high correlation being observed between machinability and load. These results suggest that great caution should be exercised in a clinical setting when the boundary between the dentin and composite resin is to be ground, as the angle of the grinding surface changes when the rotating diamond point begins grinding the composite resin.
Axial contraction in etched optical fiber due to internal stress reduction.
Lim, Kok-Sing; Yang, Hang-Zhou; Chong, Wu-Yi; Cheong, Yew-Ken; Lim, Chin-Hong; Ali, Norfizah M; Ahmad, Harith
2013-02-11
When an optical fiber is dipped in an etching solution, the internal stress profile in the fiber varies with the fiber diameter. We observed a physical contraction as much as 0.2% in the fiber axial dimension when the fiber was reduced from its original diameter to ~6 µm through analysis using high resolution microscope images of the grating period of an etched FBG at different fiber diameters. This axial contraction is related to the varying axial stress profile in the fiber when the fiber diameter is reduced. On top of that, the refractive index of fiber core increases with reducing fiber diameter due to stress-optic effect. The calculated index increment is as much as 1.8 × 10(-3) at the center of fiber core after the diameter is reduced down to ~6 µm. In comparison with the conventional model that assumes constant grating period and neglects the variation in stress-induced index change in fiber core, our proposed model indicates a discrepancy as much as 3nm in Bragg wavelength at a fiber diameter of ~6 µm.
Directory of Open Access Journals (Sweden)
Gholam Reza Ansarifar
2015-12-01
Full Text Available One of the most important operations in nuclear power plants is load following, in which an imbalance of axial power distribution induces xenon oscillations. These oscillations must be maintained within acceptable limits otherwise the nuclear power plant could become unstable. Therefore, bounded xenon oscillation is considered to be a constraint for the load following operation. In this paper, the design of a sliding mode control (SMC, which is a robust nonlinear controller, is presented. SMC is a means to control pressurized water nuclear reactor (PWR power for the load following operation problem in a way that ensures xenon oscillations are kept bounded within acceptable limits. The proposed controller uses constant axial offset (AO strategy to ensure xenon oscillations remain bounded. The constant AO is a robust state constraint for the load following problem. The reactor core is simulated based on the two-point nuclear reactor model with a three delayed neutron groups. The stability analysis is given by means of the Lyapunov approach, thus the control system is guaranteed to be stable within a large range. The employed method is easy to implement in practical applications and moreover, the SMC exhibits the desired dynamic properties during the entire output-tracking process independent of perturbations. Simulation results are presented to demonstrate the effectiveness of the proposed controller in terms of performance, robustness, and stability. Results show that the proposed controller for the load following operation is so effective that the xenon oscillations are kept bounded in the given region.
Axial loaded MRI of the lumbar spine
Energy Technology Data Exchange (ETDEWEB)
Saifuddin, A. E-mail: asaifuddin@aol.com; Blease, S.; MacSweeney, E
2003-09-01
Magnetic resonance imaging is established as the technique of choice for assessment of degenerative disorders of the lumbar spine. However, it is routinely performed with the patient supine and the hips and knees flexed. The absence of axial loading and lumbar extension results in a maximization of spinal canal dimensions, which may in some cases, result in failure to demonstrate nerve root compression. Attempts have been made to image the lumbar spine in a more physiological state, either by imaging with flexion-extension, in the erect position or by using axial loading. This article reviews the literature relating to the above techniques.
Many-electron effect in the resonant Auger electron spectroscopy spectra of adsorbates
International Nuclear Information System (INIS)
Ohno, Masahide
2007-01-01
It is shown by a many-body theory that a resonantly excited core hole state in a chemisorbed molecule such as CO/Ni, CO/Pd, and CO/Pt relaxes to a fully relaxed one, i.e., the ionized core hole state of the smallest binding energy observed by photoelectron spectroscopy, before the core hole decays so that the resonant Auger electron spectroscopy (RAES) spectrum shows the normal Auger decay spectrum. It is shown by a many-body theory that the Auger peaks on the higher kinetic energy (K.E.) side in the RAES or AES spectrum, i.e., so called back-bonding peaks, are the two-hole states consisting of a valence hole and a hole in the adsorbate-substrate hybrid states below the substrate Fermi level. The latter hole is the change in the density of the hybrid states occupied by the screening electron from the core hole state to the valence-hole state. The difference between the back-bonding peak energy and the single valence-hole energy provides an important information about the change in the density of the hybrid states occupied by the screening electron from the core hole state to the valence-hole state. The difference between the RAES spectrum measured at the resonance energy and the AES spectrum measured at far above the ionization limit shows the competition between relaxation and decay of shakeup satellites such as the charge transfer (CT) shakeup. The relaxation rate of the CT shakeup state can be determined by Auger-photoelectron coincidence spectroscopy (APECS)
Directory of Open Access Journals (Sweden)
Yingsong Li
2012-04-01
Full Text Available A coplanar waveguide (CPW fed ultra-wideband (UWB antenna with dual notched band characteristics is presented in this paper. The circular wide slot and circular radiation patch are utilized to broaden the impedance bandwidth of the UWB antenna. The dual notched band functions are achieved by employing two stepped impedance resonators (SIRs which etched on the circular radiation patch and CPW excitation line, respectively. The two notched bands can be controlled by adjusting the dimensions of the two stepped impedance resonators which give tunable notched band functions. The proposed dual notched band UWB antenna has been designed in details and optimized by means of HFSS. Experimental and numerical results show that the proposed antenna with compact size of 32 × 24 mm2, has an impedance bandwidth range from 2.8 GHz to 13.5 Hz for voltage standing-wave ratio (VSWR less than 2, except the notch bands 5.0 GHz - 6.2 GHz for HIPERLAN/2 and IEEE 802.11a (5.1 GHz - 5.9 GHz and 8.0 GHz - 9.3 GHz for satellite and military applications.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Shanju; Pelligra, Candice I.; Keskar, Gayatri; Majewski, Pawel W.; Taylor, Andre D.; Pfefferle, Lisa D.; Osuji, Chinedum O. [Department of Chemical and Environmental Engineering, Yale University, New Haven, CT (United States); Jiang, Jie; Ismail-Beigi, Sohrab [Department of Applied Physics, Yale University, New Haven, CT (United States)
2012-01-03
An entirely bottom-up approach for the preparation of liquid crystalline suspensions of core-shell nanowires for ordered bulk heterojunction photovoltaics is demonstrated. Side-on attachment of polythiophene derivatives to ZnO nanowires promotes a co-axial polymer backbone-nanowire arrangement which favors high hole mobility. This strategy offers structural control over multiple length scales and a viable means of fabricating ordered films over large areas. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
International Nuclear Information System (INIS)
Mei-Woo, Y.
2014-01-01
Gamma Spectrometry System is used to measure qualitatively and quantitatively a gamma emitting radionuclide. The accuracy of the measurement very much depends on the performance specifications of the HPGe detectors. From this study it found that all the seven co-axial HPGe detectors in Radiochemistry and Environment Group, Nuclear Malaysia are in good working conditions base on the verification of performance specifications namely Resolution, Peak Shape, Peak-to-Compton ratio and Relative Efficiency against the warranted value from the manufacturers. (author)
Dispersion relation and growth rate in a Cherenkov free electron laser: Finite axial magnetic field
International Nuclear Information System (INIS)
Kheiri, Golshad; Esmaeilzadeh, Mahdi
2013-01-01
A theoretical analysis is presented for dispersion relation and growth rate in a Cherenkov free electron laser with finite axial magnetic field. It is shown that the growth rate and the resonance frequency of Cherenkov free electron laser increase with increasing axial magnetic field for low axial magnetic fields, while for high axial magnetic fields, they go to a saturation value. The growth rate and resonance frequency saturation values are exactly the same as those for infinite axial magnetic field approximation. The effects of electron beam self-fields on growth rate are investigated, and it is shown that the growth rate decreases in the presence of self-fields. It is found that there is an optimum value for electron beam density and Lorentz relativistic factor at which the maximum growth rate can take place. Also, the effects of velocity spread of electron beam are studied and it is found that the growth rate decreases due to the electron velocity spread
Conrad, Karen S; Jordan, Christopher D; Brown, Kenneth L; Brunold, Thomas C
2015-04-20
5'-deoxyadenosylcobalamin (coenzyme B12, AdoCbl) serves as the cofactor for several enzymes that play important roles in fermentation and catabolism. All of these enzymes initiate catalysis by promoting homolytic cleavage of the cofactor's Co-C bond in response to substrate binding to their active sites. Despite considerable research efforts, the role of the lower axial ligand in facilitating Co-C bond homolysis remains incompletely understood. In the present study, we characterized several derivatives of AdoCbl and its one-electron reduced form, Co(II)Cbl, by using electronic absorption and magnetic circular dichroism spectroscopies. To complement our experimental data, we performed computations on these species, as well as additional Co(II)Cbl analogues. The geometries of all species investigated were optimized using a quantum mechanics/molecular mechanics method, and the optimized geometries were used to compute absorption spectra with time-dependent density functional theory. Collectively, our results indicate that a reduction in the basicity of the lower axial ligand causes changes to the cofactor's electronic structure in the Co(II) state that replicate the effects seen upon binding of Co(II)Cbl to Class I isomerases, which replace the lower axial dimethylbenzimidazole ligand of AdoCbl with a protein-derived histidine (His) residue. Such a reduction of the basicity of the His ligand in the enzyme active site may be achieved through proton uptake by the catalytic triad of conserved residues, DXHXGXK, during Co-C bond homolysis.
Axial offset anomalies and local pH
International Nuclear Information System (INIS)
Tarin, F.; Montes, M.; Izquierdo, J.; Garcia-Sanchez, J.
2001-01-01
Small radial and axial offset anomalies (AOA) in some Spanish PWR-type NPP's, in addition to the knowledge of the existence of similar anomalies in U.S. PWR's, led us in 1993 to study this problem. Important parameters were correlated for a database of plant operating data consisting of six cycles of five different PWR plants (all of them of the Westinghouse 3-loop, 12 ft., 17 x 17 fuel design). One of these cycles (the oldest one) followed the standard constant pH 308 = 7.0, and the remaining ones followed a modified elevated pH control strategy (the pH at EOC is typically 7.4). Only for the oldest cycle that used the standard pH control was the in-core and ex-core axial offset values found to be in good agreement with the predictions, and an anomalous soluble boron curve behavior not observed. (author)
International Nuclear Information System (INIS)
Kelly, P.J.; Kall, B.; Goerss, S.; Alker, G.J. Jr.
1983-01-01
This report describes an open stereotactic technique by which a tumour volume reconstructed in stereotactic space from CT data is removed by stereotactic CO 2 laser vaporization. The position of the laser beam in relation to the tumour outlines is monitored by computer and displayed to the surgeon on a graphics display terminal in the operating room. Twenty-six (26) of these procedures have been performed on twenty-four (24) patients with deep-seated intra-axial neoplasms (23) and arteriovenous malformation. Post-operative CT scanning revealed no evidence of contrast enhancing lesions in nineteen (19) patients while a small amount of residual tumour was noted in five (5) patients post-operatively. This method has proven itself valuable for maintaining three-dimensional surgical orientation for the resection of intra-axial neoplasms from neurologically important areas. (Author)
Co-Au core-shell nanocrystals formed by sequential ion implantation into SiO2
International Nuclear Information System (INIS)
Kluth, P.; Hoy, B.; Johannessen, B.; Dunn, S. G.; Foran, G. J.; Ridgway, M. C.
2006-01-01
Co-Au core-shell nanocrystals (NCs) were formed by sequential ion implantation of Au and Co into thin SiO 2 . The NCs were investigated by means of transmission electron microscopy and extended x-ray absorption fine structure spectroscopy. The latter reveals a bond length expansion in the Co core compared to monatomic Co NCs. Concomitantly, a significant contraction of the bond length and a significant reduction of the effective Au-Au coordination number were observed in the Au shells. Increased Debye-Waller factors indicate significant strain in the NCs. These experimental results verify recent theoretical predictions
Brown, T R; Quinn, S F
1993-01-01
Axial magnetic resonance (MR) imaging of the patellofemoral compartment was performed in 75 patients with arthroscopic correlation. Proton density and T2(2500/20/80) weighted images were obtained in all patients. Chondromalacia in stages I and II could not be reliably identified with MR imaging. For the evaluation of stage III and IV chondromalacia, the accuracy of MR was 89%. Focal or diffuse areas of increased or decreased signal alterations of the hyaline cartilage without a contour deformity or cartilaginous thinning do not correlate reliably with arthroscopic staging of chondromalacia. A normal signal intensity is no assurance that softening of the cartilage is not present. The most reliable indicators of chondromalacia are focal contour irregularities of the hyaline cartilage and/or thinning of the hyaline cartilage associated with high signal intensity changes within frank defects or contour irregularities with T2-weighted images. The poor MR-arthroscopic correlation in earlier stages of chondromalacia may be due in part to the subjective basis of the arthroscopic diagnosis. In conclusion, stage I and II chondromalacia of the patellofemoral compartment cannot be reliably evaluated with MR imaging. Stage III and IV chondromalacia is reliably evaluated with MR using the combination of proton density and T2-weighted images.
Evaluation of chondromalacia of the patellofemoral compartment with axial magnetic resonance imaging
Energy Technology Data Exchange (ETDEWEB)
Brown, T.R. (Dept. of Radiology, Oregon Health Sciences Univ., Portland, OR (United States)); Quinn, S.F. (Dept. of Radiology, Good Samaritan Hospital and Medical Center, Portland, OR (United States))
1993-01-01
Axial magnetic resonance (MR) imaging of the patellofemoral compartment was performed in 75 patients with arthroscopic correlation. Proton density and T2(2500/20/80) weighted images were obtained in all patients. Chondromalacia in stages I and II could not be reliably identified with MR imaging. For the evaluation of stage III and IV chondromalacia, the accuracy of MR was 89%. Focal or diffuse areas of increased or decreased signal alterations of the hyaline cartilage without a contour deformity or cartilaginous thinning do not correlate reliably with arthrosopic staging of chondromalacia. A normal signal intensity is no assurance that softening of the cartilage is not present. The most reliable indicators of chondromalacia are focal contour irregularities of the hyaline cartilage and/or thinning of the hyaline cartilage associated with high signal intensity changes within frank defects or contour irregularities with T2-weighted images. The poor MR-arthroscopic correlation in earlier stages of chondromalacia may be due in part to the subjective basis of the arthroscopic diagnosis. In conclusion, stage I and II chondromalacia of the patellofemoral compartment cannot be reliably evaluated with MR imaging. Stage III and IV chondromalacia is reliably evaluated with MR using the combination of proton density and T2-weighted images. (orig.)
Zhu, Jianxiao; Huang, Lei; Xiao, Yuxiu; Shen, Leo; Chen, Qi; Shi, Wangzhou
2014-05-01
We report a facile strategy to prepare 3D core-shell nanowire heterostructures with microporous hydrogenated CoOx (H-CoOx) nanowires as the conducting scaffold to support Ni(OH)2 nanosheets. Benefiting from the H-CoOx nanowire core to provide the effective pathway for charge transport and the core-shell heterostructures with synergistic effects, the H-CoOx@Ni(OH)2 core-shell nanowire electrode achieved the specific capacitance of 2196 F g-1 (areal capacitance of 5.73 F cm-2), which is approximately a 1.4-fold enhancement compared with the Co3O4@Ni(OH)2 core-shell nanowires. An aqueous asymmetric supercapacitor (ASC) device was fabricated by using H-CoOx@Ni(OH)2 nanowires as the positive electrode and reduced graphene oxide @Fe3O4 nanocomposites as the negative electrode. The ASCs achieved high energy density (~45.3 W h kg-1 at 1010 W kg-1), high power density (~7080 W kg-1 at 23.4 W h kg-1) and high cycling stability. Furthermore, after charging for ~1 min, one such 22 cm2 ASC device demonstrated to be able to drive a small windmill (0.8 V, 0.1 W) for 20 min. Two such ASCs connected in series can power up a seven-color LED (3.2 V) efficiently.We report a facile strategy to prepare 3D core-shell nanowire heterostructures with microporous hydrogenated CoOx (H-CoOx) nanowires as the conducting scaffold to support Ni(OH)2 nanosheets. Benefiting from the H-CoOx nanowire core to provide the effective pathway for charge transport and the core-shell heterostructures with synergistic effects, the H-CoOx@Ni(OH)2 core-shell nanowire electrode achieved the specific capacitance of 2196 F g-1 (areal capacitance of 5.73 F cm-2), which is approximately a 1.4-fold enhancement compared with the Co3O4@Ni(OH)2 core-shell nanowires. An aqueous asymmetric supercapacitor (ASC) device was fabricated by using H-CoOx@Ni(OH)2 nanowires as the positive electrode and reduced graphene oxide @Fe3O4 nanocomposites as the negative electrode. The ASCs achieved high energy density (~45.3 W h kg-1 at
3D dual-virtual-pinhole assisted single particle tracking microscopy
International Nuclear Information System (INIS)
Ma, Ye; Wang, Yifan; Zhou, Xin; Kuang, Cuifang; Liu, Xu
2014-01-01
We propose a novel approach for high-speed, three-dimensional single particle tracking (SPT), which we refer to as dual-virtual-pinhole assisted single particle tracking microscopy (DVPaSPTM). DVPaSPTM system can obtain axial information of the sample without optical or mechanical depth scanning, so as to offer numbers of advantages including faster imaging, improved efficiency and a great reduction of photobleaching and phototoxicity. In addition, by the use of the dual-virtual-pinhole, the effect that the quantum yield exerts to the fluorescent signal can be eliminated, which makes the measurement independent of the surroundings and increases the accuracy of the result. DVPaSPTM system measures the intensity within different virtual pinholes of which the radii are given by the host computer. Axial information of fluorophores can be measured by the axial response curve through the ratio of intensity signals. We demonstrated the feasibility of the proposed method by a series of experiments. Results showed that the standard deviation of the axial measurement was 19.2 nm over a 2.5 μm range with 30 ms temporal resolution. (papers)
Directory of Open Access Journals (Sweden)
Peer Schrapers
Full Text Available A cobalamin (Cbl cofactor in corrinoid iron-sulfur protein (CoFeSP is the primary methyl group donor and acceptor in biological carbon oxide conversion along the reductive acetyl-CoA pathway. Changes of the axial coordination of the cobalt ion within the corrin macrocycle upon redox transitions in aqua-, methyl-, and cyano-Cbl bound to CoFeSP or in solution were studied using X-ray absorption spectroscopy (XAS at the Co K-edge in combination with density functional theory (DFT calculations, supported by metal content and cobalt redox level quantification with further spectroscopic methods. Calculation of the highly variable pre-edge X-ray absorption features due to core-to-valence (ctv electronic transitions, XANES shape analysis, and cobalt-ligand bond lengths determination from EXAFS has yielded models for the molecular and electronic structures of the cobalt sites. This suggested the absence of a ligand at cobalt in CoFeSP in α-position where the dimethylbenzimidazole (dmb base of the cofactor is bound in Cbl in solution. As main species, (dmbCoIII(OH2, (dmbCoII(OH2, and (dmbCoIII(CH3 sites for solution Cbl and CoIII(OH2, CoII(OH2, and CoIII(CH3 sites in CoFeSP-Cbl were identified. Our data support binding of a serine residue from the reductive-activator protein (RACo of CoFeSP to the cobalt ion in the CoFeSP-RACo protein complex that stabilizes Co(II. The absence of an α-ligand at cobalt not only tunes the redox potential of the cobalamin cofactor into the physiological range, but is also important for CoFeSP reactivation.
Energy Technology Data Exchange (ETDEWEB)
Bhoi, P.R. [Department of Mechanical Engineering, L and T-Sargent and Lundy Limited, L and T Energy Centre, Near Chhani Jakat Naka, Baroda 390 002 (India); Channiwala, S.A. [Department of Mechanical Engineering, Sardar Vallabhbhai National Institute of Technology, Deemed University, Ichchhanath, Surat 395 007, Gujarat (India)
2009-03-15
This paper presents the emission characteristics and axial flame temperature distribution of producer gas fired premixed burner. The producer gas fired premixed burner of 150 kW capacity was tested on open core throat less down draft gasifier system in the present study. A stable and uniform flame was observed with this burner. An instrumented test set up was developed to evaluate the performance of the burner. The conventional bluff body having blockage ratio of 0.65 was used for flame stabilization. With respect to maximum flame temperature, minimum pressure drop and minimum emissions, a swirl angle of 60 seems to be optimal. The experimental results also showed that the NO{sub x} emissions are inversely proportional to swirl angle and CO emissions are independent of swirl angle. The minimum emission levels of CO and NO{sub x} are observed to be 0.167% and 384 ppm respectively at the swirl angle of 45-60 . The experimental results showed that the maximum axial flame temperature distribution was achieved at A/F ratio of 1.0. The adiabatic flame temperature of 1653 C was calculated theoretically at A/F ratio of 1.0. Experimental results are in tune with theoretical results. It was also concluded that the CO and UHC emissions decreases with increasing A/F ratio while NO{sub x} emissions decreases on either side of A/F ratio of 1.0. (author)
Ebert, Sandra; Koo, Charmaine K W; Weiss, Jochen; McClements, David Julian
2017-02-01
Antisolvent precipitation is commonly used to fabricate protein nanoparticles using a simple batch method that involves injecting a protein-solvent mixture into an antisolvent. In this study, the potential of producing core-shell protein nanoparticles by antisolvent precipitation using a continuous dual-channel microfluidization method was investigated. The solvent phase (zein in ethanol) and antisolvent phase (casein in water) were made to impinge on each other at high velocity, which generates intense shear, turbulent, and cavitation forces that ensure thorough mixing and breakup of the phases. Relatively small core-shell protein nanoparticles (dnanoparticles went from positive at low pH to negative at high pH, with a point of zero charge around pH5. Electron microscopy indicated that the protein particles formed had a roughly spherical shape. The results suggest that the dual-channel microfluidizer could be used to continuously form protein nanoparticles by antisolvent precipitation. Nevertheless, when the microfluidization method was compared with the simple batch method the size of the particles produced under similar conditions were fairly similar. Copyright © 2016 Elsevier Ltd. All rights reserved.
Yin, Xuesong; Tang, Chunhua; Zhang, Liuyang; Yu, Zhi Gen; Gong, Hao
2016-02-09
Nanostructured core/shell electrodes have been experimentally demonstrated promising for high-performance electrochemical energy storage devices. However, chemical insights into the significant roles of nanowire cores on the growth of shells and their supercapacitor behaviors still remain as a research shortfall. In this work, by substituting 1/3 cobalt in the Co3O4 nanowire core with nickel, a 61% enhancement of the specific mass-loading of the Ni(OH)2 shell, a tremendous 93% increase of the volumetric capacitance and a superior cyclability were achieved in a novel NiCo2O4/Ni(OH)2 core/shell electrode in contrast to a Co3O4/Ni(OH)2 one. A comparative study suggested that not only the growth of Ni(OH)2 shells but also the contribution of cores were attributed to the overall performances. Importantly, their chemical origins were revealed through a theoretical simulation of the core/shell interfacial energy changes. Besides, asymmetric supercapacitor devices and applications were also explored. The scientific clues and practical potentials obtained in this work are helpful for the design and analysis of alternative core/shell electrode materials.
Detection of free radicals in γ-irradiated seasnail hard tissues by electron paramagnetic resonance
International Nuclear Information System (INIS)
Koeseoglu, Rahmi; Koeksal, Fevzi
2003-01-01
Gamma-irradiated seasnail (from family of Helix lukortium) hard tissues (CaCO 3 ) were investigated by electron paramagnetic resonance (EPR) at room temperature. The radicals produced by γ-irradiation in seasnail were attributed to orthorhombic C · O 2 - , freely rotating C · O 2 - , orthorhombic C · O 3 - , axial C · O 3 - , and axial C · O 3 3- free radicals. Unirradiated seasnail hard tissues also feature Mn 2+ ions in their EPR spectra. The hyperfine values were determined for the 13 C nucleus in the orthorhombic C · O 2 - and axial C · O 3 3- free radicals and for the manganese impurity ions. The g values of all the free radicals have been measured. The results were compared with the literature data for similar defects
Development of an Intelligent Capacitive Mass Sensor Based on Co-axial Cylindrical Capacitor
Directory of Open Access Journals (Sweden)
Amir ABU AL AISH
2009-06-01
Full Text Available The paper presents a linear, robust and intelligent capacitive mass sensor made of a co-axial cylindrical capacitor. It is designed such that the mass under measurement is directly proportional to the capacitance of the sensor. The average value of the output voltage of a capacitance to voltage converter is proportional to the capacitance of the sensor. The output of the converter is measured and displayed, as mass, with the help of microcontroller. The results are free from the effect of stray capacitances which cause errors at low values of capacitances. Developed sensor is linear, free from errors due to temperature and highly flexible in design. The proto-type of the mass sensor can weigh up to 4 kilogram only.
Chen, Na; Jiang, Jian-Tang; Xu, Cheng-Yan; Yan, Shao-Jiu; Zhen, Liang
2018-02-16
Core-shell particles with integration of ferromagnetic core and dielectric shell are attracting extensive attention for promising microwave absorption applications. In this work, CoNi microspheres with conical bulges were synthesized by a simple and scalable liquid-phase reduction method. Subsequent coating of dielectric materials was conducted to acquire core-shell structured CoNi@TiO 2 composite particles, in which the thickness of TiO 2 is about 40 nm. The coating of TiO 2 enables the absorption band of CoNi to effectively shift from K u to S band, and endows CoNi@TiO 2 microspheres with outstanding electromagnetic wave absorption performance along with a maximum reflection loss of 76.6 dB at 3.3 GHz, much better than that of bare CoNi microspheres (54.4 dB at 17.8 GHz). The enhanced EMA performance is attributed to the unique core-shell structures, which can induce dipole polarization and interfacial polarization, and tune the dielectric properties to achieve good impedance matching. Impressively, TiO 2 coating endows the composites with better microwave absorption capability than CoNi@SiO 2 microspheres. Compared with SiO 2 , TiO 2 dielectric shells could protect CoNi microspheres from merger and agglomeration during annealed. These results indicate that CoNi@TiO 2 core-shell microspheres can serve as high-performance absorbers for electromagnetic wave absorbing application.
Dual Alkali Solvent System for CO2 Capture from Flue Gas.
Li, Yang; Wang, H Paul; Liao, Chang-Yu; Zhao, Xinglei; Hsiung, Tung-Li; Liu, Shou-Heng; Chang, Shih-Ger
2017-08-01
A novel two-aqueous-phase CO 2 capture system, namely the dual alkali solvent (DAS) system, has been developed. Unlike traditional solvent-based CO 2 capture systems in which the same solvent is used for both CO 2 absorption and stripping, the solvent of the DAS system consists of two aqueous phases. The upper phase, which contains an organic alkali 1-(2-hydroxyethyl) piperazine (HEP), is used for CO 2 absorption. The lower phase, which consists of a mixture of K 2 CO 3 /KHCO 3 aqueous solution and KHCO 3 precipitate, is used for CO 2 stripping. Only a certain kind of amine (such as HEP) is able to ensure the phase separation, satisfactory absorption efficiency, effective CO 2 transfer from the upper phase to the lower phase, and regeneration of the upper phase. In the meantime, due to the presence of K 2 CO 3 /KHCO 3 in the lower phase, HEP in the upper phase is capable of being regenerated from its sulfite/sulfate heat stable salt, which enables the simultaneous absorption of CO 2 and SO 2 /SO 3 from the flue gas. Preliminary experiments and simulations indicate that the implementation of the DAS system can lead to 24.0% stripping energy savings compared to the Econamine process, without significantly lowering the CO 2 absorption efficiency (∼90%).
Core-shell titanium dioxide-titanium nitride nanotube arrays with near-infrared plasmon resonances
Farsinezhad, Samira; Shanavas, Thariq; Mahdi, Najia; Askar, Abdelrahman M.; Kar, Piyush; Sharma, Himani; Shankar, Karthik
2018-04-01
Titanium nitride (TiN) is a ceramic with high electrical conductivity which in nanoparticle form, exhibits localized surface plasmon resonances (LSPRs) in the visible region of the solar spectrum. The ceramic nature of TiN coupled with its dielectric loss factor being comparable to that of gold, render it attractive for CMOS polarizers, refractory plasmonics, surface-enhanced Raman scattering and a whole host of sensing applications. We report core-shell TiO2-TiN nanotube arrays exhibiting LSPR peaks in the range 775-830 nm achieved by a simple, solution-based, low cost, large area-compatible fabrication route that does not involve laser-writing or lithography. Self-organized, highly ordered TiO2 nanotube arrays were grown by electrochemical anodization of Ti thin films on fluorine-doped tin oxide-coated glass substrates and then conformally coated with a thin layer of TiN using atomic layer deposition. The effects of varying the TiN layer thickness and thermal annealing on the LSPR profiles were also investigated. Modeling the TiO2-TiN core-shell nanotube structure using two different approaches, one employing effective medium approximations coupled with Fresnel coefficients, resulted in calculated optical spectra that closely matched the experimentally measured spectra. Modeling provided the insight that the observed near-infrared resonance was not collective in nature, and was mainly attributable to the longitudinal resonance of annular nanotube-like TiN particles redshifted due to the presence of the higher permittivity TiO2 matrix. The resulting TiO2-TiN core-shell nanotube structures also function as visible light responsive photocatalysts, as evidenced by their photoelectrochemical water-splitting performance under light emitting diode illumination using 400, 430 and 500 nm photons.
Research on flow characteristics of supercritical CO2 axial compressor blades by CFD analysis
International Nuclear Information System (INIS)
Takagi, Kazuhisa; Muto, Yasushi; Ishizuka, Takao; Kikura, Hiroshige; Aritomi, Masanori
2010-01-01
A supercritical CO 2 gas turbine of 20MPa is suitable to couple with the Na-cooled fast reactor since Na - CO 2 reaction is mild at the outlet temperature of 800K, the cycle thermal efficiency is relatively high and the size of CO 2 gas turbine is very compact. In this gas turbine cycle, a compressor operates near the critical point. The property of CO 2 and then the behavior of compressible flow near the critical point changes very sharply. So far, such a behavior is not examined sufficiently. Then, it is important to clarify compressible flow near the critical point. In this paper, an aerodynamic design of the axial supercritical CO 2 compressor for this system has been carried out based on the existing aerodynamic design method of Cohen. The cycle design point was selected to achieve the maximum cycle thermal efficiency of 43.8%. For this point, the compressor design conditions were determined. They are a mass flow rate of 2035kg/s, an inlet temperature of 308K, an inlet static pressure of 8.26MPa, an outlet static pressure of 20.6MPa and a rotational speed of 3600rpm. The mean radius was constant through axial direction. The design point was determined so as to keep the diffusion factor and blade stress within the allowable limits. Number of stages and an expected adiabatic efficiency was 14 and 87%, respectively. CFD analyses by FLUENT have been done for this compressor blade. The blade model consists of one set of a guide vane, a rotor blade and a stator blade. The analyses were conducted under the assumption both of the real gas properties and also of the modified ideal gas properties. Using the real gas properties, analysis was conducted for the 14th blade, whose condition is remote from the critical point and the possibility of divergence is very small. Then, the analyses were conducted for the blade whose conditions are nearer to the critical point. Gradually, divergence of calculation was encountered. Convergence was relatively easy for the modified
Surface-engineered core-shell nano-size ferrites and their antimicrobial activity
International Nuclear Information System (INIS)
Baraliya, Jagdish D.; Joshi, Hiren H.
2014-01-01
We report the results of biological study on core-shell structured MFe 2 O 4 (where M = Co, Mn, Ni) nanoparticles and influence of silica- DEG dual coating on their antimicrobial activity. Spherical MFe 2 O 4 nanoparticles were prepared via a Co-precipitation method. The microstructures and morphologies of these nanoparticles were studied by x-ray diffraction and FTIR. The antimicrobial activity study carried out in nutrient agar medium with addition of antimicrobial synthesis compound which is tested for its activity against different types of bacteria
Conservative axial burnup distributions for actinide-only burnup credit
International Nuclear Information System (INIS)
Kang, C.; Lancaster, D.
1997-11-01
Unlike the fresh fuel approach, which assumes the initial isotopic compositions for criticality analyses, any burnup credit methodology must address the proper treatment of axial burnup distributions. A straightforward way of treating a given axial burnup distribution is to segment the fuel assembly into multiple meshes and to model each burnup mesh with the corresponding isotopic compositions. Although this approach represents a significant increase in modeling efforts compared to the uniform average burnup approach, it can adequately determine the reactivity effect of the axial burnup distribution. A major consideration is what axial burnup distributions are appropriate for use in light of many possible distributions depending on core operating conditions and histories. This paper summarizes criticality analyses performed to determine conservative axial burnup distributions. The conservative axial burnup distributions presented in this paper are included in the Topical Report on Actinide-Only Burnup Credit for Pressurized Water Reactor Spent Nuclear Fuel Packages, Revision 1 submitted in May 1997 by the US Department of Energy (DOE) to the US Nuclear Regulatory Commission (NRC). When approved by NRC, the conservative axial burnup distributions may be used to model PWR spent nuclear fuel for the purpose of gaining actinide only burnup credit
Selection of optimum ROI for dual radionuclide analysis of 55Fe-63Ni and 63Ni-60Co
International Nuclear Information System (INIS)
Priya, S.; Prabhath Ravi, K.; Yadav, R.K.B.; Rao, D.D.; Gopalakrishnan, R.K.
2016-01-01
Dual label counting in liquid scintillation counting (LSC) enables simultaneous activity determination of two radionuclides. Dual counting procedure for 3 H and 14 C has been well established. There are several other nuclides like 63 Ni (E β- =67keV), 55 Fe (6 keV X-ray and auger electron) which are often chemically separated using detailed procedures with high decontamination factors (DF) and quantified using LSC. Despite the laborious separations, traces of these nuclides in the chemically separated fractions can mutually make their quantification difficult due to overlap of counts from both radionuclides in the spectrum, which gets further complicated in presence of traces of 60 Co. For dual label counting technique, it is essential to establish the discriminator setting at which there will be spillover of counts from both radionuclides in the two counting regions required for the inclusion method. The objective of the current work is to establish two counting ROI's for dual counting of (i) 63 Ni- 55 Fe and (ii) 63 Ni- 60 Co in a TDCR based LSC system
Song, Xinyue; Yue, Zihong; Zhang, Jiayu; Jiang, Yanxialei; Wang, Zonghua; Zhang, Shusheng
2018-04-25
Intracellular [Ca 2+ ] i and pH i have a close relationship, and their abnormal levels can result in cell dysfunction and accompanying diseases. Thus, simultaneous determination of [Ca 2+ ] i and pH i can more accurately investigate complex biological processes in an integrated platform. Herein, multicolor upconversion nanoparticles (UCNPs) were prepared with the advantages of no spectral overlapping, single NIR excitation wavelengths, and greater tissue penetration depth. The upconversion nanoprobes were easily prepared by the attachment of two fluorescent dyes, Fluo-4 and SNARF-4F. Based on the dual luminescence resonance energy transfer (LRET) process, the blue and green fluorescence of the UCNPs were specially quenched and selectively recovered after the detachment and/or absorbance change of the attached fluorescent dyes, enabling dual detection. Importantly, the developed nanoprobe could successfully be applied for the detection of [Ca 2+ ] i and pH i change in adenosine triphosphate (ATP) and ethylene glycol tetraacetic acid (EGTA) stimulation in living cells. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Off-resonance frequency operation for power transfer in a loosely coupled air core transformer
Scudiere, Matthew B
2012-11-13
A power transmission system includes a loosely coupled air core transformer having a resonance frequency determined by a product of inductance and capacitance of a primary circuit including a primary coil. A secondary circuit is configured to have a substantially same product of inductance and capacitance. A back EMF generating device (e.g., a battery), which generates a back EMF with power transfer, is attached to the secondary circuit. Once the load power of the back EMF generating device exceeds a certain threshold level, which depends on the system parameters, the power transfer can be achieved at higher transfer efficiency if performed at an operating frequency less than the resonance frequency, which can be from 50% to 95% of the resonance frequency.
Facile synthesis and excellent microwave absorption properties of FeCo-C core-shell nanoparticles
Liang, Bingbing; Wang, Shiliang; Kuang, Daitao; Hou, Lizhen; Yu, Bowen; Lin, Liangwu; Deng, Lianwen; Huang, Han; He, Jun
2018-02-01
FeCo-C core-shell nanoparticles (NPs) with diameters of 10-50 nm have been fabricated on a large scale by one-step metal-organic chemical vapor deposition using the mixture of cobalt acetylacetonate and iron acetylacetonate as the precursor. The Fe/Co molar ratio of the alloy nanocores and graphitization degree of C shells, and thus the magnetic and electric properties of the core-shell NPs, can be tuned by the deposition temperature ranging from 700 °C to 900 °C. Comparative tests reveal that a relatively high Fe/Co molar ratio and low graphitization degree benefit the microwave absorption (MA) performance of the core-shell NPs. The composite with 20 wt% core-shell NP obtained at 800 °C and 80 wt% paraffin exhibits an optimal reflection loss ({{R}}{{L}}) of -60.4 dB at 7.5 GHz with a thickness of 3.3 mm, and an effective absorption bandwidth (frequency range for RL ≤10 dB) of 9.2 GHz (8.8-18.0 GHz) under an absorber thickness of 2.5 mm. Our study provides a facile route for the fabrication of alloy-C core-shell nanostructures with high MA performance.
International Nuclear Information System (INIS)
Tatemichi, Shin-ichiro.
1981-01-01
Purpose: To eliminate the variation in the power distribution of a BWR type reactor core in the axial direction even if the flow rate is increased or decreased by providing a difference in the void coefficient between the upper part and the lower parts of the reactor core, and increasing the void coefficient at the lower part of the reactor core. Constitution: The void coefficient of the lower region from the center to the lower part along the axial direction of a nuclear fuel assembly is increased to decrease the dependence on the flow rate of the axial power distribution of the nuclear fuel assembly. That is, a water/fuel ratio is varied, the water in non-boiled region is increased or the neutron spectrum is varied so as to vary the void coefficient. In order to exemplify it, the rate of the internal pellets of the fuel rod of the nuclear fuel assembly or the shape of the channel box is varied. Accordingly, the power does not considerably vary even if the flow rate is altered since the power is varied in the power operation. (Yoshihara, H.)
Numerical investigation of a tunable band-pass plasmonic filter with a hollow-core ring resonator
International Nuclear Information System (INIS)
Setayesh, Amir; Mirnaziry, S Reza; Abrishamian, Mohammad Sadegh
2011-01-01
In this study, a compact nanoscale plasmonic filter which consists of two metal–insulator–metal (MIM) waveguides coupled to each other by a rectangular ring resonator is presented and investigated numerically. The propagating modes of surface plasmon polaritons (SPPs) are studied in this structure. By replacing a portion of the ring core with air, while the outer dimensions of the structure are kept constant, we illustrate the possibility of the redshift of resonant wavelengths in order to tune the resonance modes. This feature is useful for integrated circuits in which we have limitations on the outer dimensions of the filter structure and it is not possible to enlarge the dimension of the ring resonator to reach longer resonant wavelengths. The corresponding results are illustrated by the 2D finite-difference time-domain (FDTD) method. The proposed structure has potential applications in plasmonic integrated circuits and can be simply fabricated
Numerical investigation of a tunable band-pass plasmonic filter with a hollow-core ring resonator
Setayesh, Amir; Mirnaziry, S. Reza; Sadegh Abrishamian, Mohammad
2011-03-01
In this study, a compact nanoscale plasmonic filter which consists of two metal-insulator-metal (MIM) waveguides coupled to each other by a rectangular ring resonator is presented and investigated numerically. The propagating modes of surface plasmon polaritons (SPPs) are studied in this structure. By replacing a portion of the ring core with air, while the outer dimensions of the structure are kept constant, we illustrate the possibility of the redshift of resonant wavelengths in order to tune the resonance modes. This feature is useful for integrated circuits in which we have limitations on the outer dimensions of the filter structure and it is not possible to enlarge the dimension of the ring resonator to reach longer resonant wavelengths. The corresponding results are illustrated by the 2D finite-difference time-domain (FDTD) method. The proposed structure has potential applications in plasmonic integrated circuits and can be simply fabricated.
Alexander, Anthony J; Ma, Lianjia
2009-02-27
This paper focuses on the application of RPLC x RPLC to pharmaceutical analysis and addresses the specific problem of separating co-eluting impurities/degradation products that maybe "hidden" within the peak envelope of the active pharmaceutical ingredient (API) and thus may escape detection by conventional methods. A comprehensive two-dimensional liquid chromatograph (LC x LC) was constructed from commercially available HPLC equipment. This system utilizes two independently configurable 2nd dimension binary pumping systems to deliver independent flow rates, gradient profiles and mobile phase compositions to dual Fused-Core secondary columns. Very fast gradient separations (30s total cycle time) were achieved at ambient temperature without excessive backpressure and without compromising optimal 1st dimension sampling rates. The operation of the interface is demonstrated for the analysis of a 1mg/ml standard mixture containing 0.05% of a minor component. The practicality of using RPLC x RPLC for the analysis of actual co-eluting pharmaceutical degradation products, by exploiting pH-induced changes in selectivity, is also demonstrated using a three component mixture. This mixture (an API, an oxidation product of the API at 1.0%, w/w, and a photo degradant of the API at 0.5%, w/w) was used to assess the stability indicating nature of an established LC method for analysis of the API.
Research on dual-parameter optical fiber sensor based on thin-core fiber and spherical structure
Tong, Zhengrong; Wang, Xue; Zhang, Weihua; Xue, Lifang
2018-04-01
A novel dual-parameter optical fiber sensor is proposed and experimentally demonstrated. The proposed sensor is based on a fiber in-line Mach-Zehnder interferometer, which is fabricated by sandwiching a section of thin-core fiber between two spherical structures made of single-mode fibers. The transmission spectrum exhibits the response of the interference between the core and the different cladding modes. Due to the different wavelength shifts of the two selected dips, the simultaneous measurement of temperature and the surrounding refractive index can be achieved. The measured temperature sensitivities are 0.067 nm/°C and 0.050 nm/°C, and the refractive index sensitivities are -119.9 nm/RIU and -69.71 nm/RIU, respectively. In addition, the compact size, simple fabrication and cost-effectiveness of the fiber sensor are also advantages.
Electromagnetic Form Factors of Hadrons in Dual-Large Nc QCD
International Nuclear Information System (INIS)
Dominguez, C. A.
2011-01-01
In this talk, results are presented of determinations of electromagnetic form factors of hadrons (pion, proton, and Δ(1236)) in the framework of Dual-Large N c QCD (Dual-QCD ∞ ). This framework improves considerably tree-level VMD results by incorporating an infinite number of zero-width resonances, with masses and couplings fixed by the dual-resonance (Veneziano-type) model.
Novel gas sensor with dual response under CO(g) exposure: Optical and electrical stimuli
Rocha, L. S. R.; Cilense, M.; Ponce, M. A.; Aldao, C. M.; Oliveira, L. L.; Longo, E.; Simoes, A. Z.
2018-05-01
In this work, a lanthanum (La) doped ceria (CeO2) film, which depicted a dual gas sensing response (electric and optical) for CO(g) detection, was obtained by the microwave-assisted hydrothermal (HAM) synthesis and deposited by the screen-printing technique, in order to prevent deaths by intoxication with this life-threatening gas. An electric response under CO(g) exposure was obtained, along with an extremely fast optical response for a temperature of 380 °C, associated with Ce+4 reduction and vacancy generation. A direct optical gap was found to be around 2.31 eV from UV-Vis results, which corresponds to a transition from valence band to 4f states. Due to the anomalous electron configuration of cerium atoms with 4f electrons in its reduced state, they are likely to present an electric conduction based on the small polaron theory with a hopping mechanism responsible for its dual sensing response with a complete reversible behaviour.
Conceptual design of PFBR core
International Nuclear Information System (INIS)
Lee, S.M.; Govindarajan, S.; Indira, R.; John, T.M.; Mohanakrishnan, P.; Shankar Singh, R.; Bhoje, S.B.
1996-01-01
The design options selected for the core of the 500 MWe Prototype Fast Breeder Reactor are presented. PFBR has a conventional mixed oxide fuel core of homogeneous type with two enrichment zones for power flattening and with radial and axial blankets to make the reactor self-sustaining in fissile material. Pin diameter has been selected for minimization of fissile inventory. Considerations for the choice of number of pins per subassembly, integrated versus separate axial blankets, and other pin and subassembly parameters are discussed. As the core size is moderate, no special schemes for reducing the maximum positive sodium voiding coefficient is envisages. Two independent, diverse fast acting shutdown systems working in fail-safe mode are selected. The number of absorber rods has been minimized by choosing a layout for maximum antishadow effect. Nine control and safety rods are distributed in two rods for power flattening by differential insertion. Three Diverse Safety Rods, are also provided which are normally fully withdrawn. The optimization of layout of radial and axial shielding and adequacy of flux at detector location are also discussed. (author). 2 figs
Effective height of the core of the Dalat Nuclear Research Reactor
Energy Technology Data Exchange (ETDEWEB)
Huy, Ngo Quang [Centre for Nuclear Technique Application, Ho Chi Minh City (Viet Nam); Thong, Ha Van; Long, Vu Hai; Binh, Nguyen Duc; Tuan, Nguyen Minh; Vien, Luong Ba; Vinh, Le Vinh [Nuclear Research Inst., Da Lat (Viet Nam); Martin, D P; Yip, F G [High Institute of Nuclear Sciences and Technology (Cuba)
1994-10-01
Measurements of thermal neutron relative distributions in axial direction at different positions in the reactor core and for various control rod configurations have been carried out, and axial buckling and effective height of the core deduced. (author). 4 refs., 3 figs., 1 tab.
Thomas, S.; Reethu, K.; Thanveer, T.; Myint, M. T. Z.; Al-Harthi, S. H.
2017-08-01
The exchange bias blocking temperature distribution of naturally oxidized Co-CoO core-shell nanoparticles exhibits two distinct signatures. These are associated with the existence of two magnetic entities which are responsible for the temperature dependence of an exchange bias field. One is from the CoO grains which undergo thermally activated magnetization reversal. The other is from the disordered spins at the Co-CoO interface which exhibits spin-glass-like behavior. We investigated the oxide shell thickness dependence of the exchange bias effect. For particles with a 3 nm thick CoO shell, the predominant contribution to the temperature dependence of exchange bias is the interfacial spin-glass layer. On increasing the shell thickness to 4 nm, the contribution from the spin-glass layer decreases, while upholding the antiferromagnetic grain contribution. For samples with a 4 nm CoO shell, the exchange bias training was minimal. On the other hand, 3 nm samples exhibited both the training effect and a peak in coercivity at an intermediate set temperature Ta. This is explained using a magnetic core-shell model including disordered spins at the interface.
Multilevel resonance analysis of sup 59 Co neutron transmission measurements
Energy Technology Data Exchange (ETDEWEB)
De Saussure, G.; Larson, N.M.; Harvey, J.A.; Hill, N.W. (Oak Ridge National Lab., TN (United States))
1992-07-01
Large discrepancies exist between the recent high-resolution neutron transmission data of {sup 59}Co measured at the Oak Ridge Electron Linear Accelerator (ORELA) and transmissions computed from the resolved resonance parameters of the nuclear data collection ENDF/B-VI. In order to provide new resonance parameters consistent with these data, the transmission measurements have been analyzed with the computer code SAMMY in the energy range 200 eV to 100 keV. The resonance parameters reported in this paper provide an accurate total cross section from 10{sup -5} eV to 100 keV and correctly reproduce the thermal capture cross section. Thermal cross-section values and related quantities are also reviewed here. (author).
International Nuclear Information System (INIS)
Chen, J.M.; Lu, K.T.; Lee, J.M.; Ho, S.C.; Chang, H.W.; Lee, Y.Y.
2005-01-01
State-selective dissociation dynamics for the excited fragments of gaseous Si(CH 3 ) 2 Cl 2 following Cl 2p and Si 2p core-level excitations have been investigated by resonant photoemission spectroscopy and dispersed UV/optical fluorescence spectroscopy. The main features in the gaseous Si(CH 3 ) 2 Cl 2 fluorescence spectrum are identified as the emission from excited Si*, Si + *, CH* and H*. The core-to-Rydberg excitations at both Si 2p and Cl 2p edges lead to a noteworthy production of not only the excited atomic fragments, neutral and ionic (Si*, Si + *) but also the excited diatomic fragments (CH*). In particular, the excited neutral atomic fragments Si* are significantly reinforced. The experimental results provide deeper insight into the state-selective dissociation dynamics for the excited fragments of molecules via core-level excitation
A Low-Cost and Portable Dual-Channel Fiber Optic Surface Plasmon Resonance System.
Liu, Qiang; Liu, Yun; Chen, Shimeng; Wang, Fang; Peng, Wei
2017-12-04
A miniaturization and integration dual-channel fiber optic surface plasmon resonance (SPR) system was proposed and demonstrated in this paper. We used a yellow light-emitting diode (LED, peak wavelength 595 nm) and built-in web camera as a light source and detector, respectively. Except for the detection channel, one of the sensors was used as a reference channel to compensate nonspecific binding and physical absorption. We packaged the LED and surface plasmon resonance (SPR) sensors together, which are flexible enough to be applied to mobile devices as a compact and portable system. Experimental results show that the normalized intensity shift and refractive index (RI) of the sample have a good linear relationship in the RI range from 1.328 to 1.348. We used this sensor to monitor the reversible, specific interaction between lectin concanavalin A (Con A) and glycoprotein ribonuclease B (RNase B), which demonstrate its capabilities of specific identification and biochemical samples concentration detection. This sensor system has potential applications in various fields, such as medical diagnosis, public health, food safety, and environment monitoring.
Alginate Encapsulation of Pluripotent Stem Cells Using a Co-axial Nozzle.
Horiguchi, Ikki; Sakai, Yasuyuki
2015-07-02
Pluripotent stem cells (PS cells) are the focus of intense research due to their role in regenerative medicine and drug screening. However, the development of a mass culture system would be required for using PS cells in these applications. Suspension culture is one promising culture method for the mass production of PS cells, although some issues such as controlling aggregation and limiting shear stress from the culture medium are still unsolved. In order to solve these problems, we developed a method of calcium alginate (Alg-Ca) encapsulation using a co-axial nozzle. This method can control the size of the capsules easily by co-flowing N₂ gas. The controllable capsule diameter must be larger than 500 µm because too high a flow rate of N₂ gas causes the breakdown of droplets and thus heterogeneous-sized capsules. Moreover, a low concentration of Alg-Na and CaCl₂ causes non-spherical capsules. Although an Alg-Ca capsule without a coating of Alg-PLL easily dissolves enabling the collection of cells, they can also potentially leak out from capsules lacking an Alg-PLL coating. Indeed, an alginate-PLL coating can prevent cellular leakage but is also hard to break. This technology can be used to research the stem cell niche as well as the mass production of PS cells because encapsulation can modify the micro-environment surrounding cells including the extracellular matrix and the concentration of secreted factors.
Synthesis of Co 2SnO 4@C core-shell nanostructures with reversible lithium storage
Qi, Yue; Du, Ning; Zhang, Hui; Wu, Ping; Yang, Deren
This paper reports the synthesis of Co 2SnO 4@C core-shell nanostructures through a simple glucose hydrothermal and subsequent carbonization approach. The as-synthesized Co 2SnO 4@C core-shell nanostructures have been applied as anode materials for lithium-ion batteries, which exhibit improved cyclic performance compared to pure Co 2SnO 4 nanocrystals. The carbon matrix has good volume buffering effect and high electronic conductivity, which may be responsible for the improved cyclic performance.
A Superconducting Dual-Channel Photonic Switch.
Srivastava, Yogesh Kumar; Manjappa, Manukumara; Cong, Longqing; Krishnamoorthy, Harish N S; Savinov, Vassili; Pitchappa, Prakash; Singh, Ranjan
2018-06-05
The mechanism of Cooper pair formation and its underlying physics has long occupied the investigation into high temperature (high-T c ) cuprate superconductors. One of the ways to unravel this is to observe the ultrafast response present in the charge carrier dynamics of a photoexcited specimen. This results in an interesting approach to exploit the dissipation-less dynamic features of superconductors to be utilized for designing high-performance active subwavelength photonic devices with extremely low-loss operation. Here, dual-channel, ultrafast, all-optical switching and modulation between the resistive and the superconducting quantum mechanical phase is experimentally demonstrated. The ultrafast phase switching is demonstrated via modulation of sharp Fano resonance of a high-T c yttrium barium copper oxide (YBCO) superconducting metamaterial device. Upon photoexcitation by femtosecond light pulses, the ultrasensitive cuprate superconductor undergoes dual dissociation-relaxation dynamics, with restoration of superconductivity within a cycle, and thereby establishes the existence of dual switching windows within a timescale of 80 ps. Pathways are explored to engineer the secondary dissociation channel which provides unprecedented control over the switching speed. Most importantly, the results envision new ways to accomplish low-loss, ultrafast, and ultrasensitive dual-channel switching applications that are inaccessible through conventional metallic and dielectric based metamaterials. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Preparation of paclitaxel/chitosan co-assembled core-shell nanofibers for drug-eluting stent
Energy Technology Data Exchange (ETDEWEB)
Tang, Jing; Liu, Yongjia [Instrumental Analysis Center, Shanghai Jiao Tong University, 200240 Shanghai (China); State Key Laboratory of Metal Matrix Composites, School of Chemistry and Chemical Engineering, Shanghai Jiao Tong University, 200240 Shanghai (China); Zhu, Bangshang, E-mail: bshzhu@sjtu.edu.cn [Instrumental Analysis Center, Shanghai Jiao Tong University, 200240 Shanghai (China); State Key Laboratory for Modification of Chemical Fibers and Polymer Materials, Donghua University, 201620 Shanghai (China); Su, Yue; Zhu, Xinyuan [State Key Laboratory of Metal Matrix Composites, School of Chemistry and Chemical Engineering, Shanghai Jiao Tong University, 200240 Shanghai (China)
2017-01-30
Highlights: • The core-shell nanofibers (NFs) were made by the co-assembly of paclitaxel (PTX) and chitosan(CS). • The PTX/CS NFs have high PTX loading content, slow drug release and low adherence of platelets. • The PTX/CS NFs have low cytotoxicity and good haemocompatibility. • The PTX/CS NFs which could be easily coated on stents could have potential application for drug eluting stents. - Abstract: The paclitaxel/chitosan (PTX/CS) core-shell nanofibers (NFs) are easily prepared by co-assembly of PTX and CS and used in drug-eluting stent. The mixture solution of PTX (dissolved in ethanol) and CS (dissolved in 1% acetic acid water solution) under sonication will make the formation of NFs, in which small molecule PTX co-assembles with biomacromolecular CS through non-covalent interactions. The obtained NFs are tens to hundreds nanometers in diameter and millimeter level in length. Furthermore, the structure of PTX/CS NFs was characterized by confocal laser scanning microscopy (CLSM), zeta potential, X-ray photoelectron spectroscopy (XPS) and nanoscale infra-red (nanoIR), which provided evidences demonstrated that PTX/CS NFs are core-shell structures. The ‘shell’ of CS wrapped outside of the NFs, while PTX is located in the core. Thus it resulted in high drug loading content (>40 wt.%). The well-controlled drug release, low cytotoxicity and good haemocompatibility were also found in drug carrier system of PTX/CS NFs. In addition, the hydrophilic and flexible properties of NFs make them easily coating and filming on stent to prepare drug-eluting stent (DES). Therefore, this study provides a convenient method to prepare high PTX loaded NFs, which is a promising nano-drug carrier used for DES and other biomedical applications. The possible molecular mechanism of PTX and CS co-assembly and core-shell nanofiber formation is also explored. Statement of significance: We develop a convenient and efficient approach to fabricate core-shell nanofibers (NFs) through
Long-term evaluation of orbital dynamics in the Sun-planet system considering axial-tilt
Bakhtiari, Majid; Daneshjou, Kamran
2018-05-01
In this paper, the axial-tilt (obliquity) effect of planets on the motion of planets’ orbiter in prolonged space missions has been investigated in the presence of the Sun gravity. The proposed model is based on non-simplified perturbed dynamic equations of planetary orbiter motion. From a new point of view, in this work, the dynamic equations regarding a disturbing body in elliptic inclined three-dimensional orbit are derived. The accuracy of this non-simplified method is validated with dual-averaged method employed on a generalized Earth-Moon system. It is shown that the neglected short-time oscillations in dual-averaged technique can accumulate and propel to remarkable errors in the prolonged evolution. After validation, the effects of the planet’s axial-tilt on eccentricity, inclination and right ascension of the ascending node of the orbiter are investigated. Moreover, a generalized model is provided to study the effects of third-body inclination and eccentricity on orbit characteristics. It is shown that the planet’s axial-tilt is the key to facilitating some significant changes in orbital elements in long-term mission and short-time oscillations must be considered in accurate prolonged evaluation.
Energy Technology Data Exchange (ETDEWEB)
An, Yanling; Wei, Pan; Fan, Meiqiang, E-mail: fanmeiqiang@126.com; Chen, Da; Chen, Haichao; Ju, QiangJian; Tian, Guanglei; Shu, Kangying
2016-07-01
Highlights: • A dual core-shell hPANI/S/PANI composite was prepared in situ synthesis. • Cycle performance of the hPANI/S/PANI composite was enhanced. • The improvement was due to fine sulfur particles wrapped by two PANI films. • Some positive effects were elaborated. - Abstract: In this study, a dual-shell hollow polyaniline/sulfur-core/polyaniline (hPANI/S/PANI) composite was prepared by successively depositing PANI, S, and PANI on the surface of a template silicon sphere. The electrochemical properties of this composite were evaluated using a lithium plate as an anode in lithium/sulfur cells. The hPANI/S/PANI composite showed a discharge capacity of 572.2 mAh g{sup −1} after 214 cycles at 0.1 C, and the Coulombic efficiency was above 87% in the whole charge/discharge cycle. The improved cycle property of the hPANI/S/PANI composite can be ascribed to the fine sulfur particles homogeneously deposited on the PANI surface and sprawled inside the two PANI layers during the charge/discharge cycle. This behavior stabilized the nanostructure of sulfur and enhanced its conductivity.
Synthesis of Co/MFe(2)O(4) (M = Fe, Mn) Core/Shell Nanocomposite Particles.
Peng, Sheng; Xie, Jin; Sun, Shouheng
2008-01-01
Monodispersed cobalt nanoparticles (NPs) with controllable size (8-14 nm) have been synthesized using thermal decomposition of dicobaltoctacarbonyl in organic solvent. The as-synthesized high magnetic moment (125 emu/g) Co NPs are dispersible in various organic solvents, and can be easily transferred into aqueous phase by surface modification using phospholipids. However, the modified hydrophilic Co NPs are not stable as they are quickly oxidized, agglomerated in buffer. Co NPs are stabilized by coating the MFe(2)O(4) (M = Fe, Mn) ferrite shell. Core/shell structured bimagnetic Co/MFe(2)O(4) nanocomposites are prepared with tunable shell thickness (1-5 nm). The Co/MFe(2)O(4) nanocomposites retain the high magnetic moment density from the Co core, while gaining chemical and magnetic stability from the ferrite shell. Comparing to Co NPs, the nanocomposites show much enhanced stability in buffer solution at elevated temperatures, making them promising for biomedical applications.
James, Susan H; Wald, Rachel; Wintersperger, Bernd J; Jimenez-Juan, Laura; Deva, Djeven; Crean, Andrew M; Nguyen, Elsie; Paul, Narinder S; Ley, Sebastian
2013-08-01
The left ventricle (LV) is routinely assessed with cardiac magnetic resonance imaging (MRI) by using short-axis orientation; it remains unclear whether the right ventricle (RV) can also be adequately assessed in this orientation or whether dedicated axial orientation is required. We used phase-contrast (PC) flow measurements in the main pulmonary artery (MPA) and the ascending aorta (Aorta) as nonvolumetric standard of reference and compared RV and LV volumes in short-axis and axial orientations. A retrospective analysis identified 30 patients with cardiac MRI data sets. Patients underwent MRI (1.5 T or 3 T), with retrospectively gated cine steady-state free-precession in axial and short-axis orientations. PC flow analyses of MPA and Aorta were used as the reference measure of RV and LV output. There was a high linear correlation between MPA-PC flow and RV-stroke volume (SV) short axis (r = 0.9) and RV-SV axial (r = 0.9). Bland-Altman analysis revealed a mean offset of 1.4 mL for RV axial and -2.3 mL for RV-short-axis vs MPA-PC flow. There was a high linear correlation between Aorta-PC flow and LV-SV short-axis (r = 0.9) and LV-SV axial (r = 0.9). Bland-Altman analysis revealed a mean offset of 4.8 m for LV short axis and 7.0 mL for LV axial vs Aorta-PC flow. There was no significant difference (P = .6) between short-axis-LV SV and short-axis-RV SV. No significant impact of the slice acquisition orientation for determination of RV and LV stroke volumes was found. Therefore, cardiac magnetic resonance workflow does not need to be extended by an axial data set for patients without complex cardiac disease for assessment of biventricular function and volumes. Copyright © 2013 Canadian Association of Radiologists. Published by Elsevier Inc. All rights reserved.
Recent developments in CO2 lasers
Du, Keming
1993-05-01
CO2 lasers have been used in industry mainly for such things as cutting, welding, and surface processing. To conduct a broad spectrum of high-speed and high-quality applications, most of the developments in industrial CO2 lasers at the ILT are aimed at increasing the output power, optimizing the beam quality, and reducing the production costs. Most of the commercial CO2 lasers above 5 kW are transverse-flow systems using dc excitation. The applications of these lasers are limited due to the lower beam quality, the poor point stability, and the lower modulation frequency. To overcome the problems we developed a fast axial- flow CO2 laser using rf excitation with an output of 13 kW. In section 2 some of the results are discussed concerning the gas flow, the discharge, the resonator design, optical effects of active medium, the aerodynamic window, and the modulation of the output power. The first CO2 lasers ever built are diffusion-cooled systems with conventional dc excited cylindrical discharge tubes surrounded by cooling jackets. The output power per unit length is limited to 50 W/m by those lasers with cylindrical tubes. In the past few years considerable increases in the output power were achieved, using new mechanical geometries, excitation- techniques, and resonator designs. This progress in diffusion-cooled CO2 lasers is presented in section 3.
International Nuclear Information System (INIS)
An, Lu; Yu, Yanrong; Li, Xuejian; Liu, Wei; Yang, Hong; Wu, Dongmei; Yang, Shiping
2014-01-01
Graphical abstract: A dextran-coated Fe–Co nanoalloy was developed serving as a sensitive contrast agent for magnetic resonance imaging applications. - Highlights: • Amorphous Fe–Co nanoalloy was prepared via wet chemical reduction approach. • The Fe–Co nanoalloy is water-soluble, stable, and biocompatible. • The Fe–Co nanoalloy is superparamagnetic. • The Fe–Co nanoalloy exhibits T 2 -weighted MR enhancement both in vitro and in vivo. - Abstract: For magnetic resonance imaging applications, a facile approach for water-soluble dextran coated amorphous Fe–Co nanoalloy was developed. The as-synthesized nanoalloy had a diameter of 9 nm with a narrow size distribution and showed superparamagnetic property with a saturated magnetization (Ms) of 25 emu/g. In vitro cytotoxicity test revealed that it was biocompatible at a concentration below 120 μg/mL. It can be uptaken by HeLa cells effectively and resulted in the obvious T 2 effect after internalization. Biodistribution studies in conjunction with inductively coupled plasma-atomic emission spectroscopy (ICP-AES) confirmed that Fe–Co nanoalloy was preferentially accumulated in lung and spleen after intravenous injection for 4 h. In vivo MRI, dextran-coated Fe–Co nanoalloy can serve as a sensitive contrast agent for MR imaging, especially in the spleen, so we believe that it maybe hold great promise for diagnosis of splenic disease by appropriately functionalizing their surface
Energy Technology Data Exchange (ETDEWEB)
An, Lu; Yu, Yanrong; Li, Xuejian; Liu, Wei [The Key Laboratory of Resource Chemistry of Ministry of Education and Shanghai Key Laboratory of Rare Earth Functional Materials, Department of Chemistry, Shanghai Normal University, Shanghai 200234 (China); Yang, Hong, E-mail: yanghong@shnu.edu.cn [The Key Laboratory of Resource Chemistry of Ministry of Education and Shanghai Key Laboratory of Rare Earth Functional Materials, Department of Chemistry, Shanghai Normal University, Shanghai 200234 (China); Wu, Dongmei [Shanghai Key Laboratory of Magnetic Resonance, Department of Physics, East China Normal University, 3663 North Zhongshan Road, Shanghai 200062 (China); Yang, Shiping, E-mail: shipingy@shnu.edu.cn [The Key Laboratory of Resource Chemistry of Ministry of Education and Shanghai Key Laboratory of Rare Earth Functional Materials, Department of Chemistry, Shanghai Normal University, Shanghai 200234 (China)
2014-01-01
Graphical abstract: A dextran-coated Fe–Co nanoalloy was developed serving as a sensitive contrast agent for magnetic resonance imaging applications. - Highlights: • Amorphous Fe–Co nanoalloy was prepared via wet chemical reduction approach. • The Fe–Co nanoalloy is water-soluble, stable, and biocompatible. • The Fe–Co nanoalloy is superparamagnetic. • The Fe–Co nanoalloy exhibits T{sub 2}-weighted MR enhancement both in vitro and in vivo. - Abstract: For magnetic resonance imaging applications, a facile approach for water-soluble dextran coated amorphous Fe–Co nanoalloy was developed. The as-synthesized nanoalloy had a diameter of 9 nm with a narrow size distribution and showed superparamagnetic property with a saturated magnetization (Ms) of 25 emu/g. In vitro cytotoxicity test revealed that it was biocompatible at a concentration below 120 μg/mL. It can be uptaken by HeLa cells effectively and resulted in the obvious T{sub 2} effect after internalization. Biodistribution studies in conjunction with inductively coupled plasma-atomic emission spectroscopy (ICP-AES) confirmed that Fe–Co nanoalloy was preferentially accumulated in lung and spleen after intravenous injection for 4 h. In vivo MRI, dextran-coated Fe–Co nanoalloy can serve as a sensitive contrast agent for MR imaging, especially in the spleen, so we believe that it maybe hold great promise for diagnosis of splenic disease by appropriately functionalizing their surface.
Contributed Review: Nuclear magnetic resonance core analysis at 0.3 T
International Nuclear Information System (INIS)
Mitchell, Jonathan; Fordham, Edmund J.
2014-01-01
Nuclear magnetic resonance (NMR) provides a powerful toolbox for petrophysical characterization of reservoir core plugs and fluids in the laboratory. Previously, there has been considerable focus on low field magnet technology for well log calibration. Now there is renewed interest in the study of reservoir samples using stronger magnets to complement these standard NMR measurements. Here, the capabilities of an imaging magnet with a field strength of 0.3 T (corresponding to 12.9 MHz for proton) are reviewed in the context of reservoir core analysis. Quantitative estimates of porosity (saturation) and pore size distributions are obtained under favorable conditions (e.g., in carbonates), with the added advantage of multidimensional imaging, detection of lower gyromagnetic ratio nuclei, and short probe recovery times that make the system suitable for shale studies. Intermediate field instruments provide quantitative porosity maps of rock plugs that cannot be obtained using high field medical scanners due to the field-dependent susceptibility contrast in the porous medium. Example data are presented that highlight the potential applications of an intermediate field imaging instrument as a complement to low field instruments in core analysis and for materials science studies in general
An Exposed-Core Grapefruit Fibers Based Surface Plasmon Resonance Sensor
Directory of Open Access Journals (Sweden)
Xianchao Yang
2015-07-01
Full Text Available To solve the problem of air hole coating and analyte filling in microstructured optical fiber-based surface plasmon resonance (SPR sensors, we designed an exposed-core grapefruit fiber (EC-GFs-based SPR sensor. The exposed section of the EC-GF is coated with a SPR, supporting thin silver film, which can sense the analyte in the external environment. The asymmetrically coated fiber can support two separate resonance peaks (x- and y-polarized peaks with orthogonal polarizations and x-polarized peak, providing a much higher peak loss than y-polarized, also the x-polarized peak has higher wavelength and amplitude sensitivities. A large analyte refractive index (RI range from 1.33 to 1.42 is calculated to investigate the sensing performance of the sensor, and an extremely high wavelength sensitivity of 13,500 nm/refractive index unit (RIU is obtained. The silver layer thickness, which may affect the sensing performance, is also discussed. This work can provide a reference for developing a high sensitivity, real-time, fast-response, and distributed SPR RI sensor.
Fast core prediction simulator for load follow control
International Nuclear Information System (INIS)
Yim, Man Sung; Lee, Sang Hoon; Lee, Un Chul
1990-01-01
An operator-assisting system for the reactor core control under power changing operating condition was developed. The system is consisted of core simulator routine and Xenon and Iodine initial condition generation routine. The initial condition generation routine, without exactly knowing the core status, is capable of providing accurate number densities and axial offset conditions of Xenon and Iodine after several hours of predictor- corrector calculations using the plant instrumentation signals of power level and power axial offset. The core simulator routine, even with the two node core model, gives equivalently accurate results as the one-dimensional model for the core behaviour simulation under power changing condition and can provide proper control strategies for load follow operation. The core simulator can also be used by the operator to develop remedial actions to restore the distorted power distribution by using its prediction capability
Efficient primary and parametric resonance excitation of bistable resonators
Ramini, Abdallah; Alcheikh, Nouha; Ilyas, Saad; Younis, Mohammad I.
2016-01-01
efficient and requires less power for primary resonance excitation. Moreover, unlike the classical method where the structure is vulnerable to the dynamic pull-in instability, the axial excitation technique can provide large amplitude motion while protecting
Low loss mid-IR transmission bands using silica hollow-core anisotropic anti-resonant fibers
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
In this paper, a node-free anisotropic hollow-core anti-resonant fiber has been proposed to give low transmission loss in the near-IR to mid-IR spectral regime. The proposed silica-based fiber design shows transmission loss below 10 dB/km at 2.94 μm with multiple low loss transmission bands. Tran...
Electrochemical characterization of core@shell CoFe{sub 2}O{sub 4}/Au composite
Energy Technology Data Exchange (ETDEWEB)
Carla, Francesco [' Ugo Schiff' , Universita degli Studi di Firenze, Dipartimento di Chimica (Italy); Campo, Giulio; Sangregorio, Claudio; Caneschi, Andrea; Julian Fernandez, Cesar de; Cabrera, Lourdes I., E-mail: lourisa_cabrera@yahoo.com [Universita degli Studi di Firenze, Laboratorio di Magnetismo Molecolare, INSTM, Dipartimento di Chimica (Italy)
2013-08-15
In this paper, we address the synthesis and characterization of the core@shell composite magneto-plasmonic cobalt ferrite-gold (Co-ferrite/Au) nanosystem. The synthesis Co-ferrite/Au nanocomposite is not obvious, hence it was of interest to generate it in a simple straightforward method. Co-ferrite/Au nanocomposite was generated by synthesizing first by thermal decomposition Co-ferrite nanoparticles (NPs). On a second step, ionic gold (Au{sup 3+}) was reduced at the surface of Co-ferrite NPs by ultrasound, to obtain the metallic Au shell. The characterization of the nanomaterial was achieved by microscopy, spectroscopy, and performing magnetic measurements. However, what is attractive about our work is the use of electrochemical techniques as analytical tools. The key technique was cyclic voltammetry, which provided information about the nature and structure of the nanocomposite, allowing us to confirm the core@shell structure.
International Nuclear Information System (INIS)
Shah, J.G.; Yalmali, V.S.; Tawde, Manisha; Mishra, R.
2006-01-01
The need of nuclear power as an energy source requires the solution of many problems. One of the most important is fixation of high level radioactive waste (HLW) in suitable borosilicate glass formulation. The major issue with this process is maximum waste loading in the final vitrified product without compromising on long term product characteristics. The electrical resistivity measurement at high temperature could not be measured with good precision using standard parallel plate electrode configuration due to error in cell constant measurement. Hence a high accuracy, calibration free technique consisting of co-axial electrodes was employed
Nasir, Jamal; Jamaluddin, Mohd Haizal; Ahmad Khan, Aftab; Kamarudin, Muhammad Ramlee; Yen, Bruce Leow Chee; Owais, Owais
2017-01-13
An L-shaped dual-band multiple-input multiple-output (MIMO) rectangular dielectric resonator antenna (RDRA) for long term evolution (LTE) applications is proposed. The presented antenna can transmit and receive information independently using fundamental TE 111 and higher order TE 121 modes of the DRA. TE 111 degenerate mode covers LTE band 2 (1.85-1.99 GHz), 3 (1.71-1.88 GHz), and 9 (1.7499-1.7849 GHz) at f r = 1.8 GHz whereas TE 121 covers LTE band 7 (2.5-2.69 GHz) at f r = 2.6 GHz, respectively. An efficient design method has been used to reduce mutual coupling between ports by changing the effective permittivity values of DRA by introducing a cylindrical air-gap at an optimal position in the dielectric resonator. This air-gap along with matching strips at the corners of the dielectric resonator keeps the isolation at a value more than 17 dB at both the bands. The diversity performance has also been evaluated by calculating the envelope correlation coefficient, diversity gain, and mean effective gain of the proposed design. MIMO performance has been evaluated by measuring the throughput of the proposed MIMO antenna. Experimental results successfully validate the presented design methodology in this work.
Song, Hyon-Min; Wei, Qingshan; Ong, Quy K.; Wei, Alexander
2010-01-01
Plasmon-resonant gold nanostars (NSTs) with magnetic cores were synthesized by a multistep sequence from superparamagnetic Fe3O4 nanoparticles (NPs), and evaluated as optical contrast agents under magnetomotive (MM) imaging conditions. Core–shell Fe3O4@Au NPs were prepared in nonpolar organic solvents with nanometer control over shell thickness, and with good epitaxy to the Fe3O4 surface. Anisotropic growth was performed in micellar solutions of cetyltrimethylammonium bromide (CTAB) under mil...
International Nuclear Information System (INIS)
Prabhu Gaunkar, N.; Bouda, N. R. Y.; Nlebedim, I. C.; Hadimani, R. L.; Mina, M.; Jiles, D. C.; Bulu, I.; Ganesan, K.; Song, Y. Q.
2015-01-01
This work presents investigations and detailed analysis of ringing in a non-resonant pulsed nuclear magnetic resonance (NMR) circuit. Ringing is a commonly observed phenomenon in high power switching circuits. The oscillations described as ringing impede measurements in pulsed NMR systems. It is therefore desirable that those oscillations decay fast. It is often assumed that one of the causes behind ringing is the role of the magnetic core used in the antenna (acting as an inductive load). We will demonstrate that an LRC subcircuit is also set-up due to the inductive load and needs to be considered due to its parasitic effects. It is observed that the parasitics associated with the inductive load become important at certain frequencies. The output response can be related to the response of an under-damped circuit and to the magnetic core material. This research work demonstrates and discusses ways of controlling ringing by considering interrelationships between different contributing factors
Energy Technology Data Exchange (ETDEWEB)
Prabhu Gaunkar, N., E-mail: neelampg@iastate.edu; Bouda, N. R. Y.; Nlebedim, I. C.; Hadimani, R. L.; Mina, M.; Jiles, D. C. [Department of Electrical and Computer Engineering, Iowa State University, Ames, Iowa 50011 (United States); Bulu, I.; Ganesan, K.; Song, Y. Q. [Schlumberger-Doll Research, Cambridge, Massachusetts 02139 (United States)
2015-05-07
This work presents investigations and detailed analysis of ringing in a non-resonant pulsed nuclear magnetic resonance (NMR) circuit. Ringing is a commonly observed phenomenon in high power switching circuits. The oscillations described as ringing impede measurements in pulsed NMR systems. It is therefore desirable that those oscillations decay fast. It is often assumed that one of the causes behind ringing is the role of the magnetic core used in the antenna (acting as an inductive load). We will demonstrate that an LRC subcircuit is also set-up due to the inductive load and needs to be considered due to its parasitic effects. It is observed that the parasitics associated with the inductive load become important at certain frequencies. The output response can be related to the response of an under-damped circuit and to the magnetic core material. This research work demonstrates and discusses ways of controlling ringing by considering interrelationships between different contributing factors.
Zhao, Mengen; Chen, Zhenhua; Lv, Xinyan; Zhou, Kang; Zhang, Jie; Tian, Xiaohan; Ren, Xiuli; Mei, Xifan
2017-09-01
Core-shell structured CaCO3 microspheres (MSs) were prepared by a facile, one-pot method at room temperature. The adsorbent dosage and adsorption time of the obtained CaCO3 MSs were investigated. The results suggest that these CaCO3 MSs can rapidly and efficiently remove 99-100% of anionic dyes within the first 2 min. The obtained CaCO3 MSs have a high Brunauer-Emmett-Teller surface area (211.77 m2 g-1). In addition, the maximum adsorption capacity of the obtained CaCO3 MSs towards Congo red was 99.6 mg g-1. We also found that the core-shell structured CaCO3 MSs have a high recycling capability for removing dyes from water. Our results demonstrate that the prepared core-shell structured CaCO3 MSs can be used as an ideal, rapid, efficient and recyclable adsorbent to remove dyes from aqueous solution.
Numerical aspects of U-Mo core covered by Zry-4 miniplates co-rolling
International Nuclear Information System (INIS)
Picchetti, B.; Moscarda, M.V.; Taboada, H.
2013-01-01
The aim of this work is to support through adequate modeling the development of the co-rolling process of miniplates and plates starting with compacts including a monolithic U-Mo core with Zry-4 frame and cladding, Through relevant parameter identification and specific variables calculation a co rolling process model was set. The goal is to design a co-rolling optimal strategy related to the expected results through the use of such model. To that end the rolling process is depicted and some elements of strain stress theory on metals are employed. Plastic strain depends on deviator components of the stress tensor but no on the hydrostatic one. Metal sheet co-rolling is a plastic strain by planar compression at constant volume. During the co-rolling process the width constancy is assumed, being the piece of metal free to flow along its length. In this work the relationship between constitutive materials shield stresses U-Mo core and Zry-4 cladding under T= 650°C co-rolling is determined. This allows to modeling the reduction that exist in each co-rolling step for each one of phases present, which enables the design of a loop control lace optimizing the co rolling process. (author)
One dimensional FexCo1-x nanowires; ferromagnetic resonance and magnetization dynamics
Directory of Open Access Journals (Sweden)
Shehreen Aslam
2017-05-01
Full Text Available Soft magnetic nanowires (NWs are widely used for microwave and mm-wave components. The investigation of magnetization damping behavior of NWs have attracted great interest due to large influence of loss to the device, like integrated microwave device, magnetic sensors, and magnetic random access memory. With increasing operational frequency and degree of integration, the requirements to characterize 1-dimensional NWs become increasingly high. The purpose of this work is to study the magnetization dynamics in FexCo1-x NWs. A series of FexCo1-x (x=0, 0.25, 0.5, 0.75, 1 NWs were grown by controlled electro-deposition. By adjusting FexCo1-x concentration (x=0 to 1, the saturation magnetization, increased more than 20%. Ferromagnetic resonance (FMR both in field and frequency sweep mode are employed to characterize the NWs in flip-chip geometry. It is observed that FMR field (Hr increases with increase in applied frequency. At a fixed frequency, Fe NWs resonate at a lower field than the Co substituted NWs. FMR field linewidth (ΔH as well as frequency width (Δf are largest for Co NWs and decreased for Fe NWs. Whereas ΔH and Δf decreased further for FexCo1-x nanowires with increasing x.
Aronoff-Spencer, Eliah; Venkatesh, A G; Sun, Alex; Brickner, Howard; Looney, David; Hall, Drew A
2016-12-15
Yeast cell lines were genetically engineered to display Hepatitis C virus (HCV) core antigen linked to gold binding peptide (GBP) as a dual-affinity biobrick chimera. These multifunctional yeast cells adhere to the gold sensor surface while simultaneously acting as a "renewable" capture reagent for anti-HCV core antibody. This streamlined functionalization and detection strategy removes the need for traditional purification and immobilization techniques. With this biobrick construct, both optical and electrochemical immunoassays were developed. The optical immunoassays demonstrated detection of anti-HCV core antibody down to 12.3pM concentrations while the electrochemical assay demonstrated higher binding constants and dynamic range. The electrochemical format and a custom, low-cost smartphone-based potentiostat ($20 USD) yielded comparable results to assays performed on a state-of-the-art electrochemical workstation. We propose this combination of synthetic biology and scalable, point-of-care sensing has potential to provide low-cost, cutting edge diagnostic capability for many pathogens in a variety of settings. Copyright © 2016 Elsevier B.V. All rights reserved.
Huang, Fenglin; Liu, Wenting; Li, Peiying; Ning, Jinxia; Wei, Qufu
2016-01-01
A superfine Li0.33La0.557TiO3 (LLTO, 69.4 nm) was successfully synthesized by a facile solvent-thermal method to enhance the electrochemical properties of the lithium-ion battery separator. Co-axial nanofiber of cellulose and Poly(vinylidene fluoride-co-hexafluoropropylene) (PVDF-HFP) was prepared by a co-axial electrospinning technique, in which the shell material was PVDF-HFP and the core was cellulose. LLTO superfine nanoparticles were incorporated into the shell of the PVDF-HFP. The core–shell composite nanofibrous membrane showed good wettability (16.5°, contact angle), high porosity (69.77%), and super electrolyte compatibility (497%, electrolyte uptake). It had a higher ionic conductivity (13.897 mS·cm−1) than those of pure polymer fibrous membrane and commercial separator. In addition, the rate capability (155.56 mAh·g−1) was also superior to the compared separator. These excellent performances endowed LLTO composite nanofibrous membrane as a promising separator for high-performance lithium-ion batteries. PMID:28787873
Ferguson, A L; Hughes, A D; Tufail, U; Baumann, C G; Scott, D J; Hoggett, J G
2000-09-22
The interaction between the core form of bacterial RNA polymerases and sigma factors is essential for specific promoter recognition, and for coordinating the expression of different sets of genes in response to varying cellular needs. The interaction between Escherichia coli core RNA polymerase and sigma 70 has been investigated by surface plasmon resonance. The His-tagged form of sigma 70 factor was immobilised on a Ni2+-NTA chip for monitoring its interaction with core polymerase. The binding constant for the interaction was found to be 1.9x10(-7) M, and the dissociation rate constant for release of sigma from core, in the absence of DNA or transcription, was 4x10(-3) s(-1), corresponding to a half-life of about 200 s.
Does the radiologically isolated syndrome exist? A dual-task cost pilot study.
Dattola, Vincenzo; Logiudice, Anna Lisa; Bonanno, Lilla; Famà, Fausto; Milardi, Demetrio; Chillemi, Gaetana; D'Aleo, Giangaetano; Marino, Silvia; Calabrò, Rocco Salvatore; Russo, Margherita
2017-11-01
Simultaneous performance of motor and cognitive tasks may compete for common brain network resources in aging or patients with some neurological diseases, suggesting the occurrence of a cognitive-motor interference. While this phenomenon has been well described for multiple sclerosis (MS) patients, it never has been tested on asymptomatic subject with magnetic resonance imaging (MRI) findings suggestive of demyelinating disease (i.e., radiologically isolated syndrome: RIS). In this pilot study, 10 RIS subjects and 10 sex/age-matched healthy controls were tested by means of static posturography under eyes opened (single-task trial) and while performing two different cognitive tasks (semantic modified word list generation for first dual-task trial and phonemic semantic modified word list generation for second dual-task trial), to estimate the dual-task cost (DTC) of standing balance. In our sample, under cognitive interference (without any substantial differences between semantic and phonemic modified word list generation), the RIS group showed significance differences in CoP (center of pressure) total sway area, ellipse eccentricity, CoP sway path length, CoP median sway velocity along the AP (anteroposterior) axis and along the ML (mediolateral) axis, reflecting a higher negative DTC respect to healthy subjects (which have simply shown a statistical trend, failing to reach a significance, in some trials). The phenomenon of cognitive-motor interference might be unmasked by a dual-task posturography in RIS subjects, too. We hypothesize that this approach could be useful to early reveal the presence of a demyelinating disease and to reach a MS diagnosis in subjects otherwise classified as RIS.
Energy Technology Data Exchange (ETDEWEB)
Tung, Wu-Hsiung, E-mail: wstong@iner.gov.tw; Lee, Tien-Tso; Kuo, Weng-Sheng; Yaur, Shung-Jung
2017-03-15
Highlights: • An optimization method for axial enrichment distribution in a BWR fuel was developed. • Block coordinate descent method is employed to search for optimal solution. • Scoping libraries are used to reduce computational effort. • Optimization search space consists of enrichment difference parameters. • Capability of the method to find optimal solution is demonstrated. - Abstract: An optimization method has been developed to search for the optimal axial enrichment distribution in a fuel assembly for a boiling water reactor core. The optimization method features: (1) employing the block coordinate descent method to find the optimal solution in the space of enrichment difference parameters, (2) using scoping libraries to reduce the amount of CASMO-4 calculation, and (3) integrating a core critical constraint into the objective function that is used to quantify the quality of an axial enrichment design. The objective function consists of the weighted sum of core parameters such as shutdown margin and critical power ratio. The core parameters are evaluated by using SIMULATE-3, and the cross section data required for the SIMULATE-3 calculation are generated by using CASMO-4 and scoping libraries. The application of the method to a 4-segment fuel design (with the highest allowable segment enrichment relaxed to 5%) demonstrated that the method can obtain an axial enrichment design with improved thermal limit ratios and objective function value while satisfying the core design constraints and core critical requirement through the use of an objective function. The use of scoping libraries effectively reduced the number of CASMO-4 calculation, from 85 to 24, in the 4-segment optimization case. An exhausted search was performed to examine the capability of the method in finding the optimal solution for a 4-segment fuel design. The results show that the method found a solution very close to the optimum obtained by the exhausted search. The number of
Ferromagnetic resonance studies of lunar core stratigraphy
Housley, R. M.; Cirlin, E. H.; Goldberg, I. B.; Crowe, H.
1976-01-01
We first review the evidence which links the characteristic ferromagnetic resonance observed in lunar fines samples with agglutinatic glass produced primarily by micrometeorite impacts and present new results on Apollo 15, 16, and 17 breccias which support this link by showing that only regolith breccias contribute significantly to the characteristic FMR intensity. We then provide a calibration of the amount of Fe metal in the form of uniformly magnetized spheres required to give our observed FMR intensities and discuss the theoretical magnetic behavior to be expected of Fe spheres as a function of size. Finally, we present FMR results on samples from every 5 mm interval in the core segments 60003, 60009, and 70009. These results lead us to suggest: (1) that secondary mixing may generally be extensive during regolith deposition so that buried regolith surfaces are hard to recognize or define; and (2) that local grinding of rocks and pebbles during deposition may lead to short scale fluctuations in grain size, composition, and apparent exposure age of samples.
Properties of quasi-elastic processes due to exchange of one dual pomeron
International Nuclear Information System (INIS)
Gedalin, Eh.V.; Gurvich, E.G.
1975-01-01
The asymptotic (at S tending to infinity) characteristics of four-particle amplitudes of diffraction scattering of resonance states in the dual-resonance model is considered in the lower order of the dual theory of perturbations. It is shown that for transverse transferred momentum K→0, at least for part of the spectrum of states of the dual resonance model - i.e. of the transverse states -, the scattering amplitudes are zero, except for the elastically scattered ones, which are all identical. (author)
Performance analysis of dual-hop relaying systems in the presence of Co-channel interference
Ikki, Salama Said
2010-12-01
In this paper, we investigate the effect of co-channel interference on the performance of dual-hop communications with amplify-and-forward relaying. Based on the derivation of the effective signal-to-interference-plus-noise ratio (SINR) at the destination node of the system, taking into account co-channel interference, we obtain expressions for the error and outage probabilities. Moreover, we study the performance of the system in the high SINR regime. Monte-Carlo simulations are further provided and confirm the accuracy of the analytical results. ©2010 IEEE.
Directory of Open Access Journals (Sweden)
T. Marchenko
2015-08-01
Full Text Available We present an experimental and theoretical study of resonant inelastic x-ray scattering (RIXS in the carbon disulphide CS_{2} molecule near the sulfur K-absorption edge. We observe a strong evolution of the RIXS spectral profile with the excitation energy tuned below the lowest unoccupied molecular orbital (LUMO absorption resonance. The reason for this is twofold. Reducing the photon energy in the vicinity of the LUMO absorption resonance leads to a relative suppression of the LUMO contribution with respect to the emission signal from the higher unoccupied molecular orbitals, which results in the modulation of the total RIXS profile. At even larger negative photon-energy detuning from the resonance, the excitation-energy dependence of the RIXS profile is dominated by the onset of electron dynamics triggered by a coherent excitation of multiple electronic states. Furthermore, our study demonstrates that in the hard x-ray regime, localization of the S 1s core hole occurs in CS_{2} during the RIXS process because of the orientational dephasing of interference between the waves scattering on the two sulfur atoms. Core-hole localization leads to violation of the symmetry selection rules for the electron transitions observed in the spectra.
Electromagnetic energy harvesting from a dual-mass pendulum oscillator
Wang, Hongyan; Tang, Jiong
2016-04-01
This paper presents the analysis of a type of vibration energy harvester composed of an electromagnetic pendulum oscillator combined to an elastic main structure. In this study, the elastic main structure connected to the base is considered as a single degree-of-freedom (DOF) spring-mass-damper subsystem. The electromagnetic pendulum oscillator is considered as a dual-mass two-frequency subsystem, which is composed of a hollow bar with a tip winded coil and a magnetic mass with a spring located in the hollow bar. As the pendulum swings, the magnetic mass can move along the axial direction of the bar. Thus, the relative motion between the magnet and the coil induces a wire current. A mathematical model of the coupled system is established. The system dynamics a 1:2:1 internal resonance. Parametric analysis is carried out to demonstrate the effect of the excitation acceleration, excitation frequency, load resistance, and frequency tuning parameters on system performance.
Coupling between core and cladding modes in a helical core fiber with large core offset
International Nuclear Information System (INIS)
Napiorkowski, Maciej; Urbanczyk, Waclaw
2016-01-01
We analyzed the effect of resonant coupling between core and cladding modes in a helical core fiber with large core offset using the fully vectorial method based on the transformation optics formalism. Our study revealed that the resonant couplings to lower order cladding modes predicted by perturbative methods and observed experimentally in fibers with small core offsets are in fact prohibited for larger core offsets. This effect is related to the lack of phase matching caused by elongation of the optical path of the fundamental modes in the helical core. Moreover, strong couplings to the cladding modes of the azimuthal modal number much higher than predicted by perturbative methods may be observed for large core offsets, as the core offset introduces higher order angular harmonics in the field distribution of the fundamental modes. Finally, in contrast to previous studies, we demonstrate the existence of spectrally broad polarization sensitive couplings to the cladding modes suggesting that helical core fibers with large core offsets may be used as broadband circular polarizers. (paper)
Axial sesamoiditis in the horse: A review
Directory of Open Access Journals (Sweden)
Christelle Le Roux
2018-03-01
Full Text Available Axial sesamoiditis or osteitis of the proximal sesamoid bones (PSBs in the horse is described as a rare condition. The cause remains unknown and speculative, with vascular, infectious, and traumatic aetiologies implicated. It is specifically associated with injury of the palmar or plantar ligament (PL, also known as the intersesamoidean ligament. Imaging findings are generally rewarding and radiological changes are typical, if not pathognomonic, for the condition. Lesions consist of bone lysis at the apical to mid-body axial margins of the PSBs, with variable degrees of joint effusion. Radiographic technique warrants careful attention to make a diagnosis, and exposure factors may need to be adjusted. Perineural, intra-articular and intra-thecal anaesthesia does not seem to provide consistent improvement of lameness in these cases, with literature reporting inconsistent findings. Ultrasonographic findings include digital flexor sheath effusion, loss of the normal fibre structure of the PL at its attachment to the PSBs, abnormal echogenicity or change in thickness of the PL, and irregular hyperechoic cortical margins of the axial margins of the PSBs. Scintigraphy, computed tomography and magnetic resonance imaging, although not necessary to make a diagnosis, may add valuable information regarding the location and extent of lesions. The prognosis remains guarded to poor for return to athletic function. The focus of this paper is a comprehensive review of the proposed aetiopathogenesis of the condition, the prognosis, and a summary of the literature findings with focus on the notable diagnostic imaging features, including radiography, ultrasonography, scintigraphy, computed tomography and magnetic resonance imaging.
Mini-cavity plasma core reactors for dual-mode space nuclear power/propulsion systems
International Nuclear Information System (INIS)
Chow, S.
1976-01-01
A mini-cavity plasma core reactor is investigated for potential use in a dual-mode space power and propulsion system. In the propulsive mode, hydrogen propellant is injected radially inward through the reactor solid regions and into the cavity. The propellant is heated by both solid driver fuel elements surrounding the cavity and uranium plasma before it is exhausted out the nozzle. The propellant only removes a fraction of the driver power, the remainder is transferred by a coolant fluid to a power conversion system, which incorporates a radiator for heat rejection. In the power generation mode, the plasma and propellant flows are shut off, and the driver elements supply thermal power to the power conversion system, which generates electricity for primary electric propulsion purposes
Resonant photoemission at core-level shake-up thresholds: Valence-band satellites in nickel
International Nuclear Information System (INIS)
Bjoerneholm, O.; Andersen, J.N.; Wigren, C.; Nilsson, A.; Nyholm, R.; Ma; Ortensson, N.
1990-01-01
Three-hole satellites (3d 7 final-state configuration) in the nickel valence-band photoelectron spectrum have been identified at 13 and 18 eV binding energy with use of synchrotron radiation from the MAX storage ring. The three-hole satellites show resonances at photon energies close to the threshold for excitation of 3p 5 3d 9 core-hole shake-up states. The 13-eV satellite also shows a resonance directly at the 3p threshold. This is interpreted as an interference between the direct three-hole ionization and a shake-up transition in the Auger decay of the 3p hole. This shake-up process is also identified directly in the M 2,3 M 4,5 M 4,5 Auger spectrum
An FMM based on dual tree traversal for many-core architectures
Yokota, Rio
2013-09-01
The present work attempts to integrate the independent efforts in the fast N-body community to create the fastest N-body library for many-core and heterogenous architectures. Focus is placed on low accuracy optimizations, in response to the recent interest to use FMM as a preconditioner for sparse linear solvers. A direct comparison with other state-of-the-art fast N-body codes demonstrates that orders of magnitude increase in performance can be achieved by careful selection of the optimal algorithm and low-level optimization of the code. The current N-body solver uses a fast multipole method with an efficient strategy for finding the list of cell-cell interactions by a dual tree traversal. A task-based threading model is used to maximize thread-level parallelism and intra-node load-balancing. In order to extract the full potential of the SIMD units on the latest CPUs, the inner kernels are optimized using AVX instructions.
Electrothermally Tunable Arch Resonator
Hajjaj, Amal Z.
2017-03-18
This paper demonstrates experimentally, theoretically, and numerically a wide-range tunability of electrothermally actuated microelectromechanical arch beams. The beams are made of silicon and are intentionally fabricated with some curvature as in-plane shallow arches. An electrothermal voltage is applied between the anchors of the beam generating a current that controls the axial stress caused by thermal expansion. When the electrothermal voltage increases, the compressive stress increases inside the arch beam. This leads to an increase in its curvature, thereby increasing its resonance frequencies. We show here that the first resonance frequency can increase monotonically up to twice its initial value. We show also that after some electrothermal voltage load, the third resonance frequency starts to become more sensitive to the axial thermal stress, while the first resonance frequency becomes less sensitive. These results can be used as guidelines to utilize arches as wide-range tunable resonators. Analytical results based on the nonlinear Euler Bernoulli beam theory are generated and compared with the experimental data and the results of a multi-physics finite-element model. A good agreement is found among all the results. [2016-0291
Yan, Yibo; Li, Kaixin; Chen, Xiaoping; Yang, Yanhui; Lee, Jong-Min
2017-12-01
Expedition of electron transfer efficiency and optimization of surface reactant adsorption products desorption processes are two main challenges for developing non-noble catalysts in the oxygen reduction reaction (ORR) and CO 2 reduction reaction (CRR). A heterojunction prototype on Co 3 S 4 @Co 3 O 4 core-shell octahedron structure is established via hydrothermal lattice anion exchange protocol to implement the electroreduction of oxygen and carbon dioxide with high performance. The synergistic bifunctional catalyst consists of p-type Co 3 O 4 core and n-type Co 3 S 4 shell, which afford high surface electron density along with high capacitance without sacrificing mechanical robustness. A four electron ORR process, identical to the Pt catalyzed ORR, is validated using the core-shell octahedron catalyst. The synergistic interaction between cobalt sulfide and cobalt oxide bicatalyst reduces the activation energy to convert CO 2 into adsorbed intermediates and hereby enables CRR to run at a low overpotential, with formate as the highly selective main product at a high faraday efficiency of 85.3%. The remarkable performance can be ascribed to the synergistic coupling effect of the structured co-catalysts; heterojunction structure expedites the electron transfer efficiency and optimizes surface reactant adsorption product desorption processes, which also provide theoretical and pragmatic guideline for catalyst development and mechanism explorations. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Highly Tunable Electrothermally Actuated Arch Resonator
Hajjaj, Amal Z.; Ramini, Abdallah; Alcheikh, Nouha; Younis, Mohammad I.
2016-01-01
that after some electro-thermal voltage load, the third resonance frequency starts to become more sensitive to the axial thermal stress, while the first resonance frequency becomes less sensitive. These results can be used as guidelines to utilize arches
Using collisions and resonances to tilting Uranus
Rogoszinski, Zeeve; Hamilton, Douglas
2018-01-01
Uranus’ large obliquity (98°) is widely thought to have occurred from a polar strike with an Earth sized object. Morbidelli et al. (2012) argue that two or more collisions are required in order to explain the prograde motion of Uranus’ satellites. These impactors could have been less massive by about a factor of ten, but multiple polar strikes are still improbable as even larger mass impactors would be needed for more equatorial collisions. Here we explore an alternative non-collisional model inspired by the explanation to Saturn’s significant tilt (27°). Ward and Hamilton (2004) & Hamilton and Ward (2004) argue that a secular resonance currently between Saturn’s spin axis and Neptune’s orbital pole is responsible for Saturn’s large obliquity. Unfortunately, Uranus’ axial precession frequency today is too long to match any of the current planets’ fundamental frequencies. Boué and Laskar (2010) explain that Uranus may have harbored an improbably large moon in the past which could have sped up the planet’s axial precession frequency enough to resonate with the regression of its own orbital pole. We explore another scenario which requires only the interactions between the giant planets.Thommes et al. (1999, 2002, 2003) argue that at least the cores of Uranus and Neptune were formed in between Jupiter and Saturn, as the density of the protoplanetary disk was greater there. If Neptune was scattered outward before Uranus, then a secular spin-orbit resonance between the two planets is possible. However, driving Uranus’ obliquity to near 90° with a resonance capture requires a timescale on the order of 100 Myr. If Neptune migrated out quicker or its orbital inclination was initially larger, then we find that the resulting resonance kick can tilt Uranus more than 40° in a reasonable timespan. This could replace one of the impactors required in the collisional scenario described by Morbidelli et al. (2012), but in most situations the effect of such a
Chen, Yen-Lin; Chiang, Hsin-Han; Chiang, Chuan-Yen; Liu, Chuan-Ming; Yuan, Shyan-Ming; Wang, Jenq-Haur
2012-01-01
This study proposes a vision-based intelligent nighttime driver assistance and surveillance system (VIDASS system) implemented by a set of embedded software components and modules, and integrates these modules to accomplish a component-based system framework on an embedded heterogamous dual-core platform. Therefore, this study develops and implements computer vision and sensing techniques of nighttime vehicle detection, collision warning determination, and traffic event recording. The proposed system processes the road-scene frames in front of the host car captured from CCD sensors mounted on the host vehicle. These vision-based sensing and processing technologies are integrated and implemented on an ARM-DSP heterogamous dual-core embedded platform. Peripheral devices, including image grabbing devices, communication modules, and other in-vehicle control devices, are also integrated to form an in-vehicle-embedded vision-based nighttime driver assistance and surveillance system.
The effects of initial rise and axial loads on MEMS arches
Tella, Sherif Adekunle; Hajjaj, Amal Z.; Younis, Mohammad I.
2017-01-01
. This paper aims to investigate in depth the influence of the competing effects of initial rise and axial loads on the mechanical behavior of micromachined arches; mainly their static deflection and resonant frequencies. Based on analytical solutions
A novel CO>2- and SO>2-tolerant dual phase composite membrane for oxygen separation
DEFF Research Database (Denmark)
Cheng, Shiyang; Søgaard, Martin; Han, Li
2015-01-01
A novel dual phase composite oxygen membrane (Al0.02Ga0.02Zn0.96O1.02 – Gd0.1Ce0.9O1.95-δ) was successfully prepared and tested. The membrane shows chemical stability against CO2 and SO2, and a stable oxygen permeation over 300 hours in CO2 was demonstrated. ZnO is cheap and non-toxic...... and is therefore highly advantageous compared to other common materials used for the purpose....
Enhanced photocatalytic CO2 reduction to CH4 over separated dual co-catalysts Au and RuO2
Dong, Chunyang; Hu, Songchang; Xing, Mingyang; Zhang, Jinlong
2018-04-01
A spatially separated, dual co-catalyst photocatalytic system was constructed by the stepwise introduction of RuO2 and Au nanoparticles (NPs) at the internal and external surfaces of a three dimensional, hierarchically ordered TiO2-SiO2 (HTSO) framework (the final photocatalyst was denoted as Au/HRTSO). Characterization by HR-TEM, EDS-mapping, XRD and XPS confirmed the existence and spatially separated locations of Au and RuO2. In CO2 photocatalytic reduction (CO2PR), Au/HRTSO (0.8%) shows the optimal performance in both the activity and selectivity towards CH4; the CH4 yield is almost twice that of the singular Au/HTSO or HRTSO (0.8%, weight percentage of RuO2) counterparts. Generally, Au NPs at the external surface act as electron trapping agents and RuO2 NPs at the inner surface act as hole collectors. This advanced spatial configuration could promote charge separation and transfer efficiency, leading to enhanced CO2PR performance in both the yield and selectivity toward CH4 under simulated solar light irradiation.
Nuclear characteristic simulation device for reactor core
International Nuclear Information System (INIS)
Arakawa, Akio; Kobayashi, Yuji.
1994-01-01
In a simulation device for nuclear characteristic of a PWR type reactor, there are provided a one-dimensional reactor core dynamic characteristic model for simulating one-dimensional neutron flux distribution in the axial direction of the reactor core and average reactor power based on each of inputted signals of control rod pattern, a reactor core flow rate, reactor core pressure and reactor core inlet enthalphy, and a three-dimensional reactor core dynamic characteristic mode for simulating three-dimensional power distribution of the reactor core, and a nuclear instrumentation model for calculating read value of the nuclear instrumentation disposed in the reactor based on the average reactor core power and the reactor core three-dimensional power distribution. A one-dimensional neutron flux distribution in the axial direction of the reactor core, a reactor core average power, a reactor core three-dimensional power distribution and a nuclear instrumentation read value are calculated. As a result, the three-dimensional power distribution and the power level are continuously calculated. Further, since the transient change of the three-dimensional neutron flux distribution is calculated accurately on real time, more actual response relative to a power monitoring device of the reactor core and operation performance can be simulated. (N.H.)
Korolev, Konstantin A.; Wu, Chuanjian; Yu, Zhong; Sun, Ke; Afsar, Mohammed N.; Harris, Vincent G.
2018-05-01
Transmittance measurements have been performed on La-Co substituted barium hexaferrites in millimeter waves. Broadband millimeter-wave measurements have been carried out using the free space quasi-optical spectrometer, equipped with a set of high power backward wave oscillators covering the frequency range of 30 - 120 GHz. Strong absorption zones have been observed in the millimeter-wave transmittance spectra of all La-Co substituted barium hexaferrites due to the ferromagnetic resonance. Linear shift of ferromagnetic resonance frequency as functions of La-Co substitutions have been found. Real and imaginary parts of dielectric permittivity of La-Co substituted barium hexaferrites have been calculated using the analysis of recorded high precision transmittance spectra. Frequency dependences of magnetic permeability of La-Co substituted barium hexaferrites, as well as saturation magnetization and anisotropy field have been determined based on Schlömann's theory for partially magnetized ferrites. La-Co substituted barium hexaferrites have been further investigated by DC magnetization to assess magnetic behavior and compare with millimeter wave data. Consistency of saturation magnetization determined independently by both millimeter wave absorption and DC magnetization have been found for all La-Co substituted barium hexaferrites. These materials seem to be quite promising as tunable millimeter wave absorbers, filters, circulators, based on the adjusting of their substitution parameters.
International Nuclear Information System (INIS)
Hida, Kazuki; Yoshioka, Ritsuo
1992-01-01
A method has been developed for optimizing the axial enrichment and gadolinia distributions for the reload BWR fuel under control rod programming. The problem was to minimize the enrichment requirement subject to the criticality and axial power peaking constraints. The optimization technique was based on the successive linear programming method, each linear programming problem being solved by a goal programming algorithm. A rapid and practically accurate core neutronics model, named the modified one-dimensional core model, was developed to describe the batch-averaged burnup behavior of the reload fuel. A core burnup simulation algorithm, employing a burnup-power-void iteration, was also developed to calculate the rigorous equilibrium cycle performance. This method was applied to the optimization of axial two- and 24-region fuels for demonstrative purposes. The optimal solutions for both fuels have proved the optimality of what is called burnup shape optimization spectral shift. For the two-region fuel with a practical power peaking of 1.4, the enrichment distribution was nearly uniform, because a bottom-peaked burnup shape flattens the axial power shape. Optimization of the 24-region fuel has shown a potential improvement in BWR fuel cycle economics, which will guide future advancement in BWR fuel designs. (author)
Energy Technology Data Exchange (ETDEWEB)
Kwak, Byeong Sub; Kim, Kang Min [Department of Chemistry, College of Science, Yeungnam University, Gyeongsan, Gyeongbuk 38541 (Korea, Republic of); Park, Sun-Min, E-mail: psm@kicet.re.kr [Korea Institute of Ceramic Engineering and Technology (KICET), Jinju, Gyeongnam 52851 (Korea, Republic of); Kang, Misook, E-mail: mskang@ynu.ac.kr [Department of Chemistry, College of Science, Yeungnam University, Gyeongsan, Gyeongbuk 38541 (Korea, Republic of)
2017-06-15
Highlights: • ZnO and Zn{sub 1-x}Mg{sub x}O crystals were grown onto the BFs. • The core@shell structured BF@Zn{sub 1-x}Mg{sub x}O particles significantly increased the adsorption of CO{sub 2} gas. • The BF@ZnO or BF@Zn{sub 1-x}Mg{sub x}O particles selectively reduce the carbon dioxide to carbon monoxide. - Abstract: This study focused on the development of a catalyst for converting carbon dioxide, the main cause of global warming, into a beneficial energy source. Core@shell structured particles, BF@ZnO and BF@Zn{sub 1-x}Mg{sub x}O, are synthesized in order to selectively obtain CO gas from the photoreduction of CO{sub 2}. A modified sol-gel process is used to synthesize the core@shell structures with a three-dimensional microstructure, which are subsequently characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive spectrometry (EDAX), ultraviolet (UV)–vis absorption, photoluminescence (PL), and photocurrent density analysis. The CO{sub 2} adsorption abilities of the core@shell particles are estimated through CO{sub 2}-temperature programmed desorption (TPD). The core@shell structured BF@Zn{sub 1-x}Mg{sub x}O particles including the Mg ingredient significantly increased the adsorption of CO{sub 2} gas at the microfiber/nanoparticle interface. Both the BF@ZnO and BF@Zn{sub 1-x}Mg{sub x}O particles selectively reduce the carbon dioxide to carbon monoxide, with almost no other reduced products being observed. These results are attributed to the effective adsorption of CO{sub 2} gas and inhibited recombination of the photogenerated electron–hole pairs. BF@Zn{sub 0.75}Mg{sub 0.25}O exhibited superior photocatalytic behavior and selectively produced 5.0 μmolg{sub cat}{sup −1} L{sup −1} of CO gas after 8 h of reaction.
Compact Dual-Band Zeroth-Order Resonance Antenna
International Nuclear Information System (INIS)
Xu He-Xiu; Wang Guang-Ming; Gong Jian-Qiang
2012-01-01
A novel microstrip zeroth-order resonator (ZOR) antenna and its equivalent circuit model are exploited with two zeroth-order resonances. It is constructed based on a resonant-type composite right/left handed transmission line (CRLH TL) using a Wunderlich-shaped extended complementary single split ring resonator pair (W-ECSSRRP) and a series capacitive gap. The gap either can be utilized for double negative (DNG) ZOR antenna or be removed to engineer a simplified elision-negative ZOR (ENG) antenna. For verification, a DNG ZOR antenna sample is fabricated and measured. Numerical and experimental results agree well with each other, indicating that the omnidirectional radiations occur at two frequency bands which are accounted for by two shunt branches in the circuit model. The size of the antenna is 49% more compact than its previous counterpart. The superiority of W-ECSSRRP over CSSRRP lies in the lower fundamental resonance of the antenna by 38.2% and the introduction of a higher zeroth-order resonance. (fundamental areas of phenomenology(including applications))
Adhesion of resin composite core materials to dentin.
O'Keefe, K L; Powers, J M
2001-01-01
This study determined (1) the effect of polymerization mode of resin composite core materials and dental adhesives on the bond strength to dentin, and (2) if dental adhesives perform as well to dentin etched with phosphoric acid as to dentin etched with self-etching primer. Human third molars were sectioned 2 mm from the highest pulp horn and polished. Three core materials (Fluorocore [dual cured], Core Paste [self-cured], and Clearfil Photo Core [light cured]) and two adhesives (Prime & Bond NT Dual Cure and Clearfil SE Bond [light cured]) were bonded to dentin using two dentin etching conditions. After storage, specimens were debonded in microtension and bond strengths were calculated. Scanning electron micrographs of representative bonding interfaces were analyzed. Analysis showed differences among core materials, adhesives, and etching conditions. Among core materials, dual-cured Fluorocore had the highest bond strengths. There were incompatibilities between self-cured Core Paste and Prime & Bond NT in both etched (0 MPa) and nonetched (3.0 MPa) dentin. Among adhesives, in most cases Clearfil SE Bond had higher bond strengths than Prime & Bond NT and bond strengths were higher to self-etched than to phosphoric acid-etched dentin. Scanning electron micrographs did not show a relationship between resin tags and bond strengths. There were incompatibilities between a self-cured core material and a dual-cured adhesive. All other combinations of core materials and adhesives produced strong in vitro bond strengths both in the self-etched and phosphoric acid-etched conditions.
Design, Test, and Evaluation of a Transonic Axial Compressor Rotor with Splitter Blades
2013-09-01
INTRODUCTION A. MOTIVATION Over the course of turbomachinery history splitter vanes have been used extensively in centrifugal compressors . Axial...TEST, AND EVALUATION OF A TRANSONIC AXIAL COMPRESSOR ROTOR WITH SPLITTER BLADES by Scott Drayton September 2013 Dissertation Co...AXIAL COMPRESSOR ROTOR WITH SPLITTER BLADES 5. FUNDING NUMBERS 6. AUTHOR(S) Scott Drayton 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES
CoRes utilization for building PCK in pre-service teacher education on the digestive system topic
Nugraha, Ikmanda
2017-05-01
Knowledge of teachers in learning activities in the classroom has a close relationship with how well and how much students learn. Recently, a promising development in teacher education has appeared that centers on the academic construct of pedagogical content knowledge (PCK). This study was an exploratory study into a science teacher education program that seeks to build the foundations on which pre-service teachers can begin to build their pedagogical content knowledge (PCK). The program involved the use of Content Representations (CoRes), which was initially applied as component of a strategy for exploring and gaining insights into the PCK of in-service science teachers. This study involved the researcher and 20 students (third year) in a pre-service teacher education course (School Science I) in science education when the students worked to make content analysis on the digestive system topic. During the course, the students make their own CoRes through a workshop for digestive system topic individually, in pairs and whole class discussion. Data were recorded from students' CoRes, student reflective journals, interviews, and field notes recorded in the researcher's reflective journal. Pre-service teachers' comments from interviews and reflective journals were coded in relation to references about: (1) the effectiveness of variety strategies in building the knowledge bases required to design a CoRes and (2) their awareness and/or development of tentative components of future PCK for a digestive system topic as a result of CoRes construction. Observational data were examined for indications of increasing independence and competency on the part of student teachers when locating appropriate information for designing their CoRes. From this study, it is hoped that the pre-service science teachers are able to build knowledge and then transform it into a form of PCK for digestive system topic for their first classroom planning and teaching to teach digestive system
The origin of transverse anisotropy in axially symmetric single molecule magnets.
Barra, Anne-Laure; Caneschi, Andrea; Cornia, Andrea; Gatteschi, Dante; Gorini, Lapo; Heiniger, Leo-Philipp; Sessoli, Roberta; Sorace, Lorenzo
2007-09-05
Single-crystal high-frequency electron paramagnetic resonance spectroscopy has been employed on a truly axial single molecule magnet of formula [Mn(12)O(12)(tBu-CH(2)CO(2))16(CH(3)OH)4].CH(3)OH to investigate the origin of the transverse magnetic anisotropy, a crucial parameter that rules the quantum tunneling of the magnetization. The crystal structure, including the absolute structure of the crystal used for EPR experiments, has been fully determined and found to belong to I4 tetragonal space group. The angular dependence of the resonance fields in the crystallographic ab plane shows the presence of high-order tetragonal anisotropy and strong dependence on the MS sublevels with the second-highest-field transition being angular independent. This was rationalized including competing fourth- and sixth-order transverse parameters in a giant spin Hamiltonian which describes the magnetic anisotropy in the ground S = 10 spin state of the cluster. To establish the origin of these anisotropy terms, the experimental results have been further analyzed using a simplified multispin Hamiltonian which takes into account the exchange interactions and the single ion magnetic anisotropy of the Mn(III) centers. It has been possible to establish magnetostructural correlations with spin Hamiltonian parameters up to the sixth order. Transverse anisotropy in axial single molecule magnets was found to originate from the multispin nature of the system and from the breakdown of the strong exchange approximation. The tilting of the single-ion easy axes of magnetization with respect to the 4-fold molecular axis of the cluster plays the major role in determining the transverse anisotropy. Counterintuitively, the projections of the single ion easy axes on the ab plane correspond to hard axes of magnetization.
Zhang, Lu; Xiao, Hong; Li, Jingguo; Cheng, Du; Shuai, Xintao
2016-06-01
Drug resistance is the underlying cause for therapeutic failure in clinical cancer chemotherapy. A prodrug copolymer mPEG-PAsp(DIP-co-BZA-co-DOX) (PDBD) was synthesized and assembled into a nanoscale vesicle comprising a PEG corona, a reduction and pH dual-sensitive hydrophobic membrane and an aqueous lumen encapsulating doxorubicin hydrochloride (DOX.HCl) and arsenite (As). The dual stimulation-sensitive design of the vesicle gave rise to rapid release of the physically entrapped DOX.HCl and arsenite inside acidic lysosomes, and chemically conjugated DOX inside the cytosol with high glutathione (GSH) concentration. In the optimized concentration range, arsenite previously recognized as a promising anticancer agent from traditional Chinese medicine can down-regulate the expressions of anti-apoptotic and multidrug resistance proteins to sensitize cancer cells to chemotherapy. Consequently, the DOX-As-co-loaded vesicle demonstrated potent anticancer activity. Compared to the only DOX-loaded vesicle, the DOX-As-co-loaded one induced more than twice the apoptotic ratio of MCF-7/ADR breast cancer cells at a low As concentration (0.5 μM), due to the synergistic effects of DOX and As. The drug loading strategy integrating chemical conjugation and physical encapsulation in stimulation-sensitive carriers enabled efficient drug loading in the formulation.Drug resistance is the underlying cause for therapeutic failure in clinical cancer chemotherapy. A prodrug copolymer mPEG-PAsp(DIP-co-BZA-co-DOX) (PDBD) was synthesized and assembled into a nanoscale vesicle comprising a PEG corona, a reduction and pH dual-sensitive hydrophobic membrane and an aqueous lumen encapsulating doxorubicin hydrochloride (DOX.HCl) and arsenite (As). The dual stimulation-sensitive design of the vesicle gave rise to rapid release of the physically entrapped DOX.HCl and arsenite inside acidic lysosomes, and chemically conjugated DOX inside the cytosol with high glutathione (GSH) concentration. In the
Resonant-spin-ordering of vortex cores in interacting mesomagnets
Jain, Shikha
2013-03-01
The magnetic system of interacting vortex-state elements have a dynamically reconfigurable ground state characterized by different relative polarities and chiralities of the individual disks; and have a corresponding dynamically controlled spectrum of collective excitation modes that determine the microwave absorption of the crystal. The development of effective methods for dynamic control of the ground state in this vortex-type magnonic crystal is of interest both from fundamental and technological viewpoints. Control of vortex chirality has been demonstrated previously using various techniques; however, control and manipulation of vortex polarities remain challenging. In this work, we present a robust and efficient way of selecting the ground state configuration of interacting magnetic elements using resonant-spin-ordering approach. This is achieved by driving the system from the linear regime of constant vortex gyrations to the non-linear regime of vortex-core reversals at a fixed excitation frequency of one of the coupled modes. Subsequently reducing the excitation field to the linear regime stabilizes the system to a polarity combination whose resonant frequency is decoupled from the initialization frequency. We have utilized the resonant approach to transition between the two polarity combinations (parallel or antiparallel) in a model system of connected dot-pairs which may form the building blocks of vortex-based magnonic crystals. Taking a step further, we have extended the technique by studying many-particle system for its potential as spin-torque oscillators or logic devices. Work at Argonne was supported by the U. S. DOE, Office of BES, under Contract No. DE-AC02-06CH11357. This work was in part supported by grant DMR-1015175 from the U. S. National Science Foundation, by a Contract from the U.S. Army TARDEC and RDECOM.
Del Rosso, T.; Rey, N. A.; Rosado, T.; Landi, S.; Larrude, D. G.; Romani, E. C.; Freire Junior, F. L.; Quinteiro, S. M.; Cremona, M.; Aucelio, R. Q.; Margheri, G.; Pandoli, O.
2016-06-01
Colloidal suspensions of oxocarbon-encapsulated gold nanoparticles have been synthesized in a one-step procedure by pulsed-laser ablation (PLA) at 532 nm of a solid gold target placed in aqueous solution containing CO2 absorbers, but without any stabilizing agent. Multi-wavelength surface enhanced Raman spectroscopy allows the identification of adsorbed amorphous carbon and graphite, Au-carbonyl, Au coordinated CO2-derived bicarbonates/carbonates and hydroxyl groups around the AuNPs core. Scanning electron microscopy, energy dispersive x-ray analysis and high resolution transmission electron microscopy highlight the organic shell structure around the crystalline metal core. The stability of the colloidal solution of nanocomposites (NCs) seems to be driven by solvation forces and is achieved only in neutral or basic pH using monovalent hydroxide counter-ions (NaOH, KOH). The NCs are characterized by a blue shift of the localized surface plasmon resonance (LSPR) band typical of metal-ligand stabilization by terminal π-back bonding, attributed to a core charging effect caused by Au-carbonyls. Total organic carbon measurements detect the final content of organic carbon in the colloidal solution of NCs that is about six times higher than the value of the water solution used to perform PLA. The colloidal dispersions of NCs are stable for months and are applied as analytical probes in amino glycoside antibiotic LSPR based sensing.
Lu, Ping; Huang, Qing; Mukherjee, Amiya; Hsieh, You-Lo
2010-12-01
Silicon oxycarbide (SiCO) glass-doped carbon fibers with an average diameter of 163 nm were successfully synthesized by electrospinning polymer mixtures of preceramic precursor polyureasilazane (PUS) and carbon precursor polyacrylonitrile (PAN) into fibers then converting to ceramic/carbon hybrid via cross-linking, stabilization, and pyrolysis at temperatures up to 1000 °C. The transformation of PUS/PAN polymer precursors to SiCO/carbon structures was confirmed by EDS and FTIR. Both carbon and SiCO/carbon fibers were amorphous and slightly oxidized. Doping with SiCO enhanced the thermal stability of carbon fibers and acquired new ductile behavior in the SiCO/carbon fibers with significantly improved flexibility and breaking elongation. Furthermore, the SiCO/carbon fibers exhibited dual superhydrophilicity and superoleophilicity with water and decane absorbing capacities of 873 and 608%, respectively. The cyclic voltammetry also showed that SiCO/carbon composite fibers possess better capacitor properties than carbon fibers.
DEFF Research Database (Denmark)
Hansen, Troels Vejle; Kim, Oleksiy S.; Breinbjerg, Olav
2014-01-01
For spherical antennas consisting of a solid magnetodielectric lossy core with an impressed surface current density exciting a superposition of the ${\\rm TE}_{mn}$ and ${\\rm TM}_{mn}$ spherical modes, we analytically determine the radiation quality factor $Q$ and radiation efficiency $e$ . Also, we...
Resonant stimulation of Raman scattering from single-crystal thiophene/phenylene co-oligomers
International Nuclear Information System (INIS)
Yanagi, Hisao; Marutani, Yusuke; Matsuoka, Naoki; Hiramatsu, Toru; Ishizumi, Atsushi; Sasaki, Fumio; Hotta, Shu
2013-01-01
Amplified Raman scattering was observed from single crystals of thiophene/phenylene co-oligomers (TPCOs). Under ns-pulsed excitation, the TPCO crystals exhibited amplified spontaneous emission (ASE) at resonant absorption wavelengths. With increasing excitation wavelength to the 0-0 absorption edge, the stimulated resonant Raman peaks appeared both in the 0-1 and 0-2 ASE band regions. When the excitation wavelength coincided with the 0-1 ASE band energy, the Raman peaks selectively appeared in the 0-2 ASE band. Such unusual enhancement of the 0-2 Raman scattering was ascribed to resonant stimulation via vibronic coupling with electronic transitions in the uniaxially oriented TPCO molecules
Deconvolution of ferromagnetic resonance in devitrification process of Co-based amorphous alloys
International Nuclear Information System (INIS)
Montiel, H.; Alvarez, G.; Betancourt, I.; Zamorano, R.; Valenzuela, R.
2006-01-01
Ferromagnetic resonance (FMR) measurements were carried out on soft magnetic amorphous ribbons of composition Co 66 Fe 4 B 12 Si 13 Nb 4 Cu prepared by melt spinning. In the as-cast sample, a simple FMR spectrum was apparent. For treatment times of 5-20 min a complex resonant absorption at lower fields was detected; deconvolution calculations were carried out on the FMR spectra and it was possible to separate two contributions. These results can be interpreted as the combination of two different magnetic phases, corresponding to the amorphous matrix and nanocrystallites. The parameters of resonant absorptions can be associated with the evolution of nanocrystallization during the annealing
Plasma core reactor applications
International Nuclear Information System (INIS)
Latham, T.S.; Rodgers, R.J.
1976-01-01
Analytical and experimental investigations are being conducted to demonstrate the feasibility of fissioning uranium plasma core reactors and to characterize space and terrestrial applications for such reactors. Uranium hexafluoride (UF 6 ) fuel is injected into core cavities and confined away from the surface by argon buffer gas injected tangentially from the peripheral walls. Power, in the form of thermal radiation emitted from the high-temperature nuclear fuel, is transmitted through fused-silica transparent walls to working fluids which flow in axial channels embedded in segments of the cavity walls. Radiant heat transfer calculations were performed for a six-cavity reactor configuration; each cavity is approximately 1 m in diameter by 4.35 m in length. Axial working fluid channels are located along a fraction of each cavity peripheral wall
Anderson, Christian E; Donnola, Shannon B; Jiang, Yun; Batesole, Joshua; Darrah, Rebecca; Drumm, Mitchell L; Brady-Kalnay, Susann M; Steinmetz, Nicole F; Yu, Xin; Griswold, Mark A; Flask, Chris A
2017-08-16
Injectable Magnetic Resonance Imaging (MRI) contrast agents have been widely used to provide critical assessments of disease for both clinical and basic science imaging research studies. The scope of available MRI contrast agents has expanded over the years with the emergence of molecular imaging contrast agents specifically targeted to biological markers. Unfortunately, synergistic application of more than a single molecular contrast agent has been limited by MRI's ability to only dynamically measure a single agent at a time. In this study, a new Dual Contrast - Magnetic Resonance Fingerprinting (DC - MRF) methodology is described that can detect and independently quantify the local concentration of multiple MRI contrast agents following simultaneous administration. This "multi-color" MRI methodology provides the opportunity to monitor multiple molecular species simultaneously and provides a practical, quantitative imaging framework for the eventual clinical translation of molecular imaging contrast agents.
Directory of Open Access Journals (Sweden)
Ye Chang
2018-01-01
Full Text Available In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET and a film bulk acoustic resonator (FBAR. We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.
N–Mg dual-acceptor co-doping in CuCrO{sub 2} studied by first-principles calculations
Energy Technology Data Exchange (ETDEWEB)
Xu, Ying, E-mail: 1080071@hnust.edu.cn [School of Physics, Hunan University of Science and Technology, Xiangtan 411201 (China); Nie, Guo-Zheng [School of Physics, Hunan University of Science and Technology, Xiangtan 411201 (China); Zou, Daifeng [School of Physics, Hunan University of Science and Technology, Xiangtan 411201 (China); Shenzhen Key Laboratory of Nanobiomechanics, Shenzhen Institutes of Advanced Technology, Chinese Academy of Science, Shenzhen 518055 (China); Tang, Jing-Wu [School of Physics, Hunan University of Science and Technology, Xiangtan 411201 (China); Ao, Zhimin, E-mail: Zhimin.Ao@gdut.edu.cn [Institute of Environmental Health and Pollution Control, School of Environmental Science and Engineering, Guangdong University of Technology, Guangzhou 510006 (China)
2016-11-25
In this paper, N–Mg dual-acceptor co-doping in CuCrO{sub 2} is investigated by first-principles calculations. The electronic structure and formation energies of Mg substituting Cr-site, N substituting O-site, and co-doping of both Mg on Cr-site and N on O-site in CuCrO{sub 2} are calculated. It is found that the structure with N and Mg codoped at the nearest sites has the lowest energy due to a modest attractive interaction between the two dopants. Compared with single N or Mg doped CuCrO{sub 2}, the N–Mg codoped CuCrO{sub 2} has a lower formation energy and shallower transition level. In addition, the total density of states (DOS) analysis shows that more hole states appear above the Fermi level and higher DOS for N–Mg co-doping is obtained in the N–Mg codoped CuCrO{sub 2}, which is good to enhance the p-type conductivity in CuCrO{sub 2}. - Highlights: • N–Mg dual-acceptor co-doping in CuCrO{sub 2} is investigated. • N–Mg complex has a lower formation energy and shallower transition level. • More hole states appear above the Fermi level for N–Mg co-doping. • N–Mg co-doping in CuCrO{sub 2} can be expected to have more stable p-type conductivity.
Broadband polymer microstructured THz fiber coupler with downdoped cores
DEFF Research Database (Denmark)
Nielsen, Kristian; Rasmussen, Henrik K.; Bang, Ole
2010-01-01
We demonstrate a broadband THz directional coupler based on a dual core photonic crystal fiber (PCF) design with mechanically down-doped core regions. For a center frequency of 1.3 THz we demonstrate a bandwidth of 0.65 THz.......We demonstrate a broadband THz directional coupler based on a dual core photonic crystal fiber (PCF) design with mechanically down-doped core regions. For a center frequency of 1.3 THz we demonstrate a bandwidth of 0.65 THz....
Kyle, Jennifer Reiber; Kyle, Michael D; Raghavan, Ravi; Budak, Gurer; Ozkan, Cengiz S; Ozkan, Mihrimah
2011-03-01
In this paper we introduce a custom scanning near-field optical microscope (SNOM) that simultaneously collects reflection and transmission near-field images along with topography. This dual-optical SNOM uses a bent probe, which allows for axial reflection imaging, accurate surface scanning, and easy identification of topographic artifacts. Using this novel dual-optical SNOM, we image desiccated and non-desiccated human breast epithelial tissue. By comparing the simultaneous SNOM images, we isolate the effects of tissue morphology and variations in refractive indices on the forward- and back-scattering of light from the tissue. We find that the reduction in back-scattering from tissue, relative to the glass slide, is caused by dense packing of the scattering sites in the cytoplasm (morphology) in the desiccated tissue and a thin-film of water adhering to the glass slide (refractive index) in the non-desiccated tissue sample. Our work demonstrates the potential of our customized dual-optical SNOM system for label-free tissue diagnostics. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Praying Mantis Bending Core Breakoff and Retention Mechanism
Badescu, Mircea; Sherrit, Stewart; Bar-Cohen, Yoseph; Bao, Xiaoqi; Lindermann, Randel A.
2011-01-01
Sampling cores requires the controlled breakoff of the core at a known location with respect to the drill end. An additional problem is designing a mechanism that can be implemented at a small scale, yet is robust and versatile enough to be used for a variety of core samples. The new design consists of a set of tubes (a drill tube, an outer tube, and an inner tube) and means of sliding the inner and outer tubes axially relative to each other. Additionally, a sample tube can be housed inside the inner tube for storing the sample. The inner tube fits inside the outer tube, which fits inside the drill tube. The inner and outer tubes can move axially relative to each other. The inner tube presents two lamellae with two opposing grabbing teeth and one pushing tooth. The pushing tooth is offset axially from the grabbing teeth. The teeth can move radially and their motion is controlled by the outer tube. The outer tube presents two lamellae with radial extrusions to control the inner tube lamellae motion. In breaking the core, the mechanism creates two support points (the grabbing teeth and the bit tip) and one push point. The core is broken in bending. The grabbing teeth can also act as a core retention mechanism. The praying mantis that is disclosed herein is an active core breaking/retention mechanism that requires only one additional actuator other than the drilling actuator. It can break cores that are attached to the borehole bottom as
Electron scattering from CO in the 2Pi resonance region
International Nuclear Information System (INIS)
Buckman, S.J.; Lohmann, B.
1986-01-01
The total cross section for electron scattering from CO in the energy range 0.5--5 eV has been measured with use of a time-of-flight spectrometer. This energy region encompasses the 2 π shape resonance, and a comparison is made with other experimental and theoretical results with regard to the magnitude and position of this structure
Improved core monitoring for improved plant operations
International Nuclear Information System (INIS)
Mueller, N.P.
1987-01-01
Westinghouse has recently installed a core on-line surveillance, monitoring and operations systems (COSMOS), which uses only currently available core and plant data to accurately reconstruct the core average axial and radial power distributions. This information is provided to the operator in an immediately usable, human-engineered format and is accumulated for use in application programs that provide improved core performance predictive tools and a data base for improved fuel management. Dynamic on-line real-time axial and radial core monitoring supports a variety of plant operations to provide a favorable cost/benefit ratio for such a system. Benefits include: (1) relaxation or elimination of certain technical specifications to reduce surveillance and reporting requirements and allow higher availability factors, (2) improved information displays, predictive tools, and control strategies to support more efficient core control and reduce effluent production, and (3) expanded burnup data base for improved fuel management. Such systems can be backfit into operating plants without changing the existing instrumentation and control system and can frequently be implemented on existing plant computer capacity
Fu, Fengjiang; Sun, Shipeng; Zhang, Sui; Chung, Neal Tai-Shung
2014-01-01
Delamination and low water permeability are two issues limiting the applications of dual-layer hollow fiber membranes in the pressure retarded osmosis (PRO) process. In this work, we first developed a universal co-casting method that is able to co-cast highly viscous dope solutions to form homogeneous dual-layer flat sheet membranes. By employing this method prior to the tedious dual-layer hollow fiber spinning process, both time and material consumptions are significantly saved. The addition of polyvinylpyrrolidone (PVP) is found to eliminate delamination at the sacrifice of water flux. A new post-treatment method that involves flowing ammonium persulfate (APS) solution and DI water counter-currently is potentially to remove the PVP molecules entrapped in the substrate while keeps the integrity of the interface. As the APS concentration increases, the water flux in the PRO process is increased while the salt leakage is slightly decreased. With the optimized APS concentration of 5wt%, the post-treated membrane shows a maximum power density of 5.10W/m2 at a hydraulic pressure of 15.0bar when 1M NaCl and 10mM NaCl were used as the draw and feed solutions, respectively. To the extent of our knowledge, this is the best phase inversion dual-layer hollow fiber membrane with an outer selective layer for osmotic power generation. © 2014 Elsevier B.V.
Fu, Fengjiang
2014-11-01
Delamination and low water permeability are two issues limiting the applications of dual-layer hollow fiber membranes in the pressure retarded osmosis (PRO) process. In this work, we first developed a universal co-casting method that is able to co-cast highly viscous dope solutions to form homogeneous dual-layer flat sheet membranes. By employing this method prior to the tedious dual-layer hollow fiber spinning process, both time and material consumptions are significantly saved. The addition of polyvinylpyrrolidone (PVP) is found to eliminate delamination at the sacrifice of water flux. A new post-treatment method that involves flowing ammonium persulfate (APS) solution and DI water counter-currently is potentially to remove the PVP molecules entrapped in the substrate while keeps the integrity of the interface. As the APS concentration increases, the water flux in the PRO process is increased while the salt leakage is slightly decreased. With the optimized APS concentration of 5wt%, the post-treated membrane shows a maximum power density of 5.10W/m2 at a hydraulic pressure of 15.0bar when 1M NaCl and 10mM NaCl were used as the draw and feed solutions, respectively. To the extent of our knowledge, this is the best phase inversion dual-layer hollow fiber membrane with an outer selective layer for osmotic power generation. © 2014 Elsevier B.V.
Core optimization studies for a small heating reactor
International Nuclear Information System (INIS)
Galperin, A.
1986-11-01
Small heating reactor cores are characterized by a high contribution of the leakage to the neutron balance and by a large power density variation in the axial direction. A limited number of positions is available for the control rods, which are necessary to satisfy overall reactivity requirements subject to a safety related constraint on the maximum worth of each rod. Design approaches aimed to improve safety and fuel utilization performance of the core include separation of the cooling and moderating functions of the water with the core in order to reduce hot-to-cold reactivity shift and judicious application of the axial Gd zoning aimed to improve the discharge burnup distribution. Several design options are analyzed indicating a satisfactory solution of the axial burnup distribution problem. The feasibility of the control rod system including zircaloy, stainless steel, natural boron and possibly enriched boron rods is demonstrated. A preliminary analysis indicates directions for further improvements of the core performance by an additional reduction of the hot-to-cold reactivity shift and by a reduction of the depletion reactivity swing adopting a higher gadolinium concentration in the fuel or a two-batch fuel management scheme. (author)
Axial magnetic field produced by axially and radially magnetized permanent rings
International Nuclear Information System (INIS)
Peng, Q.L.; McMurry, S.M.; Coey, J.M.D.
2004-01-01
Axial magnetic fields produced by axially and radially magnetized permanent magnet rings were studied. First, the axial magnetic field produced by a current loop is introduced, from which the axial field generated by an infinitely thin solenoid and by an infinitely thin current disk can be derived. Then the axial fields produced by axially and by radially magnetized permanent magnet rings can be obtained. An analytic formula for the axial fields produced by two axially magnetized rings is given. A permanent magnet with a high axial gradient field is fabricated, the measured results agree with the theoretical calculation very well. As an example, the axial periodic field produced by an arrangement of alternating axially and radially magnetized rings has been discussed
Marchenko , T; Carniato , S; Journel , L; Guillemin , R; Kawerk , E; Žitnik , M; Kavčič , M; Bučar , K; Bohinc , R; Petric , M; da Cruz , V Vaz; Gel'mukhanov , F; Simon , Marielle
2015-01-01
International audience; We present an experimental and theoretical study of resonant inelastic x-ray scattering (RIXS) in the CS2 molecule near the S 1s edge. We show that localization of the S 1s core-hole occurs in CS2 during the RIXS process due to the orientational dephasing of interference between the waves scattering on the two sulfur atoms. Strong evolution of the RIXS profile with the excitation energy far below the first absorption resonance reflects the onset of electron dynamics tr...
Energy Technology Data Exchange (ETDEWEB)
Jikich, S.A.; McLendon, T.R.; Seshadri, K.S.; Irdi, G.A.; Smith, D.H.
2007-11-01
Measurements of sorption isotherms and transport properties of CO2 in coal cores are important for designing enhanced coalbed methane/CO2 sequestration field projects. Sorption isotherms measured in the lab can provide the upper limit on the amount of CO2 that might be sorbed in these projects. Because sequestration sites will most likely be in unmineable coals, many of the coals will be deep and under considerable lithostatic and hydrostatic pressures. These lithostatic pressures may significantly reduce the sorption capacities and/or transport rates. Consequently, we have studied apparent sorption and diffusion in a coal core under confining pressure. A core from the important bituminous coal Pittsburgh #8 was kept under a constant, three-dimensional external stress; the sample was scanned by X-ray computer tomography (CT) before, then while it sorbed, CO2. Increases in sample density due to sorption were calculated from the CT images. Moreover, density distributions for small volume elements inside the core were calculated and analyzed. Qualitatively, the computerized tomography showed that gas sorption advanced at different rates in different regions of the core, and that diffusion and sorption progressed slowly. The amounts of CO2 sorbed were plotted vs. position (at fixed times) and vs. time (for various locations in the sample). The resulting sorption isotherms were compared to isotherms obtained from powdered coal from the same Pittsburgh #8 extended sample. The results showed that for this single coal at specified times, the apparent sorption isotherms were dependent on position of the volume element in the core and the distance from the CO2 source. Also, the calculated isotherms showed that less CO2 was sorbed than by a powdered (and unconfined) sample of the coal. Changes in density distributions during the experiment were also observed. After desorption, the density distribution of calculated volume elements differed from the initial distribution
A dual chemosensor: Colorimetric detection of Co{sup 2+} and fluorometric detection of Zn{sup 2+}
Energy Technology Data Exchange (ETDEWEB)
Lee, Seong Youl; Kim, So Young; Kim, Jin Ah; Kim, Cheal, E-mail: chealkim@seoultech.ac.kr
2016-11-15
A new dual chemosensor 1was designed and synthesized. Receptor 1 detected Co{sup 2+} via color change and Zn{sup 2+} with turn-on fluorescence in a 1:1stoichiometric system, respectively. The response mechanisms of 1-Co{sup 2+} and 1-Zn{sup 2+} complexes have been analyzed using UV–vis spectroscopy, fluorescence titration, ESI-mass spectrometry analysis, NMR titration and DFT calculations. Importantly, the detection limit of 1 for Co{sup 2+}was down to 0.34 μM a near-perfect aqueous solution, which is the lowest one among those previously reported for organic chemosensors for sensing of Co{sup 2+}. 1 was also used to quantify Co{sup 2+} in real water samples. Therefore, a versatile chemosensor 1 could be a great method for detecting of both Co{sup 2+} and Zn{sup 2+}.
Self-dual configurations in Abelian Higgs models with k-generalized gauge field dynamics
Energy Technology Data Exchange (ETDEWEB)
Casana, R.; Cavalcante, A. [Departamento de Física, Universidade Federal do Maranhão,65080-805, São Luís, Maranhão (Brazil); Hora, E. da [Departamento de Física, Universidade Federal do Maranhão,65080-805, São Luís, Maranhão (Brazil); Coordenadoria Interdisciplinar de Ciência e Tecnologia, Universidade Federal do Maranhão,65080-805, São Luís, Maranhão (Brazil)
2016-12-14
We have shown the existence of self-dual solutions in new Maxwell-Higgs scenarios where the gauge field possesses a k-generalized dynamic, i.e., the kinetic term of gauge field is a highly nonlinear function of F{sub μν}F{sup μν}. We have implemented our proposal by means of a k-generalized model displaying the spontaneous symmetry breaking phenomenon. We implement consistently the Bogomol’nyi-Prasad-Sommerfield formalism providing highly nonlinear self-dual equations whose solutions are electrically neutral possessing total energy proportional to the magnetic flux. Among the infinite set of possible configurations, we have found families of k-generalized models whose self-dual equations have a form mathematically similar to the ones arising in the Maxwell-Higgs or Chern-Simons-Higgs models. Furthermore, we have verified that our proposal also supports infinite twinlike models with |ϕ|{sup 4}-potential or |ϕ|{sup 6}-potential. With the aim to show explicitly that the BPS equations are able to provide well-behaved configurations, we have considered a test model in order to study axially symmetric vortices. By depending of the self-dual potential, we have shown that the k-generalized model is able to produce solutions that for long distances have a exponential decay (as Abrikosov-Nielsen-Olesen vortices) or have a power-law decay (characterizing delocalized vortices). In all cases, we observe that the generalization modifies the vortex core size, the magnetic field amplitude and the bosonic masses but the total energy remains proportional to the quantized magnetic flux.
Directory of Open Access Journals (Sweden)
Fenglin Huang
2016-01-01
Full Text Available A superfine Li0.33La0.557TiO3 (LLTO, 69.4 nm was successfully synthesized by a facile solvent-thermal method to enhance the electrochemical properties of the lithium-ion battery separator. Co-axial nanofiber of cellulose and Poly(vinylidene fluoride-co-hexafluoropropylene (PVDF-HFP was prepared by a co-axial electrospinning technique, in which the shell material was PVDF-HFP and the core was cellulose. LLTO superfine nanoparticles were incorporated into the shell of the PVDF-HFP. The core–shell composite nanofibrous membrane showed good wettability (16.5°, contact angle, high porosity (69.77%, and super electrolyte compatibility (497%, electrolyte uptake. It had a higher ionic conductivity (13.897 mS·cm−1 than those of pure polymer fibrous membrane and commercial separator. In addition, the rate capability (155.56 mAh·g−1 was also superior to the compared separator. These excellent performances endowed LLTO composite nanofibrous membrane as a promising separator for high-performance lithium-ion batteries.
Local drying underwater cutting of reactor core internals by CO laser
International Nuclear Information System (INIS)
Beppu, Seiji; Takano, Genta; Matsumoto, Osa; Sugihara, Masaaki; Miya, Kenzo.
1991-01-01
Since the CO laser operates at shorter wavelength than the CO 2 laser, the former has superior ability to cut materials. Its applicability to the cutting of reactor core internals in a nuclear power plant has been studied. In order to use such a laser for cutting actual structures, it would be useful to develop underwater cutting technology for the purpose of minimizing radiation exposure during cutting. However, since the laser beam is absorbed by water, a path needs to be cleared along the laser's line of sight. The authors have developed a nozzle that forms a local dry zone and have demonstrated that CO laser cutting can be carried out under water as it is in air. (author)
Jenk, Theo Manuel; Rubino, Mauro; Etheridge, David; Ciobanu, Viorela Gabriela; Blunier, Thomas
2016-08-01
Palaeoatmospheric records of carbon dioxide and its stable carbon isotope composition (δ13C) obtained from polar ice cores provide important constraints on the natural variability of the carbon cycle. However, the measurements are both analytically challenging and time-consuming; thus only data exist from a limited number of sampling sites and time periods. Additional analytical resources with high analytical precision and throughput are thus desirable to extend the existing datasets. Moreover, consistent measurements derived by independent laboratories and a variety of analytical systems help to further increase confidence in the global CO2 palaeo-reconstructions. Here, we describe our new set-up for simultaneous measurements of atmospheric CO2 mixing ratios and atmospheric δ13C and δ18O-CO2 in air extracted from ice core samples. The centrepiece of the system is a newly designed needle cracker for the mechanical release of air entrapped in ice core samples of 8-13 g operated at -45 °C. The small sample size allows for high resolution and replicate sampling schemes. In our method, CO2 is cryogenically and chromatographically separated from the bulk air and its isotopic composition subsequently determined by continuous flow isotope ratio mass spectrometry (IRMS). In combination with thermal conductivity measurement of the bulk air, the CO2 mixing ratio is calculated. The analytical precision determined from standard air sample measurements over ice is ±1.9 ppm for CO2 and ±0.09 ‰ for δ13C. In a laboratory intercomparison study with CSIRO (Aspendale, Australia), good agreement between CO2 and δ13C results is found for Law Dome ice core samples. Replicate analysis of these samples resulted in a pooled standard deviation of 2.0 ppm for CO2 and 0.11 ‰ for δ13C. These numbers are good, though they are rather conservative estimates of the overall analytical precision achieved for single ice sample measurements. Facilitated by the small sample requirement
Directory of Open Access Journals (Sweden)
Rajesh Raju
2018-03-01
Full Text Available We report the synthesis and properties of temperature- and pH-responsive p([NIPAm-co-PEGMA] (core/[NIPAm-co-AAc] (shell nanogels with narrow size distributions, tunable sizes and increased drug loading efficiencies. The core-shell nanogels were synthesized using an optimized two-stage seeded polymerization methodology. The core-shell nanogels show a narrow size distribution and controllable physico-chemical properties. The hydrodynamic sizes, charge distributions, temperature-induced volume phase transition behaviors, pH-responsive behaviors and drug loading capabilities of the core-shell nanogels were investigated using transmission electron microscopy, zeta potential measurements, dynamic light scattering and UV-Vis spectroscopy. The size of the core-shell nanogels was controlled by polymerizing NIPAm with crosslinker poly(ethylene glycol dimethacrylate (PEGDMA of different molecular weights (Mn-200, 400, 550 and 750 g/mol during the core synthesis. It was found that the swelling/deswelling kinetics of the nanogels was sharp and reversible; with its volume phase transition temperature in the range of 40–42 °C. Furthermore, the nanogels loaded with l-3,4-dihydroxyphenylalanine (L-DOPA, using a modified breathing-in mechanism, showed high loading and encapsulation efficiencies, providing potential possibilities of such nanogels for biomedical applications.
Varma, Ruchi; Ghosh, Jayanta
2018-06-01
A new hybrid technique, which is a combination of neural network (NN) and support vector machine, is proposed for designing of different slotted dual band proximity coupled microstrip antennas. Slots on the patch are employed to produce the second resonance along with size reduction. The proposed hybrid model provides flexibility to design the dual band antennas in the frequency range from 1 to 6 GHz. This includes DCS (1.71-1.88 GHz), PCS (1.88-1.99 GHz), UMTS (1.92-2.17 GHz), LTE2300 (2.3-2.4 GHz), Bluetooth (2.4-2.485 GHz), WiMAX (3.3-3.7 GHz), and WLAN (5.15-5.35 GHz, 5.725-5.825 GHz) bands applications. Also, the comparative study of this proposed technique is done with the existing methods like knowledge based NN and support vector machine. The proposed method is found to be more accurate in terms of % error and root mean square % error and the results are in good accord with the measured values.
Structural and magnetic properties of CoO-Pt core-shell nanoparticles
Czech Academy of Sciences Publication Activity Database
Zeleňáková, A.; Zeleňák, V.; Michalik, Štefan; Kováč, J.; Meisel, M. W.
2014-01-01
Roč. 89, č. 10 (2014), "104417-1"-"104417-10" ISSN 1098-0121 Institutional support: RVO:68378271 Keywords : CoO-Pt core shell nanoparticles * superparamagnetism * superspin glass state * x-ray diffraction * x-ray absorption spectroscopy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.736, year: 2014
Electromagnetic linear machines with dual Halbach array design and analysis
Yan, Liang; Peng, Juanjuan; Zhang, Lei; Jiao, Zongxia
2017-01-01
This book extends the conventional two-dimensional (2D) magnet arrangement into 3D pattern for permanent magnet linear machines for the first time, and proposes a novel dual Halbach array. It can not only effectively increase the radial component of magnetic flux density and output force of tubular linear machines, but also significantly reduce the axial flux density, radial force and thus system vibrations and noises. The book is also the first to address the fundamentals and provide a summary of conventional arrays, as well as novel concepts for PM pole design in electric linear machines. It covers theoretical study, numerical simulation, design optimization and experimental works systematically. The design concept and analytical approaches can be implemented to other linear and rotary machines with similar structures. The book will be of interest to academics, researchers, R&D engineers and graduate students in electronic engineering and mechanical engineering who wish to learn the core principles, met...
Axial power deviation control strategy and computer simulation for Daya Bay Nuclear Power Station
International Nuclear Information System (INIS)
Liao Yehong; Zhou Xiaoling, Xiao Min
2004-01-01
Daya Bay Nuclear Power Station has very tight operation diagram especially at its right side. Therefore the successful control of axial power deviation for PWR is crucial to nuclear safety. After analyzing various core characters' effect on axial power distribution, several axial power deviation control strategies has been proposed to comply with different power varying operation scenario. Application and computer simulation of the strategies has shown that our prediction of axial power deviation evolution are comparable to the measurement values, and that our control strategies are effective. Engineering experience shows that the application of our methodology can predict accurately the transient of axial power deviation, and therefore has become a useful tool for reactor operation and safety control. This paper presents the axial power control characteristics, reactor operation strategy research, computer simulation, and comparison to measurement results in Daya Bay Nuclear Power Station. (author)
International Nuclear Information System (INIS)
Morita, Toshio.
1975-01-01
A nuclear reactor control method is described in which the power variations of the reactor are controlled partly by varying the concentration of the neutron absorbing element and partly by varying the positions of the control rods, in order to maintain the axial distribution of power appreciably symmetrical during the normal operation of the reactor. The control points are located in the upper and lower halves of the core. The controls are operated to maintain the output power difference between the upper and lower halves of the core, based on the total output power (axial deviation) significantly equal to a predetermined optimum figure during the entire running of the reactor, including when there are power variations. The optimum value is obtained by determining the axial deviation at full power with the xenon in balance and all the control rods withdrawn from the fuel area of the core. This optimum value is recalculated after a period appreciably equal to that of a month's operation at full power. This method applies in particular to PWR type reactors [fr
DEFF Research Database (Denmark)
Habib, Md Selim; Markos, Christos; Bang, Ole
2017-01-01
Hollow-core anti-resonant (HC-AR) fibers are perhaps the best platform for ultrafast nonlinear optics based on light-gas interactions because they offer broadband guidance and low-loss guidance. The main advantage of using gases inside HC fibers is that both the dispersion and nonlinearity can...... be tuned by simply changing the pressure of the gas [1]. The emission of efficient dispersive wave (DW) in the deep-UV has been already observed in a uniform Ar-filled hollow-core fiber with tunability from 200 to 320 nm by changing the gas pressure and pulse energy [2]. In the quest of optimizing...
Energy Technology Data Exchange (ETDEWEB)
Takenaka, Y.; Kuzumoto, M. (Mitsubishi Electric Corp., Tokyo (Japan))
1994-03-20
This paper describes discharge excitation technology and resonator technology as basic technologies for high power CO2 lasers. As a result of progress in high-frequency power element techniques, the discharge excitation technology now generally uses laser excitation using AC discharge of capacity coupling type. Its representative example is silent discharge (SD) excitation. This is a system to excite laser by applying high voltages with as high frequency as 100 kHz to 1 MHz across a pair of electrodes covered with a dielectric material. The system maintains stability in discharge even if power supply voltage amplitude is modulated, and easily provides pulse outputs. Discharge excitation for diffusion cooled type CO2 laser generates a discharge in a gap with a gap length of about 2 mm, and can perform gas cooling by means of thermal conduction of gas, whereas a compact resonator can be fabricated. A resonator for the diffusion cooled type CO2 laser eliminates gas circulation and cooling systems, hence the device can be made more compact. A report has been given that several of these compact resonators were combined, from which a laser output of 85W was obtained by using RF discharge of 2kW. 43 refs., 21 figs.
Angle resolved photoelectron distribution of the 1{pi} resonance of CO/Pt(111)
Energy Technology Data Exchange (ETDEWEB)
Haarlammert, Thorben; Wegner, Sebastian; Tsilimis, Grigorius; Zacharias, Helmut [Physikalisches Institut, Westfaelische Wilhelms Universitaet, Muenster (Germany); Golovin, Alexander [Institute of Physics, St. Petersburg State University (Russian Federation)
2009-07-01
The CO 1{pi} level of a c(4 x 2)-2CO/Pt(111) reconstruction shows a significant resonance when varying the photon energy between h{nu}=23 eV and h{nu}=48 e V. This resonance has not been observed in gas phase measurements or on the Pt(1 10) surface. To investigate the photoelectron distribution of the 1{pi} level high harmonic radiaton has been used. By conversion in rare gases like argon, neon, or helium photon energies of up to 100 eV have been generated at repetition r ates of up to 10 kHz. The single harmonics have been separated and focused by a toroidal grating and directed to the sample surface. A time-of-flight detector with multiple anodes registers the kinetic energies of the emitted photoelectrons and enables the simultaneous detection of multiple emission angles. The angular distributions of photoelectrons emitted from the CO 1{pi} level have been measured for a variety of initial photon energies. Further the angular distributions of the CO 1{pi} level photoelectrons emitted from a CO-Pt{sub 7} cluster have been calculated using the MSX{alpha}-Method which shows good agreement with the ex perimental data.
International Nuclear Information System (INIS)
Marchenko, T; Carniato, S; Journel, L; Guillemin, R; Kawerk, E; Simon, M; Žitnik, M; Kavčič, M; Bučar, K; Bohinc, R; Petric, M; Da Cruz, V Vaz; Gel'mukhanov, F
2015-01-01
We present an experimental and theoretical study of resonant inelastic x-ray scattering (RIXS) in the CS 2 molecule near the S 1s edge. We show that localization of the S 1s core-hole occurs in CS 2 during the RIXS process due to the orientational dephasing of interference between the waves scattering on the two sulfur atoms. Strong evolution of the RIXS profile with the excitation energy far below the first absorption resonance reflects the onset of electron dynamics triggered by a coherent excitation of multiple electronic states. (paper)
Core design options for high conversion BWRs operating in Th–233U fuel cycle
International Nuclear Information System (INIS)
Shaposhnik, Y.; Shwageraus, E.; Elias, E.
2013-01-01
Highlights: • BWR core operating in a closed self-sustainable Th– 233 U fuel cycle. • Seed blanket optimization that includes assembly size array and axial dimensions. • Fully coupled MC with fuel depletion and thermo-hydraulic feedback modules. • Thermal-hydraulic analysis includes MCPR observation. -- Abstract: Several options of fuel assembly design are investigated for a BWR core operating in a closed self-sustainable Th– 233 U fuel cycle. The designs rely on an axially heterogeneous fuel assembly structure consisting of a single axial fissile zone “sandwiched” between two fertile blanket zones, in order to improve fertile to fissile conversion ratio. The main objective of the study was to identify the most promising assembly design parameters, dimensions of fissile and fertile zones, for achieving net breeding of 233 U. The design challenge, in this respect, is that the fuel breeding potential is at odds with axial power peaking and the core minimum critical power ratio (CPR), hence limiting the maximum achievable core power rating. Calculations were performed with the BGCore system, which consists of the MCNP code coupled with fuel depletion and thermo-hydraulic feedback modules. A single 3-dimensional fuel assembly having reflective radial boundaries was modeled applying simplified restrictions on the maximum centerline fuel temperature and the CPR. It was found that axially heterogeneous fuel assembly design with a single fissile zone can potentially achieve net breeding, while matching conventional BWR core power rating under certain restrictions to the core loading pattern design
Mass and Force Sensing of an Adsorbate on a Beam Resonator Sensor
Directory of Open Access Journals (Sweden)
Yin Zhang
2015-06-01
Full Text Available The mass sensing superiority of a micro-/nano-mechanical resonator sensor over conventional mass spectrometry has been, or at least is being firmly established. Because the sensing mechanism of a mechanical resonator sensor is the shifts of resonant frequencies, how to link the shifts of resonant frequencies with the material properties of an analyte formulates an inverse problem. Besides the analyte/adsorbate mass, many other factors, such as position and axial force, can also cause the shifts of resonant frequencies. The in situ measurement of the adsorbate position and axial force is extremely difficult if not impossible, especially when an adsorbate is as small as a molecule or an atom. Extra instruments are also required. In this study, an inverse problem of using three resonant frequencies to determine the mass, position and axial force is formulated and solved. The accuracy of the inverse problem solving method is demonstrated, and how the method can be used in the real application of a nanomechanical resonator is also discussed. Solving the inverse problem is helpful to the development and application of a mechanical resonator sensor for two reasons: reducing extra experimental equipment and achieving better mass sensing by considering more factors.
Wang, Haipeng; Qiu, Liyun; Wang, Guangbin; Gao, Fei; Jia, Haipeng; Zhao, Junyu; Chen, Weibo; Wang, Cuiyan; Zhao, Bin
2017-06-01
The cardiac magnetic resonance (CMR) of children at 3.0 T presents a unique set of technical challenges because of their small cardiac anatomical structures, fast heart rates, and the limited ability to keep motionless and hold breathe, which could cause problems associated with field inhomogeneity and degrade the image quality. The aim of our study was to evaluate the effect of dual-source parallel radiofrequency (RF) transmission on the B1 homogeneity and image quality in children with CMR at 3.0 T. The study was approved by the institutional ethics committee and written informed consent was obtained. A total of 30 free-breathing children and 30 breath-hold children performed CMR examinations with dual-source and single-source RF transmission. The B1 homogeneity, contrast ratio (CR) of cine images, and off-resonance artifacts in cine images between dual-source and single-source RF transmission were assessed in free-breathing and breath-hold groups, respectively. In both free-breathing and breath-hold groups, higher mean percentage of flip angle (free-breathing group: 104.2 ± 4.6 vs 95.5 ± 6.3, P 3.0 T. This technology could be taken into account in CMR for children with cardiac diseases.
Optimization of CO2 Laser Cutting Process using Taguchi and Dual Response Surface Methodology
Directory of Open Access Journals (Sweden)
M. Madić
2014-09-01
Full Text Available Selection of optimal cutting parameter settings for obtaining high cut quality in CO2 laser cutting process is of great importance. Among various analytical and experimental optimization methods, the application of Taguchi and response surface methodology is one of most commonly used for laser cutting process optimization. Although the concept of dual response surface methodology for process optimization has been used with success, till date, no experimental study has been reported in the field of laser cutting. In this paper an approach for optimization of CO2 laser cutting process using Taguchi and dual response surface methodology is presented. The goal was to determine the near optimal laser cutting parameter values in order to ensure robust condition for minimization of average surface roughness. To obtain experimental database for development of response surface models, Taguchi’s L25 orthogonal array was implemented for experimental plan. Three cutting parameters, the cutting speed (3, 4, 5, 6, 7 m/min, the laser power (0.7, 0.9, 1.1, 1.3, 1.5 kW, and the assist gas pressure (3, 4, 5, 6, 7 bar, were used in the experiment. To obtain near optimal cutting parameters settings, multi-stage Monte Carlo simulation procedure was performed on the developed response surface models.
Magnetic resonance imaging findings in patients with Hallervorden-Spatz syndrome
International Nuclear Information System (INIS)
Nomura, Cesar Higa; Lima, Eduardo Carneiro; Cerri, Giovanni Guido; Leite, Claudia da Costa; Rosemberg, Sergio
2003-01-01
The objective of this study was to review the magnetic resonance imaging findings in patients with Hallervorden-Spatz syndrome. We evaluated eight patients with Hallervorden-Spatz syndrome using magnetic resonance imaging. The protocol included at least sagittal and axial T1-weighted images and axial and coronal T2-weighted images. Intravenous gadolinium was administered in a dose of 0.1 mmol/kg. Post-enhanced images were obtained at least in the axial and coronal planes. The results were: all patients presented a bilateral and symmetrical 'tiger-eye signal' on T2-weighted images, corresponding to central hyperintensity and peripheral hypointensity in the globi pallidus. FLAIR and diffusion images showed similar abnormalities. There was no gadolinium enhancement in any of the cases. We concluded that magnetic resonance imaging findings in patients with Hallervorden-Spatz syndrome are very typical and allow the diagnosis of the disease. (author)
Torsional Oscillations of the Earths's Core
Hide, Raymond; Boggs, Dale H.; Dickey, Jean O.
1997-01-01
Torsional oscillations of the Earth's liquid metallic outer core are investigated by diving the core into twenty imaginary e1qui-volume annuli coaxial with the axis of ratation of the Earth and determining temproal fluctuations in the axial component of angular memonetum of each annulus under the assumption of iso-rotation on cylindrical surfaces.
International Nuclear Information System (INIS)
Yamaoki, Rumi; Kimura, Shojiro; Ohta, Masatoshi
2011-01-01
Characteristics of free radical components of irradiated black pepper fruit (skin) and the pepper seed (core) were analyzed using electron spin resonance. A weak signal near g=2.005 was observed in black pepper before irradiation. Complex spectra near g=2.005 with three lines (the skin) or seven lines (the core) were observed in irradiated black pepper (both end line width; ca. 6.8 mT). The spectral intensities decreased considerably at 30 days after irradiation, and continued to decrease steadily thereafter. The spectra simulated on the basis of the content and the stability of radical components derived from plant constituents, including fiber, starch, polyphenol, mono- and disaccharide, were in good agreement with the observed spectra. Analysis showed that the signal intensities derived from fiber in the skin for an absorbed dose were higher, and the rates of decrease were lower, than that in the core. In particular, the cellulose radical component in the skin was highly stable. - Highlights: → We identified the radical components in irradiated black pepper skin and core. → The ESR spectra near g=2.005 with 3-7 lines were emerged after irradiation. → Spectra simulated basing on the content and the stability of radical from the plant constituents. → Cellulose radical component in black pepper skin was highly stable. → Single signal near g=2.005 was the most stable in black pepper core.
Federal Laboratory Consortium — The Animal Magnetic Resonance Imaging (MRI) Core develops and optimizes MRI methods for cardiovascular imaging of mice and rats. The Core provides imaging expertise,...
Paul, Shuvojit; Kumar, Randhir; Banerjee, Ayan
2018-04-01
Two-point microrheology measurements from widely separated colloidal particles approach the bulk viscosity of the host medium more reliably than corresponding single-point measurements. In addition, active microrheology offers the advantage of enhanced signal to noise over passive techniques. Recently, we reported the observation of a motional resonance induced in a probe particle in dual-trap optical tweezers when the control particle was driven externally [Paul et al., Phys. Rev. E 96, 050102(R) (2017), 10.1103/PhysRevE.96.050102]. We now demonstrate that the amplitude and phase characteristics of the motional resonance can be used as a sensitive tool for active two-point microrheology to measure the viscosity of a viscous fluid. Thus, we measure the viscosity of viscous liquids from both the amplitude and phase response of the resonance, and demonstrate that the zero crossing of the phase response of the probe particle with respect to the external drive is superior compared to the amplitude response in measuring viscosity at large particle separations. We compare our viscosity measurements with those using a commercial rheometer and obtain an agreement ˜1 % . The method can be extended to viscoelastic material where the frequency dependence of the resonance may provide further accuracy for active microrheological measurements.
Directory of Open Access Journals (Sweden)
Alfakih Khaled
2011-05-01
Full Text Available Abstract Background The dual-bolus protocol enables accurate quantification of myocardial blood flow (MBF by first-pass perfusion cardiovascular magnetic resonance (CMR. However, despite the advantages and increasing demand for the dual-bolus method for accurate quantification of MBF, thus far, it has not been widely used in the field of quantitative perfusion CMR. The main reasons for this are that the setup for the dual-bolus method is complex and requires a state-of-the-art injector and there is also a lack of post processing software. As a solution to one of these problems, we have devised a universal dual-bolus injection scheme for use in a clinical setting. The purpose of this study is to show the setup and feasibility of the universal dual-bolus injection scheme. Methods The universal dual-bolus injection scheme was tested using multiple combinations of different contrast agents, contrast agent dose, power injectors, perfusion sequences, and CMR scanners. This included 3 different contrast agents (Gd-DO3A-butrol, Gd-DTPA and Gd-DOTA, 4 different doses (0.025 mmol/kg, 0.05 mmol/kg, 0.075 mmol/kg and 0.1 mmol/kg, 2 different types of injectors (with and without "pause" function, 5 different sequences (turbo field echo (TFE, balanced TFE, k-space and time (k-t accelerated TFE, k-t accelerated balanced TFE, turbo fast low-angle shot and 3 different CMR scanners from 2 different manufacturers. The relation between the time width of dilute contrast agent bolus curve and cardiac output was obtained to determine the optimal predefined pause duration between dilute and neat contrast agent injection. Results 161 dual-bolus perfusion scans were performed. Three non-injector-related technical errors were observed (1.9%. No injector-related errors were observed. The dual-bolus scheme worked well in all the combinations of parameters if the optimal predefined pause was used. Linear regression analysis showed that the optimal duration for the predefined
Directory of Open Access Journals (Sweden)
Ivo Stachiv
2015-11-01
Full Text Available Vibrating micro-/nanosized cantilever beams under an applied axial force are the key components of various devices used in nanotechnology. In this study, we perform a complete theoretical investigation of the cantilever beams under an arbitrary value of the axial force vibrating in a specific environment such as vacuum, air or viscous fluid. Based on the results easy accessible expressions enabling one the fast and highly accurate estimations of changes in the Q-factor and resonant frequencies of beam oscillating in viscous fluid caused by the applied axial force are derived and analyzed. It has been also shown that for beam-to-string and string vibrational regimes the mode shape starts to significantly deviate from the one known for a beam without axial force. Moreover, a linear dependency of the vibrational amplitude in resonance on the dimensionless tension parameter has been found. We revealed that only a large axial force, i.e. the string vibrational regime, significantly improves the Q-factor of beams submerged in fluid, while an increase of the axial force in beam and beam-to-string transition regimes has a negligibly small impact on the Q-factor enhancement. Experiments carried out on the carbon nanotubes and nanowires are in a good agreement with present theoretical predictions.
Study of magnetization and magnetoelectricity in CoFe2O4/BiFeO3 core-shell composites
Kuila, S.; Tiwary, Sweta; Sahoo, M. R.; Barik, A.; Babu, P. D.; Siruguri, V.; Birajdar, B.; Vishwakarma, P. N.
2018-02-01
CoFe2O4 (core)/BiFeO3 (shell) nanoparticles are prepared by varying the relative molar concentration of core and shell materials (40%CoFe2O4-60%BiFeO3, 50%CoFe2O4-50%BiFeO3, and 60%CoFe2O4-40%BiFeO3). The core-shell nature is confirmed from transmission electron microscopy on these samples. A plot of ΔM (=MFC-MZFC) vs temperature suggests the presence of two types of spin dynamics: (a) particle size dependent spin blocking and (b) spin-disorder. These two spin dynamic processes are found to contribute independently to the generation of magnetoelectric voltage. Very clear first order and second order magnetoelectric voltages are recorded. The resemblance of the first order magnetoelectric coefficient vs temperature plot to that of building up of order parameters in the mean field theory suggests that spin disorder can act like one of the essential ingredients in building the magnetoelectric coupling. The best result is obtained for the 50-50 composition sample, which may be due to better coupling of magnetostrictive CoFe2O4, and piezoelectric BiFeO3, because of the optimum thickness of shell and core.
CoRE: A context-aware relation extraction method for relation completion
Li, Zhixu; Sharaf, Mohamed Abdel Fattah; Sitbon, Laurianne; Du, Xiaoyong; Zhou, Xiaofang
2014-01-01
We identify relation completion (RC) as one recurring problem that is central to the success of novel big data applications such as Entity Reconstruction and Data Enrichment. Given a semantic relation {\\cal R}, RC attempts at linking entity pairs between two entity lists under the relation {\\cal R}. To accomplish the RC goals, we propose to formulate search queries for each query entity \\alpha based on some auxiliary information, so that to detect its target entity \\beta from the set of retrieved documents. For instance, a pattern-based method (PaRE) uses extracted patterns as the auxiliary information in formulating search queries. However, high-quality patterns may decrease the probability of finding suitable target entities. As an alternative, we propose CoRE method that uses context terms learned surrounding the expression of a relation as the auxiliary information in formulating queries. The experimental results based on several real-world web data collections demonstrate that CoRE reaches a much higher accuracy than PaRE for the purpose of RC. © 1989-2012 IEEE.
CoRE: A context-aware relation extraction method for relation completion
Li, Zhixu
2014-04-01
We identify relation completion (RC) as one recurring problem that is central to the success of novel big data applications such as Entity Reconstruction and Data Enrichment. Given a semantic relation {\\\\cal R}, RC attempts at linking entity pairs between two entity lists under the relation {\\\\cal R}. To accomplish the RC goals, we propose to formulate search queries for each query entity \\\\alpha based on some auxiliary information, so that to detect its target entity \\\\beta from the set of retrieved documents. For instance, a pattern-based method (PaRE) uses extracted patterns as the auxiliary information in formulating search queries. However, high-quality patterns may decrease the probability of finding suitable target entities. As an alternative, we propose CoRE method that uses context terms learned surrounding the expression of a relation as the auxiliary information in formulating queries. The experimental results based on several real-world web data collections demonstrate that CoRE reaches a much higher accuracy than PaRE for the purpose of RC. © 1989-2012 IEEE.
Ionization and photofragmentation of Ru3(CO)12 and Os3(CO)12
International Nuclear Information System (INIS)
Schalk, Oliver; Josefsson, Ida; Odelius, Michael; Richter, Robert; Prince, Kevin C.; Mucke, Melanie
2015-01-01
In this paper, we use a combination of photoelectron spectroscopy, mass spectrometry, and density functional theory calculations to get a detailed understanding of valence single and double ionization and the subsequent dissociation processes. This is exemplified on benchmark systems, trimetallo-dodecacarbonyls M 3 (CO) 12 with M = Ru, Os, where the energy remaining in the molecule after photoionization can be retrieved by measuring the degree of fragmentation of the molecular ion. The intensity of different mass peaks can thus be directly related to ionization cross sections obtained by photoelectron spectroscopy. We find that the M—CO dissociation energy rises as the number of CO ligands decreases due to dissociation. Moreover, ionization of the CO ligands has a higher cross section than that of the metal center for both single and double ionization. After advanced fragmentation, a CO bond can break and the carbon atom remains bonded to the metal core. In addition, we found that the valence ionization cross sections of M 3 (CO) 12 are maximal at about 40 eV photon energy thus showing a more pronounced shape resonance than Ru and Os-complexes with a single metal atom center. Finally, an np → nd giant resonance absorption causes a significant increase of the ionization cross section above 50 eV for Ru 3 (CO) 12
Permeability changes of coal cores and briquettes under tri-axial stress conditions
Czech Academy of Sciences Publication Activity Database
Wierzbicki, M.; Konečný, Pavel; Kožušníková, Alena
2014-01-01
Roč. 59, č. 4 (2014), s. 1129-1138 ISSN 0860-7001 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : coal * gas permeability * tri-axial stress * coal briquettes Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.608, year: 2013 http://mining.archives.pl
Directory of Open Access Journals (Sweden)
E. S. Ahmed
2012-06-01
Full Text Available A new class of dual mode microstrip fractal resonator is proposed and developed for miniaturization of the dual band bandpass filter. The perimeter of the proposed resonator is increased by employing fourth iteration T-square fractal shape. Consequently the lower resonant frequency of the filter is decreased without increasing the usable space. The self similarity of the usable structure enables it to produce the two degenerate modes which are coupled using the proper perturbation technique. The shorting pin is placed at the null in the surface current distribution at the center of the resonator. This shorting pin is coactively coupled to the resonant circuit of the resonator, effectively coupled to the lower degenerate mode and reduces the lower edge band resonant frequency. By adjusting the resonator dimensions and the size of the shorting pin, the resonant frequency and the out-of-band rejection around the transmission bands can be controlled to meet the design requirements. The simulated response of the designed filter has two transmission bands, the first band is from 2.34-3.65 GHz with resonant frequencies at 2.47GHz and 3.55GHz, the second band is from 4.37-5.324GHz with resonant frequencies at 4.5GHz and 5.13GHz. In the pass bands, the group delay is less than 0.65 ns. The proposed filter can be applied to WLAN (2.4 GHz and 5.2 GHz and WiMAX (3.5 GHz and Bluetooth and ZigBee (4.9 GHz.
Disallowing Same-program Co-schedules to Improve Efficiency in Quad-core Servers
de Blanche, Andreas; Lundqvist, Thomas
2017-01-01
Programs running on different cores in a multicore server are often forced to share resources like off-chip memory, caches, I/O devices, etc. This resource sharing often leads to degraded performance, a slowdown, for the programs that share the resources. A job scheduler can improve performance by co-scheduling programs that use different resources on the same server. The most common approach to solve this co-scheduling problem has been to make job-schedulers resource aware, finding ways to c...
Highly Tunable Electrothermally Actuated Arch Resonator
Hajjaj, Amal Z.
2016-12-05
This paper demonstrates experimentally, theoretically, and numerically a wide-range tunability of electrothermally actuated MEMS arch beams. The beams are made of silicon and are intentionally fabricated with some curvature as in-plane shallow arches. Analytical results based on the Galerkin discretization of the Euler Bernoulli beam theory are generated and compared to the experimental data and results of a multi-physics finite-element model. A good agreement is found among all the results. The electrothermal voltage is applied between the anchors of the clamped-clamped MEMS arch beam, generating a current that passes through the MEMS arch beam and controls its axial stress caused by thermal expansion. When the electrothermal voltage increases, the compressive stress increases inside the arch beam. This leads to increase in its curvature, thereby increases the resonance frequencies of the structure. We show here that the first resonance frequency can increase up to twice its initial value. We show also that after some electro-thermal voltage load, the third resonance frequency starts to become more sensitive to the axial thermal stress, while the first resonance frequency becomes less sensitive. These results can be used as guidelines to utilize arches as wide-range tunable resonators.
Transport Mechanisms for CO2-CH4 Exchange and Safe CO2 Storage in Hydrate-Bearing Sandstone
Directory of Open Access Journals (Sweden)
Knut Arne Birkedal
2015-05-01
Full Text Available CO2 injection in hydrate-bearing sediments induces methane (CH4 production while benefitting from CO2 storage, as demonstrated in both core and field scale studies. CH4 hydrates have been formed repeatedly in partially water saturated Bentheim sandstones. Magnetic Resonance Imaging (MRI and CH4 consumption from pump logs have been used to verify final CH4 hydrate saturation. Gas Chromatography (GC in combination with a Mass Flow Meter was used to quantify CH4 recovery during CO2 injection. The overall aim has been to study the impact of CO2 in fractured and non-fractured samples to determine the performance of CO2-induced CH4 hydrate production. Previous efforts focused on diffusion-driven exchange from a fracture volume. This approach was limited by gas dilution, where free and produced CH4 reduced the CO2 concentration and subsequent driving force for both diffusion and exchange. This limitation was targeted by performing experiments where CO2 was injected continuously into the spacer volume to maintain a high driving force. To evaluate the effect of diffusion length multi-fractured core samples were used, which demonstrated that length was not the dominating effect on core scale. An additional set of experiments is presented on non-fractured samples, where diffusion-limited transportation was assisted by continuous CO2 injection and CH4 displacement. Loss of permeability was addressed through binary gas (N2/CO2 injection, which regained injectivity and sustained CO2-CH4 exchange.
A fixed incore based system for an on line core margin monitoring
International Nuclear Information System (INIS)
Mourlevat, J. L.; Carrasco, M.
2002-01-01
In order to comply with the needs of Utilities for improvements in the economic competitiveness of nuclear energy, one of the solutions proposed is to reduce the cost of the fuel cycle. To this aim, increasing the lifetime of cycles by introducing so-called low leakage fuel loading patterns to the reactor is a rather promising solution. However, these loading patterns lead to an increase in the core hostspot factors and therefore to a reduction in the core operating margins. For many years FRAMATOME-ANP has developed and proposed solutions aiming at increasing and therefore restoring these margins, namely; the improvement in design methods based on three-dimensional modelling of the core,on kinetic representation of transients and on neutron-thermohydraulic coupling, or the improvement in the fuel with the introduction of intermediate mixing girds. A third approach is to improve the core instrumentation associated with the system for monitoring the core operating limits: it is this approach that is described in this presentation. The core operating limits monitoring function calls on realtime knowledge of the power distribution. At present time, for most of the PWRs operated in the world, this knowledge is based on the measurement of the axial power distribution made by two-section neutron detectors located outside the pressure vessel. This kind of detectors is only able to provide the operators with a rustic picture of the axial power distribution through the axial dissymmetry index so called axial-offset. During normal core operation operators have to control the axial power distribution that means to keep the axial-offset value inside a pre-determined domain of which the width is a function of the mean power level. This pre-determined domain is calculated or checked during the nuclear design phase of the reload and due to th emethodology used to calculate it, a consderable potential for improving the core operating margin does ewxist. This the reason why
Intrinsically radiolabelled [59Fe]-SPIONs for dual MRI/radionuclide detection
Hoffman, David; Sun, Minghao; Yang, Likun; McDonagh, Philip R; Corwin, Frank; Sundaresan, Gobalakrishnan; Wang, Li; Vijayaragavan, Vimalan; Thadigiri, Celina; Lamichhane, Narottam; Zweit, Jamal
2014-01-01
Towards the development of iron oxide nanoparticles with intrinsically incorporated radionuclides for dual Positron Emission Tomography/Magnetic Resonance Imaging (PET/MRI) and more recently of Single Photon Emission Computed Tomography/Magnetic Resonance Imaging (SPECT/MRI), we have developed intrinsically radiolabeled [59Fe]-superparamagnetic iron oxide nanoparticles ([59Fe]-SPIONs) as a proof of concept for an intrinsic dual probe strategy. 59Fe was incorporated into Fe3O4 nanoparticle cry...
Potassium-Based Dual Ion Battery with Dual-Graphite Electrode.
Fan, Ling; Liu, Qian; Chen, Suhua; Lin, Kairui; Xu, Zhi; Lu, Bingan
2017-08-01
A potassium ion battery has potential applications for large scale electric energy storage systems due to the abundance and low cost of potassium resources. Dual graphite batteries, with graphite as both anode and cathode, eliminate the use of transition metal compounds and greatly lower the overall cost. Herein, combining the merits of the potassium ion battery and dual graphite battery, a potassium-based dual ion battery with dual-graphite electrode is developed. It delivers a reversible capacity of 62 mA h g -1 and medium discharge voltage of ≈3.96 V. The intercalation/deintercalation mechanism of K + and PF 6 - into/from graphite is proposed and discussed in detail, with various characterizations to support. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Porous Core-Shell Nanostructures for Catalytic Applications
Ewers, Trevor David
Porous core-shell nanostructures have recently received much attention for their enhanced thermal stability. They show great potential in the field of catalysis, as reactant gases can diffuse in and out of the porous shell while the core particle is protected from sintering, a process in which particles coalesce to form larger particles. Sintering is a large problem in industry and is the primary cause of irreversible deactivation. Despite the obvious advantages of high thermal stability, porous core-shell nanoparticles can be developed to have additional interactive properties from the combination of the core and shell together, rather than just the core particle alone. This dissertation focuses on developing new porous core-shell systems in which both the core and shell take part in catalysis. Two types of systems are explored; (1) yolk-shell nanostructures with reducible oxide shells formed using the Kirkendall effect and (2) ceramic-based porous oxide shells formed using sol-gel chemistry. Of the Kirkendall-based systems, Au FexOy and Cu CoO were synthesized and studied for catalytic applications. Additionally, ZnO was explored as a potential shelling material. Sol-gel work focused on optimizing synthetic methods to allow for coating of small gold particles, which remains a challenge today. Mixed metal oxides were explored as a shelling material to make dual catalysts in which the product of a reaction on the core particle becomes a reactant within the shell.
Resonant Raman scattering of ZnS, ZnO, and ZnS/ZnO core/shell quantum dots
Energy Technology Data Exchange (ETDEWEB)
Milekhin, A.G. [Institute of Semiconductor Physics, Novosibirsk (Russian Federation); Novosibirsk State University, Novosibirsk (Russian Federation); Yeryukov, N.A.; Sveshnikova, L.L.; Duda, T.A. [Institute of Semiconductor Physics, Novosibirsk (Russian Federation); Himcinschi, C. [TU Bergakademie Freiberg, Institut fuer Theoretische Physik, Freiberg (Germany); Zenkevich, E.I. [Belarussian National Technical University, Minsk (Belarus); Zahn, D.R.T. [Chemnitz University of Technology, Semiconductor Physics, Chemnitz (Germany)
2012-05-15
Resonant Raman scattering by optical phonon modes as well as their overtones was investigated in ZnS and ZnO quantum dots grown by the Langmuir-Blodgett technique. The in situ formation of ZnS/ZnO core/shell quantum dots was monitored by Raman spectroscopy during laser illumination. (orig.)
Nishihara, Munetake; Freund, Jonathan B.; Glumac, Nick G.; Elliott, Gregory S.
2018-03-01
This paper presents dual-pump coherent anti-Stokes Raman scattering (CARS) measurements for simultaneous detection of flow temperature and relative concentration, applied to the characterization of a discharge-coupled reacting jet in a cross flow. The diagnostic is hydrogen Q-branch based, providing a much wider dynamic range compared to detection in the S-branch. For a previously developed dielectric barrier discharge, aligned co-axially with the fuel jet, OH planar laser induced fluorescence measurements show that the disturbance in the flame boundary leads to mixing enhancement. The H2-N2 dual-pump CARS measurement was used to map two-dimensional temperature distributions. The increase of the maximum temperature was up to 300 K, with 50% more H2 consumption, providing the reason for the decrease in the flame length by 25%. The increase of the relative H2O-H2 fraction was accompanied with a temperature increase, which indicates local equivalence ratios of below 1. The H2-O2 dual-pump measurements confirmed that the fuel-oxidizer ratios remain in the fuel-lean side at most of the probed locations.
Liu, Xiao-Li; Liang, Shan; Nan, Fan; Pan, Yue-Yue; Shi, Jun-Jun; Zhou, Li; Jia, Shuang-Feng; Wang, Jian-Bo; Yu, Xue-Feng; Wang, Qu-Quan
2013-10-21
Cubic Au-AgCdS core-shell nanostructures were synthesized through cation exchange method assisted by tributylphosphine (TBP) as a phase-transfer agent. Among intermediate products, Au-Ag core-shell nanocubes exhibited many high-order plasmon resonance modes related to the special cubic shape, and these plasmon bands red-shifted along with the increasing of particle size. The plasmon band of Au core first red-shifted and broadened at the step of Au-Ag₂S and then blue-shifted and narrowed at the step of Au-AgCdS. Since TBP was very crucial for the efficient conversion from Ag₂S to CdS, we found that both absorption and fluorescence of the final products could be controlled by TBP.
Zhang, Liyun; Liu, Hongyang; Huang, Xing; Sun, Xueping; Jiang, Zheng; Schlögl, Robert; Su, Dangsheng
2015-12-21
Nanodiamond-graphene core-shell materials have several unique properties compared with purely sp(2) -bonded nanocarbons and perform remarkably well as metal-free catalysts. In this work, we report that palladium nanoparticles supported on nanodiamond-graphene core-shell materials (Pd/ND@G) exhibit superior catalytic activity in CO oxidation compared to Pd NPs supported on an sp(2) -bonded onion-like carbon (Pd/OLC) material. Characterization revealed that the Pd NPs in Pd/ND@G have a special morphology with reduced crystallinity and are more stable towards sintering at high temperature than the Pd NPs in Pd/OLC. The electronic structure of Pd is changed in Pd/ND@G, resulting in weak CO chemisorption on the Pd NPs. Our work indicates that strong metal-support interactions can be achieved on a non-reducible support, as exemplified for nanocarbon, by carefully tuning the surface structure of the support, thus providing a good example for designing a high-performance nanostructured catalyst. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Maekawa, Hiroaki; Sul, Soohwan; Ge, Nien-Hui
2013-01-01
Highlights: ► Vibrational dynamics of conjugated C=O and N=N modes of ethyl diazoacetate was studied. ► Their frequency–frequency correlation functions are different. ► The dual-frequency 2D IR spectrum indicates anticorrelated frequency fluctuations. ► Correlation effects on dual-frequency 2D IR spectra are discussed. ► The existence of cis and trans conformers is revealed in 2D IR spectra. - Abstract: We have applied infrared three-pulse photon echo and single- and dual-frequency 2D IR spectroscopy to the ester C=O and diazo N=N stretching modes in ethyl diazoacetate (EDA), and investigated their vibrational frequency fluctuations and correlation. The two modes exhibit different vibrational dynamics and 2D lineshape, which are well simulated by frequency–frequency correlation functions (FFCFs) with two decaying components. Although the FT IR spectrum shows a single C=O band, absolute magnitude 2D IR nonrephasing spectrum displays spectral signatures supporting the presence of cis and trans conformations. The cross-peak inclined toward the anti-diagonal in the dual-frequency 2D IR spectrum, indicating that the frequency fluctuations of the two modes are anticorrelated. This behavior is attributed to anticorrelated change in the bond orders when solvent and structural fluctuations causes EDA to adopt a different mixture of the two dominant resonance structures. The effects of cross FFCF on the cross-peak line shape are discussed
Energy Technology Data Exchange (ETDEWEB)
Maekawa, Hiroaki; Sul, Soohwan [Department of Chemistry, University of California at Irvine, Irvine, CA 92697-2025 (United States); Ge, Nien-Hui, E-mail: nhge@uci.edu [Department of Chemistry, University of California at Irvine, Irvine, CA 92697-2025 (United States)
2013-08-30
Highlights: ► Vibrational dynamics of conjugated C=O and N=N modes of ethyl diazoacetate was studied. ► Their frequency–frequency correlation functions are different. ► The dual-frequency 2D IR spectrum indicates anticorrelated frequency fluctuations. ► Correlation effects on dual-frequency 2D IR spectra are discussed. ► The existence of cis and trans conformers is revealed in 2D IR spectra. - Abstract: We have applied infrared three-pulse photon echo and single- and dual-frequency 2D IR spectroscopy to the ester C=O and diazo N=N stretching modes in ethyl diazoacetate (EDA), and investigated their vibrational frequency fluctuations and correlation. The two modes exhibit different vibrational dynamics and 2D lineshape, which are well simulated by frequency–frequency correlation functions (FFCFs) with two decaying components. Although the FT IR spectrum shows a single C=O band, absolute magnitude 2D IR nonrephasing spectrum displays spectral signatures supporting the presence of cis and trans conformations. The cross-peak inclined toward the anti-diagonal in the dual-frequency 2D IR spectrum, indicating that the frequency fluctuations of the two modes are anticorrelated. This behavior is attributed to anticorrelated change in the bond orders when solvent and structural fluctuations causes EDA to adopt a different mixture of the two dominant resonance structures. The effects of cross FFCF on the cross-peak line shape are discussed.
Provino, Laurent; Taunay, Thierry
2018-02-01
Optimal suppression of higher-order modes (HOMs) in hollow-core antiresonant fibers comprising a single ring of thin-walled capillaries was previously studied, and can be achieved when the condition on the capillary-tocore diameter ratio is satisfied (d/D ≍ 0.68). Here we report on the conditions for maximizing the leakage losses of HOMs in hollow-core nested antiresonant node-less fibers, while preserving low confinement loss for the fundamental mode. Using an analytical model based on coupled capillary waveguides, as well as full-vector finite element modeling, we show that optimal d/D value leading to high leakage losses of HOMs, is strongly correlated to the size of nested capillaries. We also show that extremely high value of degree of HOM suppression (˜1200) at the resonant coupling is almost unchanged on a wide range of nested capillary diameter dN ested values. These results thus suggest the possibility of designing antiresonant fibers with nested elements, which show optimal guiding performances in terms of the HOM loss compared to that of the fundamental mode, for clearly defined paired values of the ratios dN ested/d and d/D. These can also tend towards a single-mode behavior only when the dimensionless parameter dN ested/d is less than 0.30, with identical wall thicknesses for all of the capillaries.
International Nuclear Information System (INIS)
Harty, R.B.
1991-01-01
The development of the wire core system for Nuclear Thermal Propulsion (NTP) that took place from 1963 to 1965 is discussed. A wire core consists of a fuel wire with spacer wires. It's an annular flow core having a central control rod. There are actually four of these, with beryllium solid reflectors on both ends and all the way around. Much of the information on the concept is given in viewgraph form. Viewgraphs are presented on design details of the wire core, the engine design, engine weight vs. thrust, a technique used to fabricate the wire fuel element, and axial temperature distribution
Vanathi Vijayalakshmi, R.; Praveen Kumar, P.; Selvarani, S.; Rajakumar, P.; Ravichandran, K.
2017-10-01
A series of core@shell nanoparticles (Co@TiO2, Ag@TiO2 and Co@AgCl) stabilized with zeroth generation triazolylchalcone dendrimer was synthesized using reduction transmetalation method. The coordination of chalcone dendrimer with silver ions was confirmed by UV-vis spectroscopy. The NMR spectrum ensures the number of protons and carbon signals in the chalcone dendrimer. The prepared samples were structurally characterized by XRD, FESEM and HRTEM analysis. The SAED and XRD analyses exhibited the cubic structure with d hkl = 2.2 Å, 1.9 Å and 1.38 Å. The antibacterial and antifungal activities of the dendrimer stabilized core@shell nanoparticles (DSCSNPs) were tested against the pathogens Bacillus subtilis, Proteus mirabilis, Candida albicans and Aspergillus nigir from which it is identified that the dendrimer stabilized core shell nanoparticles with silver ions at the shell (Co@AgCl) shows effectively high activity against the tested pathogen following the other core@shell nanoparticles viz Ag@TiO2 and Co@TiO2.
Co-sputtered Mo/Re superconducting coplanar resonators compatible with carbon nanotube growth
Energy Technology Data Exchange (ETDEWEB)
Blien, Stefan; Stiller, Peter L.; Goetz, Karl; Vavra, Ondrej; Huber, Thomas; Mayer, Thomas; Strunk, Christoph; Huettel, Andreas K. [Institute for Experimental and Applied Physics, University of Regensburg, 93040 Regensburg (Germany)
2016-07-01
Carbon nanotubes are simultaneously prototypical single electron tunneling devices and nano-electromechanical resonators. In particular for ''ultraclean'' devices, where the nanotube is grown in a last fabrication step over pre-existing chip structures, highly regular quantum spectra and high mechanical quality factors emerge. Targeting optomechanical experiments, a coupling of these devices to on-chip superconducting coplanar waveguide resonators is highly desirable. The conditions for in-situ growth of carbon nanotubes over metal contacts are quite detrimental to most superconductors: the CVD growth process takes place in a hydrogen/methane atmosphere heated up to 900 {sup circle} C. We present data on transmission line resonators fabricated of a co-sputtered molybdenum rhenium alloy that withstand CVD and remain superconducting with critical temperatures up to 8K after growth. Resonant operation at cryogenic temperatures is demonstrated, and the behaviour is highly consistent with a combination of Mattis-Bardeen theory and two-level systems in the substrate.
Integrated nanohole array surface plasmon resonance sensing device using a dual-wavelength source
International Nuclear Information System (INIS)
Escobedo, C; Vincent, S; Choudhury, A I K; Campbell, J; Gordon, R; Brolo, A G; Sinton, D
2011-01-01
In this paper, we demonstrate a compact integrated nanohole array-based surface plasmon resonance sensing device. The unit includes a LED light source, driving circuitry, CCD detector, microfluidic network and computer interface, all assembled from readily available commercial components. A dual-wavelength LED scheme was implemented to increase spectral diversity and isolate intensity variations to be expected in the field. The prototype shows bulk sensitivity of 266 pixel intensity units/RIU and a limit of detection of 6 × 10 −4 RIU. Surface binding tests were performed, demonstrating functionality as a surface-based sensing system. This work is particularly relevant for low-cost point-of-care applications, especially those involving multiple tests and field studies. While nanohole arrays have been applied to many sensing applications, and their suitability to device integration is well established, this is the first demonstration of a fully integrated nanohole array-based sensing device.
Fuel loading method to exchangeable reactor core of BWR type reactor and its core
International Nuclear Information System (INIS)
Koguchi, Kazushige.
1995-01-01
In a fuel loading method for an exchangeable reactor core of a BWR type reactor, at least two kinds of fresh fuel assemblies having different reactivities between axial upper and lower portions are preliminarily prepared, and upon taking out fuel assemblies of advanced combustion and loading the fresh fuel assemblies dispersingly, they are disposed so as to attain a predetermined axial power distribution in the reactor. At least two kinds of fresh fuel assemblies have a content of burnable poisons different between the axial upper portion and lower portions. In addition, reactivity characteristics are made different at a region higher than the central boundary and a region lower than the central boundary which is set within a range of about 6/24 to 16/24 from the lower portion of the fuel effective length. There can be attained axial power distribution as desired such as easy optimization of the axial power distribution, high flexibility, and flexible flattening of the power distribution, and it requires no special change in view of the design and has a good economical property. (N.H.)
International Nuclear Information System (INIS)
Siegenthaler, Urs; Monnin, Eric; Kawamura, Kenji; Spahni, Renato; Schwander, Jakob; Stauffer, Bernhard; Stocker, Thomas F.; Fischer, Hubertus
2005-01-01
The most direct method of investigating past variations of the atmospheric CO 2 concentration before 1958, when continuous direct atmospheric CO 2 measurements started, is the analysis of air extracted from suitable ice cores. Here we present a new detailed CO 2 record from the Dronning Maud Land (DML) ice core, drilled in the framework of the European Project for Ice Coring in Antarctica (EPICA) and some new measurements on a previously drilled ice core from the South Pole. The DML CO 2 record shows an increase from about 278 to 282 parts per million by volume (ppmv) between ad 1000 and ad 1200 and a fairly continuous decrease to a mean value of about 277 ppmv around ad 1700. While the new South Pole measurements agree well with DML at the minimum at ad 1700 they are on average about 2 ppmv lower during the period ad 1000-1500. Published measurements from the coastal high-accumulation site Law Dome are considered as very reliable because of the reproducibility of the measurements, high temporal resolution and an accurate time scale. Other Antarctic ice cores could not, or only partly, reproduce the pre-industrial measurements from Law Dome. A comparison of the trends of DML and Law Dome shows a general agreement. However we should be able to rule out co-variations caused by the same artefact. Two possible effects are discussed, first production of CO 2 by chemical reactions and second diffusion of dissolved air through the ice matrix into the bubbles. While the first effect cannot be totally excluded, comparison of the Law Dome and DML record shows that dissolved air diffusing to bubbles cannot be responsible for the pre-industrial variation. Therefore, the new record is not a proof of the Law Dome results but the first very strong support from an ice core of the Antarctic plateau
Directory of Open Access Journals (Sweden)
Chelsea N Wong
2015-08-01
Full Text Available Higher cardiorespiratory fitness is associated with better cognitive performance and enhanced brain activation. Yet, the extent to which cardiorespiratory fitness-related brain activation is associated with better cognitive performance is not well understood. In this cross-sectional study, we examined whether the association between cardiorespiratory fitness and executive function was mediated by greater prefrontal cortex activation in healthy older adults. Brain activation was measured during dual-task performance with functional magnetic resonance imaging in a sample of 128 healthy older adults (59-80 years. Higher cardiorespiratory fitness was associated with greater activation during dual-task processing in several brain areas including the anterior cingulate and supplementary motor cortex (ACC/SMA, thalamus and basal ganglia, right motor/somatosensory cortex and middle frontal gyrus, and left somatosensory cortex, controlling for age, sex, education, and gray matter volume. Of these regions, greater ACC/SMA activation mediated the association between cardiorespiratory fitness and dual-task performance. We provide novel evidence that cardiorespiratory fitness may support cognitive performance by facilitating brain activation in a core region critical for executive function.
Effects of Boundary Conditions on the Parametric Resonance of Cylindrical Shells under Axial Loading
Directory of Open Access Journals (Sweden)
T.Y. Ng
1998-01-01
Full Text Available In this paper, a formulation for the dynamic stability analysis of circular cylindrical shells under axial compression with various boundary conditions is presented. The present study uses Love’s first approximation theory for thin shells and the characteristic beam functions as approximate axial modal functions. Applying the Ritz procedure to the Lagrangian energy expression yields a system of Mathieu–Hill equations the stability of which is analyzed using Bolotin’s method. The present study examines the effects of different boundary conditions on the parametric response of homogeneous isotropic cylindrical shells for various transverse modes and length parameters.
Vibrational structures in electron-CO2 scattering below the 2Πu shape resonance
International Nuclear Information System (INIS)
Allan, Michael
2002-01-01
Structures of vibrational origin were discovered in vibrationally inelastic electron-CO 2 cross sections in the energy range 0.4-0.9 eV, well below the 2 Π u shape resonance. They appear in the excitation of higher vibrational levels, in particular the highest members of the Fermi polyads of the type (n, 2m, 0) with n+m=2-4. The lowest two structures, at 0.445 and 0.525 eV, are narrow; higher-lying structures are broader and boomerang-like. The structures are absent when the antisymmetric stretch is co-excited. The structures are interpreted in terms of a wavepacket of the nuclei reflected from a potential surface of the CO 2 - anion in a bent and stretched geometry. A state emerging from the virtual state upon bending and stretching and the state resulting from bending the 2 Π u shape resonance are discussed as possibly being responsible for the structures. (author). Letter-to-the-editor
Siegel, Marilyn J; Kaza, Ravi K; Bolus, David N; Boll, Daniel T; Rofsky, Neil M; De Cecco, Carlo N; Foley, W Dennis; Morgan, Desiree E; Schoepf, U Joseph; Sahani, Dushyant V; Shuman, William P; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L
This is the first of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography (DECT). This article, part 1, describes the fundamentals of the physical basis for DECT and the technology of DECT and proposes uniform nomenclature to account for differences in proprietary terms among manufacturers.
Healy, Noel; Fokine, Michael; Franz, Yohann; Hawkins, Thomas; Jones, Maxwell; Ballato, John; Peacock, Anna C.; Gibson, Ursula J.
2016-01-01
Reduced losses in silicon-core fibers are obtained using CO2 laser directional recrystallization of the core. Single crystals with aspect ratios up to 1500:1 are reported, limited by the scan range of the equipment. This processing technique holds promise for bringing crystalline silicon-core fibers to a central role in nonlinear optics and signal processing applications.
Kamada, M.; Hideshima, T.; Azuma, J.; Yamamoto, I.; Imamura, M.; Takahashi, K.
2016-04-01
Unoccupied and occupied electronic structures of an L-cysteine film have been studied by absorption and resonant photoelectron spectroscopies. Core absorptions at S-L, C-K, N-K, and O-K levels indicate that the lower unoccupied states are predominantly composed of oxygen-2p, carbon-2p, and sulfur-4s+3d orbitals, while higher unoccupied states may be attributed dominantly to nitrogen-np (n ≥ 3), oxygen-np (n ≥ 3), and sulfur-ns+md (n ≥ 4, m ≥ 3) orbitals. Resonant photoelectron spectra at S-L23 and O-K levels indicate that the highest occupied state is originated from sulfur-3sp orbitals, while oxygen-2sp orbitals contribute to the deeper valence states. The delocalization lifetimes of the oxygen-1s and sulfur-2p excited states are estimated from a core-hole clock method to be about 9 ± 1 and 125 ± 25 fs, respectively.
Energy Technology Data Exchange (ETDEWEB)
Kamada, M., E-mail: kamada@cc.saga-u.ac.jp; Hideshima, T.; Azuma, J.; Yamamoto, I.; Imamura, M.; Takahashi, K. [Synchrotron Light Application Center, Saga University, Honjo 1, Saga 840-8502 (Japan)
2016-04-15
Unoccupied and occupied electronic structures of an L-cysteine film have been studied by absorption and resonant photoelectron spectroscopies. Core absorptions at S-L, C-K, N-K, and O-K levels indicate that the lower unoccupied states are predominantly composed of oxygen-2p, carbon-2p, and sulfur-4s+3d orbitals, while higher unoccupied states may be attributed dominantly to nitrogen-np (n ≥ 3), oxygen-np (n ≥ 3), and sulfur-ns+md (n ≥ 4, m ≥ 3) orbitals. Resonant photoelectron spectra at S-L{sub 23} and O-K levels indicate that the highest occupied state is originated from sulfur-3sp orbitals, while oxygen-2sp orbitals contribute to the deeper valence states. The delocalization lifetimes of the oxygen-1s and sulfur-2p excited states are estimated from a core-hole clock method to be about 9 ± 1 and 125 ± 25 fs, respectively.
Radiologic Diagnosis of Spondylodiscitis, Role of Magnetic Resonance
Ramadani, Naser; Dedushi, Kreshnike; Kabashi, Serbeze; Mucaj, Sefedin
2017-01-01
Introduction: Study aim is to report the Magnetic Resonance Imaging (MRI) features of acute and chronic spontaneous spondylodiscitis. Case report: 57 year old female, complaining of a fever and longstanding cervical pain worsened during physical therapy. Methods: MR images were acquired using superconductive magnet 1.5 T, with the following sequences: sagittal PD and T2 TSE, sagittal T1 SE, axial PD and T2 TSE (lumbar spine), axial T2 GRE (cervical spine). Axial and sagittal T1 SE after admin...
Wang, Y Y; Zhao, Z; Luo, G; Li, Y; Zhang, J L; Huang, F
2016-11-01
Objective: To evaluate the specificity and limitations of sacroiliac joint magnetic resonance imaging (MRI) in the diagnosis of axial spondyloarthritis (SpA)in patients with chronic low back pain. Methods: We retrospectively analyzed clinical data of 390 patients with chronic low back pain in Department of Rheumatology, the PLA General Hospital from January 2013 to December 2015, including clinical manifestations, laboratory examinations and MRI data of sacroiliac joints. Results: There were 238 men and 152 women recruited. A total of 326 cases were diagnosed as axial SpA, including 216 men and 110 women with mean age (27.10±8.64) years and mean duration (7.64±3.50) months. Among these 326 patients, 243 (74.5%) were HLA-B 27 positive. The other 64 patients were considered as diagnoses rather than SpA (non-SpA), consisting of 22 men and 42 women with mean age (31.29±7.76) years and mean duration (5.75±2.90)months. Non-SpA group had 10 (15.6%) patients with HLA-B 27 positive. There were 68.1% and 65.0% SpA patients showing bone marrow edema and bone erosion of sacroiliac joint in MRI imaging respectively. Although there were 25.0% non-SpA patients with bone marrow edema and 7.8% with bone erosion in MRI of sacroiliac joint, the scores of bone marrow edema 0.00(0.00, 0.75) and bone erosion [0.00(0.00, 0.00)] were significantly lower compared with those in axial SpA group [bone marrow edema scores 2.00(0.00, 4.00), bone erosion scores 1.00(0.00, 3.00); P Sacroiliac joint MRI is a valuable method to diagnose axial SpA in patients with chronic low back pain. Yet it still has some limitations. Clinical presentations and spinal MRI would be helpful in some patients.
Co3O4@CoS Core-Shell Nanosheets on Carbon Cloth for High Performance Supercapacitor Electrodes
Directory of Open Access Journals (Sweden)
Jinfeng Ning
2017-06-01
Full Text Available In this work, a two-step electrodeposition strategy is developed for the synthesis of core-shell Co3O4@CoS nanosheet arrays on carbon cloth (CC for supercapacitor applications. Porous Co3O4 nanosheet arrays are first directly grown on CC by electrodeposition, followed by the coating of a thin layer of CoS on the surface of Co3O4 nanosheets via the secondary electrodeposition. The morphology control of the ternary composites can be easily achieved by altering the number of cyclic voltammetry (CV cycles of CoS deposition. Electrochemical performance of the composite electrodes was evaluated by cyclic voltammetry, galvanostatic charge–discharge and electrochemical impedance spectroscopy techniques. The results demonstrate that the Co3O4@CoS/CC with 4 CV cycles of CoS deposition possesses the largest specific capacitance 887.5 F·g−1 at a scan rate of 10 mV·s−1 (764.2 F·g−1 at a current density of 1.0 A·g−1, and excellent cycling stability (78.1% capacitance retention at high current density of 5.0 A·g−1 after 5000 cycles. The porous nanostructures on CC not only provide large accessible surface area for fast ions diffusion, electron transport and efficient utilization of active CoS and Co3O4, but also reduce the internal resistance of electrodes, which leads to superior electrochemical performance of Co3O4@CoS/CC composite at 4 cycles of CoS deposition.
Effects of Core Cavity on a Flow Distribution
Energy Technology Data Exchange (ETDEWEB)
Kwon, Tae-Soon; Kim, Kihwan [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-10-15
The axial pressure drop is removed in the free core condition, But the actual core has lots of fuel bundles and mixing vanes to the flow direction. The axial pressure drop induces flow uniformity. In a uniform flow having no shear stress, the cross flow or cross flow mixing decreases. The mixing factor is important in the reactor safety during a Steam Line Break (SLB) or Main Steam Line Break (MSLB) transients. And the effect of core cavity is needed to evaluate the realistic core mixing factor quantification. The multi-dimensional flow mixing phenomena in a core cavity has been studied using a CFD code. The 1/5-scale model was applied for the reactor flow analysis. A single phase water flow conditions were considered for the 4-cold leg and DVI flows. To quantify the mixing intensity, a boron scalar was introduced to the ECC injection water at cold legs and DVI nozzles. The present CFD pre-study was performed to quantify the effects of core structure on the mixing phenomena. The quantified boron mixing scalar in the core simulator model represented the effect of core cavity on the core mixing phenomena. This simulation results also give the information for sensor resolution to measure the boron concentration in the experiments and response time to detect mixing phenomena at the core and reactor vessel.
Deng, Shengjue; Zhong, Yu; Zeng, Yinxiang; Wang, Yadong; Wang, Xiuli; Lu, Xihong; Xia, Xinhui; Tu, Jiangping
2018-03-01
Designing ever more efficient and cost-effective bifunctional electrocatalysts for oxygen/hydrogen evolution reactions (OER/HER) is greatly vital and challenging. Here, a new type of binder-free hollow TiO 2 @Co 9 S 8 core-branch arrays is developed as highly active OER and HER electrocatalysts for stable overall water splitting. Hollow core-branch arrays of TiO 2 @Co 9 S 8 are readily realized by the rational combination of crosslinked Co 9 S 8 nanoflakes on TiO 2 core via a facile and powerful sulfurization strategy. Arising from larger active surface area, richer/shorter transfer channels for ions/electrons, and reinforced structural stability, the as-obtained TiO 2 @Co 9 S 8 core-branch arrays show noticeable exceptional electrocatalytic performance, with low overpotentials of 240 and 139 mV at 10 mA cm -2 as well as low Tafel slopes of 55 and 65 mV Dec -1 for OER and HER in alkaline medium, respectively. Impressively, the electrolysis cell based on the TiO 2 @Co 9 S 8 arrays as both cathode and anode exhibits a remarkably low water splitting voltage of 1.56 V at 10 mA cm -2 and long-term durability with no decay after 10 d. The versatile fabrication protocol and smart branch-core design provide a new way to construct other advanced metal sulfides for energy conversion and storage.
DEFF Research Database (Denmark)
Pedersen, Susanne Juhl; Maksymowych, Walter P
2015-01-01
In the last few years, many studies have investigated the role of imaging for improved diagnosis, assessment of treatment effects, and determining prognosis in patients with axial spondyloarthritis (SpA). Recent research has primarily focused on the utility of magnetic resonance imaging (MRI...... developed and have provided insight into effects of treatment on structural progression and the interrelationships between different lesions visualized by MRI. This review gives an overview of the recent advances in imaging of the axial skeleton in axial SpA from a clinical perspective....
Hu, Jianqiang; Wen, Zhenhai; Wang, Qiang; Yao, Xin; Zhang, Qian; Zhou, Jianhua; Li, Jinghong
2006-12-07
Multifunctional Au(core)Co(3)O(4shell) nanocubes were synthesized through the introduction of chloroauric acid (HAuCl(4)) into a typical hydrothermal system after a solvothermal process was completed to form metastable Co(3)O(4) hollow nanospheres in the presence of sodium dodecyl benzenesulfonate (SDBS), which served as the surfactant. The strategy suggested that HAuCl(4) played a vital role in the shape transformation and core/shell structure formation, and the sizes of the nanocubes can be tunable through control of the acid concentration. The core/shell structure of the nanocubes was demonstrated by X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), and element analysis (EA) measurements. Moreover, Li ion battery measurement indicated that trace Au intercalation altered not only the size and shape of the Co(3)O(4) nanoparticles but also greatly increased their electrochemical properties. These multifunctional nanocubes will be not only helpful to study physical chemistry properties of magnetic nanocrystals but also are expected to find use in many fields such as biomolecular detection and analysis, sensor, electrochemistry, and Li ion batteries.
Resonant influence of a longitudinal hypersonic field on the radiation from channeled electrons
International Nuclear Information System (INIS)
Grigoryan, L.Sh.; Mkrtchyan, A.R.; Mkrtchyan, A.H.; Khachatryan, H.F.; Prade, H.; Wagner, W.; Piestrup, M.A.
2001-01-01
The wave function of a planar/axially channeled electron with energy 10 MeV≤E<<1 GeV under the influence of a longitudinal hypersonic wave excited in a single crystal is calculated. Conditions for the resonant influence of the hypersonic wave on the quantum state of the channeled electron are deduced. Expressions for the wave function that are applicable in the case of resonance are obtained. Angular and spectral distributions of the radiation intensity from the planar/axially channeled electron are also calculated. The possibility of significant amplification of channeling radiation by a hypersonic wave is substantiated. It is found that the hypersound can excite inverse radiative transitions through which the transversal energy of the channeled electron is increased. These transitions have a resonant nature and can lead to a considerable intensification of the electron channeling radiation. In the case of axial channeling, the resonance radiation is sustained also by direct radiative transitions of the electron
Studies of mixed HEU-LEU-MTR cores using 3D models
Energy Technology Data Exchange (ETDEWEB)
Haenggi, P.; Lehmann, E.; Hammer, J.; Christen, R. [Paul Scherrer Institute, Villigen (Switzerland)
1997-08-01
Several different core loadings were assembled at the SAPHIR research reactor in Switzerland combining the available types of MTR-type fuel elements, consisting mainly of both HEU and LEU fuel. Bearing in mind the well known problems which can occur in such configurations (especially power peaking), investigations have been carried out for each new loading with a 2D neutron transport code (BOXER). The axial effects were approximated by a global buckling value and therefore the radial effects could be studied in considerably detail. Some of the results were reported at earlier RERTR meetings and were compared to those obtained by other methods and with experimental values. For the explicit study of the third dimension of the core, another code (SILWER), which has been developed in PSI for LWR power plant cores, has been selected. With the help of an adapted model for the MTR-core of SAPHIR, several important questions have been addressed. Among other aspects, the estimation of the axial contribution to the hot channel factors, the influence of the control rod position and of the Xe-poisoning on the power distribution were studied. Special attention was given to a core position where a new element was assumed placed near a empty, water filled position. The comparison of elements of low and high enrichments at this position was made in terms of the induced power peaks, with explicit consideration of axial effects. The program SILWER has proven to be applicable to MTR-cores for the investigation of axial effects. For routine use as for the support of reactor operation, this 3D code is a good supplement to the standard 2D model.
Profound Interfacial Effects in CoFe2O4/Fe3O4 and Fe3O4/CoFe2O4 Core/Shell Nanoparticles
Polishchuk, Dmytro; Nedelko, Natalia; Solopan, Sergii; Ślawska-Waniewska, Anna; Zamorskyi, Vladyslav; Tovstolytkin, Alexandr; Belous, Anatolii
2018-03-01
Two sets of core/shell magnetic nanoparticles, CoFe2O4/Fe3O4 and Fe3O4/CoFe2O4, with a fixed diameter of the core ( 4.1 and 6.3 nm for the former and latter sets, respectively) and thickness of shells up to 2.5 nm were synthesized from metal chlorides in a diethylene glycol solution. The nanoparticles were characterized by X-ray diffraction, transmission electron microscopy, and magnetic measurements. The analysis of the results of magnetic measurements shows that coating of magnetic nanoparticles with the shells results in two simultaneous effects: first, it modifies the parameters of the core-shell interface, and second, it makes the particles acquire combined features of the core and the shell. The first effect becomes especially prominent when the parameters of core and shell strongly differ from each other. The results obtained are useful for optimizing and tailoring the parameters of core/shell spinel ferrite magnetic nanoparticles for their use in various technological and biomedical applications.
CARS Spectral Fitting with Multiple Resonant Species using Sparse Libraries
Cutler, Andrew D.; Magnotti, Gaetano
2010-01-01
The dual pump CARS technique is often used in the study of turbulent flames. Fast and accurate algorithms are needed for fitting dual-pump CARS spectra for temperature and multiple chemical species. This paper describes the development of such an algorithm. The algorithm employs sparse libraries, whose size grows much more slowly with number of species than a conventional library. The method was demonstrated by fitting synthetic "experimental" spectra containing 4 resonant species (N2, O2, H2 and CO2), both with noise and without it, and by fitting experimental spectra from a H2-air flame produced by a Hencken burner. In both studies, weighted least squares fitting of signal, as opposed to least squares fitting signal or square-root signal, was shown to produce the least random error and minimize bias error in the fitted parameters.
M. Zaidabadi nejad; G.R. Ansarifar
2018-01-01
Improved load-following capability is one of the most important technical tasks of a pressurized water reactor. Controlling the nuclear reactor core during load-following operation leads to some difficulties. These difficulties mainly arise from nuclear reactor core limitations in local power peaking: the core is subjected to sharp and large variation of local power density during transients. Axial offset (AO) is the parameter usually used to represent the core power peaking. One of the impor...
Cross-sectional area of the murine aorta linearly increases with increasing core body temperature.
Crouch, A Colleen; Manders, Adam B; Cao, Amos A; Scheven, Ulrich M; Greve, Joan M
2017-11-06
The cardiovascular (CV) system plays a vital role in thermoregulation. To date, the response of core vasculature to increasing core temperature has not been adequately studied in vivo. Our objective was to non-invasively quantify the arterial response in murine models due to increases in body temperature, with a focus on core vessels of the torso and investigate whether responses were dependent on sex or age. Male and female, adult and aged mice were anaesthetised and underwent magnetic resonance imaging (MRI). Data were acquired from the circle of Willis (CoW), heart, infrarenal aorta and peripheral arteries at core temperatures of 35, 36, 37 and 38 °C (±0.2 °C). Vessels in the CoW did not change. Ejection fraction decreased and cardiac output (CO) increased with increasing temperature in adult female mice. Cross-sectional area of the aorta increased significantly and linearly with temperature for all groups, but at a diminished rate for aged animals (p temperature are biologically important because they may affect conductive and convective heat transfer. Leveraging non-invasive methodology to quantify sex and age dependent vascular responses due to increasing core temperature could be combined with bioheat modelling in order to improve understanding of thermoregulation.
Flow measurements using noise signals of axially displaced thermocouples
Energy Technology Data Exchange (ETDEWEB)
Kozma, R.; Hoogenboom, J.E. (Interuniversitair Reactor Inst., Delft (Netherlands))
1990-01-01
Determination of the flow rate of the coolant in the cooling channels of nuclear reactors is an important aspect of core monitoring. It is usually impossible to measure the flow by flowmeters in the individual channels due to the lack of space and safety reasons. An alternative method is based on the analysis of noise signals of the available in-core detectors. In such a noise method, a transit time which characterises the propagation of thermohydraulic fluctuations (density or temperature fluctuations) in the coolant is determined from the correlation between the noise signals of axially displaced detectors. In this paper, the results of flow measurements using axially displaced thermocouples in the channel wall will be presented. The experiments have been performed in a simulated MRT-type fuel assembly located in the research reactor HOR of the Interfaculty Reactor Institute, Delft. It was found that the velocities obtained via temperature noise correlation methods are significantly larger than the area-averaged velocity in the single-phase coolant flow. Model calculations show that the observed phenomenon can be explained by effects due to the radial velocity distribution in the channel. (author).
Historical Variations in Inner Core Rotation and Polar Motion at Decade Timescales
Dumberry, M.
2005-12-01
Exchanges of angular momentum between the mantle, the fluid core and the solid inner core result in changes in the Earth's rotation. Torques in the axial direction produce changes in amplitude, or changes in length of day, while torques in the equatorial direction lead to changes in orientation of the rotation vector with respect to the mantle, or polar motion. In this work, we explore the possibility that a combination of electromagnetic and gravitational torques on the inner core can reproduce the observed decadal variations in polar motion known as the Markowitz wobble. Torsional oscillations, which involve azimuthal motions in the fluid core with typical periods of decades, entrain the inner core by electromagnetic traction. When the inner core is axially rotated, its surfaces of constant density are no longer aligned with the gravitational potential from mantle density heterogeneities, and this results in a gravitational torque between the two. The axial component of this torque has been previously described and is believed to be partly responsible for decadal changes in length of day. In this work, we show that it has also an equatorial component, which produces a tilt of the inner core and results in polar motion. The polar motion produced by this mechanism depends on the density structure in the mantle, the rheology of the inner core, and the time-history of the angle of axial misalignment between the inner core and the mantle. We reconstruct the latter using a model of torsional oscillations derived from geomagnetic secular variation. From this time-history, and by using published models of mantle density structure, we show that we can reproduce the salient characteristics of the Markowitz wobble: an eccentric decadal polar motion of 30-50 milliarcsecs oriented along a specific longitude. We discuss the implications of this result, noting that a match in both amplitude and phase of the observed Markowitz wobble allows the recovery of the historical
Energy Technology Data Exchange (ETDEWEB)
Busch, S.; Johnson, T.R.C.; Wintersperger, B.J.; Minaifar, N.; Bhargava, A.; Rist, C.; Reiser, M.F.; Becker, C.; Nikolaou, K. [University of Munich, Department of Clinical Radiology, Munich (Germany)
2008-03-15
Cardiac magnetic resonance imaging and echocardiography are currently regarded as standard modalities for the quantification of left ventricular volumes and ejection fraction. With the recent introduction of dual-source computedtomography (DSCT), the increased temporal resolution of 83 ms should also improve the assessment of cardiac function in CT. The aim of this study was to evaluate the accuracy of DSCT in the assessment of left ventricular functional parameters with cardiac magnetic resonance imaging (MRI) as standard of reference. Fifteen patients (two female, 13 male; mean age 50.8 {+-} 19.2 years) underwent CT and MRI examinations on a DSCT (Somatom Definition; Siemens Medical Solutions, Forchheim, Germany) and a 3.0-Tesla MR scanner (Magnetom Trio; Siemens Medical Solutions), respectively. Multiphase axial CT images were analysed with a semiautomatic region growing algorithms (Syngo Circulation; Siemens Medical Solutions) by two independent blinded observers. In MRI, dynamic cine loops of short axis slices were evaluated with semiautomatic contour detection software (ARGUS; Siemens Medical Solutions) independently by two readers. End-systolic volume (ESV), end-diastolic volume (EDV), ejection fraction (EF) and stroke volume (SV) were determined for both modalities, and correlation coefficient, systematic error, limits of agreement and inter-observer variability were assessed. In DSCT, EDV and ESV were 135.8 {+-} 41.9 ml and 54.9 {+-} 29.6 ml, respectively, compared with 132.1 {+-} 40.8 ml EDV and 57.6 {+-} 27.3 ml ESV in MRI. Thus, EDV was overestimated by 3.7 ml (limits of agreement -46.1/+53.6), while ESV was underestimated by 2.6 ml (-36.6/+31.4). Mean EF was 61.6 {+-} 12.4% in DSCT and 57.9 {+-} 9.0% in MRI, resulting in an overestimation of EF by 3.8% with limits of agreement at -14.7 and +22.2%. Rank correlation rho values were 0.81 for EDV (P = 0.0024), 0.79 for ESV (P = 0.0031) and 0.64 for EF (P = 0.0168). The kappa value of inter
International Nuclear Information System (INIS)
Busch, S.; Johnson, T.R.C.; Wintersperger, B.J.; Minaifar, N.; Bhargava, A.; Rist, C.; Reiser, M.F.; Becker, C.; Nikolaou, K.
2008-01-01
Cardiac magnetic resonance imaging and echocardiography are currently regarded as standard modalities for the quantification of left ventricular volumes and ejection fraction. With the recent introduction of dual-source computedtomography (DSCT), the increased temporal resolution of 83 ms should also improve the assessment of cardiac function in CT. The aim of this study was to evaluate the accuracy of DSCT in the assessment of left ventricular functional parameters with cardiac magnetic resonance imaging (MRI) as standard of reference. Fifteen patients (two female, 13 male; mean age 50.8 ± 19.2 years) underwent CT and MRI examinations on a DSCT (Somatom Definition; Siemens Medical Solutions, Forchheim, Germany) and a 3.0-Tesla MR scanner (Magnetom Trio; Siemens Medical Solutions), respectively. Multiphase axial CT images were analysed with a semiautomatic region growing algorithms (Syngo Circulation; Siemens Medical Solutions) by two independent blinded observers. In MRI, dynamic cine loops of short axis slices were evaluated with semiautomatic contour detection software (ARGUS; Siemens Medical Solutions) independently by two readers. End-systolic volume (ESV), end-diastolic volume (EDV), ejection fraction (EF) and stroke volume (SV) were determined for both modalities, and correlation coefficient, systematic error, limits of agreement and inter-observer variability were assessed. In DSCT, EDV and ESV were 135.8 ± 41.9 ml and 54.9 ± 29.6 ml, respectively, compared with 132.1 ± 40.8 ml EDV and 57.6 ± 27.3 ml ESV in MRI. Thus, EDV was overestimated by 3.7 ml (limits of agreement -46.1/+53.6), while ESV was underestimated by 2.6 ml (-36.6/+31.4). Mean EF was 61.6 ± 12.4% in DSCT and 57.9 ± 9.0% in MRI, resulting in an overestimation of EF by 3.8% with limits of agreement at -14.7 and +22.2%. Rank correlation rho values were 0.81 for EDV (P = 0.0024), 0.79 for ESV (P 0.0031) and 0.64 for EF (P = 0.0168). The kappa value of inter-observer variability were
Real-time biodetection using a smartphone-based dual-color surface plasmon resonance sensor
Liu, Qiang; Yuan, Huizhen; Liu, Yun; Wang, Jiabin; Jing, Zhenguo; Peng, Wei
2018-04-01
We proposed a compact and cost-effective red-green dual-color fiber optic surface plasmon resonance (SPR) sensor based on the smartphone. Inherent color selectivity of phone cameras was utilized for real-time monitoring of red and green color channels simultaneously, which can reduce the chance of false detection and improve the sensitivity. Because there are no external prisms, complex optical lenses, or diffraction grating, simple optical configuration is realized. It has a linear response in a refractive index range of 1.326 to 1.351 (R2 = 0.991) with a resolution of 2.3 × 10 - 4 RIU. We apply it for immunoglobulin G (IgG) concentration measurement. Experimental results demonstrate that a linear SPR response was achieved for IgG concentrations varying from 0.02 to 0.30 mg / ml with good repeatability. It may find promising applications in the fields of public health and environment monitoring owing to its simple optics design and applicability in real-time, label-free biodetection.
Ruiz-Díaz, P.; Muñoz-Navia, M.; Dorantes-Dávila, J.
2018-03-01
Charge-doping together with 3 d-4 d alloying emerges as promising mechanisms for tailoring the magnetic properties of low-dimensional systems. Here, throughout ab initio calculations, we present a systematic overview regarding the impact of both electron(hole) charge-doping and chemical composition on the magnetocrystalline anisotropy (MA) of CoPt core-shell alloy clusters. By taking medium-sized Co n Pt m ( N = n + m = 85) octahedral-like alloy nanoparticles for some illustrative core-sizes as examples, we found enhanced MA energies and large induced spin(orbital) moments in Pt-rich clusters. Moreover, depending on the Pt-core-size, both in-plane and off-plane directions of magnetization are observed. In general, the MA of these binary compounds further stabilizes upon charge-doping. In addition, in the clusters with small MA, the doping promotes magnetization switching. Insights into the microscopical origins of the MA behavior are associated to changes in the electronic structure of the clusters. [Figure not available: see fulltext.
Directory of Open Access Journals (Sweden)
Wuseong You
2017-12-01
Full Text Available In this paper, we designed and analyzed advanced sodium-cooled fast reactor cores using uranium-free metallic fuels for maximizing burning rate of transuranics (TRU nuclides from PWR spent fuels. It is well known that the removal of fertile nuclides such as 238U from fuels in liquid metal cooled fast reactor leads to the degradation of important safety parameters such as the Doppler coefficient, coolant void worth, and delayed neutron fraction. To resolve the degradation of the Doppler coefficient, we considered adding resonant nuclides to the uranium-free metallic fuels. The analysis results showed that the cores using uranium-free fuels loaded with tungsten instead of uranium have a significantly lower burnup reactivity swing and more negative Doppler coefficients than the core using uranium-free fuels without resonant nuclides. In addition, we considered the use of axially central B4C absorber region and moderator rods to further improve safety parameters such as sodium void worth, burnup reactivity swing, and the Doppler coefficient. The results of the analysis showed that the final design core can consume ~353 kg per cycle and satisfies self-controllability under unprotected accidents. The fuel cycle analysis showed that the PWR–SFR coupling fuel cycle option drastically reduces the amount of waste going to repository and the SFR burner can consume the amount of TRUs discharged from 3.72 PWRs generating the same electricity.
3D modeling of dual wind-up extensional rheometers
DEFF Research Database (Denmark)
Yu, Kaijia; Román Marín, José Manuel; Rasmussen, Henrik K.
2010-01-01
Fully three-dimensional numerical simulations of a dual wind-up drum rheometer of the Sentmanat Extensional Rheometer (SER; Sentmanat, 2004 [1]) or the Extensional Viscosity Fixture (EVF; Garritano and Berting, 2006 [2]) type have been performed. In the SER and EVF a strip of rectangular shape...... is attached onto two drums, followed by a rotation of both drums in opposite direction. The numerical modeling is based on integral constitutive equations of the K-BKZ type. Generally, to ensure a proper uni-axial extensional deformation in dual wind-up drum rheometers the simulations show that a very small...
Zhang, Naiqian; Wang, Zefeng; Xi, Xiaoming
2017-10-01
In this paper, we demonstrate a novel method for the low-loss coupling between solid-core multi-mode fibers (MMFs) and anti-resonant hollow-core fibers (AR-HCFs). The core/cladding diameter of the MMF is 50/125μm and the mode field diameter of the AR-HCFs are 33.3μm and 71.2μm of the ice-cream type AR-HCFs and the non-node type ARHCFs, respectively. In order to match the mode field diameters of these two specific AR-HCFs, the mode field diameter of the MMFs is increased or decreased by up-tapering or down-tapering the MMFs. Then, according to the principle of coupled fiber mode matching, the optimal diameter of tapered fiber for low-loss coupling is calculated. Based on beam propagation method, the calculated coupling losses without tapering process are 0.31dB and 0.89dB, respectively for a MMF-HCF-MMF structure of the ice-cream type AR-HCFs and the non-node type AR-HCFs. These values can be reduced to 0.096dB and 0.047dB when the outer diameters of the MMF are down-tapered to 116μm and up-tapered to 269μm, respectively. What's more, these results can also be verified by existing experiments.
TRANPZ - A computer code for the simulation of reactors with axial dependence
International Nuclear Information System (INIS)
Sampaio, L.C.M.
1980-12-01
A computer code was developed to simulate a PWR reactor in steady state and during transients. The solution of one speed diffusion equation in the axial direction is obtained numerically dividing the core in various axial segments and the axial power distribution is obtained there from. A method was developed to determine the transient solution. The external reactivity effects are caused by the motion of the control rods, starting from the steady condition with the control rods in any position. The heat conduction equation in the fuel is numerically solved in the radial direction. Various tests were performed in steady state and transient conditions and the validity of the present model was verified. Results were compared in steady state condition with the code CITATION and a reasonable agreement was found. (E.G.) [pt
Energy Technology Data Exchange (ETDEWEB)
Miyazaki, T; Ito, H [Geological Survey of Japan, Tsukuba (Japan)
1996-05-01
This paper introduces examples of image data analysis on fault drilling samples. The paper describes the following matters: core samples used in the analysis are those obtained from wells drilled piercing the Nojima fault which has moved in the Hygoken-Nanbu Earthquake; the CORESCAN system made by DMT Corporation, Germany, used in acquiring the image data consists of a CCD camera, a light source and core rotation mechanism, and a personal computer, its resolution being about 5 pixels/mm in both axial and circumferential directions, and 24-bit full color; with respect to the opening fractures in core samples collected by using a constant azimuth coring, it was possible to derive values of the opening width, inclination angle, and travel from the image data by using a commercially available software for the personal computer; and comparison of this core image with the BHTV record and the hydrophone VSP record (travel and inclination obtained from the BHTV record agree well with those obtained from the core image). 4 refs., 4 figs.
Analysis of resonance oscillation of the neutron flow in a BWR-core
International Nuclear Information System (INIS)
Storm, J.
1987-09-01
This is a thesis which has been made within the institution of automatic control in Lund. Two programs, 'Blackie' and 'Test' have been written in Fortran. These two programs are to be used for the evaluation of ASEA-ATOMs resonance test in different nuclear reactors. In these tests the condition of the reactor becomes more and more unstable because the coolant flow decreases at the same time as the power gradually increases. This leads to resonance in the neutron flow. This flow is measured by detectors placed in different parts of the reactor core. 'Blackie' receives and stores the values sampled by the detectors. The same program also carries out a Fourier analysis. Amplitudes and phase angles from the different oscillations are calculated. These results are then used as inputs for 'Test'. 'Test' is a plotting program. It draws the reactor and plots arrows where the detectors are situated. The size and direction of the arrows are measurements of the amplitudes and phase angles of the neutron flow oscillations. From these arrow diagrams you can come to conclusions about the oscillations in the neutron flow and how the affect the reactor. (author)
Energy Technology Data Exchange (ETDEWEB)
Zhu, Jie [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Usov, Pavel M. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Xu, Wenqian [Argonne National Lab. (ANL), Argonne, IL (United States). Advanced Photon Source (APS) and X-ray Science Division; Celis-Salazar, Paula J. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Lin, Shaoyang [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Kessinger, Matthew C. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Landaverde-Alvarado, Carlos [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemical Engineering and Macromolecules Innovation Inst.; Cai, Meng [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; May, Ann M. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Slebodnick, Carla [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Zhu, Dunru [Nanjing Univ. of Technology (China). State Key Lab. of Materials-Oriented Chemical Engineering (MCE) and College of Chemical Engineering; Senanayake, Sanjaya D. [Brookhaven National Lab. (BNL), Upton, NY (United States). Dept. of Chemistry; Morris, Amanda J. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry and Macromolecules Innovation Inst.
2017-12-22
Metal-organic frameworks (MOFs) have shown great promise in catalysis, mainly due to their high content of active centers, large internal surface areas, tunable pore size, and versatile chemical functionalities. However, it is a challenge to rationally design and construct MOFs that can serve as highly stable and reusable heterogeneous catalysts. Here two new robust 3D porous metal-cyclam-based zirconium MOFs, denoted VPI-100 (Cu) and VPI-100 (Ni), have been prepared by a modulated synthetic strategy. The frameworks are assembled by eight-connected Zr-6 clusters and metallocyclams as organic linkers. Importantly, the cyclam core has accessible axial coordination sites for guest interactions and maintains the electronic properties exhibited by the parent cyclam ring. The VPI-100 MOFs exhibit excellent chemical stability in various organic and aqueous solvents over a wide pH range and show high CO2 uptake capacity (up to similar to 9.83 wt% adsorption at 273 K under 1 atm). Moreover, VPI-100 MOFs demonstrate some of the highest reported catalytic activity values (turnover frequency and conversion efficiency) among Zr-based MOFs for the chemical fixation of CO2 with epoxides, including sterically hindered epoxides. The MOFs, which bear dual catalytic sites (Zr and Cu/Ni), enable chemistry not possible with the cyclam ligand under the same conditions and can be used as recoverable stable heterogeneous catalysts without losing performance.
Using axial magnetized permanent rings to build axial gradient magnetic field
International Nuclear Information System (INIS)
Peng Quanling
2003-01-01
Axial field produced by an axially magnetized permanent ring was studied. For two permanent magnet rings, if they are magnetized in the same direction, a nearly uniform axial field can be produced; if they are magnetized in opposite direction, an axial gradient field can be produced in the region between the two permanent rings, with the field strength changing from -B 0 to B 0 . A high gradient axial magnetic field has been built by using two axially magnetized permanent rings, the measured field results agree with the PANDIRA calculation very well. It is desirable that the field gradient can be varied to match various requirements. A method to produce the variable gradient field is presented. Axial gradient field can also be used as a beam focusing facility for linear accelerator if axial periodic field can be produced. Its magnetic field is similar to that of a solenoid, in which, large stray field will leak to the outside environment. A method for shielding the outside stray field is discussed
Hu, Jing; Li, Minchan; Lv, Fucong; Yang, Mingyang; Tao, Pengpeng; Tang, Yougen; Liu, Hongtao; Lu, Zhouguang
2015-10-01
A novel heterogeneous NiCo2O4@PPy core/sheath nanowire arrays are directly grown on Ni foam involving three facile steps, hydrothermal synthesis and calcination of NiCo2O4 nanowire arrays and subsequent in-situ oxidative polymerization of polypyrrole (PPy). When investigated as binder- and conductive additive-free electrodes for supercapacitors (SCs) in 6 M KOH, the NiCo2O4@PPy core/sheath nanowire arrays exhibit high areal capacitance of 3.49 F cm-2 at a discharge current density of 5 mA cm-2, which is almost 1.5 times as much as the pristine NiCo2O4 (2.30 F cm-2). More importantly, it can remain 3.31 F cm-2 (94.8% retention) after 5000 cycles. The as-obtained electrode also displays excellent rate capability, whose areal capacitance can still remain 2.79 F cm-2 while the discharge current density is increased to 50 mA cm-2. The remarkable electrochemical performance is mainly attributed to the unique heterogeneous core/sheath nanowire-array architectures.
Czech Academy of Sciences Publication Activity Database
Kaštyl, J.; Chlup, Zdeněk; Clemen, F.; Trunec, M.
2017-01-01
Roč. 37, č. 6 (2017), s. 2439-2447 ISSN 0955-2219 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : ceramic injection moldings * oxide fuel -cells * electrophoretic deposition * large pores * alumina * fabrication * behavior * tubes * bioceramics * composites * Zirconia * Co-extrusion * Core-shell * Porous structure * Mechanical properties Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 3.411, year: 2016